BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23744_g1_i1 len=1118 path=[2390:0-184 62:185-269 2902:270-388
266:389-445 3044:446-643 521:644-675 2651:676-705 583:706-741
3606:742-742 3607:743-784 662:785-873 3513:874-877 755:878-915
1824:916-1117]

Length=1118
                                                                      Score     E

ref|XP_006349492.1|  PREDICTED: tropinone reductase homolog             398   1e-134   
ref|XP_009773607.1|  PREDICTED: tropinone reductase homolog             396   6e-134   
ref|XP_009622919.1|  PREDICTED: tropinone reductase homolog             395   2e-133   
ref|XP_004249635.1|  PREDICTED: tropinone reductase homolog isofo...    394   2e-133   
gb|EYU41758.1|  hypothetical protein MIMGU_mgv1a011856mg                378   4e-127   
ref|XP_011094903.1|  PREDICTED: tropinone reductase homolog             375   9e-126   
emb|CDP14238.1|  unnamed protein product                                375   1e-125   
ref|XP_011070195.1|  PREDICTED: tropinone reductase 1-like              375   1e-125   
ref|XP_002532998.1|  tropinone reductase, putative                      362   1e-120   Ricinus communis
emb|CDP11659.1|  unnamed protein product                                357   6e-119   
ref|XP_002308173.1|  hypothetical protein POPTR_0006s09070g             355   3e-118   Populus trichocarpa [western balsam poplar]
gb|KDP35685.1|  hypothetical protein JCGZ_09123                         353   4e-117   
ref|XP_011006389.1|  PREDICTED: tropinone reductase homolog isofo...    347   7e-115   
ref|XP_010654244.1|  PREDICTED: tropinone reductase homolog             347   1e-114   
ref|XP_008442514.1|  PREDICTED: tropinone reductase homolog             346   1e-114   
gb|KDO38494.1|  hypothetical protein CISIN_1g024551mg                   343   3e-113   
ref|XP_004137775.1|  PREDICTED: tropinone reductase homolog             342   6e-113   
ref|XP_007026941.1|  NAD(P)-binding Rossmann-fold superfamily pro...    343   6e-113   
gb|KCW49544.1|  hypothetical protein EUGRSUZ_K03064                     340   4e-112   
ref|XP_006429149.1|  hypothetical protein CICLE_v10012479mg             338   2e-111   
ref|XP_010037803.1|  PREDICTED: tropinone reductase 1-like              340   2e-111   
gb|KHG29311.1|  Tropinone reductase                                     338   6e-111   
gb|KDP35675.1|  hypothetical protein JCGZ_09113                         336   1e-110   
emb|CBI30506.3|  unnamed protein product                                334   1e-109   
ref|XP_007026940.1|  NAD(P)-binding Rossmann-fold superfamily pro...    337   1e-109   
ref|XP_002271837.2|  PREDICTED: tropinone reductase homolog             334   1e-109   Vitis vinifera
ref|XP_010654243.1|  PREDICTED: tropinone reductase homolog             332   5e-109   
ref|XP_004302760.1|  PREDICTED: tropinone reductase homolog             331   9e-109   
emb|CBI30509.3|  unnamed protein product                                330   1e-108   
emb|CBI30508.3|  unnamed protein product                                331   2e-108   
ref|XP_004302758.1|  PREDICTED: tropinone reductase homolog             330   3e-108   
ref|XP_006429154.1|  hypothetical protein CICLE_v10012494mg             330   4e-108   
ref|XP_004302763.1|  PREDICTED: tropinone reductase homolog             329   7e-108   
emb|CAN74482.1|  hypothetical protein VITISV_028249                     330   1e-107   Vitis vinifera
ref|XP_010312361.1|  PREDICTED: tropinone reductase homolog isofo...    327   1e-107   
ref|XP_006493560.1|  PREDICTED: tropinone reductase homolog             328   3e-107   
ref|XP_006429148.1|  hypothetical protein CICLE_v10012479mg             325   1e-106   
ref|XP_006493561.1|  PREDICTED: tropinone reductase homolog             325   4e-106   
ref|XP_008387806.1|  PREDICTED: tropinone reductase homolog             324   4e-106   
ref|XP_006493567.1|  PREDICTED: tropinone reductase homolog             324   5e-106   
ref|XP_009358754.1|  PREDICTED: tropinone reductase homolog isofo...    324   7e-106   
ref|XP_009346407.1|  PREDICTED: tropinone reductase homolog isofo...    323   8e-106   
ref|XP_006429152.1|  hypothetical protein CICLE_v10012433mg             323   2e-105   
ref|XP_006429155.1|  hypothetical protein CICLE_v10012221mg             325   3e-105   
ref|XP_009358752.1|  PREDICTED: tropinone reductase homolog isofo...    321   7e-105   
ref|XP_008363884.1|  PREDICTED: tropinone reductase homolog             321   1e-104   
ref|XP_009346409.1|  PREDICTED: tropinone reductase homolog             321   1e-104   
ref|XP_008359743.1|  PREDICTED: tropinone reductase homolog isofo...    319   5e-104   
ref|XP_006429157.1|  hypothetical protein CICLE_v10012496mg             319   5e-104   
ref|XP_006493570.1|  PREDICTED: tropinone reductase homolog             319   6e-104   
ref|XP_008369937.1|  PREDICTED: tropinone reductase homolog             319   7e-104   
gb|KDO52384.1|  hypothetical protein CISIN_1g024752mg                   319   7e-104   
ref|XP_008363883.1|  PREDICTED: tropinone reductase 1-like              318   1e-103   
ref|XP_004303414.1|  PREDICTED: tropinone reductase homolog             317   2e-103   
ref|XP_009346408.1|  PREDICTED: tropinone reductase homolog isofo...    317   3e-103   
ref|XP_009358760.1|  PREDICTED: tropinone reductase homolog             316   9e-103   
ref|XP_008359746.1|  PREDICTED: tropinone reductase homolog             315   1e-102   
gb|KHG00112.1|  Tropinone reductase                                     315   3e-102   
ref|XP_009358758.1|  PREDICTED: tropinone reductase homolog             314   5e-102   
ref|XP_010088596.1|  Tropinone reductase-like protein                   313   1e-101   
ref|XP_009358759.1|  PREDICTED: tropinone reductase homolog             313   1e-101   
ref|XP_004137777.1|  PREDICTED: tropinone reductase homolog             312   4e-101   
ref|XP_011076794.1|  PREDICTED: tropinone reductase homolog             311   1e-100   
emb|CDP12723.1|  unnamed protein product                                309   5e-100   
gb|KDO52375.1|  hypothetical protein CISIN_1g024994mg                   308   8e-100   
ref|XP_010691207.1|  PREDICTED: tropinone reductase homolog At1g0...    308   9e-100   
ref|XP_008442511.1|  PREDICTED: tropinone reductase homolog             308   1e-99    
ref|XP_009346421.1|  PREDICTED: tropinone reductase homolog             310   1e-99    
ref|XP_002308174.2|  hypothetical protein POPTR_0006s09080g             307   3e-99    Populus trichocarpa [western balsam poplar]
ref|XP_011006388.1|  PREDICTED: tropinone reductase homolog             307   4e-99    
gb|EYU19938.1|  hypothetical protein MIMGU_mgv1a012090mg                306   4e-99    
ref|XP_007218806.1|  hypothetical protein PRUPE_ppa009941mg             307   5e-99    
ref|XP_008461702.1|  PREDICTED: tropinone reductase homolog             306   1e-98    
gb|KEH34753.1|  NAD(P)-binding rossmann-fold protein                    305   2e-98    
ref|XP_010256814.1|  PREDICTED: tropinone reductase homolog At1g0...    305   2e-98    
ref|XP_006493568.1|  PREDICTED: tropinone reductase homolog isofo...    304   3e-98    
sp|P50165.1|TRNH_DATST  RecName: Full=Tropinone reductase homolog...    304   4e-98    Datura stramonium [common thornapple]
ref|XP_004503172.1|  PREDICTED: tropinone reductase homolog At1g0...    304   5e-98    
gb|AFK39944.1|  unknown                                                 304   7e-98    
ref|XP_006429160.1|  hypothetical protein CICLE_v10012493mg             303   9e-98    
ref|XP_006493569.1|  PREDICTED: tropinone reductase homolog isofo...    303   9e-98    
ref|XP_008233480.1|  PREDICTED: tropinone reductase homolog At1g0...    303   1e-97    
ref|XP_009603003.1|  PREDICTED: tropinone reductase homolog isofo...    302   3e-97    
gb|EPS58365.1|  hypothetical protein M569_16448                         301   4e-97    
ref|XP_004503163.1|  PREDICTED: tropinone reductase homolog             302   4e-97    
ref|XP_010033096.1|  PREDICTED: tropinone reductase homolog At1g0...    302   5e-97    
gb|KEH34749.1|  NAD(P)-binding rossmann-fold protein                    301   5e-97    
ref|XP_009421329.1|  PREDICTED: tropinone reductase homolog             301   6e-97    
ref|XP_002879208.1|  hypothetical protein ARALYDRAFT_481843             301   6e-97    
ref|XP_010106552.1|  Tropinone reductase-like protein                   301   7e-97    
ref|XP_003552795.1|  PREDICTED: tropinone reductase homolog             301   1e-96    
ref|XP_003632186.1|  PREDICTED: tropinone reductase homolog At1g0...    301   1e-96    
ref|XP_004492175.1|  PREDICTED: tropinone reductase homolog             300   1e-96    
ref|XP_004150641.1|  PREDICTED: tropinone reductase homolog At1g0...    300   1e-96    
ref|XP_010033094.1|  PREDICTED: tropinone reductase homolog At1g0...    300   2e-96    
gb|AFK36242.1|  unknown                                                 300   2e-96    
ref|XP_003538423.1|  PREDICTED: tropinone reductase homolog At1g0...    300   2e-96    
ref|XP_011033874.1|  PREDICTED: tropinone reductase homolog At1g0...    300   2e-96    
ref|XP_003537468.1|  PREDICTED: tropinone reductase homolog At1g0...    300   2e-96    
gb|ACU16743.1|  unknown                                                 300   2e-96    Glycine max [soybeans]
gb|KEH34737.1|  NAD(P)-binding rossmann-fold protein                    300   2e-96    
gb|AIX10937.1|  putative tropinone reductase                            300   3e-96    
gb|KDP44893.1|  hypothetical protein JCGZ_01393                         300   3e-96    
gb|KEH34754.1|  NAD(P)-binding rossmann-fold protein                    300   3e-96    
gb|KCW65560.1|  hypothetical protein EUGRSUZ_G02957                     299   5e-96    
gb|KCW65561.1|  hypothetical protein EUGRSUZ_G02957                     299   5e-96    
ref|XP_002311182.2|  tropinone reductase family protein                 299   5e-96    Populus trichocarpa [western balsam poplar]
ref|XP_010067433.1|  PREDICTED: tropinone reductase homolog At1g0...    299   5e-96    
ref|XP_010256821.1|  PREDICTED: tropinone reductase homolog             298   9e-96    
ref|XP_010067438.1|  PREDICTED: tropinone reductase homolog At1g0...    298   1e-95    
ref|XP_004503173.1|  PREDICTED: tropinone reductase homolog At1g0...    298   1e-95    
ref|XP_007163456.1|  hypothetical protein PHAVU_001G235700g             298   1e-95    
ref|XP_010650984.1|  PREDICTED: tropinone reductase homolog At1g0...    298   2e-95    
ref|XP_009343858.1|  PREDICTED: tropinone reductase homolog At1g0...    297   3e-95    
emb|CDP12722.1|  unnamed protein product                                297   3e-95    
gb|KDO69163.1|  hypothetical protein CISIN_1g024125mg                   297   3e-95    
ref|XP_006435623.1|  hypothetical protein CICLE_v10032389mg             297   3e-95    
ref|XP_003538424.1|  PREDICTED: tropinone reductase homolog At1g0...    297   4e-95    
emb|CAN63543.1|  hypothetical protein VITISV_035429                     296   6e-95    Vitis vinifera
ref|XP_010542622.1|  PREDICTED: tropinone reductase homolog At1g0...    296   6e-95    
ref|XP_003552193.1|  PREDICTED: tropinone reductase homolog isofo...    296   7e-95    
ref|XP_004235263.1|  PREDICTED: tropinone reductase homolog             296   7e-95    
ref|XP_007009277.1|  NAD(P)-binding Rossmann-fold superfamily pro...    296   8e-95    
ref|XP_010033099.1|  PREDICTED: tropinone reductase homolog At1g0...    296   9e-95    
gb|KHN17893.1|  Tropinone reductase like                                295   2e-94    
gb|KHN04080.1|  Tropinone reductase like                                295   2e-94    
gb|AFK45411.1|  unknown                                                 294   3e-94    
ref|XP_010920509.1|  PREDICTED: tropinone reductase homolog             294   4e-94    
ref|XP_010650983.1|  PREDICTED: tropinone reductase homolog At1g0...    294   4e-94    
emb|CBI16073.3|  unnamed protein product                                294   5e-94    
gb|AFK38962.1|  unknown                                                 294   5e-94    
ref|XP_010685684.1|  PREDICTED: tropinone reductase homolog At1g0...    294   5e-94    
ref|XP_010106547.1|  Tropinone reductase-like protein                   293   6e-94    
ref|XP_002277835.1|  PREDICTED: tropinone reductase homolog At1g0...    293   1e-93    Vitis vinifera
gb|KCW52641.1|  hypothetical protein EUGRSUZ_J02019                     293   1e-93    
gb|AIN39992.1|  tropinone reductase I                                   293   2e-93    
ref|XP_010910872.1|  PREDICTED: tropinone reductase homolog At1g0...    293   2e-93    
dbj|BAA13547.1|  tropinone reductase-I                                  292   2e-93    Hyoscyamus niger [black henbane]
gb|AFP55030.1|  tropinone reductase I                                   292   2e-93    
ref|NP_001275290.1|  tropinone reductase 1-like                         292   2e-93    
ref|XP_010650989.1|  PREDICTED: tropinone reductase homolog At1g0...    292   3e-93    
ref|NP_180494.1|  tropinone reductase                                   291   3e-93    Arabidopsis thaliana [mouse-ear cress]
gb|AGL76989.1|  tropinone reductase I                                   292   3e-93    
ref|XP_010650992.1|  PREDICTED: tropinone reductase homolog At1g0...    292   3e-93    
gb|KEH34739.1|  NAD(P)-binding rossmann-fold protein                    291   4e-93    
ref|XP_002282755.1|  PREDICTED: tropinone reductase homolog At1g0...    291   4e-93    Vitis vinifera
ref|XP_008801625.1|  PREDICTED: tropinone reductase homolog At1g0...    293   4e-93    
emb|CAB88214.1|  putative tropinone reductase                           291   5e-93    Solanum tuberosum [potatoes]
ref|XP_010423393.1|  PREDICTED: tropinone reductase homolog At1g0...    291   5e-93    
gb|KEH22972.1|  NAD(P)-binding rossmann-fold protein                    291   5e-93    
ref|XP_010650991.1|  PREDICTED: tropinone reductase homolog At1g0...    291   5e-93    
emb|CAN69507.1|  hypothetical protein VITISV_016037                     291   6e-93    Vitis vinifera
emb|CDX86485.1|  BnaC08g02180D                                          290   8e-93    
ref|XP_010096620.1|  Tropinone reductase-like protein                   291   9e-93    
ref|XP_010414428.1|  PREDICTED: tropinone reductase homolog At1g0...    290   9e-93    
gb|ACB71202.1|  tropinone reductase I                                   291   1e-92    Anisodus acutangulus
gb|ADE76974.1|  unknown                                                 290   1e-92    
sp|P50162.1|TRN1_DATST  RecName: Full=Tropinone reductase 1; AltN...    290   1e-92    Datura stramonium [common thornapple]
ref|XP_009621668.1|  PREDICTED: tropinone reductase homolog             290   2e-92    
ref|XP_007163457.1|  hypothetical protein PHAVU_001G235800g             290   2e-92    
ref|XP_010469989.1|  PREDICTED: tropinone reductase homolog At1g0...    290   2e-92    
emb|CDP00133.1|  unnamed protein product                                290   2e-92    
ref|XP_010650990.1|  PREDICTED: tropinone reductase homolog isofo...    298   3e-92    
ref|XP_002520507.1|  tropinone reductase, putative                      289   3e-92    Ricinus communis
ref|NP_001237661.1|  uncharacterized protein LOC100306108               289   3e-92    
ref|XP_002319563.2|  tropinone reductase family protein                 289   3e-92    Populus trichocarpa [western balsam poplar]
ref|NP_180496.1|  senescence-associated protein 13                      289   3e-92    Arabidopsis thaliana [mouse-ear cress]
gb|KFK43068.1|  hypothetical protein AALP_AA1G074500                    289   3e-92    
ref|XP_010067435.1|  PREDICTED: tropinone reductase homolog At1g0...    289   4e-92    
ref|XP_010650985.1|  PREDICTED: tropinone reductase homolog At1g0...    289   4e-92    
ref|XP_010414392.1|  PREDICTED: tropinone reductase homolog At1g0...    289   4e-92    
ref|XP_009796888.1|  PREDICTED: tropinone reductase homolog             289   4e-92    
gb|KDP30781.1|  hypothetical protein JCGZ_13724                         289   5e-92    
gb|KEH22973.1|  NAD(P)-binding rossmann-fold protein                    288   5e-92    
ref|XP_009630417.1|  PREDICTED: tropinone reductase 1-like              288   5e-92    
ref|NP_001118408.1|  tropinone reductase-like protein                   288   6e-92    Arabidopsis thaliana [mouse-ear cress]
gb|AFK35677.1|  unknown                                                 288   7e-92    
gb|KHN17894.1|  Tropinone reductase like                                288   7e-92    
ref|XP_011023548.1|  PREDICTED: tropinone reductase homolog At1g0...    288   7e-92    
gb|ABK94587.1|  unknown                                                 288   8e-92    Populus trichocarpa [western balsam poplar]
ref|XP_006288477.1|  hypothetical protein CARUB_v10001737mg             288   8e-92    
ref|XP_007140493.1|  hypothetical protein PHAVU_008G117200g             288   9e-92    
emb|CAQ19734.1|  putative tropinone reductase I                         288   1e-91    Solanum nigrum subsp. nigrum
gb|ABF95188.1|  Tropinone reductase, putative, expressed                288   1e-91    Oryza sativa Japonica Group [Japonica rice]
gb|KEH22982.1|  enoyl-(acyl carrier) reductase                          288   1e-91    
ref|XP_002319562.1|  hypothetical protein POPTR_0013s02690g             287   1e-91    Populus trichocarpa [western balsam poplar]
ref|XP_011023546.1|  PREDICTED: tropinone reductase homolog At1g0...    287   1e-91    
ref|XP_010931228.1|  PREDICTED: tropinone reductase homolog At1g0...    288   1e-91    
ref|XP_009144385.1|  PREDICTED: tropinone reductase homolog At1g0...    287   1e-91    
ref|XP_007140484.1|  hypothetical protein PHAVU_008G116500g             287   1e-91    
ref|XP_007132035.1|  hypothetical protein PHAVU_011G061300g             287   1e-91    
gb|AFK36946.1|  unknown                                                 287   2e-91    
ref|XP_006294815.1|  hypothetical protein CARUB_v10023866mg             287   2e-91    
gb|KEH30187.1|  enoyl-(acyl carrier) reductase                          287   2e-91    
gb|AFK33539.1|  unknown                                                 287   2e-91    
gb|KFK41764.1|  hypothetical protein AALP_AA2G169200                    286   2e-91    
emb|CDO98529.1|  unnamed protein product                                288   2e-91    
emb|CDY14094.1|  BnaC02g02110D                                          287   2e-91    
ref|XP_007140482.1|  hypothetical protein PHAVU_008G116300g             287   2e-91    
ref|XP_011023547.1|  PREDICTED: tropinone reductase homolog At1g0...    286   2e-91    
gb|EAY89400.1|  hypothetical protein OsI_10905                          287   3e-91    Oryza sativa Indica Group [Indian rice]
emb|CDY45434.1|  BnaA05g12670D                                          286   3e-91    
ref|XP_009110944.1|  PREDICTED: tropinone reductase homolog At1g0...    286   3e-91    
ref|XP_010542627.1|  PREDICTED: tropinone reductase homolog At1g0...    286   4e-91    
ref|XP_004249378.1|  PREDICTED: tropinone reductase 1 isoform X2        286   4e-91    
ref|XP_010491151.1|  PREDICTED: tropinone reductase homolog At1g0...    286   4e-91    
ref|XP_009772417.1|  PREDICTED: tropinone reductase homolog             286   4e-91    
ref|XP_006355361.1|  PREDICTED: tropinone reductase homolog             286   4e-91    
emb|CDY04977.1|  BnaAnng01590D                                          286   5e-91    
emb|CDX86486.1|  BnaC08g02170D                                          286   5e-91    
gb|KDP35687.1|  hypothetical protein JCGZ_09125                         286   5e-91    
gb|AGY46257.1|  tropinone reductase I                                   286   5e-91    
ref|XP_010510516.1|  PREDICTED: tropinone reductase homolog At1g0...    286   6e-91    
ref|XP_008221978.1|  PREDICTED: tropinone reductase homolog At1g0...    286   6e-91    
ref|XP_003558258.1|  PREDICTED: tropinone reductase homolog At1g0...    286   6e-91    
gb|KEH22981.1|  NAD(P)-binding rossmann-fold protein                    286   6e-91    
emb|CDY68057.1|  BnaAnng26060D                                          286   6e-91    
ref|XP_010452515.1|  PREDICTED: tropinone reductase homolog At1g0...    286   6e-91    
emb|CAD20555.1|  tropinone reductase I                                  286   7e-91    Calystegia sepium
gb|AIN39993.1|  tropinone reductase I                                   286   7e-91    
emb|CDO98530.1|  unnamed protein product                                286   8e-91    
emb|CDY45432.1|  BnaA05g12690D                                          285   8e-91    
ref|XP_008223763.1|  PREDICTED: tropinone reductase homolog At1g0...    286   8e-91    
ref|XP_004307471.1|  PREDICTED: tropinone reductase homolog             285   1e-90    
ref|NP_850131.1|  tropinone reductase-like protein                      285   1e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CDO98527.1|  unnamed protein product                                286   1e-90    
ref|XP_010068031.1|  PREDICTED: tropinone reductase 1-like              283   1e-90    
gb|ABW81120.1|  putative tropinone reductase-14                         285   1e-90    Boechera divaricarpa
emb|CDX98899.1|  BnaC09g49360D                                          285   2e-90    
gb|AFK34404.1|  unknown                                                 285   2e-90    
ref|XP_004979872.1|  PREDICTED: tropinone reductase homolog At1g0...    284   2e-90    
ref|XP_009125632.1|  PREDICTED: tropinone reductase homolog At1g0...    285   2e-90    
dbj|BAC65128.2|  short chain alcohol dehydrogenase-like protein         286   2e-90    Daucus carota [carrots]
emb|CDY62820.1|  BnaC04g56400D                                          284   2e-90    
ref|XP_002873234.1|  hypothetical protein ARALYDRAFT_487407             284   2e-90    
ref|XP_007140477.1|  hypothetical protein PHAVU_008G115900g             285   2e-90    
gb|AGB56644.1|  tropinone reductase I                                   285   2e-90    
ref|XP_010658532.1|  PREDICTED: tropinone reductase homolog At1g0...    285   2e-90    
ref|XP_009140976.1|  PREDICTED: tropinone reductase homolog At1g0...    285   2e-90    
ref|XP_004237405.1|  PREDICTED: tropinone reductase homolog             284   3e-90    
ref|XP_007205726.1|  hypothetical protein PRUPE_ppa010064mg             284   3e-90    
gb|AFD23287.1|  tropinone reductase I                                   284   3e-90    
ref|NP_196225.1|  putative tropine dehydrogenase                        284   3e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010521892.1|  PREDICTED: tropinone reductase homolog At1g0...    284   3e-90    
ref|XP_008358998.1|  PREDICTED: tropinone reductase homolog At1g0...    284   3e-90    
ref|XP_002879210.1|  hypothetical protein ARALYDRAFT_481850             284   3e-90    
ref|XP_008387076.1|  PREDICTED: tropinone reductase homolog At1g0...    284   3e-90    
emb|CAN69508.1|  hypothetical protein VITISV_016038                     285   4e-90    Vitis vinifera
ref|XP_010414408.1|  PREDICTED: tropinone reductase homolog At1g0...    283   4e-90    
ref|XP_006341201.1|  PREDICTED: tropinone reductase homolog             283   4e-90    
gb|KHN25230.1|  Tropinone reductase like                                283   5e-90    
ref|XP_009375951.1|  PREDICTED: tropinone reductase homolog At1g0...    283   5e-90    
ref|XP_006409983.1|  hypothetical protein EUTSA_v10017106mg             283   6e-90    
ref|NP_180479.1|  tropinone reductase-like protein                      283   6e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007205718.1|  hypothetical protein PRUPE_ppa009959mg             283   6e-90    
ref|NP_565680.2|  tropinone reductase-like protein                      285   6e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510526.1|  PREDICTED: tropinone reductase homolog At1g0...    283   7e-90    
ref|XP_008777412.1|  PREDICTED: tropinone reductase homolog At1g0...    283   7e-90    
ref|XP_006424908.1|  hypothetical protein CICLE_v10029047mg             283   7e-90    
gb|KHG18782.1|  hypothetical protein F383_24463                         283   8e-90    
ref|XP_008349592.1|  PREDICTED: tropinone reductase homolog At1g0...    283   8e-90    
ref|XP_006409971.1|  hypothetical protein EUTSA_v10017105mg             283   9e-90    
emb|CDO98523.1|  unnamed protein product                                282   1e-89    
gb|AFD23289.1|  tropinone reductase II                                  283   1e-89    
ref|XP_009603002.1|  PREDICTED: tropinone reductase homolog isofo...    285   1e-89    
gb|ABW81086.1|  TRL9                                                    283   1e-89    Tarenaya spinosa
ref|XP_006344583.1|  PREDICTED: tropinone reductase homolog             283   1e-89    
ref|XP_002282875.1|  PREDICTED: tropinone reductase homolog At1g0...    283   1e-89    Vitis vinifera
ref|XP_006846355.1|  hypothetical protein AMTR_s00012p00260970          283   1e-89    
ref|XP_010542632.1|  PREDICTED: tropinone reductase homolog At1g0...    282   1e-89    
ref|XP_010256816.1|  PREDICTED: tropinone reductase homolog At1g0...    285   1e-89    
ref|XP_003539545.1|  PREDICTED: tropinone reductase homolog At1g0...    283   1e-89    
ref|XP_008777422.1|  PREDICTED: tropinone reductase homolog At1g0...    283   1e-89    
ref|XP_009140985.1|  PREDICTED: tropinone reductase homolog At1g0...    284   1e-89    
gb|ABW81048.1|  tropinoe-reductase-like33_2                             282   1e-89    Arabidopsis lyrata subsp. lyrata
ref|XP_010521893.1|  PREDICTED: tropinone reductase homolog At1g0...    283   1e-89    
ref|XP_010414404.1|  PREDICTED: tropinone reductase homolog At1g0...    282   1e-89    
gb|ABW74581.1|  putative tropinone reductase                            282   1e-89    Boechera divaricarpa
gb|KFK24998.1|  hypothetical protein AALP_AA8G053200                    282   1e-89    
ref|XP_010521894.1|  PREDICTED: tropinone reductase homolog At1g0...    282   1e-89    
ref|XP_010469961.1|  PREDICTED: tropinone reductase homolog At1g0...    282   2e-89    
gb|ABW81127.1|  putative tropinone reductase-22                         282   2e-89    
emb|CDO98525.1|  unnamed protein product                                283   2e-89    
emb|CDO98526.1|  unnamed protein product                                282   2e-89    
gb|ABW81156.1|  TRL15                                                   282   2e-89    
ref|XP_010557240.1|  PREDICTED: tropinone reductase homolog At1g0...    284   2e-89    
ref|XP_006649825.1|  PREDICTED: tropinone reductase homolog At1g0...    282   2e-89    
ref|XP_010414424.1|  PREDICTED: tropinone reductase homolog At1g0...    282   2e-89    
ref|XP_010469988.1|  PREDICTED: tropinone reductase homolog At1g0...    282   2e-89    
ref|XP_008375982.1|  PREDICTED: tropinone reductase homolog At1g0...    282   2e-89    
gb|AAC95218.1|  putative tropinone reductase                            282   2e-89    
ref|XP_006429161.1|  hypothetical protein CICLE_v10012645mg             280   2e-89    
ref|XP_007140479.1|  hypothetical protein PHAVU_008G116100g             282   2e-89    
emb|CDY09823.1|  BnaC09g43380D                                          282   2e-89    
ref|XP_010521889.1|  PREDICTED: tropinone reductase homolog At1g0...    281   3e-89    
ref|XP_009375950.1|  PREDICTED: tropinone reductase homolog At1g0...    281   3e-89    
ref|XP_010469970.1|  PREDICTED: tropinone reductase homolog At1g0...    281   3e-89    
emb|CDY09824.1|  BnaC09g43370D                                          281   3e-89    
gb|KEH34736.1|  NAD(P)-binding rossmann-fold protein                    282   3e-89    
ref|NP_001049675.1|  Os03g0268900                                       281   3e-89    
ref|XP_009118438.1|  PREDICTED: tropinone reductase homolog At1g0...    281   3e-89    
ref|XP_010931230.1|  PREDICTED: tropinone reductase homolog At1g0...    281   4e-89    
gb|KFK41763.1|  hypothetical protein AALP_AA2G169000                    281   4e-89    
ref|XP_009144389.1|  PREDICTED: tropinone reductase homolog At1g0...    281   4e-89    
ref|XP_010423394.1|  PREDICTED: tropinone reductase homolog At1g0...    281   4e-89    
ref|XP_004246864.1|  PREDICTED: tropinone reductase homolog             281   4e-89    
ref|XP_008777402.1|  PREDICTED: tropinone reductase homolog At1g0...    281   5e-89    
gb|AAM61117.1|  short chain alcohol dehydrogenase-like                  281   6e-89    
ref|XP_002524214.1|  tropinone reductase, putative                      281   6e-89    
emb|CDY31773.1|  BnaA04g17090D                                          280   6e-89    
ref|XP_006341200.1|  PREDICTED: tropinone reductase homolog             281   8e-89    
ref|XP_006649826.1|  PREDICTED: tropinone reductase homolog At1g0...    281   8e-89    
gb|ACJ84726.1|  unknown                                                 280   9e-89    
ref|XP_006399065.1|  hypothetical protein EUTSA_v10014421mg             280   9e-89    
ref|XP_010414393.1|  PREDICTED: tropinone reductase homolog At1g0...    281   9e-89    
emb|CAN69103.1|  hypothetical protein VITISV_027298                     280   9e-89    
ref|XP_006424909.1|  hypothetical protein CICLE_v10029051mg             280   9e-89    
ref|XP_006294799.1|  hypothetical protein CARUB_v10023850mg             280   1e-88    
gb|EMT31236.1|  Tropinone reductase-like protein                        282   1e-88    
ref|XP_006409994.1|  hypothetical protein EUTSA_v10017057mg             280   1e-88    
ref|XP_009140992.1|  PREDICTED: tropinone reductase homolog At1g0...    280   1e-88    
emb|CDY31776.1|  BnaA04g17120D                                          280   1e-88    
emb|CDY09917.1|  BnaC08g45340D                                          280   1e-88    
ref|XP_010414403.1|  PREDICTED: tropinone reductase homolog At1g0...    280   1e-88    
ref|XP_006488391.1|  PREDICTED: tropinone reductase homolog At1g0...    280   1e-88    
ref|XP_009133859.1|  PREDICTED: tropinone reductase homolog At1g0...    280   1e-88    
emb|CDY40188.1|  BnaC04g14160D                                          280   1e-88    
ref|XP_010033100.1|  PREDICTED: tropinone reductase homolog At1g0...    280   1e-88    
ref|XP_010040245.1|  PREDICTED: tropinone reductase homolog At1g0...    280   1e-88    
gb|ABW81046.1|  tropinone-reductase-like protein                        280   1e-88    
ref|XP_010685685.1|  PREDICTED: tropinone reductase homolog At1g0...    279   2e-88    
gb|ABW81145.1|  TRL27                                                   280   2e-88    
ref|XP_010931231.1|  PREDICTED: tropinone reductase homolog At1g0...    280   2e-88    
ref|XP_011089796.1|  PREDICTED: tropinone reductase homolog isofo...    281   2e-88    
ref|XP_004235264.1|  PREDICTED: tropinone reductase homolog isofo...    279   2e-88    
ref|XP_011089795.1|  PREDICTED: tropinone reductase homolog isofo...    281   2e-88    
gb|KEH22977.1|  NAD(P)-binding rossmann-fold protein                    279   2e-88    
ref|XP_010106549.1|  hypothetical protein L484_025309                   279   3e-88    
ref|XP_010665941.1|  PREDICTED: tropinone reductase homolog At1g0...    279   3e-88    
ref|XP_010510510.1|  PREDICTED: tropinone reductase homolog At1g0...    280   3e-88    
ref|XP_009623489.1|  PREDICTED: tropinone reductase 1-like isofor...    279   3e-88    
ref|XP_010557237.1|  PREDICTED: tropinone reductase homolog At1g0...    279   3e-88    
gb|ABW81148.1|  TRL23                                                   279   3e-88    
gb|KDP42205.1|  hypothetical protein JCGZ_02935                         281   3e-88    
ref|XP_010650987.1|  PREDICTED: tropinone reductase homolog At1g0...    278   4e-88    
emb|CDY06260.1|  BnaA09g49430D                                          278   4e-88    
ref|XP_003539556.1|  PREDICTED: tropinone reductase homolog At1g0...    278   4e-88    
ref|XP_010931229.1|  PREDICTED: tropinone reductase homolog At1g0...    278   4e-88    
emb|CBI16074.3|  unnamed protein product                                278   5e-88    
ref|XP_010650986.1|  PREDICTED: tropinone reductase homolog At1g0...    278   5e-88    
ref|XP_006295594.1|  hypothetical protein CARUB_v10024703mg             278   5e-88    
ref|XP_006409997.1|  hypothetical protein EUTSA_v10017639mg             278   5e-88    
ref|XP_010658533.1|  PREDICTED: tropinone reductase homolog At1g0...    278   5e-88    
ref|XP_002282638.2|  PREDICTED: tropinone reductase homolog At1g0...    281   5e-88    
ref|XP_007206734.1|  hypothetical protein PRUPE_ppa024823mg             278   5e-88    
ref|XP_002879212.1|  hypothetical protein ARALYDRAFT_481853             278   5e-88    
gb|ABW81150.1|  TRL21                                                   278   6e-88    
ref|XP_010414398.1|  PREDICTED: tropinone reductase homolog At1g0...    278   6e-88    
ref|XP_006846352.1|  hypothetical protein AMTR_s00012p00260130          278   6e-88    
gb|KDO38492.1|  hypothetical protein CISIN_1g0356422mg                  278   6e-88    
ref|XP_004507158.1|  PREDICTED: tropinone reductase homolog             279   6e-88    
ref|XP_007140480.1|  hypothetical protein PHAVU_008G116200g             278   7e-88    
ref|XP_004291519.1|  PREDICTED: tropinone reductase homolog At1g0...    278   8e-88    
ref|XP_006429151.1|  hypothetical protein CICLE_v10012433mg             276   8e-88    
ref|XP_010040250.1|  PREDICTED: tropinone reductase homolog At1g0...    278   8e-88    
gb|AFK34899.1|  unknown                                                 278   9e-88    
ref|XP_010510499.1|  PREDICTED: tropinone reductase homolog At1g0...    286   9e-88    
ref|XP_006488388.1|  PREDICTED: tropinone reductase homolog isofo...    280   9e-88    
ref|XP_007205714.1|  hypothetical protein PRUPE_ppa009944mg             278   1e-87    
ref|XP_010033103.1|  PREDICTED: tropinone reductase homolog At1g0...    278   1e-87    
ref|XP_010510508.1|  PREDICTED: tropinone reductase homolog At1g0...    278   1e-87    
ref|XP_010312198.1|  PREDICTED: tropinone reductase 1 isoform X1        278   1e-87    
ref|NP_001239850.1|  uncharacterized protein LOC100785449               278   1e-87    
ref|XP_009133850.1|  PREDICTED: tropinone reductase homolog At1g0...    277   1e-87    
gb|AAP06917.1|  unknown protein                                         279   1e-87    
ref|XP_011023544.1|  PREDICTED: tropinone reductase homolog At1g0...    277   1e-87    
ref|XP_010557238.1|  PREDICTED: tropinone reductase homolog At1g0...    277   1e-87    
ref|XP_010106548.1|  hypothetical protein L484_025308                   277   1e-87    
gb|ABW81146.1|  TRL26                                                   277   1e-87    
ref|NP_850132.2|  tropinone reductase-like protein                      277   1e-87    
ref|XP_010414419.1|  PREDICTED: tropinone reductase homolog At1g0...    277   2e-87    
ref|XP_006341006.1|  PREDICTED: tropinone reductase 1-like              277   2e-87    
ref|XP_002451211.1|  hypothetical protein SORBIDRAFT_05g025840          277   2e-87    
ref|XP_010452516.1|  PREDICTED: tropinone reductase homolog At1g0...    277   2e-87    
ref|XP_006838385.1|  hypothetical protein AMTR_s00002p00066940          277   2e-87    
ref|XP_006358703.1|  PREDICTED: tropinone reductase homolog At1g0...    278   2e-87    
dbj|BAJ87177.1|  predicted protein                                      277   2e-87    
gb|ABW81121.1|  putative tropinone reductase-15                         276   2e-87    
gb|KHG18781.1|  Tropinone reductase                                     279   2e-87    
emb|CBI31633.3|  unnamed protein product                                278   2e-87    
gb|ABW81170.1|  tropinone reductase-like protein                        276   2e-87    
ref|NP_001149071.1|  LOC100282692                                       277   3e-87    
ref|XP_007206475.1|  hypothetical protein PRUPE_ppa018984mg             276   3e-87    
ref|XP_010033102.1|  PREDICTED: tropinone reductase homolog At1g0...    277   3e-87    
ref|XP_009140990.1|  PREDICTED: tropinone reductase homolog At1g0...    276   3e-87    
ref|XP_002465494.1|  hypothetical protein SORBIDRAFT_01g039880          276   3e-87    
ref|XP_010931237.1|  PREDICTED: tropinone reductase homolog At1g0...    277   3e-87    
ref|XP_004984926.1|  PREDICTED: tropinone reductase homolog At1g0...    276   3e-87    
gb|ABW81147.1|  TRL24                                                   276   3e-87    
gb|AAP06906.1|  putative pfam00106, adh_short, short chain dehydr...    277   3e-87    
gb|ABW81152.1|  TRL19                                                   276   4e-87    
ref|XP_008222026.1|  PREDICTED: tropinone reductase homolog At1g0...    276   4e-87    
ref|XP_004979871.1|  PREDICTED: tropinone reductase homolog At1g0...    276   4e-87    
gb|AFK36108.1|  unknown                                                 275   5e-87    
ref|XP_010469962.1|  PREDICTED: tropinone reductase homolog At1g0...    276   5e-87    
ref|XP_010414400.1|  PREDICTED: tropinone reductase homolog At1g0...    276   5e-87    
emb|CDX70101.1|  BnaA10g24500D                                          276   5e-87    
ref|XP_002879209.1|  hypothetical protein ARALYDRAFT_481846             275   5e-87    
ref|NP_180625.1|  NAD(P)-binding Rossmann-fold superfamily protein      275   6e-87    
gb|KFK24584.1|  hypothetical protein AALP_AAs67532U000400               275   6e-87    
ref|XP_006290197.1|  hypothetical protein CARUB_v10003882mg             275   6e-87    
gb|ABW81164.1|  TRL6                                                    276   6e-87    
gb|KFK21964.1|  hypothetical protein AALP_AAs48252U001400               275   7e-87    
ref|XP_008366739.1|  PREDICTED: tropinone reductase homolog At1g0...    277   7e-87    
ref|XP_010469966.1|  PREDICTED: tropinone reductase homolog At1g0...    275   7e-87    
ref|XP_009364346.1|  PREDICTED: tropinone reductase homolog At1g0...    275   7e-87    
gb|ABW81125.1|  short chain dehydrogenase                               275   7e-87    
ref|XP_010228815.1|  PREDICTED: tropinone reductase homolog At1g0...    275   8e-87    
ref|XP_010685687.1|  PREDICTED: tropinone reductase homolog At1g0...    278   8e-87    
ref|NP_180492.1|  tropinone reductase-like protein                      275   9e-87    
ref|XP_008221969.1|  PREDICTED: tropinone reductase homolog At1g0...    275   9e-87    
emb|CBI16068.3|  unnamed protein product                                275   9e-87    
ref|XP_009611893.1|  PREDICTED: tropinone reductase homolog At1g0...    275   9e-87    
ref|XP_010543921.1|  PREDICTED: tropinone reductase homolog At1g0...    275   9e-87    
emb|CDY40183.1|  BnaC04g14110D                                          275   9e-87    
ref|XP_008222016.1|  PREDICTED: tropinone reductase homolog At1g0...    275   9e-87    
gb|ABW81047.1|  tropinone-reductase-like32                              275   1e-86    
ref|NP_172224.1|  NAD(P)-binding Rossmann-fold superfamily protein      275   1e-86    
ref|XP_010685686.1|  PREDICTED: tropinone reductase homolog At1g0...    278   1e-86    
ref|XP_010510507.1|  PREDICTED: tropinone reductase homolog At1g0...    275   1e-86    
gb|AFK38194.1|  unknown                                                 275   1e-86    
gb|KHN04072.1|  Tropinone reductase like                                274   1e-86    
emb|CDY51372.1|  BnaA04g28660D                                          275   1e-86    
ref|XP_010510505.1|  PREDICTED: tropinone reductase homolog At1g0...    275   1e-86    
ref|XP_010088522.1|  Tropinone reductase-like protein                   275   1e-86    
ref|XP_009122209.1|  PREDICTED: tropinone reductase homolog At1g0...    275   1e-86    
ref|XP_004240378.1|  PREDICTED: tropinone reductase homolog             276   1e-86    
ref|XP_006293509.1|  hypothetical protein CARUB_v10023815mg             275   1e-86    
emb|CDX95753.1|  BnaC03g26340D                                          275   1e-86    
ref|XP_007016318.1|  Senescence-associated gene 13 isoform 1            275   1e-86    
ref|XP_008356743.1|  PREDICTED: tropinone reductase homolog At1g0...    275   1e-86    
ref|XP_006305532.1|  hypothetical protein CARUB_v10010021mg             275   1e-86    
gb|EPS66466.1|  hypothetical protein M569_08306                         274   2e-86    
ref|XP_009140995.1|  PREDICTED: tropinone reductase homolog At1g0...    275   2e-86    
emb|CDY31772.1|  BnaA04g17080D                                          274   2e-86    
ref|XP_008356736.1|  PREDICTED: tropinone reductase homolog At1g0...    274   2e-86    
emb|CAO02390.1|  tropinone reductase                                    275   2e-86    
gb|ABW81087.1|  TRL11                                                   275   2e-86    
ref|XP_009375952.1|  PREDICTED: tropinone reductase homolog At1g0...    274   2e-86    
ref|XP_003540716.1|  PREDICTED: tropinone reductase homolog             276   2e-86    
gb|KFK39905.1|  hypothetical protein AALP_AA3G304100                    274   2e-86    
ref|XP_009760666.1|  PREDICTED: LOW QUALITY PROTEIN: tropinone re...    275   2e-86    
ref|XP_009144376.1|  PREDICTED: tropinone reductase homolog At1g0...    274   2e-86    
ref|NP_180491.1|  tropinone reductase-like protein                      274   2e-86    
ref|XP_011023549.1|  PREDICTED: tropinone reductase homolog At1g0...    274   2e-86    
emb|CDX83307.1|  BnaA03g21990D                                          274   2e-86    
gb|AAK97712.1|  At2g29320/F16P2.30                                      274   2e-86    
ref|XP_004294665.1|  PREDICTED: tropinone reductase homolog At1g0...    274   2e-86    
ref|XP_006417804.1|  hypothetical protein EUTSA_v10008362mg             275   3e-86    
gb|KHN40273.1|  Tropinone reductase like                                274   3e-86    
ref|NP_180497.1|  tropinone reductase-like protein                      274   3e-86    
sp|P50163.1|TRN2_DATST  RecName: Full=Tropinone reductase 2; AltN...    274   3e-86    
ref|XP_006294828.1|  hypothetical protein CARUB_v10023879mg             274   3e-86    
ref|XP_002881032.1|  hypothetical protein ARALYDRAFT_481835             274   3e-86    
ref|XP_008349700.1|  PREDICTED: uncharacterized protein LOC103412975    287   3e-86    
ref|XP_011035256.1|  PREDICTED: tropinone reductase homolog             276   3e-86    
ref|XP_006344593.1|  PREDICTED: tropinone reductase homolog             275   3e-86    
ref|NP_180493.1|  tropinone reductase-like protein                      274   3e-86    
ref|XP_006294819.1|  hypothetical protein CARUB_v10023870mg             273   3e-86    
gb|ABW81153.1|  TRL18                                                   273   4e-86    
ref|XP_010475505.1|  PREDICTED: tropinone reductase homolog At1g0...    273   4e-86    
ref|XP_006409996.1|  hypothetical protein EUTSA_v10017909mg             273   4e-86    
ref|XP_006294788.1|  hypothetical protein CARUB_v10023838mg             274   4e-86    
ref|XP_010480220.1|  PREDICTED: tropinone reductase homolog At1g0...    273   4e-86    
emb|CAN64401.1|  hypothetical protein VITISV_027737                     273   4e-86    
ref|XP_010043492.1|  PREDICTED: tropinone reductase homolog             275   4e-86    
ref|XP_010414405.1|  PREDICTED: tropinone reductase homolog At1g0...    273   4e-86    
gb|KHN17906.1|  Tropinone reductase like                                274   4e-86    
ref|XP_008221957.1|  PREDICTED: tropinone reductase homolog At1g0...    273   4e-86    
gb|ABW81149.1|  TRL22                                                   273   4e-86    
ref|XP_006352698.1|  PREDICTED: tropinone reductase homolog             273   4e-86    
gb|ABW81066.1|  tropinone-reductase-like53                              273   5e-86    
ref|XP_004246428.1|  PREDICTED: tropinone reductase homolog isofo...    273   5e-86    
ref|XP_003529117.1|  PREDICTED: tropinone reductase homolog isofo...    273   6e-86    
gb|ABW81178.1|  tropinone reductase-like protein 16                     273   6e-86    
ref|XP_010475502.1|  PREDICTED: tropinone reductase homolog At1g0...    274   6e-86    
ref|XP_006409980.1|  hypothetical protein EUTSA_v10017118mg             273   7e-86    
gb|ABW74557.1|  tropinone-reductase-like protein                        274   7e-86    
pdb|1IPE|A  Chain A, Tropinone Reductase-Ii Complexed With Nadph        273   7e-86    
ref|XP_011048910.1|  PREDICTED: tropinone reductase homolog At1g0...    273   8e-86    
gb|ABW81042.1|  tropinone-reductase-like protein                        273   8e-86    
ref|NP_001189631.1|  tropinone reductase-like protein                   273   8e-86    
ref|XP_010510506.1|  PREDICTED: tropinone reductase homolog At1g0...    273   8e-86    
ref|XP_010469967.1|  PREDICTED: tropinone reductase homolog At1g0...    281   8e-86    
gb|ABW81052.1|  tropinone-reductase-like37                              272   9e-86    
gb|ABW81067.1|  Tropinon-reductase-like54                               273   1e-85    
ref|XP_004293354.1|  PREDICTED: tropinone reductase homolog At1g0...    273   1e-85    
gb|ABW81050.1|  tropinone-reductase-like35                              272   1e-85    
ref|XP_010510314.1|  PREDICTED: tropinone reductase homolog At1g0...    273   1e-85    
ref|XP_004294666.1|  PREDICTED: tropinone reductase homolog At1g0...    273   1e-85    



>ref|XP_006349492.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=279

 Score =   398 bits (1023),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 187/258 (72%), Positives = 224/258 (87%), Gaps = 2/258 (1%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            Q+WSL G TALV+GGTRGIG+AIVEELAGFGA VHTCSRN+KEL++K+QEW+AKGFKV+G
Sbjct  18   QKWSLHGKTALVTGGTRGIGSAIVEELAGFGASVHTCSRNKKELDEKIQEWEAKGFKVTG  77

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCDL S+EQR++LIHTV+SVF GKLNILVNNAAIS +++  D   E+ S+I+ TN+ESP
Sbjct  78   SVCDLFSKEQREELIHTVSSVFEGKLNILVNNAAISMIKRTADISVEDYSKIMGTNVESP  137

Query  559  YHLAQLTYPLLKATGN-ASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            +H+ Q+ YPLLKA GN ASIVFISSLAG +ALPA+SVY +SK AINQLTK LACEW  DG
Sbjct  138  FHITQIAYPLLKACGNTASIVFISSLAGSLALPALSVYGASKGAINQLTKFLACEWASDG  197

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IRVNTVSP  V+T I+K E+IDPS+   Y E+M RTPLKPIAE +EISPLVAFLCLP AA
Sbjct  198  IRVNTVSPFAVKTNILKAEDIDPSLLGNYSELMCRTPLKPIAEPDEISPLVAFLCLP-AA  256

Query  202  SHITGQVILIDGGYTAGA  149
            SHITGQ+IL+DGG++AG+
Sbjct  257  SHITGQIILVDGGFSAGS  274



>ref|XP_009773607.1| PREDICTED: tropinone reductase homolog [Nicotiana sylvestris]
Length=276

 Score =   396 bits (1017),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 187/258 (72%), Positives = 223/258 (86%), Gaps = 2/258 (1%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            Q+WSL G TALV+GGTRGIG AIVEELAGFGA +HTCSRNQKEL++K+QEW+ KGFKV+G
Sbjct  15   QKWSLHGKTALVTGGTRGIGFAIVEELAGFGATIHTCSRNQKELDEKIQEWKGKGFKVTG  74

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCDL+S+EQR+QLI TV+SV  GKL+ILVNNAAIS +++A D  AE+ S+I+ TN+ESP
Sbjct  75   SVCDLSSKEQREQLIQTVSSVLEGKLDILVNNAAISMIKRAADVSAEDYSKIMGTNVESP  134

Query  559  YHLAQLTYPLLKATGN-ASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            +HL Q+ YPLLKA GN ASIVFISSLAG +ALPA+SVY +SK AINQLTK LACEW  DG
Sbjct  135  FHLTQIAYPLLKACGNAASIVFISSLAGSVALPALSVYGASKGAINQLTKFLACEWASDG  194

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IRVNTVSP  V+T I+KPE+IDPS+   Y E+M RTPLKPIAE +EISPLVAFLCLP AA
Sbjct  195  IRVNTVSPFAVKTNILKPEDIDPSLLGNYSELMCRTPLKPIAEPDEISPLVAFLCLP-AA  253

Query  202  SHITGQVILIDGGYTAGA  149
            SHITGQ+I +DGG++AG+
Sbjct  254  SHITGQIIHVDGGFSAGS  271



>ref|XP_009622919.1| PREDICTED: tropinone reductase homolog [Nicotiana tomentosiformis]
Length=276

 Score =   395 bits (1014),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/258 (72%), Positives = 224/258 (87%), Gaps = 2/258 (1%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            Q+WSL G TALV+GGTRGIG AIVEELAGFGA +HTCSRNQKEL++K+QEW+ KGFKV+G
Sbjct  15   QKWSLYGKTALVTGGTRGIGFAIVEELAGFGATIHTCSRNQKELDEKIQEWKGKGFKVTG  74

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCDL  +E+R+QLI TV+SVF GKL+ILVNNAAIS +++A D  AE+ S+I+ TN+ESP
Sbjct  75   SVCDLYIKEEREQLIQTVSSVFEGKLDILVNNAAISMIKRAADISAEDYSKIMGTNVESP  134

Query  559  YHLAQLTYPLLKATGN-ASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            +HL Q+ YPLLKA+GN ASIVFISSLAG +ALPA+SVY +SK AINQLTK LACEW  DG
Sbjct  135  FHLTQIAYPLLKASGNAASIVFISSLAGSVALPALSVYGASKGAINQLTKFLACEWASDG  194

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IRVNTVSP  V+T I+KPE+IDPS+   Y E+M RTPLKPIAEA+EISP+VAFLCLP AA
Sbjct  195  IRVNTVSPFAVKTNILKPEDIDPSLLGNYSELMCRTPLKPIAEADEISPVVAFLCLP-AA  253

Query  202  SHITGQVILIDGGYTAGA  149
            SHITGQ+I +DGG++AG+
Sbjct  254  SHITGQIIHVDGGFSAGS  271



>ref|XP_004249635.1| PREDICTED: tropinone reductase homolog isoform X1 [Solanum lycopersicum]
Length=273

 Score =   394 bits (1013),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 188/269 (70%), Positives = 226/269 (84%), Gaps = 4/269 (1%)
 Frame = -2

Query  946  MASEQCGMN--QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQ  773
            MA +    N  Q+WSL G TALV+GGTRGIG+AIVEELAGFGA VHTCSRN+KEL+ K+Q
Sbjct  1    MAEQSSSSNRVQKWSLHGKTALVTGGTRGIGSAIVEELAGFGASVHTCSRNKKELDDKIQ  60

Query  772  EWQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEEL  593
            EW+AKGFKV+GSVCDL  +EQR+QLIH V+SVF GKLNILVNNAAIS +++  D   E+ 
Sbjct  61   EWEAKGFKVTGSVCDLFFKEQREQLIHNVSSVFEGKLNILVNNAAISMIKRTADISVEDY  120

Query  592  SRIIQTNLESPYHLAQLTYPLLKATGN-ASIVFISSLAGHIALPAISVYASSKAAINQLT  416
            S+I+ TN++SP+H+ Q+ YPLLKA GN ASIVFISSLAG +ALPA+SVY +SK AINQLT
Sbjct  121  SKIMGTNVDSPFHITQIAYPLLKACGNTASIVFISSLAGSLALPALSVYGASKGAINQLT  180

Query  415  KNLACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISP  236
            K LACEW  DGIRVNTVSP  V+T+I+K E+IDPS+   Y E+M RTPLKPIAE +EISP
Sbjct  181  KFLACEWANDGIRVNTVSPFAVKTSILKAEDIDPSLVGNYSELMCRTPLKPIAEPDEISP  240

Query  235  LVAFLCLPAAASHITGQVILIDGGYTAGA  149
            LVAFLCLP AASHITGQ+IL+DGG++AG+
Sbjct  241  LVAFLCLP-AASHITGQIILVDGGFSAGS  268



>gb|EYU41758.1| hypothetical protein MIMGU_mgv1a011856mg [Erythranthe guttata]
Length=268

 Score =   378 bits (971),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 178/256 (70%), Positives = 220/256 (86%), Gaps = 1/256 (0%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRW+L+GMTALV+GGT+GIG AI+EELAGFGA ++TCSRNQ EL ++++EW+ KG+KV G
Sbjct  12   QRWTLQGMTALVTGGTKGIGYAIIEELAGFGATIYTCSRNQAELSERLKEWEDKGYKVMG  71

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            S CDL+SR QRQ+LI+ V+S F+GKLNILVNNAAIS +++A D+ AE+ S I++TNLE+P
Sbjct  72   STCDLSSRTQRQELINNVSSAFHGKLNILVNNAAISMMKRACDHSAEDFSSIMETNLEAP  131

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YH+ QL+YPLLKA+G  +IVFISS+AG IALPA+S YA+SK AINQLTKNLACEW KD I
Sbjct  132  YHICQLSYPLLKASGLGNIVFISSVAGGIALPALSAYAASKGAINQLTKNLACEWAKDNI  191

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            R NTV+P GVRTTI+K E+IDPSI +M   IM RT L  +AEA+EISPLVAFLCLP AAS
Sbjct  192  RTNTVAPFGVRTTILKLEDIDPSILQMLFPIMARTQLGRVAEADEISPLVAFLCLP-AAS  250

Query  199  HITGQVILIDGGYTAG  152
            +ITGQVI +DGG+TAG
Sbjct  251  YITGQVIYVDGGFTAG  266



>ref|XP_011094903.1| PREDICTED: tropinone reductase homolog [Sesamum indicum]
Length=268

 Score =   375 bits (962),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 175/257 (68%), Positives = 218/257 (85%), Gaps = 1/257 (0%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRW+L+GMTALV+GGT+GIG AIVEELAGFGA V+TCSRNQ EL ++++EW+ KGFKV G
Sbjct  12   QRWTLQGMTALVTGGTKGIGYAIVEELAGFGATVYTCSRNQAELSERLKEWEGKGFKVKG  71

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            S CDL+S  QR++LI +V++ F+GKLNILVNNAA+S L++A D+ AE+  RI++TNLESP
Sbjct  72   SACDLSSSPQREELIQSVSAAFDGKLNILVNNAAMSLLKRASDHTAEDYRRIMETNLESP  131

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YH+ QL YPLLKA+G  +IVFISS+AG +ALPAIS YA+SK AINQLTKNLACEW KD I
Sbjct  132  YHICQLAYPLLKASGLGNIVFISSVAGGVALPAISAYAASKGAINQLTKNLACEWAKDNI  191

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            R NTV+P GVRT+I+KPE+IDPSI +M+  +M RTP+  IAE  E+S LV FLCLP AAS
Sbjct  192  RTNTVAPFGVRTSILKPEDIDPSILEMFIPLMGRTPIGRIAEPEEVSSLVTFLCLP-AAS  250

Query  199  HITGQVILIDGGYTAGA  149
            +ITGQVI +DGG+TAG+
Sbjct  251  YITGQVIYVDGGFTAGS  267



>emb|CDP14238.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   375 bits (962),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/256 (68%), Positives = 218/256 (85%), Gaps = 1/256 (0%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRWSLKG TALV+GGTRGIG AIVEELAGFGA VHTCSRNQ EL  +++EW+AKGF+VSG
Sbjct  11   QRWSLKGQTALVTGGTRGIGHAIVEELAGFGARVHTCSRNQTELNDRLKEWKAKGFQVSG  70

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCDL SR QR++L+ TV+S F+ KLNILVNNAA +K+++A++  +E+ S ++ TNLES 
Sbjct  71   SVCDLLSRTQREELMKTVSSEFDAKLNILVNNAATTKMKRAENSTSEDYSFLMSTNLESS  130

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            +HL+QL YPLLKA+ N +IVFISS+AG  ALP +S+Y+++K AINQLTKNLACEW KD I
Sbjct  131  FHLSQLAYPLLKASANGNIVFISSVAGATALPGLSIYSATKGAINQLTKNLACEWAKDSI  190

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVNTV+P  VRTT++KPEE D S+ +M+  ++ RTPL+ IAEANEISPLVAFLCLP AAS
Sbjct  191  RVNTVAPWAVRTTVLKPEEADESLLRMFFPLVNRTPLRRIAEANEISPLVAFLCLP-AAS  249

Query  199  HITGQVILIDGGYTAG  152
            +ITGQVI +DGG+TAG
Sbjct  250  YITGQVICVDGGFTAG  265



>ref|XP_011070195.1| PREDICTED: tropinone reductase 1-like [Sesamum indicum]
Length=266

 Score =   375 bits (962),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 170/261 (65%), Positives = 218/261 (84%), Gaps = 1/261 (0%)
 Frame = -2

Query  937  EQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAK  758
            ++   +++WSLKGMTALV+GGTRGIG AIVEEL GFGA +HTCSRNQ EL +++QEW+ K
Sbjct  5    KEVSRDEKWSLKGMTALVTGGTRGIGHAIVEELGGFGARIHTCSRNQTELNERIQEWKGK  64

Query  757  GFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQ  578
            GF+VSGSVCDL+SR QR++L+HTV S+F+ KLNILVNNAAIS +++A ++  ++   I+ 
Sbjct  65   GFEVSGSVCDLSSRTQREELMHTVASLFDAKLNILVNNAAISIMKRAIEHTEQDFWHIMS  124

Query  577  TNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACE  398
            TNLESPYHL Q+ YPLLKA+G  +IVFISS+AG +ALP +++Y++SK AINQLTKNLACE
Sbjct  125  TNLESPYHLCQIAYPLLKASGKGNIVFISSVAGKMALPGLAIYSASKGAINQLTKNLACE  184

Query  397  WGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLC  218
            W KD IRVNTV+P  V+TTI+ PE +D SI  MY  ++ RTP++ IAEA+EISPL AFLC
Sbjct  185  WAKDNIRVNTVAPFAVKTTIINPENVDKSIQIMYAPLLARTPIRAIAEADEISPLTAFLC  244

Query  217  LPAAASHITGQVILIDGGYTA  155
            LP AASHITGQVI +DGG+T+
Sbjct  245  LP-AASHITGQVIYVDGGFTS  264



>ref|XP_002532998.1| tropinone reductase, putative [Ricinus communis]
 gb|EEF29390.1| tropinone reductase, putative [Ricinus communis]
Length=266

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/255 (67%), Positives = 207/255 (81%), Gaps = 3/255 (1%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSL+GMTALV+GGTRGIG A+VEELAGFGA+V+TCSRN+KEL ++++EW+ KGF V 
Sbjct  11   DQRWSLQGMTALVTGGTRGIGYAVVEELAGFGAKVYTCSRNEKELNERIKEWEIKGFNVC  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL  R+QRQ LI TV+S F GKLNILVNNA   K +   DY  E+ S I+ TNLES
Sbjct  71   GSVCDLICRDQRQNLIDTVSSSFEGKLNILVNNAGTIKHKNTVDYTLEDYSSIMSTNLES  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL QL YPLLKA+GN SIVF+SS+AG IALP ISVYA++K AINQLTKNLACEW KD 
Sbjct  131  PYHLCQLAYPLLKASGNGSIVFLSSVAGFIALPLISVYAATKGAINQLTKNLACEWAKDN  190

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+PSG RTTI+  +E DP++ + Y  I+ R P++PIAE NE+S LVAFLCLP AA
Sbjct  191  IRTNAVAPSGTRTTIL--QEPDPAVIEAYAGIIPRNPIRPIAEPNEVSSLVAFLCLP-AA  247

Query  202  SHITGQVILIDGGYT  158
            S+I GQVI +DGG+T
Sbjct  248  SYINGQVICVDGGFT  262



>emb|CDP11659.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   357 bits (917),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 210/266 (79%), Gaps = 3/266 (1%)
 Frame = -2

Query  946  MASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEW  767
            MASEQ  ++ RWSL GMTALV+GGTRGIG +IVEELAGFGA V+TCSRNQKEL +++QEW
Sbjct  1    MASEQ--LSGRWSLNGMTALVTGGTRGIGHSIVEELAGFGAIVYTCSRNQKELNERLQEW  58

Query  766  QAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSR  587
             AKG+KV GS CDLASR +R +L+  V+S F+GKLNILVNNAA   LR+A D  AE+ SR
Sbjct  59   GAKGYKVYGSTCDLASRPERVELMKNVSSTFDGKLNILVNNAAAIILRRATDLSAEDFSR  118

Query  586  IIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNL  407
            ++ TNLE PYHL QL YPLLK +   SIVFISS+AG  ALP  S+Y SSK AINQLTK+L
Sbjct  119  VLGTNLEGPYHLCQLAYPLLKVSEARSIVFISSVAGGTALPGTSIYGSSKGAINQLTKSL  178

Query  406  ACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVA  227
            ACEW KD IRVNTV+P GV+TT  K E+ D SIA     IM RTPL+P+AE NE+SPLVA
Sbjct  179  ACEWAKDKIRVNTVAPHGVKTTRPKLEDYDESIALQMRPIMSRTPLRPLAEPNEVSPLVA  238

Query  226  FLCLPAAASHITGQVILIDGGYTAGA  149
            FL LP  AS ITGQVI +DGGY+AG+
Sbjct  239  FLSLP-VASFITGQVIQVDGGYSAGS  263



>ref|XP_002308173.1| hypothetical protein POPTR_0006s09070g [Populus trichocarpa]
 gb|EEE91696.1| hypothetical protein POPTR_0006s09070g [Populus trichocarpa]
Length=267

 Score =   355 bits (912),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/267 (63%), Positives = 211/267 (79%), Gaps = 2/267 (1%)
 Frame = -2

Query  946  MASEQCGMN-QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            MA  + G   QRWSLKGMTALV+GGTRGIG AIVEELAGFGA V+TCSRN+KEL ++++E
Sbjct  1    MAETEMGCREQRWSLKGMTALVTGGTRGIGFAIVEELAGFGARVYTCSRNEKELNERIKE  60

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            W+ KGF V GSVCDL+S++ RQ+LI +VTS F+GKLNILVNNAA + LRK+ DY  E+ S
Sbjct  61   WEIKGFNVRGSVCDLSSQDDRQKLIGSVTSAFDGKLNILVNNAATAILRKSLDYTLEDYS  120

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKN  410
             I+ TNL+SPYHL QL +PLLKA+GN +IVFISS+AG +ALP +SVY+++K AINQLT+N
Sbjct  121  FIMNTNLQSPYHLCQLAHPLLKASGNGNIVFISSVAGIVALPMLSVYSATKGAINQLTRN  180

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLV  230
            LACEW KD IR NTV+P G+RTT+ + +  DP + + Y ++  R P+  I E NE+S LV
Sbjct  181  LACEWAKDNIRTNTVAPGGIRTTVGQDQSADPDVGEAYSDMFSRIPISRIGEPNEVSSLV  240

Query  229  AFLCLPAAASHITGQVILIDGGYTAGA  149
             FLCLP  AS+I GQVI +DGG TA A
Sbjct  241  VFLCLP-TASYINGQVICVDGGLTAKA  266



>gb|KDP35685.1| hypothetical protein JCGZ_09123 [Jatropha curcas]
Length=268

 Score =   353 bits (905),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 170/264 (64%), Positives = 214/264 (81%), Gaps = 4/264 (2%)
 Frame = -2

Query  946  MASEQCG-MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            MA  + G  +QRWSLKGMTALV+GGT+GIG AIVEELAGFGA VHTCSRN+K+  ++V+E
Sbjct  1    MAETELGSRDQRWSLKGMTALVTGGTKGIGRAIVEELAGFGARVHTCSRNEKDFNERVKE  60

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            W+AKG++VS SVCDL  R QR++LI TV+SVF+GKLNILVNNA I  L+   +Y +EE S
Sbjct  61   WKAKGYQVSFSVCDLTCRTQREKLIDTVSSVFDGKLNILVNNAGIVALKDCLNYTSEEYS  120

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKN  410
             I+ TNLE+PYH++QL +PLLK +GN SIVFISS+AG ++LP ISVYA++K AINQLTKN
Sbjct  121  NIMSTNLEAPYHISQLAHPLLKTSGNGSIVFISSIAGIVSLPIISVYAATKGAINQLTKN  180

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLV  230
            LACEW KD IR NTV+PSGV+T I+   E D ++ K YG ++ RTP+  +AE NE+S +V
Sbjct  181  LACEWAKDNIRTNTVAPSGVKTEILT--EPDLAVIKAYGGVLDRTPMGRMAEPNEVSSVV  238

Query  229  AFLCLPAAASHITGQVILIDGGYT  158
            AFLCLP AAS+ITGQ+I +DGG T
Sbjct  239  AFLCLP-AASYITGQIICVDGGIT  261



>ref|XP_011006389.1| PREDICTED: tropinone reductase homolog isoform X1 [Populus euphratica]
Length=267

 Score =   347 bits (890),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 164/267 (61%), Positives = 206/267 (77%), Gaps = 2/267 (1%)
 Frame = -2

Query  946  MASEQCGMN-QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            MA  + G   QRWSLKGMTALV+GGTRGIG AIVEELAGFGA V+TCSRN+KEL ++++E
Sbjct  1    MAETEMGCREQRWSLKGMTALVTGGTRGIGFAIVEELAGFGARVYTCSRNEKELNERIKE  60

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            W+ KGF V GSVCDL+S++ RQ+LI +VTS F GKLNILVNNAA   LRK+ DY  E+ S
Sbjct  61   WEIKGFNVRGSVCDLSSQDDRQKLIGSVTSAFEGKLNILVNNAATITLRKSLDYTLEDYS  120

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKN  410
             ++ TN +SPYHL QL +PLLKA+GN +IVFISS+AG +ALP +SVY+++K AINQLT+N
Sbjct  121  FMMNTNFKSPYHLCQLAHPLLKASGNGNIVFISSVAGIVALPMLSVYSATKGAINQLTRN  180

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLV  230
            LACEW KD IR NTV+P  +RTT+ + +  DP + + Y ++  R P+    E NE+S LV
Sbjct  181  LACEWAKDNIRTNTVAPGAIRTTVAQDQSADPDVGEAYSDMFSRIPISRRGEPNEVSSLV  240

Query  229  AFLCLPAAASHITGQVILIDGGYTAGA  149
             FLCLP  AS+I GQVI +DGG TA A
Sbjct  241  VFLCLP-TASYINGQVICVDGGLTAKA  266



>ref|XP_010654244.1| PREDICTED: tropinone reductase homolog [Vitis vinifera]
Length=267

 Score =   347 bits (889),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 168/262 (64%), Positives = 206/262 (79%), Gaps = 1/262 (0%)
 Frame = -2

Query  943  ASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQ  764
            ASE     +RWSLKGMTAL++GGTRGIG AIVEELA  GA VHTCSRNQ EL +++QEW+
Sbjct  3    ASEPSCRAKRWSLKGMTALITGGTRGIGYAIVEELAELGAIVHTCSRNQTELNERLQEWE  62

Query  763  AKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRI  584
             KGF+VSGSVCDL SR QR++L  TV+S+F GKLNILVNNAA   L+   +Y AE+ S I
Sbjct  63   GKGFRVSGSVCDLTSRAQREKLTETVSSLFEGKLNILVNNAATVALKAPTNYTAEDCSSI  122

Query  583  IQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLA  404
            +QTN ESPYHL QL +PLLKA+G  SI+FISS+AG I+LP +SVYA++K AINQ+TKNLA
Sbjct  123  LQTNFESPYHLCQLAHPLLKASGRGSIIFISSVAGLISLPHMSVYAATKGAINQVTKNLA  182

Query  403  CEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAF  224
            CEW KD IR N V+P  VRT++    E D  +A  Y +++ RTPL  IAE +E+SPLVAF
Sbjct  183  CEWAKDNIRTNAVAPWTVRTSVRPILEPDNPMATAYPQLLARTPLHRIAEPDEVSPLVAF  242

Query  223  LCLPAAASHITGQVILIDGGYT  158
            LCLP AAS+ITGQVI +DGG++
Sbjct  243  LCLP-AASYITGQVICVDGGFS  263



>ref|XP_008442514.1| PREDICTED: tropinone reductase homolog [Cucumis melo]
Length=259

 Score =   346 bits (888),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/256 (64%), Positives = 203/256 (79%), Gaps = 4/256 (2%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRWSL G TALV+GGTRGIG AIVEELA  GA VHTCSRNQ E++Q++QEWQ KGFKV+ 
Sbjct  6    QRWSLDGFTALVTGGTRGIGYAIVEELASLGASVHTCSRNQTEIDQRLQEWQQKGFKVTA  65

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCDL S  QRQQLI TV+S+FNG LNILVNNA    L+ A +Y  E+ + ++ TN E+P
Sbjct  66   SVCDLTSSSQRQQLIDTVSSIFNGTLNILVNNAGTVTLKGATEYTTEDYNYMMSTNFEAP  125

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+Q+++P+LKA+G  SIVF+SS+AG  ALP IS+YA++K AINQ+TKNLACEW KD I
Sbjct  126  YHLSQISHPILKASGYGSIVFVSSIAGVTALPKISIYAATKGAINQITKNLACEWAKDNI  185

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVNTV+P GVRTTI KP   D ++ + YG ++ RTP   I E  EIS +VAFLCLP AAS
Sbjct  186  RVNTVAPWGVRTTISKP---DAAVVEEYGRLIGRTPAGRIGEPEEISSVVAFLCLP-AAS  241

Query  199  HITGQVILIDGGYTAG  152
            +++GQ+I +DGG+TAG
Sbjct  242  YVSGQIICVDGGFTAG  257



>gb|KDO38494.1| hypothetical protein CISIN_1g024551mg [Citrus sinensis]
Length=266

 Score =   343 bits (879),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/264 (63%), Positives = 212/264 (80%), Gaps = 2/264 (1%)
 Frame = -2

Query  943  ASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQ  764
            A+E    +++WSL+GMTALV+GGTRGIG AIVEELA FGA VHTC R+Q  + +++QEW+
Sbjct  4    AAEPVFGDKKWSLRGMTALVTGGTRGIGYAIVEELARFGASVHTCGRDQNMINERIQEWE  63

Query  763  AKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRI  584
            +KGFKV+GSVCDL+  +QR++LI TV+SVF+GKLNILVNNAA+  +++A +Y  EE S +
Sbjct  64   SKGFKVTGSVCDLSFGDQREKLIETVSSVFDGKLNILVNNAALVVMKRATEYTLEEYSSV  123

Query  583  IQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLA  404
            + TN+ES YHL QL +PLLKA+GNASIVF+SS+AG I++P +S YA+SK AINQLTKNLA
Sbjct  124  MSTNVESSYHLCQLAHPLLKASGNASIVFMSSVAGAISIPRLSAYAASKGAINQLTKNLA  183

Query  403  CEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAF  224
            CEW  D IRVN VSP  V T I  P +++  + + Y +++ +TPL   AE NEISPLVAF
Sbjct  184  CEWATDSIRVNAVSPWAVNTQI-SPPDLNDLLVQEYVKLIAKTPLARSAEPNEISPLVAF  242

Query  223  LCLPAAASHITGQVILIDGGYTAG  152
            LCLP AAS+ITGQVI IDGGYTAG
Sbjct  243  LCLP-AASYITGQVISIDGGYTAG  265



>ref|XP_004137775.1| PREDICTED: tropinone reductase homolog [Cucumis sativus]
 ref|XP_004169351.1| PREDICTED: tropinone reductase homolog [Cucumis sativus]
 gb|KGN58843.1| hypothetical protein Csa_3G733970 [Cucumis sativus]
Length=259

 Score =   342 bits (877),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 160/256 (63%), Positives = 201/256 (79%), Gaps = 4/256 (2%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRWSL G TALV+GGTRGIG AIVEELA  GA VHTCSRNQ E++Q++QEWQ KGFKV+ 
Sbjct  6    QRWSLNGFTALVTGGTRGIGYAIVEELASLGASVHTCSRNQTEIDQRLQEWQQKGFKVTA  65

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCDL S  QRQQLI TV+S+FNG LNILVNNA    ++ A +Y  E+ + ++ TN E+P
Sbjct  66   SVCDLTSSSQRQQLIDTVSSIFNGTLNILVNNAGTVTMKTATEYTTEDYNYMMSTNFEAP  125

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+Q+++P+LKA+G  SIVF+SS+AG  ALP IS+YA++K AINQ+TKNLACEW KD I
Sbjct  126  YHLSQISHPILKASGYGSIVFVSSIAGVTALPRISIYAATKGAINQITKNLACEWAKDNI  185

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            R+NTV+P GVRTTI  P   D +  + YG ++ RTP   + E  EIS +VAFLCLP AAS
Sbjct  186  RINTVAPWGVRTTISTP---DAAAVEEYGRLIGRTPAGRLGEPEEISSVVAFLCLP-AAS  241

Query  199  HITGQVILIDGGYTAG  152
            +++GQ+I +DGGYTAG
Sbjct  242  YVSGQIICVDGGYTAG  257



>ref|XP_007026941.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY07443.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
Length=278

 Score =   343 bits (879),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 170/261 (65%), Positives = 207/261 (79%), Gaps = 9/261 (3%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            NQRWSL+GMTALV+GGTRGIG AIVEELA  GA VHTCSRNQ E+ +++QEWQ+KGFKVS
Sbjct  10   NQRWSLQGMTALVTGGTRGIGYAIVEELAALGAVVHTCSRNQTEINERLQEWQSKGFKVS  69

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL+SREQR++L+ TV+SVF GKLNILVNNA I+ L+   ++  E+ S ++ TN+E+
Sbjct  70   GSVCDLSSREQREKLMETVSSVFYGKLNILVNNAGITMLKPCVEHTLEDYSTVMSTNVEA  129

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL+QL +P LKA+GN SIVFISS+AG +ALP +S Y++SK AINQ+TKNLACEW KD 
Sbjct  130  PYHLSQLAHPFLKASGNGSIVFISSVAGSLALPRLSAYSASKGAINQITKNLACEWAKDN  189

Query  382  IRVNTVSPSGVRTTIMKPEE---IDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLP  212
            IR NTVSP GV+TTIM P +   ++  I  + G  M RT      E  EIS LVAFLCLP
Sbjct  190  IRTNTVSPWGVKTTIMIPPDSPYVEEFIRLIAGTAMPRT-----GEPEEISSLVAFLCLP  244

Query  211  AAASHITGQVILIDGGYTAGA  149
             AAS+ITGQVI +DGGYTAG 
Sbjct  245  -AASYITGQVISVDGGYTAGG  264



>gb|KCW49544.1| hypothetical protein EUGRSUZ_K03064 [Eucalyptus grandis]
Length=263

 Score =   340 bits (871),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/257 (63%), Positives = 205/257 (80%), Gaps = 4/257 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSLKG TALV+GGTRGIG AIV ELAG GA VHTCSRN+KEL ++V+EW+ KG +VS
Sbjct  10   DRRWSLKGKTALVTGGTRGIGYAIVAELAGLGASVHTCSRNEKELNERVEEWRGKGLQVS  69

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL    Q++ L+ TV+SVF+GKLNILVNNAA   L+   D+  E+ S +++ NLES
Sbjct  70   GSVCDLTCNTQKEALVKTVSSVFDGKLNILVNNAATVVLKGVLDHTLEDCSYVLKANLES  129

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL QL +PLLKA+G+ +IVF+SS+AG +ALPA+S+Y++SK AINQLTKNLACEW KD 
Sbjct  130  PYHLCQLAHPLLKASGDGNIVFLSSIAGEVALPALSIYSASKGAINQLTKNLACEWAKDN  189

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR+NTV+P  V+TTI KPE   P I + + +++ R PL  + E NEIS +VAFLCLP AA
Sbjct  190  IRINTVAPGPVKTTIAKPE---PEIKEKFLKMLARMPLHRLGEPNEISSVVAFLCLP-AA  245

Query  202  SHITGQVILIDGGYTAG  152
            S++TGQVI +DGGYT G
Sbjct  246  SYVTGQVISVDGGYTVG  262



>ref|XP_006429149.1| hypothetical protein CICLE_v10012479mg [Citrus clementina]
 ref|XP_006480854.1| PREDICTED: tropinone reductase homolog isoform X1 [Citrus sinensis]
 gb|ESR42389.1| hypothetical protein CICLE_v10012479mg [Citrus clementina]
Length=266

 Score =   338 bits (867),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/257 (63%), Positives = 208/257 (81%), Gaps = 2/257 (1%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +++WSL+GMTALV+GGTRGIG AIVEELA FGA VHTC R+Q  + +++QEW++KGFKV+
Sbjct  11   DKKWSLRGMTALVTGGTRGIGYAIVEELARFGALVHTCGRDQNMINKRIQEWESKGFKVT  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL+  +QR++LI TV+SVF+GKLNILVNNAA+  ++ A +Y  EE S ++ TN+ES
Sbjct  71   GSVCDLSFGDQREKLIETVSSVFDGKLNILVNNAALVVMKGATEYTLEEYSSVMSTNVES  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL QL +PLLKA+GNASIVF+SS+AG I++P +S YA+SK AINQLTKNLACEW  D 
Sbjct  131  SYHLCQLAHPLLKASGNASIVFMSSVAGAISIPRLSAYAASKGAINQLTKNLACEWATDS  190

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IRVN VSP  V T I  P +++  + + Y +++ +TP+   AE NEISPLVAFLCLP AA
Sbjct  191  IRVNAVSPWAVNTQI-SPPDLNDLLVQEYVKLIAKTPIARSAEPNEISPLVAFLCLP-AA  248

Query  202  SHITGQVILIDGGYTAG  152
            S+ITGQVI IDGGYTAG
Sbjct  249  SYITGQVISIDGGYTAG  265



>ref|XP_010037803.1| PREDICTED: tropinone reductase 1-like [Eucalyptus grandis]
Length=316

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/257 (63%), Positives = 205/257 (80%), Gaps = 4/257 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSLKG TALV+GGTRGIG AIV ELAG GA VHTCSRN+KEL ++V+EW+ KG +VS
Sbjct  63   DRRWSLKGKTALVTGGTRGIGYAIVAELAGLGASVHTCSRNEKELNERVEEWRGKGLQVS  122

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL    Q++ L+ TV+SVF+GKLNILVNNAA   L+   D+  E+ S +++ NLES
Sbjct  123  GSVCDLTCNTQKEALVKTVSSVFDGKLNILVNNAATVVLKGVLDHTLEDCSYVLKANLES  182

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL QL +PLLKA+G+ +IVF+SS+AG +ALPA+S+Y++SK AINQLTKNLACEW KD 
Sbjct  183  PYHLCQLAHPLLKASGDGNIVFLSSIAGEVALPALSIYSASKGAINQLTKNLACEWAKDN  242

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR+NTV+P  V+TTI KPE   P I + + +++ R PL  + E NEIS +VAFLCLP AA
Sbjct  243  IRINTVAPGPVKTTIAKPE---PEIKEKFLKMLARMPLHRLGEPNEISSVVAFLCLP-AA  298

Query  202  SHITGQVILIDGGYTAG  152
            S++TGQVI +DGGYT G
Sbjct  299  SYVTGQVISVDGGYTVG  315



>gb|KHG29311.1| Tropinone reductase [Gossypium arboreum]
Length=283

 Score =   338 bits (866),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 160/257 (62%), Positives = 206/257 (80%), Gaps = 2/257 (1%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            NQRWSL+GMTALV+GGTRGIG A+VEELA  GA VHTCSRNQ EL ++++EWQ+KGFK+S
Sbjct  10   NQRWSLQGMTALVTGGTRGIGFAVVEELAALGAAVHTCSRNQSELNERLKEWQSKGFKLS  69

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GS+CD++SREQR++L+ TV+SVFNGKLNILVNNA I++++   +   E+ + ++ TN+E+
Sbjct  70   GSMCDVSSREQREKLMETVSSVFNGKLNILVNNAGITRIKPCVEQSLEDYTTVMSTNVEA  129

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL+QL YP LKA+GN S+VFISS+AG +ALP +S Y++SK AINQ+TKNLACEW KD 
Sbjct  130  PYHLSQLAYPFLKASGNGSVVFISSVAGSMALPGLSAYSASKGAINQITKNLACEWAKDN  189

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N VSP GV+T  M  + I+  +A     ++  T +  +AE  EIS LVAFLCLP AA
Sbjct  190  IRTNNVSPWGVKTK-MAEQNINAPLAGELFRLIAGTAMPRMAEPEEISSLVAFLCLP-AA  247

Query  202  SHITGQVILIDGGYTAG  152
            S+ITGQVI +DGGYTAG
Sbjct  248  SYITGQVISVDGGYTAG  264



>gb|KDP35675.1| hypothetical protein JCGZ_09113 [Jatropha curcas]
Length=254

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/258 (62%), Positives = 201/258 (78%), Gaps = 15/258 (6%)
 Frame = -2

Query  931  CGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGF  752
            C  +QRWSLKGMTALV+GGTRGIG AIVEELAGFGA VHTCSRN+++L ++V+EW++KGF
Sbjct  8    CSRDQRWSLKGMTALVTGGTRGIGYAIVEELAGFGARVHTCSRNEQDLNERVKEWKSKGF  67

Query  751  KVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTN  572
            +V+ SVCDL  +EQR++LI TV            NNA I K +   DY  E+ S I+ TN
Sbjct  68   EVTTSVCDLNFKEQREKLIDTV------------NNAGIVKYKDCVDYTIEDYSSIMSTN  115

Query  571  LESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWG  392
            LESPYHL QL YPLLK +GN SIVF+SS+AG +ALP ISVYA++K AINQLTKNLACEW 
Sbjct  116  LESPYHLCQLAYPLLKESGNGSIVFLSSIAGFVALPLISVYAATKGAINQLTKNLACEWA  175

Query  391  KDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLP  212
            KD IR+N V+PSG RTT++  +E DP+I K +  ++ +TP+  IAE +E+S LVAFLCLP
Sbjct  176  KDNIRINAVAPSGTRTTML--QEPDPAIVKAFAGLISKTPINRIAEPSEVSSLVAFLCLP  233

Query  211  AAASHITGQVILIDGGYT  158
             AAS+ITGQVI +DGG+T
Sbjct  234  -AASYITGQVICVDGGFT  250



>emb|CBI30506.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/260 (60%), Positives = 206/260 (79%), Gaps = 1/260 (0%)
 Frame = -2

Query  940  SEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQA  761
            +E    N+RWSL+GMTALV+GG+RGIG AIVEELA FGA VHTCSRNQ+EL+Q++QEW+ 
Sbjct  4    AEMSSRNRRWSLEGMTALVTGGSRGIGHAIVEELAAFGATVHTCSRNQEELDQRLQEWKN  63

Query  760  KGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRII  581
            KGFKVS S+CD++SR QR QL+ TV+S+F+GKL+ILVNNA    L++A +  AE+ S I+
Sbjct  64   KGFKVSASLCDVSSRSQRTQLMETVSSIFDGKLSILVNNAGTIILKEATECTAEDFSTIM  123

Query  580  QTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLAC  401
             TN ES YHL QL +PLLKA+GN SIVFISS++G +A PA S+YA+SK A+NQ+TKNLAC
Sbjct  124  GTNFESAYHLCQLGHPLLKASGNGSIVFISSISGLLAFPASSIYAASKGAMNQVTKNLAC  183

Query  400  EWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFL  221
            EW KDGIRVNT++P  ++T+++   +  P+I +    ++ RTP+    E +E+SPLVAFL
Sbjct  184  EWAKDGIRVNTIAPWIIKTSLLHVIDDHPNIKENMSRLISRTPISRPGEPDEVSPLVAFL  243

Query  220  CLPAAASHITGQVILIDGGY  161
            C P  AS+ITGQVI +DGGY
Sbjct  244  CFP-VASYITGQVICVDGGY  262



>ref|XP_007026940.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY07442.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=348

 Score =   337 bits (863),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/253 (64%), Positives = 203/253 (80%), Gaps = 2/253 (1%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            NQRWSL+GMTALV+GGTRGIG AIVEELA  GA VHTCSRNQ E+ +++QEWQ+KGFKVS
Sbjct  10   NQRWSLQGMTALVTGGTRGIGYAIVEELAALGAVVHTCSRNQTEINERLQEWQSKGFKVS  69

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL+SREQR++L+ TV+SVF GKLNILVNNA I+ L+   ++  E+ S ++ TN+E+
Sbjct  70   GSVCDLSSREQREKLMETVSSVFYGKLNILVNNAGITMLKPCVEHTLEDYSTVMSTNVEA  129

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL+QL +P LKA+GN SIVFISS+AG +ALP +S Y++SK AINQ+TKNLACEW KD 
Sbjct  130  PYHLSQLAHPFLKASGNGSIVFISSVAGSLALPRLSAYSASKGAINQITKNLACEWAKDN  189

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR NTVSP GV+TTIM P+   P + + +  ++  T +    E  EIS LVAFLCLP AA
Sbjct  190  IRTNTVSPWGVKTTIMIPKPDSPYVEE-FIRLIAGTAMPRTGEPEEISSLVAFLCLP-AA  247

Query  202  SHITGQVILIDGG  164
            S+ITGQVI +DGG
Sbjct  248  SYITGQVISVDGG  260



>ref|XP_002271837.2| PREDICTED: tropinone reductase homolog [Vitis vinifera]
Length=291

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/260 (60%), Positives = 206/260 (79%), Gaps = 1/260 (0%)
 Frame = -2

Query  940  SEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQA  761
            +E    N+RWSL+GMTALV+GG+RGIG AIVEELA FGA VHTCSRNQ+EL+Q++QEW+ 
Sbjct  28   AEMSSRNRRWSLEGMTALVTGGSRGIGHAIVEELAAFGATVHTCSRNQEELDQRLQEWKN  87

Query  760  KGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRII  581
            KGFKVS S+CD++SR QR QL+ TV+S+F+GKL+ILVNNA    L++A +  AE+ S I+
Sbjct  88   KGFKVSASLCDVSSRSQRTQLMETVSSIFDGKLSILVNNAGTIILKEATECTAEDFSTIM  147

Query  580  QTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLAC  401
             TN ES YHL QL +PLLKA+GN SIVFISS++G +A PA S+YA+SK A+NQ+TKNLAC
Sbjct  148  GTNFESAYHLCQLGHPLLKASGNGSIVFISSISGLLAFPASSIYAASKGAMNQVTKNLAC  207

Query  400  EWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFL  221
            EW KDGIRVNT++P  ++T+++   +  P+I +    ++ RTP+    E +E+SPLVAFL
Sbjct  208  EWAKDGIRVNTIAPWIIKTSLLHVIDDHPNIKENMSRLISRTPISRPGEPDEVSPLVAFL  267

Query  220  CLPAAASHITGQVILIDGGY  161
            C P  AS+ITGQVI +DGGY
Sbjct  268  CFP-VASYITGQVICVDGGY  286



>ref|XP_010654243.1| PREDICTED: tropinone reductase homolog [Vitis vinifera]
Length=269

 Score =   332 bits (852),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/261 (61%), Positives = 205/261 (79%), Gaps = 1/261 (0%)
 Frame = -2

Query  940  SEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQA  761
            +E    N RWSL+G TALV+GGTRGIG AIVEELA FGA VHTCSRNQKEL++ +Q W++
Sbjct  6    TEMSSRNSRWSLQGTTALVTGGTRGIGHAIVEELAAFGATVHTCSRNQKELDEMLQVWKS  65

Query  760  KGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRII  581
            KGFKVSGSVCD++SR QR QL+ TV+S+F+GKLNILVNNA     ++ ++Y  E++S I+
Sbjct  66   KGFKVSGSVCDVSSRPQRTQLMDTVSSLFDGKLNILVNNAGTVISKRTEEYTVEDVSIIM  125

Query  580  QTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLAC  401
             TN ES YHL+QL YPLLKA+G  SIVFISS+AG +ALP IS+YA+SK A+NQ+T+NLAC
Sbjct  126  GTNFESAYHLSQLGYPLLKASGRGSIVFISSVAGVMALPVISIYAASKGAMNQVTRNLAC  185

Query  400  EWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFL  221
            EW +D IRVNT++P  + T+++   + DPS  +    I+ RTP+  + E +E+S LVAFL
Sbjct  186  EWAEDNIRVNTIAPWVINTSLIHKAKDDPSSEEKIKRIISRTPICRMGEPDEVSSLVAFL  245

Query  220  CLPAAASHITGQVILIDGGYT  158
            C P AAS+ITGQVI +DGGY+
Sbjct  246  CFP-AASYITGQVICVDGGYS  265



>ref|XP_004302760.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=260

 Score =   331 bits (849),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 209/255 (82%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSLKGMTALV+GGT+GIG AIVEELAG GA VHTC+RNQ++++++VQEW++KGFKVS
Sbjct  6    SQRWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNQEQIDERVQEWKSKGFKVS  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL S+ QR++LI TV+SVF+GKLNILVNNAA   LR+ +DY  E+LS ++ +N+ES
Sbjct  66   GSVCDLTSKSQREELIKTVSSVFDGKLNILVNNAASVTLRRTEDYTLEDLSSMMGSNVES  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL QL+YPLLKA+ NASIVFI+S+AG IALP +S YA++K+A+ Q++KNLACEW +D 
Sbjct  126  SYHLCQLSYPLLKASENASIVFIASIAGAIALPRLSAYAATKSAVIQISKNLACEWARDK  185

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR NTV+P  V T + K    D S  + +  ++ RTP++ +AE NEIS LV+FLCLP AA
Sbjct  186  IRTNTVAPWAVNTGV-KVGNDDHS--EDFRRLIGRTPIRRVAEPNEISSLVSFLCLP-AA  241

Query  202  SHITGQVILIDGGYT  158
            S+I GQV+ +DGG+T
Sbjct  242  SYINGQVVNVDGGFT  256



>emb|CBI30509.3| unnamed protein product [Vitis vinifera]
Length=250

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/247 (64%), Positives = 196/247 (79%), Gaps = 1/247 (0%)
 Frame = -2

Query  898  MTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGSVCDLAS  719
            MTAL++GGTRGIG AIVEELA  GA VHTCSRNQ EL +++QEW+ KGF+VSGSVCDL S
Sbjct  1    MTALITGGTRGIGYAIVEELAELGAIVHTCSRNQTELNERLQEWEGKGFRVSGSVCDLTS  60

Query  718  REQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPYHLAQLT  539
            R QR++L  TV+S+F GKLNILVNNAA   L+   +Y AE+ S I+QTN ESPYHL QL 
Sbjct  61   RAQREKLTETVSSLFEGKLNILVNNAATVALKAPTNYTAEDCSSILQTNFESPYHLCQLA  120

Query  538  YPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIRVNTVSP  359
            +PLLKA+G  SI+FISS+AG I+LP +SVYA++K AINQ+TKNLACEW KD IR N V+P
Sbjct  121  HPLLKASGRGSIIFISSVAGLISLPHMSVYAATKGAINQVTKNLACEWAKDNIRTNAVAP  180

Query  358  SGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASHITGQVI  179
              VRT++    E D  +A  Y +++ RTPL  IAE +E+SPLVAFLCLP AAS+ITGQVI
Sbjct  181  WTVRTSVRPILEPDNPMATAYPQLLARTPLHRIAEPDEVSPLVAFLCLP-AASYITGQVI  239

Query  178  LIDGGYT  158
             +DGG++
Sbjct  240  CVDGGFS  246



>emb|CBI30508.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/255 (62%), Positives = 203/255 (80%), Gaps = 1/255 (0%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            N RWSL+G TALV+GGTRGIG AIVEELA FGA VHTCSRNQKEL++ +Q W++KGFKVS
Sbjct  5    NSRWSLQGTTALVTGGTRGIGHAIVEELAAFGATVHTCSRNQKELDEMLQVWKSKGFKVS  64

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD++SR QR QL+ TV+S+F+GKLNILVNNA     ++ ++Y  E++S I+ TN ES
Sbjct  65   GSVCDVSSRPQRTQLMDTVSSLFDGKLNILVNNAGTVISKRTEEYTVEDVSIIMGTNFES  124

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL+QL YPLLKA+G  SIVFISS+AG +ALP IS+YA+SK A+NQ+T+NLACEW +D 
Sbjct  125  AYHLSQLGYPLLKASGRGSIVFISSVAGVMALPVISIYAASKGAMNQVTRNLACEWAEDN  184

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IRVNT++P  + T+++   + DPS  +    I+ RTP+  + E +E+S LVAFLC P AA
Sbjct  185  IRVNTIAPWVINTSLIHKAKDDPSSEEKIKRIISRTPICRMGEPDEVSSLVAFLCFP-AA  243

Query  202  SHITGQVILIDGGYT  158
            S+ITGQVI +DGGY+
Sbjct  244  SYITGQVICVDGGYS  258



>ref|XP_004302758.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=262

 Score =   330 bits (845),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/258 (63%), Positives = 202/258 (78%), Gaps = 5/258 (2%)
 Frame = -2

Query  928  GMN-QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGF  752
            G N +RWSLKG TALV+GGT+GIG AIVEELAG GA VHTC+RN+  L Q++QEW++KGF
Sbjct  5    GFNSERWSLKGKTALVTGGTKGIGYAIVEELAGLGATVHTCARNEALLNQRIQEWESKGF  64

Query  751  KVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTN  572
            KVSGSVCDL S+ QR++L+ TV+SVF+GKLNILVNNAA   LR   DY  E+ S ++ TN
Sbjct  65   KVSGSVCDLTSKSQREELLETVSSVFDGKLNILVNNAATCTLRTTTDYSLEDFSSMMSTN  124

Query  571  LESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWG  392
            +ESPYHL QL +PLLKA+GN SIVFI+S+AG  ALP +S YA++K+AI Q++KNLACEW 
Sbjct  125  VESPYHLCQLAHPLLKASGNGSIVFIASIAGIKALPRLSAYAATKSAIIQISKNLACEWA  184

Query  391  KDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLP  212
            +D IR NTV+P  V T   KP+  D S    Y  ++ RTP++ +AE NEIS LV FLCLP
Sbjct  185  QDSIRTNTVAPWAVNTG-AKPDNDDHSAD--YRRLIGRTPIRRVAEPNEISSLVTFLCLP  241

Query  211  AAASHITGQVILIDGGYT  158
             AAS+ITGQV+ IDGG+T
Sbjct  242  -AASYITGQVVSIDGGFT  258



>ref|XP_006429154.1| hypothetical protein CICLE_v10012494mg [Citrus clementina]
 gb|ESR42394.1| hypothetical protein CICLE_v10012494mg [Citrus clementina]
Length=263

 Score =   330 bits (845),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/254 (62%), Positives = 198/254 (78%), Gaps = 1/254 (0%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRWSLKGMTALV+GGTRGIG AIVEEL  FGA VHTCSRN+ EL +++QEW++KG KVSG
Sbjct  7    QRWSLKGMTALVTGGTRGIGYAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSG  66

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            S CDL  R +RQ+L+ TV S F+GKLNILVNNA  +  ++A ++  E+ S I+ TN ES 
Sbjct  67   SACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESA  126

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+QL YPLLKA+GN +I+FISS+ G IA+P  S+YAS+K A+NQLTKNLACEWGKD I
Sbjct  127  YHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNI  186

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVN V+P  +RT+++   E DP + +    ++ RTP+    E NE+S +VAFLCLP AAS
Sbjct  187  RVNAVAPWIIRTSLIDSIEKDPRVLEHASRLIARTPIPRPGEPNEVSSVVAFLCLP-AAS  245

Query  199  HITGQVILIDGGYT  158
            +ITGQVI IDGGY+
Sbjct  246  YITGQVICIDGGYS  259



>ref|XP_004302763.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=260

 Score =   329 bits (843),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 160/258 (62%), Positives = 205/258 (79%), Gaps = 5/258 (2%)
 Frame = -2

Query  928  GMN-QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGF  752
            G N QRWSLKGMTALV+GGT+GIG AIVEELAG GA VHTC+RNQ+++++ V+EW++KGF
Sbjct  3    GFNSQRWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNQEQIDEWVREWKSKGF  62

Query  751  KVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTN  572
            +VSGSVCDL S+ QR++L+ TV+S F+GKLNILVNNAA   LR   +Y  E+LS ++ TN
Sbjct  63   QVSGSVCDLTSKSQREELMRTVSSKFDGKLNILVNNAATVTLRSTTEYALEDLSSMMSTN  122

Query  571  LESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWG  392
            +ESPYHL QL YPLLKA+GN SIVFI+S+AG  ALP +S YA++K+A+ Q++KNLACEW 
Sbjct  123  VESPYHLCQLAYPLLKASGNGSIVFIASIAGLKALPRLSAYAATKSAVIQISKNLACEWA  182

Query  391  KDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLP  212
            KDGIR NTV+P  V T + K E  D S    +  ++ RTP++ +AE NEIS LV FLCLP
Sbjct  183  KDGIRTNTVAPWAVNTGV-KVENDDHS--DDFRRLIGRTPIRRVAEPNEISSLVTFLCLP  239

Query  211  AAASHITGQVILIDGGYT  158
             AAS+I GQV+ +DGG+T
Sbjct  240  -AASYINGQVVSVDGGFT  256



>emb|CAN74482.1| hypothetical protein VITISV_028249 [Vitis vinifera]
Length=307

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/247 (64%), Positives = 193/247 (78%), Gaps = 0/247 (0%)
 Frame = -2

Query  943  ASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQ  764
            ASE     +RWSLKGMTALV+GGTRGIG AIVEELA  GA VHTCSRNQ EL +++QEW+
Sbjct  3    ASEPSCRTKRWSLKGMTALVTGGTRGIGYAIVEELAELGAIVHTCSRNQTELNERLQEWE  62

Query  763  AKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRI  584
             KGF+VSGSVCDL SR QR++L  TV+S+F GKLNILVNNAA   L+   +Y AE+ S I
Sbjct  63   GKGFRVSGSVCDLTSRAQREKLTETVSSLFEGKLNILVNNAATVALKAXTNYTAEDCSSI  122

Query  583  IQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLA  404
            +QTN ESPYHL QL +PLLKA+G  SI+FISS+AG I+LP +SVYA++K AINQ+TKNLA
Sbjct  123  LQTNFESPYHLCQLAHPLLKASGRGSIIFISSVAGLISLPHMSVYAATKGAINQVTKNLA  182

Query  403  CEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAF  224
            CEW KD IR N V+P  VRT++    E D  +A  Y +++ RTPL  IAE +E+SPLVAF
Sbjct  183  CEWAKDNIRTNAVAPWTVRTSVRPILEPDNPMATAYPQLLARTPLHRIAEPDEVSPLVAF  242

Query  223  LCLPAAA  203
            LCLPAA+
Sbjct  243  LCLPAAS  249



>ref|XP_010312361.1| PREDICTED: tropinone reductase homolog isoform X2 [Solanum lycopersicum]
Length=241

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/269 (61%), Positives = 198/269 (74%), Gaps = 36/269 (13%)
 Frame = -2

Query  946  MASEQCGMN--QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQ  773
            MA +    N  Q+WSL G TALV+GGTRGIG+AIVEELAGFGA VHTCSRN+KEL+ K+Q
Sbjct  1    MAEQSSSSNRVQKWSLHGKTALVTGGTRGIGSAIVEELAGFGASVHTCSRNKKELDDKIQ  60

Query  772  EWQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEEL  593
            EW+AKGFKV                                NNAAIS +++  D   E+ 
Sbjct  61   EWEAKGFKV--------------------------------NNAAISMIKRTADISVEDY  88

Query  592  SRIIQTNLESPYHLAQLTYPLLKATGN-ASIVFISSLAGHIALPAISVYASSKAAINQLT  416
            S+I+ TN++SP+H+ Q+ YPLLKA GN ASIVFISSLAG +ALPA+SVY +SK AINQLT
Sbjct  89   SKIMGTNVDSPFHITQIAYPLLKACGNTASIVFISSLAGSLALPALSVYGASKGAINQLT  148

Query  415  KNLACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISP  236
            K LACEW  DGIRVNTVSP  V+T+I+K E+IDPS+   Y E+M RTPLKPIAE +EISP
Sbjct  149  KFLACEWANDGIRVNTVSPFAVKTSILKAEDIDPSLVGNYSELMCRTPLKPIAEPDEISP  208

Query  235  LVAFLCLPAAASHITGQVILIDGGYTAGA  149
            LVAFLCLP AASHITGQ+IL+DGG++AG+
Sbjct  209  LVAFLCLP-AASHITGQIILVDGGFSAGS  236



>ref|XP_006493560.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/254 (61%), Positives = 197/254 (78%), Gaps = 1/254 (0%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRWSLKGMTALV+GGTRGIG AIVEEL  FGA VHTCSRN+ EL +++QEW++KG KVSG
Sbjct  7    QRWSLKGMTALVTGGTRGIGYAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSG  66

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            S CDL  R +RQ+L+  V S F+GKLNILVNNA  +  ++A ++  E+ S I+ TN ES 
Sbjct  67   SACDLKIRAERQKLMEAVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESA  126

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+QL YPLLKA+GN +I+FISS+ G IA+P  S+YAS+K A+NQLTKNLACEWGKD I
Sbjct  127  YHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNI  186

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVN V+P  +RT+++   E DP + +    ++ RTP+    E NE+S +VAFLCLP AAS
Sbjct  187  RVNAVAPWIIRTSLIDSIEKDPRVLEHASRLIARTPIPRPGEPNEVSSVVAFLCLP-AAS  245

Query  199  HITGQVILIDGGYT  158
            +ITGQVI IDGGY+
Sbjct  246  YITGQVICIDGGYS  259



>ref|XP_006429148.1| hypothetical protein CICLE_v10012479mg [Citrus clementina]
 ref|XP_006480855.1| PREDICTED: tropinone reductase homolog isoform X2 [Citrus sinensis]
 gb|ESR42388.1| hypothetical protein CICLE_v10012479mg [Citrus clementina]
Length=248

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/249 (64%), Positives = 200/249 (80%), Gaps = 2/249 (1%)
 Frame = -2

Query  898  MTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGSVCDLAS  719
            MTALV+GGTRGIG AIVEELA FGA VHTC R+Q  + +++QEW++KGFKV+GSVCDL+ 
Sbjct  1    MTALVTGGTRGIGYAIVEELARFGALVHTCGRDQNMINKRIQEWESKGFKVTGSVCDLSF  60

Query  718  REQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPYHLAQLT  539
             +QR++LI TV+SVF+GKLNILVNNAA+  ++ A +Y  EE S ++ TN+ES YHL QL 
Sbjct  61   GDQREKLIETVSSVFDGKLNILVNNAALVVMKGATEYTLEEYSSVMSTNVESSYHLCQLA  120

Query  538  YPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIRVNTVSP  359
            +PLLKA+GNASIVF+SS+AG I++P +S YA+SK AINQLTKNLACEW  D IRVN VSP
Sbjct  121  HPLLKASGNASIVFMSSVAGAISIPRLSAYAASKGAINQLTKNLACEWATDSIRVNAVSP  180

Query  358  SGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASHITGQVI  179
              V T I  P +++  + + Y +++ +TP+   AE NEISPLVAFLCLP AAS+ITGQVI
Sbjct  181  WAVNTQI-SPPDLNDLLVQEYVKLIAKTPIARSAEPNEISPLVAFLCLP-AASYITGQVI  238

Query  178  LIDGGYTAG  152
             IDGGYTAG
Sbjct  239  SIDGGYTAG  247



>ref|XP_006493561.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/254 (61%), Positives = 196/254 (77%), Gaps = 1/254 (0%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRWSLKGMTALV+GGTRGIG AIVEEL  FGA VHTCSRN+ EL +++QEW++KG KVSG
Sbjct  7    QRWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSG  66

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            S CDL  R +RQ+L+  V S F+GKLNILVNNA  +  ++A ++  E+ S I+ TN ES 
Sbjct  67   SACDLKIRAERQKLMEAVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESA  126

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+QL YPLLKA+GN +I+FISS+ G IA+P  S+YAS+K A+NQLTKNLACEWGKD I
Sbjct  127  YHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLSSIYASTKGAMNQLTKNLACEWGKDNI  186

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVN V+P  +RT+++   E DP + +    ++ RTP+    E NE+S +VAFLCLP AAS
Sbjct  187  RVNAVAPWIIRTSLIDSIEKDPRVMEHASRLIPRTPIPRPGEPNEVSSVVAFLCLP-AAS  245

Query  199  HITGQVILIDGGYT  158
            ++TGQV  IDGGY+
Sbjct  246  YVTGQVFCIDGGYS  259



>ref|XP_008387806.1| PREDICTED: tropinone reductase homolog [Malus domestica]
 ref|XP_008350442.1| PREDICTED: tropinone reductase homolog [Malus domestica]
Length=260

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/255 (60%), Positives = 204/255 (80%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSLKGMTALV+GGT+GIG AIVEELAG GA VHTC+RN+ ++ +++QEW++KGFKV+
Sbjct  6    SQRWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNEAQILERLQEWESKGFKVT  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL S+ QR+ LI TV+S+F+GKLNILVN+AA   LR   DY  E+ S +++TN+ES
Sbjct  66   GSVCDLTSKAQRENLIKTVSSIFHGKLNILVNSAATCTLRGTTDYTLEDFSSMMETNVES  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL+Q  +PLLKA+GNASIVF++S+AG +ALP +S YA++K+AI Q++KNLACEW KDG
Sbjct  126  PYHLSQJAHPLLKASGNASIVFVASIAGVVALPKLSAYAATKSAIIQISKNLACEWAKDG  185

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N+V+P  V T + K E    S    +  ++ RTP++ +A+ NEIS LV FLCLP AA
Sbjct  186  IRTNSVAPWAVNTGV-KVESDGHS--DDFRRLIGRTPIRRLAQPNEISSLVTFLCLP-AA  241

Query  202  SHITGQVILIDGGYT  158
            S+I GQVI +DGG+T
Sbjct  242  SYINGQVISVDGGFT  256



>ref|XP_006493567.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/254 (61%), Positives = 200/254 (79%), Gaps = 1/254 (0%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRWSLK MTALV+GGT+GIG AIV+ELA FGA VHTCSRN+ EL Q+VQEW++ G KVSG
Sbjct  7    QRWSLKDMTALVTGGTKGIGYAIVKELAAFGAIVHTCSRNEAELNQRVQEWKSMGLKVSG  66

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCDL  R Q+++L+ TV+S+F+GKLNILVNNA IS  ++A ++  E+ S II TN ES 
Sbjct  67   SVCDLKVRAQQEKLMETVSSLFDGKLNILVNNAGISIPKEATEFTMEDFSTIITTNFESA  126

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+Q+ +PLLKA+GN +I+FISS+AG IALP  S+YASSK A+N+LTKNLACEW KD I
Sbjct  127  YHLSQIAHPLLKASGNGNIIFISSVAGVIALPMCSIYASSKGAMNELTKNLACEWAKDKI  186

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVN+V+P  +RT ++   E D +  +    +++RTP+    E NE+S +VAFLC P AAS
Sbjct  187  RVNSVAPWMIRTPLLDNFEKDSTFLEQANRLILRTPIPRPREPNEVSSVVAFLCFP-AAS  245

Query  199  HITGQVILIDGGYT  158
            ++TGQVI +DGGY+
Sbjct  246  YVTGQVICVDGGYS  259



>ref|XP_009358754.1| PREDICTED: tropinone reductase homolog isoform X1 [Pyrus x bretschneideri]
Length=260

 Score =   324 bits (830),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/255 (60%), Positives = 205/255 (80%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSLKGMTALV+GGT+GIG AIVEELAG GA VHTC+RN+ ++ +++QEW++KGFKV+
Sbjct  6    SQRWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNEAQILERLQEWESKGFKVT  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL S+ QR+ LI TV+S+F+GKLNILVN+AA   LR   DY  E+ S +++TN+ES
Sbjct  66   GSVCDLTSKAQRENLIKTVSSIFHGKLNILVNSAATCTLRGTTDYTLEDFSSMMETNVES  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL+QL +PLLKA+GNASIVF++S+AG +ALP +S YA++K+AI Q++KNLACEW +DG
Sbjct  126  PYHLSQLAHPLLKASGNASIVFVASIAGVVALPKLSAYAATKSAIIQISKNLACEWARDG  185

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N+V+P  V T + K E    S    +  ++ RTP++ +A+ NEIS LV FLCLP AA
Sbjct  186  IRTNSVAPWAVNTGV-KVESDGHS--DDFRRLIGRTPIRRLAQPNEISSLVTFLCLP-AA  241

Query  202  SHITGQVILIDGGYT  158
            S+I GQVI +DGG+T
Sbjct  242  SYINGQVISVDGGFT  256



>ref|XP_009346407.1| PREDICTED: tropinone reductase homolog isoform X1 [Pyrus x bretschneideri]
Length=260

 Score =   323 bits (829),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 151/255 (59%), Positives = 201/255 (79%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSLKGMTALV+GGT+GIG AIVEELAG GA VHTC+RNQ ++ +++QEW++KGFKV+
Sbjct  6    SQRWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNQSQILERLQEWESKGFKVT  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL S+ QR+ LI TV+S+F GKLNILVNNAA   LR   DY  E+ S +++TN+ES
Sbjct  66   GSVCDLTSKAQRENLIKTVSSIFEGKLNILVNNAATCTLRGTTDYTLEDFSSMMKTNVES  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL+QL +PLLKA+GNASIVF++S+AG +ALP +S YA++K+A+ Q++KNLACEW KD 
Sbjct  126  PYHLSQLAHPLLKASGNASIVFVASIAGVVALPKLSAYAATKSAVIQISKNLACEWAKDN  185

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  V T +    +     +  +  ++ RTP++ +A+ NEIS L+ FLCLP AA
Sbjct  186  IRTNAVAPWAVNTGVKVDSD---GHSDDFRRLIGRTPIRRLAQPNEISSLITFLCLP-AA  241

Query  202  SHITGQVILIDGGYT  158
            S+I GQVI +DGG+T
Sbjct  242  SYINGQVISVDGGFT  256



>ref|XP_006429152.1| hypothetical protein CICLE_v10012433mg [Citrus clementina]
 ref|XP_006493557.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
 ref|XP_006493558.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
 gb|ESR42392.1| hypothetical protein CICLE_v10012433mg [Citrus clementina]
Length=276

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/255 (60%), Positives = 198/255 (78%), Gaps = 1/255 (0%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            N+RWSL GMTALV+GGTRGIG A VEELA FGA VHTCSRNQ EL+ ++ EW+ KGFKV+
Sbjct  10   NKRWSLNGMTALVTGGTRGIGHATVEELARFGAIVHTCSRNQIELDARLHEWKNKGFKVT  69

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL+SREQR++LI TVTS+F GKLNIL+NNAAI+ ++   D  AE++S +  TN ES
Sbjct  70   GSVCDLSSREQREKLIETVTSIFQGKLNILINNAAIAFVKPTVDITAEDMSTVSSTNFES  129

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +HL+QL +PL KA+GN SIVFISS+ G   +P++S+Y + K A+NQLTKNLACEW KD 
Sbjct  130  VFHLSQLAHPLFKASGNGSIVFISSVGGVRGIPSVSLYGAYKGAMNQLTKNLACEWAKDN  189

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR NTV+P  ++T+++KP E  P  ++    I  +TP+    E +E+S LVAFLCLP AA
Sbjct  190  IRTNTVAPWVIKTSMIKPFEEGPEGSEFLDGIARQTPIGRAGEPDEVSSLVAFLCLP-AA  248

Query  202  SHITGQVILIDGGYT  158
            S+ITGQ+I +DGG T
Sbjct  249  SYITGQIICVDGGVT  263



>ref|XP_006429155.1| hypothetical protein CICLE_v10012221mg [Citrus clementina]
 gb|ESR42395.1| hypothetical protein CICLE_v10012221mg [Citrus clementina]
Length=320

 Score =   325 bits (832),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/254 (61%), Positives = 196/254 (77%), Gaps = 1/254 (0%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRWSLKGMTALV+GGTRGIG AIVEEL  FGA VHTCSRN+ EL +++QEW++KG KVSG
Sbjct  64   QRWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSG  123

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            S CDL  R +RQ+L+  V S F+GKLNILVNNA  +  ++A ++  E+ S I+ TN ES 
Sbjct  124  SACDLKIRAERQKLMEAVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESA  183

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+QL YPLLKA+GN +I+FISS+ G IA+P  S+YAS+K A+NQLTKNLACEWGKD I
Sbjct  184  YHLSQLAYPLLKASGNGNIIFISSVTGVIAVPLSSIYASTKGAMNQLTKNLACEWGKDNI  243

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVN V+P  +RT+++   E DP + +    ++ RTP+    E NE+S +VAFLCLP AAS
Sbjct  244  RVNAVAPWIIRTSLIDSIEKDPRVMEHASRLIPRTPIPRPGEPNEVSSVVAFLCLP-AAS  302

Query  199  HITGQVILIDGGYT  158
            ++TGQV  IDGGY+
Sbjct  303  YVTGQVFCIDGGYS  316



>ref|XP_009358752.1| PREDICTED: tropinone reductase homolog isoform X1 [Pyrus x bretschneideri]
Length=260

 Score =   321 bits (823),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 156/255 (61%), Positives = 198/255 (78%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSLKG TALV+GGT+GIG A+VEELAG GA VH C+RN + L +++QEW++KGF+VS
Sbjct  6    SQRWSLKGRTALVTGGTKGIGFAVVEELAGLGATVHMCARNGELLHERIQEWKSKGFEVS  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL S++QR++LI TV+SVF+GKLNILVNNA    LR A DY  E+ S ++ TN+ES
Sbjct  66   GSVCDLTSKDQREELIRTVSSVFHGKLNILVNNAGTVTLRNATDYTLEDFSTMMSTNVES  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            P+HL QL +PLLKA+GNASIVF+SS+ G  ALP  S YA++K A+ Q+ KNLACEW KD 
Sbjct  126  PFHLCQLAHPLLKASGNASIVFVSSVGGMKALPKTSAYAATKGAVIQIVKNLACEWAKDN  185

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N+V+P  V TT+ KP+  D S    Y  ++ RTP+   A+ NE+S LV FLCLP AA
Sbjct  186  IRTNSVAPWAVNTTV-KPDSDDHS--DDYRRLIGRTPICRPAQPNEVSSLVTFLCLP-AA  241

Query  202  SHITGQVILIDGGYT  158
            S+ITGQVI IDGG+T
Sbjct  242  SYITGQVISIDGGFT  256



>ref|XP_008363884.1| PREDICTED: tropinone reductase homolog [Malus domestica]
Length=260

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/255 (60%), Positives = 202/255 (79%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSLKGMTALV+GGT+GIG AIVEELAG GA VHTC+RNQ ++ +++QEW++KGFKV+
Sbjct  6    SQRWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNQAQILERLQEWESKGFKVT  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL S+ QR+ LI TV+S+F GKLNILVN+AA   LR   DY  E+ S +++TN+ES
Sbjct  66   GSVCDLTSKAQRENLIKTVSSIFEGKLNILVNSAATCTLRGTTDYTLEDFSSMMKTNVES  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL+QL +PLLKA+GNASIVF++S+AG +ALP +S YA++K+A+ Q++KNLACEW KD 
Sbjct  126  PYHLSQLAHPLLKASGNASIVFVASIAGVVALPKLSAYAATKSAVIQISKNLACEWAKDN  185

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  V T + K E    S    +  ++ RTP++ +A+ NEIS L+ FLCLP AA
Sbjct  186  IRTNAVAPWAVNTGV-KVESDGHS--DDFRRLIGRTPIQRLAQPNEISSLITFLCLP-AA  241

Query  202  SHITGQVILIDGGYT  158
            S+I GQVI +DGG+T
Sbjct  242  SYINGQVISVDGGFT  256



>ref|XP_009346409.1| PREDICTED: tropinone reductase homolog [Pyrus x bretschneideri]
Length=260

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 201/258 (78%), Gaps = 5/258 (2%)
 Frame = -2

Query  928  GMN-QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGF  752
            G N QRWSLKGMTALV+GGT+GIG AIVEELAG GA VHTC+RN+ ++ +++QEW+ KGF
Sbjct  3    GFNSQRWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNEAQIIERLQEWEDKGF  62

Query  751  KVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTN  572
            KV+GSVCDL S+ QR+ LI TV+ +FNGKLNILVNNAAI  LR   DY  E+ S ++ TN
Sbjct  63   KVTGSVCDLTSKAQRENLIKTVSCIFNGKLNILVNNAAICTLRSTADYTLEDFSGMMGTN  122

Query  571  LESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWG  392
            +ESPYHL+QL YPLLKA+ +ASIVF+SS+AG  ALP +S YA++KAA+ Q+ KNLACEW 
Sbjct  123  VESPYHLSQLAYPLLKASEDASIVFVSSIAGLKALPRLSAYAATKAAVIQIAKNLACEWA  182

Query  391  KDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLP  212
            KD IR NTV+P  V T   K E  +   A+ +  ++ RTP++ +A+ NEIS LV+FLCLP
Sbjct  183  KDNIRTNTVAPWAVNTG-AKVE--NDGHAEDFRRLIGRTPIRRLAQPNEISSLVSFLCLP  239

Query  211  AAASHITGQVILIDGGYT  158
             AAS I GQVI +DGG+T
Sbjct  240  -AASFINGQVISVDGGFT  256



>ref|XP_008359743.1| PREDICTED: tropinone reductase homolog isoform X1 [Malus domestica]
Length=260

 Score =   319 bits (818),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 155/255 (61%), Positives = 197/255 (77%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSLKG TALV+GGT+GIG A+VEELAG GA VH C+RN + L +++QEW++KGF+VS
Sbjct  6    SQRWSLKGRTALVTGGTKGIGFAVVEELAGLGATVHMCARNGELLHERIQEWKSKGFEVS  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL S++QR++LI TV+SVF+GKLNILVNNA    LR A DY  E+ S ++ TN+ES
Sbjct  66   GSVCDLTSKDQREELIRTVSSVFDGKLNILVNNAGTVTLRNATDYTLEDFSTMMSTNVES  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            P+HL QL +PLLKA+GNASIVF+SS+ G  ALP  S YA++K A+ Q+ KNLACEW KD 
Sbjct  126  PFHLCQLAHPLLKASGNASIVFVSSVGGMKALPKTSAYAATKGAVIQIVKNLACEWAKDN  185

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N+V+P  V T + KP+  D S    Y  ++ RTP+   A+ NE+S LV FLCLP AA
Sbjct  186  IRTNSVAPWAVNTGV-KPDSDDHS--DDYRRLIGRTPICRPAQPNEVSSLVTFLCLP-AA  241

Query  202  SHITGQVILIDGGYT  158
            S+ITGQVI IDGG+T
Sbjct  242  SYITGQVISIDGGFT  256



>ref|XP_006429157.1| hypothetical protein CICLE_v10012496mg [Citrus clementina]
 gb|ESR42397.1| hypothetical protein CICLE_v10012496mg [Citrus clementina]
Length=263

 Score =   319 bits (818),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 150/254 (59%), Positives = 198/254 (78%), Gaps = 1/254 (0%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRWSLKGMTALV+GGT+GIG A+VEELA FGA VHTCSRN+ EL Q++QEW++KG +VSG
Sbjct  7    QRWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSG  66

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCDL  R QR++L+ TV+S F+GKLNIL+NNA     ++  ++  E+ S ++ TN ES 
Sbjct  67   SVCDLKIRAQREKLMLTVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESA  126

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+QL +PLLK+ GN +I+FISS+AG IA+P  S+YASSK A+NQLTKNLACEW KD I
Sbjct  127  YHLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKGAMNQLTKNLACEWAKDKI  186

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVNTV+P  +RT ++   E D +  +    +++RTP+    E NE+S +VAFLCL +AAS
Sbjct  187  RVNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCL-SAAS  245

Query  199  HITGQVILIDGGYT  158
            ++TGQVI +DGGY+
Sbjct  246  YVTGQVICVDGGYS  259



>ref|XP_006493570.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   319 bits (817),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/254 (59%), Positives = 197/254 (78%), Gaps = 1/254 (0%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRWSLKGMTALV+GGT+GIG A+VEELA FGA VHTCSRN+ EL Q++QEW++KG +VSG
Sbjct  7    QRWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSG  66

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCDL  R QR++L+ TV+S F+GKLNIL+NNA     ++  ++  E+ S ++ TN ES 
Sbjct  67   SVCDLKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESA  126

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+QL +PLLK+ GN +I+FISS+AG IA+P  S+YASSK A+NQLTKNLACEW KD I
Sbjct  127  YHLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKGAMNQLTKNLACEWAKDKI  186

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVNTV+P  +RT ++   E D +  +    +++RTP+    E NE+S +VAFLCL +A S
Sbjct  187  RVNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCL-SATS  245

Query  199  HITGQVILIDGGYT  158
            ++TGQVI +DGGY+
Sbjct  246  YVTGQVICVDGGYS  259



>ref|XP_008369937.1| PREDICTED: tropinone reductase homolog [Malus domestica]
Length=260

 Score =   319 bits (817),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 200/255 (78%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSLKG TALV+GGT+GIG AIVEELAG GA VHTC+RN+ ++ +++QEW++KGFKV+
Sbjct  6    SQRWSLKGTTALVTGGTKGIGYAIVEELAGLGATVHTCARNEVQILERLQEWESKGFKVT  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL S+ QR+ L+ TV+S+F GKLNILVN+AA   LR   DY  E+ S +++TN+ES
Sbjct  66   GSVCDLTSKAQRENLVKTVSSIFXGKLNILVNSAATCTLRGTTDYTLEDFSSMMETNVES  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL+QL  PLLKA+GNASIVF++S+AG +ALP +S YA++K+A+ Q++KNLACEW KDG
Sbjct  126  PYHLSQLANPLLKASGNASIVFVASIAGVVALPKLSAYAATKSAVIQISKNLACEWAKDG  185

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  V T +    +     A  +  ++ RTP++ +A+ NEIS LV FLCLP AA
Sbjct  186  IRTNAVAPWAVNTGVKVESD---GHADDFRRLIGRTPIRRLAQPNEISSLVTFLCLP-AA  241

Query  202  SHITGQVILIDGGYT  158
            S+I GQVI +DGG+T
Sbjct  242  SYINGQVISVDGGFT  256



>gb|KDO52384.1| hypothetical protein CISIN_1g024752mg [Citrus sinensis]
Length=263

 Score =   319 bits (817),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/254 (59%), Positives = 197/254 (78%), Gaps = 1/254 (0%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRWSLKGMTALV+GGT+GIG A+VEELA FGA VHTCSRN+ EL Q++QEW++KG +VSG
Sbjct  7    QRWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSG  66

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCDL  R QR++L+ TV+S F+GKLNIL+NNA     ++  ++  E+ S ++ TN ES 
Sbjct  67   SVCDLKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESA  126

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+QL +PLLK+ GN +I+FISS+AG IA+P  S+YASSK A+NQLTKNLACEW KD I
Sbjct  127  YHLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKVAMNQLTKNLACEWAKDKI  186

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVNTV+P  +RT ++   E D +  +    +++RTP+    E NE+S +VAFLCL +A S
Sbjct  187  RVNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCL-SATS  245

Query  199  HITGQVILIDGGYT  158
            ++TGQVI +DGGY+
Sbjct  246  YVTGQVICVDGGYS  259



>ref|XP_008363883.1| PREDICTED: tropinone reductase 1-like [Malus domestica]
Length=260

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/258 (61%), Positives = 198/258 (77%), Gaps = 5/258 (2%)
 Frame = -2

Query  928  GMN-QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGF  752
            G N QRWSLKGMTALV+GGT+GIG AIVEELAG GA VHTC+RN+ ++ +++QEW+ KGF
Sbjct  3    GFNSQRWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNEAQIVERLQEWEDKGF  62

Query  751  KVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTN  572
            KV+GSVCDL  + QR+ LI TV+ +FNGKLNILVNNAAI  LR   DY  E+ S ++ TN
Sbjct  63   KVTGSVCDLTCKAQRENLIKTVSCIFNGKLNILVNNAAICTLRSTADYTLEDFSGMMGTN  122

Query  571  LESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWG  392
            +ESPYHL+QL YPLLKA+ +ASIVF+SS+AG  ALP +S YA++K A+ Q+ KNLACEW 
Sbjct  123  VESPYHLSQLAYPLLKASEDASIVFVSSIAGLKALPRLSAYAATKGAVIQIAKNLACEWA  182

Query  391  KDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLP  212
            KD IR NTV+P  V T   K E  D   A+ +  ++ RTP+  +A+ NEIS LV+FLCLP
Sbjct  183  KDNIRTNTVAPWAVNTG-AKVENDDH--AEDFRRLIGRTPIXRLAQPNEISSLVSFLCLP  239

Query  211  AAASHITGQVILIDGGYT  158
             AAS I GQVI +DGG+T
Sbjct  240  -AASFINGQVISVDGGFT  256



>ref|XP_004303414.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=249

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/255 (60%), Positives = 193/255 (76%), Gaps = 15/255 (6%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSLKGMTALV+ GTRGIG AIVEELAG GA VHTC+RN+  ++++VQEW+ KGF VS
Sbjct  6    SQRWSLKGMTALVTSGTRGIGYAIVEELAGLGATVHTCARNKALIDERVQEWKIKGFTVS  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL S+ QR++LI TV+S F+GKL+ILVNNAAI  LR   DY  E+ S ++ +N+ES
Sbjct  66   GSVCDLTSKSQREELIKTVSSAFDGKLSILVNNAAIVTLRGTTDYSLEDFSSMMSSNVES  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL QL +PLLKA+GN SI+F+SS+AG IALP +S YA++K AI Q++KNLACEW KD 
Sbjct  126  PYHLCQLAHPLLKASGNGSIIFVSSIAGVIALPKLSAYAATKGAIIQISKNLACEWAKDK  185

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR NTV+P   R                +  ++ RTP++ +A+ NEIS LV FLCLP AA
Sbjct  186  IRTNTVAPWAQRDD--------------FRRLIARTPIRRLADPNEISSLVTFLCLP-AA  230

Query  202  SHITGQVILIDGGYT  158
            S+I GQV+ IDGG+T
Sbjct  231  SYINGQVVSIDGGFT  245



>ref|XP_009346408.1| PREDICTED: tropinone reductase homolog isoform X2 [Pyrus x bretschneideri]
Length=258

 Score =   317 bits (812),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/255 (59%), Positives = 199/255 (78%), Gaps = 6/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSLKGMTALV+GGT+GIG AIVEELAG GA VHTC+RNQ ++ +++QEW++KGFKV+
Sbjct  6    SQRWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNQSQILERLQEWESKGFKVT  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL S+ QR+ LI TV+S+F GKLNILVNNAA   LR   DY  E+ S +++TN+ES
Sbjct  66   GSVCDLTSKAQRENLIKTVSSIFEGKLNILVNNAATCTLRGTTDYTLEDFSSMMKTNVES  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL+QL +PLLKA+GNASIVF++S+AG +ALP +S YA++K  I Q++KNLACEW KD 
Sbjct  126  PYHLSQLAHPLLKASGNASIVFVASIAGVVALPKLSAYAATK--IIQISKNLACEWAKDN  183

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  V T +    +     +  +  ++ RTP++ +A+ NEIS L+ FLCLP AA
Sbjct  184  IRTNAVAPWAVNTGVKVDSD---GHSDDFRRLIGRTPIRRLAQPNEISSLITFLCLP-AA  239

Query  202  SHITGQVILIDGGYT  158
            S+I GQVI +DGG+T
Sbjct  240  SYINGQVISVDGGFT  254



>ref|XP_009358760.1| PREDICTED: tropinone reductase homolog [Pyrus x bretschneideri]
Length=260

 Score =   316 bits (809),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 197/258 (76%), Gaps = 5/258 (2%)
 Frame = -2

Query  928  GMN-QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGF  752
            G N QRWSLKG TALV+GGT+GIG AIVEELAG GA VHTC+RN+ ++ ++++EW+ KGF
Sbjct  3    GFNSQRWSLKGTTALVTGGTKGIGYAIVEELAGLGATVHTCARNEAQIVERLREWEDKGF  62

Query  751  KVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTN  572
            KV+GSVCDL S+ QR+ LI TV+S+FNGKLNILVNNAA   LR   DY  E+ S ++ TN
Sbjct  63   KVTGSVCDLTSKAQRENLIKTVSSIFNGKLNILVNNAATCTLRSTADYTLEDFSSMMSTN  122

Query  571  LESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWG  392
            +ESPYHL QL YPLLKA+ NASIVF+SS+AG  ALP +S YA++K A+ Q+ KNLACEW 
Sbjct  123  VESPYHLCQLAYPLLKASENASIVFVSSIAGLKALPRLSAYAATKGAVIQIAKNLACEWA  182

Query  391  KDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLP  212
            KD IR NTV+P  V T   K E  +   A+ +  ++ RTP+  +A+ NEIS LV+FLCLP
Sbjct  183  KDNIRTNTVAPWAVNTG-AKVE--NDGHAEDFRRLIGRTPIPRLAQPNEISSLVSFLCLP  239

Query  211  AAASHITGQVILIDGGYT  158
             AAS I GQVI +DGG+T
Sbjct  240  -AASFINGQVISVDGGFT  256



>ref|XP_008359746.1| PREDICTED: tropinone reductase homolog [Malus domestica]
Length=260

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 201/255 (79%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSL+GMTALV+GGT+GIG AIVEELAG GA VHTC+RN+ ++ ++++EW+ KGF V+
Sbjct  6    SQRWSLQGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNKTQILERLKEWENKGFNVT  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL S+ QR+ LI TV+S+F+GKLNILVN+AA   LR   DY  E+ S +++TN+ES
Sbjct  66   GSVCDLTSKAQRENLIKTVSSIFDGKLNILVNSAATCTLRGTTDYTLEDFSTMMETNVES  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL+QL +PLLKA+GNASIVF++S+AG +ALP +S YA++K+A+ Q++KNLACEW KD 
Sbjct  126  PYHLSQLAHPLLKASGNASIVFVASIAGVVALPKLSAYAATKSAVIQISKNLACEWAKDS  185

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  V T + K E    S    +  ++ RTP++ +A+ NEIS LV FLCLP AA
Sbjct  186  IRTNAVAPWAVNTGV-KVESDGHS--DDFRRLIGRTPIRRLAQPNEISSLVTFLCLP-AA  241

Query  202  SHITGQVILIDGGYT  158
            S+I GQVI +DGG+T
Sbjct  242  SYINGQVISVDGGFT  256



>gb|KHG00112.1| Tropinone reductase [Gossypium arboreum]
 gb|KHG26231.1| Tropinone reductase [Gossypium arboreum]
Length=285

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 197/257 (77%), Gaps = 3/257 (1%)
 Frame = -2

Query  946  MASEQCGMN-QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            MA  + G   QRWSL+GM ALV+GGTRGIG A VEELA  GA VHTCSRNQ EL +++QE
Sbjct  1    MAGTEAGCKKQRWSLQGMAALVTGGTRGIGYATVEELATLGAVVHTCSRNQTELHERLQE  60

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            WQ+KGFKVSGS CDL+ R+QR++L+ TV++VF+GKLNILVNNA  + ++  + +  E+ +
Sbjct  61   WQSKGFKVSGSACDLSYRQQREKLMETVSTVFDGKLNILVNNAGTTVIKPCEGHNLEDYT  120

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKN  410
             ++ TN+E+PYHL QL YPLLKA+GN SIVFISS+AG +ALP +S Y++SK AINQ+TKN
Sbjct  121  TVMNTNVEAPYHLCQLAYPLLKASGNGSIVFISSVAGSMALPRLSAYSASKGAINQITKN  180

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLV  230
            LACEW KD IR NTVSP GVRT+I KPE   P + + +  ++  T +  I E  EIS +V
Sbjct  181  LACEWAKDNIRTNTVSPWGVRTSITKPEADAPFVEE-FLRLIAGTAMPRIGEPEEISSMV  239

Query  229  AFLCLPAAASHITGQVI  179
            AFLCLP AAS+I GQ +
Sbjct  240  AFLCLP-AASYINGQAL  255



>ref|XP_009358758.1| PREDICTED: tropinone reductase homolog [Pyrus x bretschneideri]
Length=260

 Score =   314 bits (804),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 201/253 (79%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSLKGMTALV+GGT+GIG AIVEELAG GA VHTC+R++ ++ +++Q+W+ KGF+V+GS
Sbjct  8    RWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARSKTQILERLQQWENKGFRVTGS  67

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCDL S+ QR+ LI TV+S+F+GKLNILVN+AA   LR   DY  E+ S +++TN+ESPY
Sbjct  68   VCDLTSKAQRENLIKTVSSIFDGKLNILVNSAATCTLRGTTDYTLEDFSTMMETNVESPY  127

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL+QL +PLLKA+GNASIVF++S+AG +ALP +S YA++K+A+ Q++KN+ACEW KD IR
Sbjct  128  HLSQLAHPLLKASGNASIVFVASIAGVVALPKLSAYAATKSAVIQISKNVACEWAKDSIR  187

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N V+P  V T + K E    S    +  +++RTP++ +A+ NEIS LV FLCLP AAS+
Sbjct  188  TNAVAPWAVNTGV-KVESDGHS--DDFRRLIVRTPIRRLAQPNEISSLVTFLCLP-AASY  243

Query  196  ITGQVILIDGGYT  158
            I GQVI +DGG+T
Sbjct  244  INGQVISVDGGFT  256



>ref|XP_010088596.1| Tropinone reductase-like protein [Morus notabilis]
 gb|EXB36737.1| Tropinone reductase-like protein [Morus notabilis]
Length=251

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/257 (61%), Positives = 191/257 (74%), Gaps = 18/257 (7%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRWSLKG TALV+GGT+GIG AIVEELAG  A VHTCSR Q ++ ++V+EW++KG+KV+G
Sbjct  12   QRWSLKGQTALVTGGTKGIGHAIVEELAGLAAAVHTCSRTQTDVHERVKEWESKGYKVTG  71

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCDL S  QR++LI TV+S FNGKLNILVNNA    + +A DY  EE S ++ TN E+P
Sbjct  72   SVCDLTSCAQREELIKTVSSTFNGKLNILVNNAGSVTMNRATDYSLEEFSSMMSTNAEAP  131

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+QL +PLLKA+GN SIVFISS+AG               AINQLTKN ACEW KDGI
Sbjct  132  YHLSQLAHPLLKASGNGSIVFISSIAG---------------AINQLTKNFACEWAKDGI  176

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            R NTV+P GVRT ++ P+   P I   + EI  RTP+  +AE NEIS +VAFLCLP AAS
Sbjct  177  RTNTVAPWGVRTQVIPPDA-SPRIDD-FVEIYKRTPIPRLAEPNEISSVVAFLCLP-AAS  233

Query  199  HITGQVILIDGGYTAGA  149
            ++ GQVI +DGG TAG+
Sbjct  234  YVNGQVISVDGGLTAGS  250



>ref|XP_009358759.1| PREDICTED: tropinone reductase homolog [Pyrus x bretschneideri]
Length=260

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 200/255 (78%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSL+GMTALV+GGT+GIG AIVEELAG GA VHTC+RN+ ++ ++++EW+ KGF V+
Sbjct  6    SQRWSLQGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNKTQILERLKEWENKGFNVT  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL S+ QR+ LI TV+S+F+GKLNILVN+AA   LR   DY  E+ S +++TN+ES
Sbjct  66   GSVCDLTSKAQRENLIKTVSSIFDGKLNILVNSAATCTLRGTTDYTLEDFSTMMETNVES  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL+QL +PLLKA+GNASIVF++S+AG +ALP +S YA++K+A+ Q++KNLACEW KD 
Sbjct  126  PYHLSQLAHPLLKASGNASIVFVASIAGVVALPKLSAYAATKSAVIQISKNLACEWAKDS  185

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  V T + K E    S    +   + RTP++ +A+ NEIS LV FLCLP AA
Sbjct  186  IRTNAVAPWAVNTGV-KVESDGHS--DDFRRPIGRTPIRRLAQPNEISSLVTFLCLP-AA  241

Query  202  SHITGQVILIDGGYT  158
            S+I GQVI +DGG+T
Sbjct  242  SYINGQVISVDGGFT  256



>ref|XP_004137777.1| PREDICTED: tropinone reductase homolog [Cucumis sativus]
 ref|XP_004169350.1| PREDICTED: tropinone reductase homolog [Cucumis sativus]
 gb|KGN58842.1| hypothetical protein Csa_3G733960 [Cucumis sativus]
Length=270

 Score =   312 bits (800),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 151/260 (58%), Positives = 199/260 (77%), Gaps = 3/260 (1%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            NQRWSLKGMTALV+GG+RGIG A VEELA FGA VHTC R+Q++L++ ++EW+A GFKVS
Sbjct  6    NQRWSLKGMTALVTGGSRGIGRATVEELAEFGARVHTCCRSQEDLDKCLKEWEAMGFKVS  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAA--ISKLRKAKDYEAEELSRIIQTNL  569
            GSVCD+ S+EQR++L+ TV+S+FNG LNILVNNA   +S L+   +   E++S ++ TN 
Sbjct  66   GSVCDVQSKEQRKKLMETVSSLFNGTLNILVNNAGRTLSSLKSTVEVTEEDISSVMSTNF  125

Query  568  ESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGK  389
            ES +H +QL YPLLKA+GN SIVFISS++G  ALP  + YA+SKAAINQ+TKNLACEW K
Sbjct  126  ESSFHFSQLAYPLLKASGNGSIVFISSVSGLTALPFSTPYAASKAAINQITKNLACEWAK  185

Query  388  DGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
            D IR N V+P  ++T +++    DP   K   +++  TPLK   E +E+S +V FLCLP 
Sbjct  186  DNIRTNAVAPWIIKTRLVERSNDDPMHVKGIEQLLSVTPLKRAGEPHEVSSMVVFLCLP-  244

Query  208  AASHITGQVILIDGGYTAGA  149
            AAS+ITGQ+ +IDGG+T  A
Sbjct  245  AASYITGQLFVIDGGHTVKA  264



>ref|XP_011076794.1| PREDICTED: tropinone reductase homolog [Sesamum indicum]
Length=266

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/258 (60%), Positives = 194/258 (75%), Gaps = 4/258 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            N RWSL GMTALV+GGTRGIG A VEELA  GA V+TCSRN++EL Q++QEW +KGFKVS
Sbjct  6    NSRWSLSGMTALVTGGTRGIGQATVEELAEMGATVYTCSRNEEELNQRLQEWNSKGFKVS  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD +SRE+R QL+  V+SVFN KL+IL+NN   +  +   D+ AEE S I+ TNLES
Sbjct  66   GSVCDASSREERVQLMEKVSSVFNAKLDILINNVGTNIRKPTVDFTAEEYSTIMATNLES  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL+QL +PLLKA+G +SIVFISS+AG + L + S+Y ++K AINQLTKNLACEW KD 
Sbjct  126  SYHLSQLAHPLLKASGTSSIVFISSVAGLVHLFSGSIYGATKGAINQLTKNLACEWAKDN  185

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IRVN+V+P  ++T++ K    +    K    ++ RTPLK   E  E+S LVAFLCLP AA
Sbjct  186  IRVNSVAPWYIKTSLTKSLLEN---TKFLDNVISRTPLKRPGEPQEVSSLVAFLCLP-AA  241

Query  202  SHITGQVILIDGGYTAGA  149
            S+ITGQ+I +DGG T  A
Sbjct  242  SYITGQIIAVDGGMTVNA  259



>emb|CDP12723.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   309 bits (792),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 155/264 (59%), Positives = 198/264 (75%), Gaps = 6/264 (2%)
 Frame = -2

Query  946  MASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEW  767
            M S    ++ RWSL GMTALV+GGTRGIG AIVEELAG GA+VHT SR + EL +++QEW
Sbjct  1    MESTVGKISSRWSLSGMTALVTGGTRGIGCAIVEELAGLGAKVHTFSRKESELNERLQEW  60

Query  766  QAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSR  587
             +KGFKV+GSVCD +SREQR QLI  V+S+FNGKLNILVNN      R+A+ + AEE + 
Sbjct  61   SSKGFKVTGSVCDASSREQRTQLIGEVSSIFNGKLNILVNNVGTGVFRQAEAFTAEEYNL  120

Query  586  IIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNL  407
            I+ TNL+S YH +QL YPLLKA+G  +IVF+SS+AG + +  +SVY+ +K A+NQLTKNL
Sbjct  121  IMSTNLDSGYHFSQLAYPLLKASGIGNIVFMSSVAGLVHVHHLSVYSMTKGAMNQLTKNL  180

Query  406  ACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGE-IMMRTPLKPIAEANEISPLV  230
            ACEW KD IRVN+V+P  +RT++ + +  D    K Y E +  RTP++   E  E+S LV
Sbjct  181  ACEWAKDNIRVNSVAPWYIRTSLAEEKLSD----KEYEERVESRTPMRRTGEPEEVSSLV  236

Query  229  AFLCLPAAASHITGQVILIDGGYT  158
            AFLCLP AAS+ITGQVI +DGG T
Sbjct  237  AFLCLP-AASYITGQVIAVDGGMT  259



>gb|KDO52375.1| hypothetical protein CISIN_1g024994mg [Citrus sinensis]
Length=259

 Score =   308 bits (790),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 148/247 (60%), Positives = 191/247 (77%), Gaps = 1/247 (0%)
 Frame = -2

Query  898  MTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGSVCDLAS  719
            MTALV+GGTRGIG A VEELA FGA VHTCSRNQ EL+ ++ EW+ KGFKV+GSVCDL+S
Sbjct  1    MTALVTGGTRGIGHATVEELARFGAIVHTCSRNQIELDARLHEWKNKGFKVTGSVCDLSS  60

Query  718  REQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPYHLAQLT  539
            REQR++LI TVTS+F GKLNIL+NNAAI+ ++   D  AE++S +  TN ES +HL+QL 
Sbjct  61   REQREKLIETVTSIFQGKLNILINNAAIAFVKPTVDITAEDMSTVSSTNFESVFHLSQLA  120

Query  538  YPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIRVNTVSP  359
            +PL KA+GN SIVFISS+ G   +P++S+Y + K A+NQLTKNLACEW KD IR NTV+P
Sbjct  121  HPLFKASGNGSIVFISSVGGVRGIPSVSLYGAYKGAMNQLTKNLACEWAKDNIRTNTVAP  180

Query  358  SGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASHITGQVI  179
              ++T+++KP E  P  ++    I  +TP+    E +E+S LVAFLCLP AAS+ITGQ+I
Sbjct  181  WVIKTSMIKPFEEGPEGSEFLDGIARQTPIGRAGEPDEVSSLVAFLCLP-AASYITGQII  239

Query  178  LIDGGYT  158
             +DGG T
Sbjct  240  CVDGGVT  246



>ref|XP_010691207.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=263

 Score =   308 bits (790),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 153/255 (60%), Positives = 191/255 (75%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSL GMTALV+GGTRGIG A+VEEL GFGA++H CSRN+ EL + ++EW+ KGF+VS
Sbjct  4    SQRWSLSGMTALVTGGTRGIGNAVVEELGGFGAKIHLCSRNEVELNKCLEEWKIKGFQVS  63

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD+ SREQRQ+L+  V S+FNGKLNILVNNA  +      +   EE ++++ TNLES
Sbjct  64   GSVCDVTSREQRQKLMQDVASIFNGKLNILVNNAGTNIRNSTVEVSPEEYTKVMATNLES  123

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL QL +PLLK +G  SIVFISS+AG   L   SVY +SKAAINQLT+NLACEW KD 
Sbjct  124  AYHLCQLAHPLLKDSGAGSIVFISSVAGVTHLGTGSVYGTSKAAINQLTRNLACEWAKDN  183

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR NTV+P   RT+++     D S      +++ RTPL  IAEA E++ +VAFLCLP AA
Sbjct  184  IRSNTVAPWYTRTSLVTHLLADESFVD---KVISRTPLGRIAEAEEVASMVAFLCLP-AA  239

Query  202  SHITGQVILIDGGYT  158
            S+ITGQVI +DGG T
Sbjct  240  SYITGQVICVDGGMT  254



>ref|XP_008442511.1| PREDICTED: tropinone reductase homolog [Cucumis melo]
Length=270

 Score =   308 bits (789),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/260 (58%), Positives = 197/260 (76%), Gaps = 3/260 (1%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            NQRWSLKG TALV+GG+RGIG A VEELA FGA VHTC R+Q++L++ ++EW+  GF+VS
Sbjct  6    NQRWSLKGKTALVTGGSRGIGRATVEELAEFGARVHTCCRSQEDLDKCLKEWEEMGFEVS  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAA--ISKLRKAKDYEAEELSRIIQTNL  569
            GSVCD+ S+EQR++L+ TV+S+FNG LNILVNNA   +S L+   +   EE+S ++ TN 
Sbjct  66   GSVCDVQSKEQRKKLMETVSSLFNGTLNILVNNAGRTLSSLKSTVEVTEEEISSVMSTNF  125

Query  568  ESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGK  389
            E+  H +QL YPLLKA+GN SIVFISS++G +ALP  + YA+SKAAINQ+TKNLACEW K
Sbjct  126  EASLHFSQLAYPLLKASGNGSIVFISSVSGLMALPFSTPYAASKAAINQMTKNLACEWAK  185

Query  388  DGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
            D IR N V+P  ++T  ++    DP   K   +I+  TPLK   E +E+S +VAFLCLP 
Sbjct  186  DNIRTNAVAPWIIKTRFVESSNDDPMHVKGMEQILSVTPLKRAGEPHEVSSMVAFLCLP-  244

Query  208  AASHITGQVILIDGGYTAGA  149
            AAS+ITGQ+ +IDGG+T  A
Sbjct  245  AASYITGQLFVIDGGHTVKA  264



>ref|XP_009346421.1| PREDICTED: tropinone reductase homolog [Pyrus x bretschneideri]
Length=312

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 199/255 (78%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSLKG TALV+GGT+GIG AIVEELAG GA VHTC+RN+ ++ +++QEW++K  KV+
Sbjct  58   SQRWSLKGTTALVTGGTKGIGYAIVEELAGLGATVHTCARNEAQILERLQEWESKRLKVT  117

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
             SVCDL S+ QR+ LI TV+S+F+GKLNILVN+AA   LR   DY  E+ S +++TN+ES
Sbjct  118  SSVCDLTSKAQRENLIKTVSSIFDGKLNILVNSAATCTLRGTIDYTLEDFSSMMETNVES  177

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL+QL +PLLKA+GNASIVF++S+AG +ALP +S YA++K+A+ Q++KNLACEW KD 
Sbjct  178  PYHLSQLAHPLLKASGNASIVFVASIAGVVALPKLSAYAATKSAVIQISKNLACEWAKDA  237

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  V T +    E D   A  +  ++ RTP++ +A+ NEIS LV FLCLP AA
Sbjct  238  IRTNVVAPWAVNTGVKV--EYDGH-ADDFRRLIGRTPIRRLAQPNEISSLVTFLCLP-AA  293

Query  202  SHITGQVILIDGGYT  158
            S+I GQVI +DGG+T
Sbjct  294  SYINGQVISVDGGFT  308



>ref|XP_002308174.2| hypothetical protein POPTR_0006s09080g [Populus trichocarpa]
 gb|EEE91697.2| hypothetical protein POPTR_0006s09080g [Populus trichocarpa]
Length=275

 Score =   307 bits (787),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/261 (59%), Positives = 195/261 (75%), Gaps = 13/261 (5%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSLKGMTALV+GGTRGIG AIVEELAGFGA VHTCSRN+ +L++ ++EW++KGF+V+GS
Sbjct  12   RWSLKGMTALVTGGTRGIGFAIVEELAGFGAAVHTCSRNETKLDECIREWESKGFRVTGS  71

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD++ R QR +LI  V+S F GKLNILVNNAA    + +    AE+++  + TN+E+ Y
Sbjct  72   VCDVSCRTQRDKLIEKVSSTFQGKLNILVNNAAAVVSKNSTKVTAEDMAYTLGTNVEASY  131

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL +PLLKA+GN SIVFISS+A  +ALP +S Y +SK A+NQLTK+LACEW  D IR
Sbjct  132  HLCQLAHPLLKASGNGSIVFISSVAAVVALPTLSFYGASKGALNQLTKSLACEWAHDKIR  191

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGE-------IMMRTPLKPIAEANEISPLVAFLC  218
             N VSP      I+K   +D S+AK   E       I+ +TP+  + EA+EIS LVAFLC
Sbjct  192  ANAVSP-----WIIKTPLLDASLAKSPSEQRAGMSRIVAQTPISRLGEASEISSLVAFLC  246

Query  217  LPAAASHITGQVILIDGGYTA  155
            LP AA +ITGQ+I +DGGYTA
Sbjct  247  LPTAA-YITGQIISVDGGYTA  266



>ref|XP_011006388.1| PREDICTED: tropinone reductase homolog [Populus euphratica]
Length=275

 Score =   307 bits (787),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 195/261 (75%), Gaps = 13/261 (5%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSLKGMTALV+GGTRGIG AIVEELAGFGA VHTCSRN+ +L++ ++EW++KGF+V+GS
Sbjct  12   RWSLKGMTALVTGGTRGIGFAIVEELAGFGAAVHTCSRNETKLDECIREWESKGFRVTGS  71

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD++ R QR++LI  V+S F GKLNILVNNAA    + +    AE+++  + TN+E+ Y
Sbjct  72   VCDVSCRTQREKLIEKVSSTFQGKLNILVNNAAAVVSKNSTKVTAEDMANTLGTNVEASY  131

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL +PLLKA+GN SIVFISS+A  +ALP +S Y +SK A+NQLTK+LACEW +D IR
Sbjct  132  HLCQLAHPLLKASGNGSIVFISSVAAVVALPTLSFYGASKGALNQLTKSLACEWAQDKIR  191

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGE-------IMMRTPLKPIAEANEISPLVAFLC  218
             N VSP      I+K   +D S+AK   E       I+ +TP+  + E  EIS LVAFLC
Sbjct  192  ANAVSP-----WIIKTPLLDASLAKSASEQRAGMSRIVSQTPINRLGEPTEISSLVAFLC  246

Query  217  LPAAASHITGQVILIDGGYTA  155
            LP  AS+ITGQ+I +DGGYTA
Sbjct  247  LP-TASYITGQIISVDGGYTA  266



>gb|EYU19938.1| hypothetical protein MIMGU_mgv1a012090mg [Erythranthe guttata]
Length=262

 Score =   306 bits (785),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/256 (61%), Positives = 191/256 (75%), Gaps = 4/256 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL G TALV+GGTRGIG A VEELA  GA V+TCSRNQ+EL Q++QEW +KGFKVSGS
Sbjct  8    RWSLSGTTALVTGGTRGIGYATVEELAEMGATVYTCSRNQEELTQRLQEWSSKGFKVSGS  67

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD +SREQR QL+  V+S FNGKLNIL+NN   +  +   +Y AEE S I+ TNLES Y
Sbjct  68   VCDASSREQRVQLMEKVSSSFNGKLNILINNVGTNIRKPTVEYTAEEYSSIMTTNLESSY  127

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL +PLLKA+ N+SIVFISS+AG + L   S+Y ++K AINQLTKNLACEW KD IR
Sbjct  128  HLCQLAHPLLKASANSSIVFISSVAGLVHLYTGSIYGATKGAINQLTKNLACEWAKDNIR  187

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
            VN V+P  ++T+++K    +    +    ++ RTPLK   E  E+S LVAFLCLP AAS+
Sbjct  188  VNCVAPWYIKTSLVKHLLENEEFLE---HVVSRTPLKRPGEPQEVSSLVAFLCLP-AASY  243

Query  196  ITGQVILIDGGYTAGA  149
            ITGQVI +DGG+T  A
Sbjct  244  ITGQVISVDGGFTVNA  259



>ref|XP_007218806.1| hypothetical protein PRUPE_ppa009941mg [Prunus persica]
 gb|EMJ20005.1| hypothetical protein PRUPE_ppa009941mg [Prunus persica]
Length=271

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 151/258 (59%), Positives = 198/258 (77%), Gaps = 4/258 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            N RWSLKGMTALV+GGTRGIG A+VEELAGFGA VHTCSR + EL + ++EW+AKGF V+
Sbjct  10   NSRWSLKGMTALVTGGTRGIGYAVVEELAGFGAAVHTCSRKEAELHKCLKEWEAKGFLVT  69

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD +S+ +R++L+  V S FNGKLNILVNN   +  +   +Y +EE S ++ TNLES
Sbjct  70   GSVCDASSKTEREKLVQQVASSFNGKLNILVNNVGTNIRKPTTEYTSEEYSIVMATNLES  129

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL+QL +PLL+A+G  SIVFISS+AG +++ + ++YA+SKAAINQLTKNLACEW KD 
Sbjct  130  TYHLSQLAHPLLRASGAGSIVFISSVAGLVSIGSGTIYAASKAAINQLTKNLACEWAKDN  189

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR+N+V P   RT++++   +D    +   EI  RTP+  +AE  E+S LVAFLCLP AA
Sbjct  190  IRINSVCPWYTRTSLVE-HLLDNK--EFLEEITSRTPIDRVAEPEEVSSLVAFLCLP-AA  245

Query  202  SHITGQVILIDGGYTAGA  149
            S+ITGQ+I +DGG TA +
Sbjct  246  SYITGQIISVDGGMTANS  263



>ref|XP_008461702.1| PREDICTED: tropinone reductase homolog [Cucumis melo]
Length=273

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 200/263 (76%), Gaps = 5/263 (2%)
 Frame = -2

Query  943  ASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQ  764
            AS+  G+  RWSLKG TALV+GGTRGIG A+VEELAG GA VHTCSRNQ +L Q ++EW+
Sbjct  4    ASDSAGI-PRWSLKGFTALVTGGTRGIGHAVVEELAGLGASVHTCSRNQSDLNQCLKEWE  62

Query  763  AKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRI  584
            AKGF V+GSVCD +SR QR++LI  V S FNG LNILVNNA  +  +   +Y  E++S +
Sbjct  63   AKGFVVTGSVCDASSRTQREELIQEVASSFNGTLNILVNNAGTNIRKPTAEYSLEDVSTL  122

Query  583  IQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLA  404
            + TN ES YHL+QL++PLLKA+GN SIVFISS+ G +++ + S+YA++K+AINQLTK LA
Sbjct  123  MTTNFESAYHLSQLSHPLLKASGNGSIVFISSVGGLVSVGSGSIYAATKSAINQLTKYLA  182

Query  403  CEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAF  224
            CEW KD IRVN V+P  + T +++    + ++      I+ RTPL+ I E+ E+S LVAF
Sbjct  183  CEWAKDNIRVNGVAPWYINTPLVEKLLNNKTLVD---NIVSRTPLRRIGESKEVSSLVAF  239

Query  223  LCLPAAASHITGQVILIDGGYTA  155
            LCLP AAS+ITGQ++ +DGG+TA
Sbjct  240  LCLP-AASYITGQIMSVDGGFTA  261



>gb|KEH34753.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=273

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/264 (61%), Positives = 195/264 (74%), Gaps = 6/264 (2%)
 Frame = -2

Query  943  ASEQCGMN--QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            A E+C  N   RWSLKG TALV+GGTRGIG AIVE+L GFGA VHTCSRNQ EL   + +
Sbjct  3    AVEECSSNGVSRWSLKGKTALVTGGTRGIGHAIVEDLCGFGATVHTCSRNQDELNNCLNQ  62

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            W++KGF VSGSVCD++SREQR++LI  V S+FNGKL+I VNN   +  +   +Y AE  S
Sbjct  63   WRSKGFLVSGSVCDVSSREQREKLIQEVASIFNGKLHIYVNNVGANFRKPTIEYTAEVYS  122

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKN  410
             I+  NL+S YHL QLT+PLLKA G  SIVFISS+AG ++L   SVYA+SKAAI QLTKN
Sbjct  123  EIMAINLDSAYHLCQLTHPLLKAYGMGSIVFISSIAGVVSLGTGSVYAASKAAITQLTKN  182

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLV  230
            LACEW KDGIR N V P+   T ++  E +  +   M  E++ RTPL  IAE++E+S LV
Sbjct  183  LACEWAKDGIRSNCVVPATTNTPLV--EHLLRNKQYM-DEMLSRTPLGCIAESHEVSSLV  239

Query  229  AFLCLPAAASHITGQVILIDGGYT  158
            AFLCLP AAS+ITGQVI +DGG T
Sbjct  240  AFLCLP-AASYITGQVICVDGGLT  262



>ref|XP_010256814.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Nelumbo nucifera]
Length=269

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/266 (59%), Positives = 195/266 (73%), Gaps = 14/266 (5%)
 Frame = -2

Query  940  SEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQA  761
            +E    + RW LKGMTALV+GGTRGIG AIVEELAG GA VHTCSR + EL   +++W +
Sbjct  4    AESSSRDSRWYLKGMTALVTGGTRGIGHAIVEELAGLGATVHTCSRKEDELNGCLRDWAS  63

Query  760  KGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRII  581
            KGF+VSGSVCD++SR QR++LI TV+SVF+GKLNIL+NNA  +  +   +Y AEE S +I
Sbjct  64   KGFRVSGSVCDVSSRPQREKLIETVSSVFSGKLNILINNAGTNIRKPTIEYTAEEFSTLI  123

Query  580  QTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLAC  401
             TNLES YHL QL YPLLK +G  SIVFISS+AG +AL + +VY +SK AINQLTKNLAC
Sbjct  124  ATNLESAYHLCQLAYPLLKLSGVGSIVFISSVAGVVALGSGTVYGASKGAINQLTKNLAC  183

Query  400  EWGKDGIRVNTVSPSGVRTTIMK-----PEEIDPSIAKMYGEIMMRTPLKPIAEANEISP  236
            EW KD IR N V+P  +RT++++      E +D  IA        RTPL+   E  E+S 
Sbjct  184  EWAKDNIRTNCVAPWYIRTSLVEHLLDNKEFLDTVIA--------RTPLRRPGEPKEVSS  235

Query  235  LVAFLCLPAAASHITGQVILIDGGYT  158
            LVAFLCLP A+S+ITGQVI +DGG T
Sbjct  236  LVAFLCLP-ASSYITGQVISVDGGMT  260



>ref|XP_006493568.1| PREDICTED: tropinone reductase homolog isoform X1 [Citrus sinensis]
Length=263

 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 194/254 (76%), Gaps = 1/254 (0%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            +RWSLKGMTALV+GGT+GIG A+VEELA FGA VHTCSRN+ EL Q++QEW++KG +VSG
Sbjct  7    KRWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSG  66

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            + CD+  R QR++L+ TV+S F+GKLNIL+NNA     ++  ++  E+ S ++ TN ES 
Sbjct  67   NACDVKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESA  126

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YH++QL +PLLK++GN +I+FISS+AG IA+P  S+ ASSK A+NQLTKNLACEW KD I
Sbjct  127  YHVSQLAHPLLKSSGNGNIIFISSVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKI  186

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVN+V+P  +RT ++     D +  +    +++RTP+    E  E+S +VAFLC P AAS
Sbjct  187  RVNSVAPWIIRTPLIDKVLKDSTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFP-AAS  245

Query  199  HITGQVILIDGGYT  158
            ++TGQVI +DGGY+
Sbjct  246  YVTGQVICVDGGYS  259



>sp|P50165.1|TRNH_DATST RecName: Full=Tropinone reductase homolog; AltName: Full=P29X 
[Datura stramonium]
 gb|AAA33280.1| 29kDa protein; high homology to aa sequence of tropinone reductases 
[Datura stramonium]
Length=268

 Score =   304 bits (779),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 197/257 (77%), Gaps = 1/257 (0%)
 Frame = -2

Query  928  GMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFK  749
            G ++RWSL+GMTALV+GGTRGIG AIVEELA FGAEV+TCSR+Q +L++ +++W+ KGFK
Sbjct  8    GGDRRWSLRGMTALVTGGTRGIGYAIVEELANFGAEVYTCSRSQNDLDECLEKWRRKGFK  67

Query  748  VSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNL  569
            VSG VCD++S  QRQ L+ +VTS FNGKLNIL+NNA  +  ++A ++ AE+ S I+ TN 
Sbjct  68   VSGPVCDVSSISQRQTLMESVTSSFNGKLNILINNAGTTIPKEATNFTAEDYSIIMGTNF  127

Query  568  ESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGK  389
            E+ Y+L QL +PLLKA+GNASIVF SS AG IA+P  S+YA+SK AINQ+TK+LACEW K
Sbjct  128  EASYNLCQLAHPLLKASGNASIVFNSSAAGVIAVPLSSIYAASKGAINQVTKSLACEWAK  187

Query  388  DGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
            D IRVN V+P  + T I++     PS  K    ++ R P+K   E +E+S LV +LCLP 
Sbjct  188  DSIRVNAVAPWIINTPIIEAACQVPSQKKNIESLIGRAPMKRAGEPSEVSSLVTYLCLP-  246

Query  208  AASHITGQVILIDGGYT  158
             AS+ITGQ+I +DGGYT
Sbjct  247  TASYITGQIICVDGGYT  263



>ref|XP_004503172.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cicer 
arietinum]
Length=269

 Score =   304 bits (779),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/253 (61%), Positives = 186/253 (74%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL GMTALV+GGTRGIG AIV +LA FGA VHTCSR + EL + +QEWQ++GF V+GS
Sbjct  10   RWSLTGMTALVTGGTRGIGHAIVNDLAAFGATVHTCSRTESELNKCLQEWQSQGFLVTGS  69

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD+ASR QR+ L+  VTS FNGKLNI VNN   +  +   +Y  EE S ++  NL+S +
Sbjct  70   VCDVASRPQRENLVQQVTSTFNGKLNIFVNNVGTNIRKPTVEYTGEEYSELMAINLDSAF  129

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL YPLLKA+G  SIVFISS+AG ++L   SVYA+SKAAINQLTKNLACEW KD IR
Sbjct  130  HLCQLAYPLLKASGIGSIVFISSVAGVVSLGTGSVYAASKAAINQLTKNLACEWAKDNIR  189

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N V P   RT ++  E +  +  K   +IM RTPLK IAE  E+S LV FLCLP AAS+
Sbjct  190  SNCVVPWATRTPLV--EHLFQN-QKFVDDIMSRTPLKRIAEPEEVSSLVTFLCLP-AASY  245

Query  196  ITGQVILIDGGYT  158
            ITGQVI +DGG T
Sbjct  246  ITGQVISVDGGLT  258



>gb|AFK39944.1| unknown [Lotus japonicus]
Length=276

 Score =   304 bits (778),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 153/253 (60%), Positives = 190/253 (75%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL GMTALV+GGTRGIG AIVE+L GFG  VHTCSRNQ EL++ + +WQ+KGF VSGS
Sbjct  17   RWSLNGMTALVTGGTRGIGHAIVEDLCGFGTTVHTCSRNQAELDKCLSDWQSKGFLVSGS  76

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD++S   R++LI  VTS+FNGKLN+ VNN   +  +   +Y AE+ S ++  NL+S +
Sbjct  77   VCDVSSLAHREKLIQEVTSIFNGKLNVYVNNVGANFRKPTVEYTAEDYSGMMAINLDSAF  136

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL YPLLKA+G  SIVFISS+AG ++L   SVYA+SKAAINQLTK+LACEW KDGIR
Sbjct  137  HLCQLAYPLLKASGMGSIVFISSIAGVVSLGTGSVYAASKAAINQLTKSLACEWAKDGIR  196

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N V P+   T +++    +    K   E++ RTP++ IAEA EIS LVAFLCLP AAS+
Sbjct  197  SNCVVPATTNTPLVEHLLRNK---KYVDEMLSRTPIRRIAEAQEISSLVAFLCLP-AASY  252

Query  196  ITGQVILIDGGYT  158
            ITGQVI IDGG T
Sbjct  253  ITGQVICIDGGLT  265



>ref|XP_006429160.1| hypothetical protein CICLE_v10012493mg [Citrus clementina]
 gb|ESR42400.1| hypothetical protein CICLE_v10012493mg [Citrus clementina]
Length=263

 Score =   303 bits (776),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 193/254 (76%), Gaps = 1/254 (0%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            +RWSLKGMTALV+GGT+GIG A+VEELA FGA VHTCSRN+ EL Q++QEW++KG +VSG
Sbjct  7    KRWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSG  66

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            + CDL  R QR++L+ TV+S F+G LNIL+NNA     ++  ++  E+ S ++ TN ES 
Sbjct  67   NACDLKIRAQREKLMETVSSQFDGMLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESA  126

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YH++QL +PLLK++GN +I+FISS+AG IA+P  S+ ASSK A+NQLTKNLACEW KD I
Sbjct  127  YHVSQLAHPLLKSSGNGNIIFISSVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKI  186

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVN+V+P  +RT ++     D +  +    +++RTP+    E  E+S +VAFLC P AAS
Sbjct  187  RVNSVAPWIIRTPLIDKVLKDSTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFP-AAS  245

Query  199  HITGQVILIDGGYT  158
            ++TGQVI +DGGY+
Sbjct  246  YVTGQVICVDGGYS  259



>ref|XP_006493569.1| PREDICTED: tropinone reductase homolog isoform X2 [Citrus sinensis]
Length=261

 Score =   303 bits (776),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 196/254 (77%), Gaps = 3/254 (1%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            +RWSLKGMTALV+GGT+GIG A+VEELA FGA VHTCSRN+ EL Q++QEW++KG +VSG
Sbjct  7    KRWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSG  66

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            + CD+  R QR++L+ TV+S F+GKLNIL+NNA     ++  ++  E+ S ++ TN ES 
Sbjct  67   NACDVKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESA  126

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YH++QL +PLLK++GN +I+FISS+AG IA+P  S+ ASSK A+NQLTKNLACEW KD I
Sbjct  127  YHVSQLAHPLLKSSGNGNIIFISSVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKI  186

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVN+V+P  +RT ++  ++ D +  +    +++RTP+    E  E+S +VAFLC P AAS
Sbjct  187  RVNSVAPWIIRTPLI--DKKDSTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFP-AAS  243

Query  199  HITGQVILIDGGYT  158
            ++TGQVI +DGGY+
Sbjct  244  YVTGQVICVDGGYS  257



>ref|XP_008233480.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=271

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 193/255 (76%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            N RWSLKGMTALV+GGTRGIG A+VEELAGFGA VHTCSRN+ EL + ++EW+AKGF V+
Sbjct  10   NSRWSLKGMTALVTGGTRGIGYAVVEELAGFGAAVHTCSRNEAELHKCLKEWEAKGFLVT  69

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD +S+ +R++L+  V S FNGKLNILVNN   +  +   +Y +EE S ++ TNLES
Sbjct  70   GSVCDASSKTEREKLVQQVASSFNGKLNILVNNVGTNIRKPTTEYTSEEYSIVMATNLES  129

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL+QL +PLL+A+G  SIVFISS+AG + + + ++YA+SKAAINQLTKNLACEW KD 
Sbjct  130  TYHLSQLAHPLLRASGAGSIVFISSVAGLVGIGSGTIYAASKAAINQLTKNLACEWAKDN  189

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N+V P   RT+++     +    +   EI  RTP+  +AE  E+S LVAFLCLP AA
Sbjct  190  IRSNSVCPWYTRTSLVGHLLGNKEFLE---EITSRTPIDRVAEPEEVSSLVAFLCLP-AA  245

Query  202  SHITGQVILIDGGYT  158
            S+ITGQ+I +DGG T
Sbjct  246  SYITGQIISVDGGMT  260



>ref|XP_009603003.1| PREDICTED: tropinone reductase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=269

 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/264 (57%), Positives = 195/264 (74%), Gaps = 5/264 (2%)
 Frame = -2

Query  946  MASEQC-GMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            MA   C G + RWSL G TALV+GGTRGIG A+VEELA  GA V+TCSRNQ EL +++QE
Sbjct  1    MAKVACIGSSSRWSLSGFTALVTGGTRGIGHAVVEELAELGATVYTCSRNQAELNERLQE  60

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            W  KG +V GSVCD +SREQR QL+  V+S F+GKLNILVNN   +  +   DY AEE +
Sbjct  61   WAVKGLQVKGSVCDASSREQRVQLMENVSSAFDGKLNILVNNVGTNIRKPTTDYSAEEYA  120

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKN  410
            R++ TNLES YHL QL +PLLKA+GN S+VFISS+AG + L + S+Y ++K A+NQLT+N
Sbjct  121  RLLSTNLESAYHLCQLAHPLLKASGNGSVVFISSVAGLVHLSSGSIYGATKGAMNQLTRN  180

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLV  230
            LACEW  D IRVN V+P  +RT+++  E +  +   + G ++ RTPL+   E+ E+S LV
Sbjct  181  LACEWANDSIRVNGVAPWYIRTSLV--EHLLENKTFLDG-VISRTPLRRPGESQEVSSLV  237

Query  229  AFLCLPAAASHITGQVILIDGGYT  158
            A+LCLP  AS+ITGQVI +DGG+T
Sbjct  238  AYLCLP-GASYITGQVIAVDGGFT  260



>gb|EPS58365.1| hypothetical protein M569_16448 [Genlisea aurea]
Length=267

 Score =   301 bits (772),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/261 (56%), Positives = 197/261 (75%), Gaps = 6/261 (2%)
 Frame = -2

Query  928  GMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFK  749
            G + RWSL GMTALV+GGTRGIG A VEEL+  GA VHTCSRN++EL  +++EW +KGFK
Sbjct  5    GNSSRWSLFGMTALVTGGTRGIGHATVEELSDLGAIVHTCSRNEEELNSRLKEWNSKGFK  64

Query  748  VSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNL  569
            V+GSVCD + REQR +LI  V+S+F+GKLNILVNN   +  +KA DY AEE S ++ TNL
Sbjct  65   VTGSVCDASVREQRAKLIDDVSSIFDGKLNILVNNVGTNFRKKAVDYTAEEYSTLMATNL  124

Query  568  ESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGK  389
            +S YH +QL +PLLKA+G+ +IV ISS++G   + + SVY ++K A+NQLT+NLACEW  
Sbjct  125  DSAYHFSQLAHPLLKASGSGNIVIISSISGVAHISSGSVYGATKGALNQLTRNLACEWAD  184

Query  388  DGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIM-MRTPLKPIAEANEISPLVAFLCLP  212
            DGIRVN V+P  +RT++++P   +    K + E +  RTPLK + E  E+S LVA+LCLP
Sbjct  185  DGIRVNCVAPGYIRTSLVEPLLEN----KHFTETLESRTPLKRMGEPGEVSSLVAYLCLP  240

Query  211  AAASHITGQVILIDGGYTAGA  149
             AAS+ITGQ++++DGG T  A
Sbjct  241  -AASYITGQIVVVDGGLTVNA  260



>ref|XP_004503163.1| PREDICTED: tropinone reductase homolog [Cicer arietinum]
Length=272

 Score =   302 bits (773),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/264 (58%), Positives = 194/264 (73%), Gaps = 8/264 (3%)
 Frame = -2

Query  943  ASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQ  764
            A+E      RWSLKG TALV+GGTRGIG A+VEELA FGA V+TCSRN+ EL + + +WQ
Sbjct  4    ATESSSRGSRWSLKGATALVTGGTRGIGHAVVEELAEFGATVYTCSRNEVELNKCLNQWQ  63

Query  763  AKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRI  584
             KGF V GSVCDL+S  QR++LI  V S FNGKLNILVNNA  +  +   DY AEE S++
Sbjct  64   EKGFSVYGSVCDLSSSSQREELIRKVASAFNGKLNILVNNAGTNVRKPTIDYTAEEYSKV  123

Query  583  IQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLA  404
            + TNL+S YHL+QL Y LLK +GN SIVF SS+A   ++ + S+YA SKAAINQLTK+LA
Sbjct  124  MNTNLDSVYHLSQLAYSLLKESGNGSIVFNSSVASLTSVGSGSIYALSKAAINQLTKSLA  183

Query  403  CEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIA--KMYGEIMMRTPLKPIAEANEISPLV  230
            CEW KD IR N V+P   +T++     ++  IA  +   EI+ RTP+K IAEA+E+S LV
Sbjct  184  CEWAKDNIRSNCVAPWYTKTSL-----VEHLIANEEFVNEILSRTPIKRIAEAHEVSSLV  238

Query  229  AFLCLPAAASHITGQVILIDGGYT  158
             FLCLP AAS+ITGQ++ +DGG+T
Sbjct  239  TFLCLP-AASYITGQIVSVDGGFT  261



>ref|XP_010033096.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW52638.1| hypothetical protein EUGRSUZ_J02011 [Eucalyptus grandis]
Length=279

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 192/254 (76%), Gaps = 4/254 (2%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
             RWSL GMTALV+GGT+GIG AIVEELA  GA VHTCSRN+ E+ + +++W++KGF+VSG
Sbjct  21   NRWSLHGMTALVTGGTKGIGHAIVEELARLGATVHTCSRNEAEINECLKDWKSKGFRVSG  80

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            S CD++SR +R++L+ TV+SVF+GKLNIL+NN   + L+   DY AE+ S I+ TN ES 
Sbjct  81   STCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFIMTTNFESA  140

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+QL +PLLKA+G  SIVF+SS+ G +++   S+Y+++K A+NQLTKNLACEW KD I
Sbjct  141  YHLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLACEWAKDNI  200

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            R N+V+P  + T + +P   D    K + E++ RTPL    E  E+S LVAFLCLP AAS
Sbjct  201  RSNSVAPWFILTPLAEPLLSDK---KFHEEVIARTPLGRTGEPEEVSSLVAFLCLP-AAS  256

Query  199  HITGQVILIDGGYT  158
            +ITGQ I +DGG+T
Sbjct  257  YITGQTICVDGGFT  270



>gb|KEH34749.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=275

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/254 (60%), Positives = 186/254 (73%), Gaps = 4/254 (2%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRWSL GMTALV+GGTRGIG AIV +L  FGA VHTCSR + EL + +QEWQ+KGF V+G
Sbjct  15   QRWSLTGMTALVTGGTRGIGHAIVNDLVAFGAAVHTCSRTESELSKCLQEWQSKGFSVTG  74

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCD++SR QR+ L+  V S FNGKLNI VNN   +  +   +Y AEE S ++  NL+S 
Sbjct  75   SVCDVSSRSQRESLVQEVASTFNGKLNIFVNNVGSNFRKPTIEYTAEEYSELMTINLDSS  134

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            +HL QL++PLLK +GN SIVFISS+AG ++L   SVYA+SKAAINQLTKNLACEW  D I
Sbjct  135  FHLCQLSHPLLKESGNGSIVFISSVAGVVSLGTGSVYAASKAAINQLTKNLACEWAIDNI  194

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            R N V P   RT ++  E +  +  K   +I+ RTPLK IAE  E+S LV FLCLP AAS
Sbjct  195  RSNCVVPWATRTPLV--EHLFQN-QKFVDDILSRTPLKRIAEPEEVSSLVTFLCLP-AAS  250

Query  199  HITGQVILIDGGYT  158
            +ITGQVI +DGG T
Sbjct  251  YITGQVICVDGGLT  264



>ref|XP_009421329.1| PREDICTED: tropinone reductase homolog [Musa acuminata subsp. 
malaccensis]
Length=271

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 149/253 (59%), Positives = 191/253 (75%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL GMTALV+GGTRGIG A+VEELAG GA VHTCSR + +L + +++W AKGF+V+GS
Sbjct  15   RWSLGGMTALVTGGTRGIGHAVVEELAGLGASVHTCSRKEADLTECLRKWAAKGFRVTGS  74

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCDL+SREQR QLI  V++ FNGKLNILVNN   +  +   +Y AEE S ++ TNLES Y
Sbjct  75   VCDLSSREQRDQLIREVSATFNGKLNILVNNVGTNIRKPTVEYSAEEYSFLMATNLESAY  134

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL +PLLKA+G  SIVFISS+AG +AL + S+YA++KAA+NQ+TKNLACEW KD IR
Sbjct  135  HLCQLAHPLLKASGMGSIVFISSVAGVVALSSGSIYAAAKAAMNQMTKNLACEWAKDNIR  194

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N+VSP  ++T +++    D    +    I+ RTPL  + E  E+S LV +LCLP AAS+
Sbjct  195  TNSVSPWYIKTKLVEHLLNDKDSLQ---RIIDRTPLGRVGEPEEVSSLVGYLCLP-AASY  250

Query  196  ITGQVILIDGGYT  158
            ITGQ+I +DGG T
Sbjct  251  ITGQIISVDGGMT  263



>ref|XP_002879208.1| hypothetical protein ARALYDRAFT_481843 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55467.1| hypothetical protein ARALYDRAFT_481843 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score =   301 bits (771),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 194/256 (76%), Gaps = 4/256 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M++RWSL+GMTALV+GGT+GIG A+VEEL+  GA VHTC+R++ +L+++++EWQ KGF+V
Sbjct  1    MDKRWSLQGMTALVTGGTKGIGEAVVEELSMLGARVHTCARDETQLQERLREWQGKGFQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            + SVCD++ R+QR++LI TV+S+F GKLNILVNNA    L+   +Y AEE S I+ TNLE
Sbjct  61   TTSVCDVSLRDQREKLIETVSSLFQGKLNILVNNAGTFILKPTTEYTAEEFSFIMATNLE  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            S +H++QL +PLLKA+G+ SIVF+SS+AG + +   S+Y ++K A+NQL +NLACEW  D
Sbjct  121  SAFHISQLAHPLLKASGSGSIVFMSSIAGVVHVSVGSIYGATKGAMNQLARNLACEWASD  180

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
             IR N + P  ++T ++     D  I K   E   RTP+  + EANE+SPLVAFLCLP A
Sbjct  181  NIRTNAICPGVIKTPLISDLLSDEEIKK---EAEQRTPMGRVGEANEVSPLVAFLCLP-A  236

Query  205  ASHITGQVILIDGGYT  158
            AS+ITGQ I +DGG T
Sbjct  237  ASYITGQTICVDGGLT  252



>ref|XP_010106552.1| Tropinone reductase-like protein [Morus notabilis]
 gb|EXC10728.1| Tropinone reductase-like protein [Morus notabilis]
Length=271

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 194/258 (75%), Gaps = 4/258 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSL+GMTALV+GGT+GIG AIVEELAGFGA V+TCSRN+ +L + + EWQ K F+V 
Sbjct  12   SQRWSLEGMTALVTGGTKGIGYAIVEELAGFGATVYTCSRNKVQLHECLVEWQRKKFRVC  71

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD+AS   R++L + V+S+FNGKLNILVNN   +  + A ++ AE+ S +I+TNLES
Sbjct  72   GSVCDVASEADRKELANKVSSLFNGKLNILVNNVGTTIPKSAIEHNAEDFSFLIKTNLES  131

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YH+ QL++PLLKA+G ASIVFISS+A  I+LP  ++YA +KA +NQLTKNLACEW +D 
Sbjct  132  AYHMCQLSHPLLKASGEASIVFISSIASVISLPVGTMYAVTKAEMNQLTKNLACEWAQDN  191

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V PS  RT + +P   D S  K     + R P+  +AE NE+S LVAFLCLP AA
Sbjct  192  IRSNCVLPSVTRTPLAEPFFSDESFLK---PAISRMPIGRVAEPNEVSSLVAFLCLP-AA  247

Query  202  SHITGQVILIDGGYTAGA  149
            S+I+GQ I +DGG+T  A
Sbjct  248  SYISGQAICVDGGFTVNA  265



>ref|XP_003552795.1| PREDICTED: tropinone reductase homolog [Glycine max]
 gb|KHN07592.1| Tropinone reductase like [Glycine soja]
Length=272

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/253 (60%), Positives = 186/253 (74%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL G TALV+GGTRGIG AIV +LA FGA VHTCSR Q EL + +QEWQ+ GF+V+GS
Sbjct  13   RWSLNGTTALVTGGTRGIGHAIVSDLAAFGAAVHTCSRTQTELNKCLQEWQSLGFQVTGS  72

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD++S  QR++LI  VTS+ NGKLNI VNN   +  +   +Y AEE S+++  NL+S +
Sbjct  73   VCDVSSPSQREKLIEEVTSILNGKLNIYVNNVGTNFRKPTIEYTAEEYSQLMTVNLDSSF  132

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL YPLLKA+ N SIVFISS+AG ++L   +VYA+SKAAINQLTKNLACEW KD IR
Sbjct  133  HLCQLAYPLLKASENGSIVFISSVAGVVSLGTGAVYAASKAAINQLTKNLACEWAKDNIR  192

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N V P   RT +++    D    K   +IM RTP+K IAE  E+S LV FLCLP AAS+
Sbjct  193  SNCVVPWATRTPLVEHLLRD---QKFVDDIMSRTPIKRIAEPEEVSSLVTFLCLP-AASY  248

Query  196  ITGQVILIDGGYT  158
            ITGQVI +DGG T
Sbjct  249  ITGQVICVDGGLT  261



>ref|XP_003632186.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera]
 emb|CBI16071.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/255 (57%), Positives = 195/255 (76%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            + RWSLKGMTALV+GGT+GIG AIVEELAG GA +HTCSR + EL + +++W+AKGF VS
Sbjct  11   DSRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVS  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD++SR QR++L+ T++SVFNGKLNIL+NNAAIS  +   +  AEE S I+ TN ES
Sbjct  71   GSVCDVSSRAQREKLMQTISSVFNGKLNILINNAAISIQKPTIEVTAEEFSTIMATNFES  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL+Q+ +PLLKA+G  SIVFISS++G +A   IS Y+ +K A+NQLTKNLACEW KD 
Sbjct  131  VYHLSQIAHPLLKASGAGSIVFISSVSGIVAHKNISAYSVTKGAMNQLTKNLACEWAKDN  190

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  ++T +++    + +  +   E++ R PL+ + +  E+S LVAFLCLP A+
Sbjct  191  IRSNAVAPWYIKTPMVEQMLTNQAFLE---EVINRAPLRRVGDPKEVSSLVAFLCLP-AS  246

Query  202  SHITGQVILIDGGYT  158
            S+ITGQ+I +DGG T
Sbjct  247  SYITGQIICVDGGMT  261



>ref|XP_004492175.1| PREDICTED: tropinone reductase homolog [Cicer arietinum]
Length=265

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/255 (57%), Positives = 185/255 (73%), Gaps = 1/255 (0%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSL+GMTALV+GGTRGIG AIVEELA FGA VH C+RNQ ++ + ++EW+ KGF+V+
Sbjct  11   DQRWSLQGMTALVTGGTRGIGHAIVEELAEFGASVHICARNQDDINKCLEEWKDKGFRVT  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GS CDL   +QRQ+L+ TV SVFNGKLNILVNNA I   +    Y  E+++ I+ TN  S
Sbjct  71   GSTCDLLFCDQRQKLMETVASVFNGKLNILVNNAGIFIPKNIIKYTDEDITTIMDTNFVS  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL QL YPLLKA+G  SIVFISS++G  ALP  S+Y +SK A+NQLTKNLA EW KD 
Sbjct  131  GYHLCQLAYPLLKASGYGSIVFISSISGLKALPLCSIYGASKGAMNQLTKNLALEWSKDN  190

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  V+T ++        +    G+I+ +TP+  + E  ++S LVAFLCLP  A
Sbjct  191  IRANAVAPGPVKTLLLDNAMKSAEVVNAIGDIVSQTPINRVGEPKDVSGLVAFLCLP-VA  249

Query  202  SHITGQVILIDGGYT  158
            SHITGQ+I  DGG+T
Sbjct  250  SHITGQIIAADGGFT  264



>ref|XP_004150641.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cucumis 
sativus]
 ref|XP_004172534.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cucumis 
sativus]
 gb|KGN50576.1| hypothetical protein Csa_5G184270 [Cucumis sativus]
Length=273

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 195/256 (76%), Gaps = 4/256 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            N RWSL+G TALV+GGTRGIG A+VEELAG GA VHTC+RN+ +L Q ++EW+AKG+ V+
Sbjct  10   NSRWSLEGFTALVTGGTRGIGHAVVEELAGLGASVHTCARNESDLNQCLKEWEAKGYVVT  69

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD +SR QR++LI  V S FNG LNILVNN   +  + + +Y  EE+S ++ TN ES
Sbjct  70   GSVCDASSRTQREELIQEVASSFNGTLNILVNNVGTNIRKPSAEYSLEEVSTLMTTNFES  129

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +HL+QL++PLLKA+GN SIVFISS+ G +++ + S+YA++K+AINQLT+NL CEW KD 
Sbjct  130  AFHLSQLSHPLLKASGNGSIVFISSVGGLVSIGSGSIYAATKSAINQLTRNLTCEWAKDN  189

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IRVN V+P  + T +++    + ++      I+ RTPL  I E+ E+S LVAFLCLP AA
Sbjct  190  IRVNCVAPWYINTPLVEKLMKNKTLVD---NIVSRTPLGRIGESKEVSSLVAFLCLP-AA  245

Query  202  SHITGQVILIDGGYTA  155
            S+ITGQ++ +DGG+TA
Sbjct  246  SYITGQIMSVDGGFTA  261



>ref|XP_010033094.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW52634.1| hypothetical protein EUGRSUZ_J02006 [Eucalyptus grandis]
Length=279

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 191/254 (75%), Gaps = 4/254 (2%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
             RWSL GMTALV+GGT+GIG AIVEEL G G+ VHTCSRN+ E+ + +++W++KGF+VSG
Sbjct  21   NRWSLHGMTALVTGGTKGIGHAIVEELGGLGSTVHTCSRNEAEINECLKDWKSKGFRVSG  80

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            S CD++SR +R++L+ TV+SVF+GKLNIL+NN   + L+   DY AE+ S I+  N ES 
Sbjct  81   STCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFIMTINFESA  140

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+QL +PLLKA+G  SIVF+SS+ G +++   S+Y+++K A+NQLTKNLACEW KD I
Sbjct  141  YHLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLACEWAKDNI  200

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            R N+V+P  + T + +P   D    K + E++ RTPL    E  E+S LVAFLCLP AAS
Sbjct  201  RSNSVAPWFILTPLAEPVLSDE---KFHEEVIARTPLGRTGEPEEVSSLVAFLCLP-AAS  256

Query  199  HITGQVILIDGGYT  158
            +ITGQ I +DGG+T
Sbjct  257  YITGQTICVDGGFT  270



>gb|AFK36242.1| unknown [Medicago truncatula]
Length=275

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/254 (59%), Positives = 185/254 (73%), Gaps = 4/254 (2%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            QRWSL GMTALV+GGTRGIG AIV +L  FGA VHTCSR + EL + +QEWQ+KGF V+G
Sbjct  15   QRWSLTGMTALVTGGTRGIGHAIVNDLVAFGAAVHTCSRTESELSKCLQEWQSKGFSVTG  74

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCD++SR QR+ L+  V S FNGKLNI VNN   +  +   +Y AEE S ++  NL+S 
Sbjct  75   SVCDVSSRSQRESLVQEVASTFNGKLNIFVNNVGSNFRKPTIEYTAEEYSELMTINLDSS  134

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            +HL QL++PLLK +GN SIVFISS+AG ++L   SVY +SKAAINQLTKNLACEW  D I
Sbjct  135  FHLCQLSHPLLKESGNGSIVFISSVAGVVSLGTGSVYTASKAAINQLTKNLACEWAIDNI  194

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            R N V P   RT ++  E +  +  K   +I+ RTPLK IAE  E+S LV FLCLP AAS
Sbjct  195  RSNCVVPWATRTPLV--EHLFQN-QKFVDDILSRTPLKRIAEPEEVSSLVTFLCLP-AAS  250

Query  199  HITGQVILIDGGYT  158
            +ITGQVI +DGG T
Sbjct  251  YITGQVICVDGGLT  264



>ref|XP_003538423.1| PREDICTED: tropinone reductase homolog At1g07440 [Glycine max]
Length=270

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/263 (58%), Positives = 189/263 (72%), Gaps = 4/263 (2%)
 Frame = -2

Query  946  MASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEW  767
            MA       +RWSL GMTALV+GGTRGIG +IV +LA FGA VHTCSR Q EL + +QEW
Sbjct  1    MAGSSINRGERWSLNGMTALVTGGTRGIGHSIVSDLAAFGAAVHTCSRTQTELNKCLQEW  60

Query  766  QAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSR  587
            Q++GF+V+GS+CD++S  QR++LI  V S FNGKLNI VNN  I+  +   +Y AEE S+
Sbjct  61   QSQGFQVTGSLCDVSSPPQREKLIQEVASTFNGKLNIYVNNVGINIRKPTIEYTAEEYSQ  120

Query  586  IIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNL  407
            I+  NL+S +HL QL YPLLKA+   SIVFISS+AG ++L   +V+A+SKAAINQLTKNL
Sbjct  121  IMTVNLDSSFHLCQLAYPLLKASEKGSIVFISSVAGVVSLGTGAVFAASKAAINQLTKNL  180

Query  406  ACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVA  227
            AC+W KD IR N V P   RT +++    D    K   +IM RTP+K IAE  E+S LV 
Sbjct  181  ACDWAKDNIRSNCVVPWATRTPVVEHLFKD---QKFVDDIMSRTPIKRIAEPEEVSSLVN  237

Query  226  FLCLPAAASHITGQVILIDGGYT  158
            FLCLP AAS ITGQVI +DGG T
Sbjct  238  FLCLP-AASFITGQVICVDGGLT  259



>ref|XP_011033874.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=266

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 193/263 (73%), Gaps = 4/263 (2%)
 Frame = -2

Query  946  MASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEW  767
            MA      + RWSL GMTALV+GGTRGIG A V ELAGFGA VHTCSRN++EL + ++EW
Sbjct  1    MAESSRFKDSRWSLHGMTALVTGGTRGIGNATVVELAGFGARVHTCSRNEEELNKCLKEW  60

Query  766  QAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSR  587
            +AKGF V+GSVCD +S  QR++LI  V SVF+GKLNILVNN   +  +    Y AEE S 
Sbjct  61   EAKGFVVTGSVCDASSHVQREKLIEEVDSVFHGKLNILVNNVGTNIRKPTTGYSAEEFSN  120

Query  586  IIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNL  407
            ++ TN ES YHL+Q+ +PLLKA+G  SIVFISS+AG + + + S+Y +SK AINQLTKNL
Sbjct  121  LLATNFESAYHLSQIAHPLLKASGAGSIVFISSVAGLLHIGSGSIYGASKGAINQLTKNL  180

Query  406  ACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVA  227
            ACEW KD IR N V+P  ++T+++K   +D  +     +I+ RTPL+ I +  E+S LV 
Sbjct  181  ACEWAKDNIRTNCVAPWYIKTSLVK-NLLDDKV--FLDKIISRTPLQRIGDPKEVSSLVG  237

Query  226  FLCLPAAASHITGQVILIDGGYT  158
            FLCLPAAA +ITGQVI +DGG+T
Sbjct  238  FLCLPAAA-YITGQVISVDGGFT  259



>ref|XP_003537468.1| PREDICTED: tropinone reductase homolog At1g07440-like [Glycine 
max]
Length=277

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/253 (60%), Positives = 186/253 (74%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL GMTALV+GGTRGIG AIV +LA FGA VHTCSRNQ EL + +QEWQ++GF+V+GS
Sbjct  18   RWSLNGMTALVTGGTRGIGHAIVNDLAAFGAAVHTCSRNQTELNKCLQEWQSQGFEVTGS  77

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD++S  QR++LI    S FNGKLNI VNN  ++  +   +Y AEE S ++  NL S +
Sbjct  78   VCDVSSPPQREKLIQEAASTFNGKLNIYVNNVGVNYRKPTIEYSAEEYSEMMTVNLNSAF  137

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL YPLLKA+G  SIVF+SS+AG  ++   SVYA+SKAAINQLTKNLACEW KD IR
Sbjct  138  HLCQLAYPLLKASGKGSIVFLSSVAGVTSMGTGSVYAASKAAINQLTKNLACEWAKDNIR  197

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N V P   RT +++    + +  +   ++M RTPLK IAE  E+S LVAFLCLP AAS+
Sbjct  198  SNCVVPWTTRTPLIEHLLQNQTFVE---DVMSRTPLKRIAEPEEVSSLVAFLCLP-AASY  253

Query  196  ITGQVILIDGGYT  158
            ITGQVI  DGG T
Sbjct  254  ITGQVICADGGVT  266



>gb|ACU16743.1| unknown [Glycine max]
Length=269

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/263 (58%), Positives = 189/263 (72%), Gaps = 4/263 (2%)
 Frame = -2

Query  946  MASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEW  767
            MA       +RWSL GMTALV+GGTRGIG +IV +LA FGA VHTCSR Q EL + +QEW
Sbjct  1    MAGSSINRGERWSLNGMTALVTGGTRGIGHSIVSDLAAFGAAVHTCSRTQTELNKCLQEW  60

Query  766  QAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSR  587
            Q++GF+V+GS+CD++S  QR++LI  V S FNGKLNI VNN  I+  +   +Y AEE S+
Sbjct  61   QSQGFQVTGSLCDVSSPPQREKLIQEVASTFNGKLNIYVNNVGINIRKPTIEYTAEEYSQ  120

Query  586  IIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNL  407
            I+  NL+S +HL QL YPLLKA+   SIVFISS+AG ++L   +V+A+SKAAINQLTKNL
Sbjct  121  IMTVNLDSSFHLCQLAYPLLKASEKGSIVFISSVAGVVSLGTGAVFAASKAAINQLTKNL  180

Query  406  ACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVA  227
            AC+W KD IR N V P   RT +++    D    K   +IM RTP+K IAE  E+S LV 
Sbjct  181  ACDWAKDNIRSNCVVPWATRTPVVEHLFKD---QKFVDDIMSRTPIKRIAEPEEVSSLVN  237

Query  226  FLCLPAAASHITGQVILIDGGYT  158
            FLCLP AAS ITGQVI +DGG T
Sbjct  238  FLCLP-AASFITGQVICVDGGLT  259



>gb|KEH34737.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=269

 Score =   300 bits (767),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 189/255 (74%), Gaps = 8/255 (3%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSLKG TALV+GGTRGIG A+VEELA FGA V TCSRN++EL + + EW+ KGF V GS
Sbjct  12   RWSLKGTTALVTGGTRGIGHAVVEELAEFGATVFTCSRNEEELNKCLNEWKEKGFSVYGS  71

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD +S  QR++LI  V S FNGKLNILVNNA  +  +   +Y AE+ S+++ TNL+S Y
Sbjct  72   VCDASSPSQREELIRQVASAFNGKLNILVNNAGTNVRKPTIEYTAEDYSKVMTTNLDSAY  131

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL YPLLK +GN SIVFISS+A  I++   S+YA SKAAINQLTKNLACEW KD IR
Sbjct  132  HLCQLAYPLLKESGNGSIVFISSVASLISVGTGSIYAVSKAAINQLTKNLACEWAKDNIR  191

Query  376  VNTVSPSGVRTTIMKPEEIDPSIA--KMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
             N V+P   +T++     ++  IA  +   E++ RTP+K IAE +E+S LV FLCLP AA
Sbjct  192  SNCVAPWYTKTSL-----VEQFIANKEFVDEVLSRTPIKRIAETHEVSALVTFLCLP-AA  245

Query  202  SHITGQVILIDGGYT  158
            S+ITGQ + +DGG+T
Sbjct  246  SYITGQTVSVDGGFT  260



>gb|AIX10937.1| putative tropinone reductase [Gardenia jasminoides]
Length=274

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/253 (58%), Positives = 189/253 (75%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL G TALV+GGTRGIG A+VEELA  GA +HTCSRN+ EL +++QEW +KGFKV+GS
Sbjct  12   RWSLAGKTALVTGGTRGIGLAVVEELAELGATIHTCSRNEVELNERLQEWASKGFKVTGS  71

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD +SREQR+QL+  V+SVF+GKLN+L+NN   +  +   DY AEE  RI+ TNLES Y
Sbjct  72   VCDASSREQREQLMGKVSSVFDGKLNLLINNVGTNIRKPTTDYTAEEYCRIMATNLESAY  131

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL+QL YPLLKA+G  S VFISS+AG + L + S+Y ++K A+NQLT+NLACEW KD IR
Sbjct  132  HLSQLAYPLLKASGVGSTVFISSVAGLVHLSSGSIYGATKGAMNQLTRNLACEWAKDNIR  191

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
            VN V+P  +RT++++    +     M   ++ RTPL    E  E+S LVA+ CLP AAS+
Sbjct  192  VNCVAPWYIRTSLVENLLNNKEFLDM---VISRTPLGRPGEPKEVSSLVAYFCLP-AASY  247

Query  196  ITGQVILIDGGYT  158
            ITGQV+ +DGG T
Sbjct  248  ITGQVVAVDGGMT  260



>gb|KDP44893.1| hypothetical protein JCGZ_01393 [Jatropha curcas]
Length=274

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 197/267 (74%), Gaps = 5/267 (2%)
 Frame = -2

Query  946  MASEQCGM-NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            MA  +C   + RWSL+G+TALV+GGTRGIG A VEELAG GA VHTCSRN+ EL + ++E
Sbjct  1    MAKAECSFKDPRWSLQGLTALVTGGTRGIGYATVEELAGLGARVHTCSRNEAELSKCLKE  60

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            W+AKGF V+GSVCD +SREQR+ LI  V S F+G LNILVNN   +  +   +Y AEE +
Sbjct  61   WEAKGFLVTGSVCDASSREQRENLIREVGSAFSGSLNILVNNVGTNIRKPTIEYSAEEFA  120

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKN  410
            +++ TNLE+ YHL QL +PLLKA+G  SIVFISS+ G   + + S+Y +SK AINQLTKN
Sbjct  121  KLMTTNLETTYHLCQLAHPLLKASGVGSIVFISSVGGLAHIGSGSIYGASKGAINQLTKN  180

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLV  230
            LACEW KD IR N V+P  ++T++++   +D    +   +++ RTPL+ + EA E+S LV
Sbjct  181  LACEWAKDNIRSNCVAPWYIKTSLVE-NLLDNK--EFLDKVVSRTPLQRVGEAKEVSSLV  237

Query  229  AFLCLPAAASHITGQVILIDGGYTAGA  149
            AFLCLP AAS+ITGQVI +DGG TA A
Sbjct  238  AFLCLP-AASYITGQVIAVDGGMTANA  263



>gb|KEH34754.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=277

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 160/268 (60%), Positives = 195/268 (73%), Gaps = 10/268 (4%)
 Frame = -2

Query  943  ASEQCGMN--QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            A E+C  N   RWSLKG TALV+GGTRGIG AIVE+L GFGA VHTCSRNQ EL   + +
Sbjct  3    AVEECSSNGVSRWSLKGKTALVTGGTRGIGHAIVEDLCGFGATVHTCSRNQDELNNCLNQ  62

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            W++KGF VSGSVCD++SREQR++LI  V S+FNGKL+I VNN   +  +   +Y AE  S
Sbjct  63   WRSKGFLVSGSVCDVSSREQREKLIQEVASIFNGKLHIYVNNVGANFRKPTIEYTAEVYS  122

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSK----AAINQ  422
             I+  NL+S YHL QLT+PLLKA G  SIVFISS+AG ++L   SVYA+SK    AAI Q
Sbjct  123  EIMAINLDSAYHLCQLTHPLLKAYGMGSIVFISSIAGVVSLGTGSVYAASKVMFSAAITQ  182

Query  421  LTKNLACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEI  242
            LTKNLACEW KDGIR N V P+   T ++  E +  +   M  E++ RTPL  IAE++E+
Sbjct  183  LTKNLACEWAKDGIRSNCVVPATTNTPLV--EHLLRNKQYM-DEMLSRTPLGCIAESHEV  239

Query  241  SPLVAFLCLPAAASHITGQVILIDGGYT  158
            S LVAFLCLP AAS+ITGQVI +DGG T
Sbjct  240  SSLVAFLCLP-AASYITGQVICVDGGLT  266



>gb|KCW65560.1| hypothetical protein EUGRSUZ_G02957 [Eucalyptus grandis]
Length=271

 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/262 (55%), Positives = 196/262 (75%), Gaps = 4/262 (2%)
 Frame = -2

Query  943  ASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQ  764
            A+++     RW+L+G TALV+GGTRGIG AIVEEL+GFGA VHTCSRN +EL + ++EW+
Sbjct  3    AAQKNDRESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKEWE  62

Query  763  AKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRI  584
             KG  V+GSVCDL+SR+QR+ LI  V+S F G+LNIL+NNA ++  +   DY  EE S+I
Sbjct  63   GKGLAVTGSVCDLSSRDQRESLIKEVSSKFGGRLNILINNAGMNFRKPTVDYTVEEFSKI  122

Query  583  IQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLA  404
            + TN +S YHL Q+ +PLLKA+G  SI+FISS+AG ++L   SVYA++K AINQ+TKNLA
Sbjct  123  MATNFDSAYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKNLA  182

Query  403  CEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAF  224
            CEW KD IR N+++P  +RT++++    +    + Y  I+ RTPL+ + E  E++ L AF
Sbjct  183  CEWAKDNIRSNSIAPWYIRTSLVENLLKNK---EFYDGIIARTPLQRVGEPREVASLAAF  239

Query  223  LCLPAAASHITGQVILIDGGYT  158
            LCLP AAS+ITGQVI +DGG T
Sbjct  240  LCLP-AASYITGQVISVDGGMT  260



>gb|KCW65561.1| hypothetical protein EUGRSUZ_G02957 [Eucalyptus grandis]
Length=271

 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/262 (55%), Positives = 196/262 (75%), Gaps = 4/262 (2%)
 Frame = -2

Query  943  ASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQ  764
            A+++     RW+L+G TALV+GGTRGIG AIVEEL+GFGA VHTCSRN +EL + ++EW+
Sbjct  3    AAQKNDRESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKEWE  62

Query  763  AKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRI  584
             KG  V+GSVCDL+SR+QR+ LI  V+S F G+LNIL+NNA ++  +   DY  EE S+I
Sbjct  63   GKGLAVTGSVCDLSSRDQRESLIKEVSSKFGGRLNILINNAGMNFRKPTVDYTVEEFSKI  122

Query  583  IQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLA  404
            + TN +S YHL Q+ +PLLKA+G  SI+FISS+AG ++L   SVYA++K AINQ+TKNLA
Sbjct  123  MATNFDSAYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKNLA  182

Query  403  CEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAF  224
            CEW KD IR N+++P  +RT++++    +    + Y  I+ RTPL+ + E  E++ L AF
Sbjct  183  CEWAKDNIRSNSIAPWYIRTSLVENLLKNK---EFYDGIIARTPLQRVGEPKEVASLAAF  239

Query  223  LCLPAAASHITGQVILIDGGYT  158
            LCLP AAS+ITGQVI +DGG T
Sbjct  240  LCLP-AASYITGQVISVDGGMT  260



>ref|XP_002311182.2| tropinone reductase family protein [Populus trichocarpa]
 gb|EEE88549.2| tropinone reductase family protein [Populus trichocarpa]
Length=266

 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/263 (56%), Positives = 193/263 (73%), Gaps = 4/263 (2%)
 Frame = -2

Query  946  MASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEW  767
            MA      + RWSL GMTALV+GGTRGIG A VEELAGFGA VHTCSRN++EL + ++EW
Sbjct  1    MAESSRFKDSRWSLHGMTALVTGGTRGIGNATVEELAGFGARVHTCSRNEEELNKCLKEW  60

Query  766  QAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSR  587
            +AKGF V+GSVCD +SR QR++LI  V SVF+GKLN LVNN   +  +    Y AEE S 
Sbjct  61   EAKGFVVTGSVCDASSRVQREKLIEEVGSVFHGKLNSLVNNVGTNIRKPTTGYSAEEFSN  120

Query  586  IIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNL  407
            ++ TN ES YHL+Q+ +PLLK +G  S+VFISS+AG + + + S+Y +SK AINQLTKNL
Sbjct  121  LLATNFESAYHLSQIAHPLLKESGAGSVVFISSVAGLLHIGSGSIYGASKGAINQLTKNL  180

Query  406  ACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVA  227
            ACEW KD IR N V+P  +RT++++   +D  +     +I+ RTPL+ + +  E+S LV 
Sbjct  181  ACEWAKDNIRTNCVAPWYIRTSLVE-HLLDDKV--FLDKIISRTPLQRVGDPKEVSSLVG  237

Query  226  FLCLPAAASHITGQVILIDGGYT  158
            FLCLPAAA +ITGQVI +DGG+T
Sbjct  238  FLCLPAAA-YITGQVISVDGGFT  259



>ref|XP_010067433.1| PREDICTED: tropinone reductase homolog At1g07440 [Eucalyptus 
grandis]
Length=272

 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/262 (55%), Positives = 196/262 (75%), Gaps = 4/262 (2%)
 Frame = -2

Query  943  ASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQ  764
            A+++     RW+L+G TALV+GGTRGIG AIVEEL+GFGA VHTCSRN +EL + ++EW+
Sbjct  4    AAQKNDRESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKEWE  63

Query  763  AKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRI  584
             KG  V+GSVCDL+SR+QR+ LI  V+S F G+LNIL+NNA ++  +   DY  EE S+I
Sbjct  64   GKGLAVTGSVCDLSSRDQRESLIKEVSSKFGGRLNILINNAGMNFRKPTVDYTVEEFSKI  123

Query  583  IQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLA  404
            + TN +S YHL Q+ +PLLKA+G  SI+FISS+AG ++L   SVYA++K AINQ+TKNLA
Sbjct  124  MATNFDSAYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKNLA  183

Query  403  CEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAF  224
            CEW KD IR N+++P  +RT++++    +    + Y  I+ RTPL+ + E  E++ L AF
Sbjct  184  CEWAKDNIRSNSIAPWYIRTSLVENLLKNK---EFYDGIIARTPLQRVGEPKEVASLAAF  240

Query  223  LCLPAAASHITGQVILIDGGYT  158
            LCLP AAS+ITGQVI +DGG T
Sbjct  241  LCLP-AASYITGQVISVDGGMT  261



>ref|XP_010256821.1| PREDICTED: tropinone reductase homolog [Nelumbo nucifera]
Length=273

 Score =   298 bits (764),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 191/252 (76%), Gaps = 4/252 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSLKGMTALV+GGTRGIG A+VEEL G GA ++TC RN+ EL +++QEW  KGF+V+GS
Sbjct  16   RWSLKGMTALVTGGTRGIGHAVVEELGGLGAIIYTCCRNETELSERLQEWTRKGFQVTGS  75

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD++SR+ R++L+ +V+S FNGKL+I VNN A   +++  +  AE+L+  +  N ES Y
Sbjct  76   VCDISSRQGREKLMESVSSAFNGKLHIFVNNPATVVMKQILESTAEDLTSTMAVNFESAY  135

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL YPLLKA+G  SIVFISSL+  +ALP +SVY +SK AINQ+TK+LACEW KD IR
Sbjct  136  HLCQLAYPLLKASGMGSIVFISSLSSVVALPYMSVYGASKGAINQVTKSLACEWAKDNIR  195

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N+V+PS +RT+ ++P   +  + +    ++ R P+  I E  E+S LVAFLCLP +AS+
Sbjct  196  TNSVAPSIIRTSSVEPYLENKELVE---RVISRAPITRIGEPQEVSSLVAFLCLP-SASY  251

Query  196  ITGQVILIDGGY  161
            ITGQVI +DGGY
Sbjct  252  ITGQVICVDGGY  263



>ref|XP_010067438.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW65563.1| hypothetical protein EUGRSUZ_G02959 [Eucalyptus grandis]
Length=271

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 195/266 (73%), Gaps = 12/266 (5%)
 Frame = -2

Query  943  ASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQ  764
            A+++     RW+L+G TALV+GGTRGIG AIVEEL+GFGA VHTCSRN +EL + ++EW+
Sbjct  3    AAQKNDRESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKEWE  62

Query  763  AKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRI  584
             KG  V+GSVCDL+SR+QR+ LI  V+S F G+LNIL+NNA  +  +   DY  EE S+I
Sbjct  63   GKGLAVTGSVCDLSSRDQRENLIKEVSSKFGGRLNILINNAGTNFRKPTVDYTVEEFSKI  122

Query  583  IQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLA  404
            + TN +S YHL Q+ +PLLKA+G  SI+FISS+AG ++L   SVYA++K AINQ+TKNLA
Sbjct  123  MATNFDSAYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKNLA  182

Query  403  CEWGKDGIRVNTVSPSGVRTT----IMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISP  236
            CEW KD IR N+++P   RT+    ++K +E       +Y  I+ RTPL+ + E  E++ 
Sbjct  183  CEWAKDNIRSNSIAPWYTRTSFVENLLKNKE-------LYDGIIARTPLQRVGEPKEVAS  235

Query  235  LVAFLCLPAAASHITGQVILIDGGYT  158
            L AFLCLP AAS+ITGQVI +DGG T
Sbjct  236  LAAFLCLP-AASYITGQVISVDGGMT  260



>ref|XP_004503173.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cicer 
arietinum]
Length=274

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 159/274 (58%), Positives = 195/274 (71%), Gaps = 22/274 (8%)
 Frame = -2

Query  946  MASEQCGMNQ------RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELE  785
            MA E+C  N       RWSL  MTALV+GGTRGIG AIVE+L GFGA VHTCSRNQ EL 
Sbjct  1    MAGEECSSNSNSIRASRWSLAEMTALVTGGTRGIGRAIVEDLCGFGATVHTCSRNQTELN  60

Query  784  QKVQEWQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYE  605
                +W++KGF VS  VCD++S  QR++LI  VTS+FNGKL+I VNN  ++  +   +Y 
Sbjct  61   NCFDQWRSKGFLVS--VCDVSSPPQREKLIQEVTSIFNGKLHIYVNNVGVNIRKPTIEYT  118

Query  604  AEELSRIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAIN  425
            AE  S I+ TNL+S YHL QLT+PLLKA+G  +IVFISS+AG ++L   SVYA+SKAAIN
Sbjct  119  AEVYSEIMSTNLDSAYHLCQLTHPLLKASGMGNIVFISSIAGVVSLGTGSVYAASKAAIN  178

Query  424  QLTKNLACEWGKDGIRVNTVSPSGVRTTIMK-----PEEIDPSIAKMYGEIMMRTPLKPI  260
            QLTKNLACEW KDGIR N V P+   T +++      + ID        E++ RTPL  I
Sbjct  179  QLTKNLACEWAKDGIRSNCVVPATTNTPLVEHLLRNKQYID--------EMLARTPLGRI  230

Query  259  AEANEISPLVAFLCLPAAASHITGQVILIDGGYT  158
            AEA+E+S LVAFLCLP AAS+ITGQVI +DGG T
Sbjct  231  AEAHEVSSLVAFLCLP-AASYITGQVICVDGGLT  263



>ref|XP_007163456.1| hypothetical protein PHAVU_001G235700g [Phaseolus vulgaris]
 gb|ESW35450.1| hypothetical protein PHAVU_001G235700g [Phaseolus vulgaris]
Length=273

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/253 (59%), Positives = 184/253 (73%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL GMTALV+GGTRGIG AIV +LA FGA VHTCSR Q EL + ++EWQ  GFKV+GS
Sbjct  14   RWSLSGMTALVTGGTRGIGHAIVSDLAAFGAAVHTCSRTQTELNKCLEEWQNLGFKVTGS  73

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD++S  QR+ LI  V S FNG+LNI VNN  I+  +   +Y  +E S+++  NL+S +
Sbjct  74   VCDVSSPPQRENLIQEVASTFNGRLNIYVNNVGINFRKPTIEYSTDEYSQLMAVNLDSSF  133

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL YPLLKA+G  SIVFISS+AG ++L   +VYA+SKAAINQLTKNLACEW KD IR
Sbjct  134  HLCQLAYPLLKASGKGSIVFISSVAGVVSLGTGAVYAASKAAINQLTKNLACEWAKDNIR  193

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N V P   RT++++    D    K   EI+ RTP+K IAE  E+S LV FLCLP  AS+
Sbjct  194  SNCVVPWATRTSLVEHLLKD---LKFVDEILSRTPIKRIAEPEEVSSLVTFLCLP-GASY  249

Query  196  ITGQVILIDGGYT  158
            ITGQVI +DGG T
Sbjct  250  ITGQVICVDGGLT  262



>ref|XP_010650984.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Vitis vinifera]
Length=270

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/270 (55%), Positives = 197/270 (73%), Gaps = 19/270 (7%)
 Frame = -2

Query  940  SEQCGM---NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            ++ CG    + RWSLKGMTALV+GGT+GIG AIVEELAG  A +HTCSR + EL++ +++
Sbjct  2    AQTCGFSSGDSRWSLKGMTALVTGGTKGIGHAIVEELAGLVATIHTCSRKETELDECLKD  61

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            W+AKGF VSGSVCD++SR QR++L+ TV+SVFNGKLNILVNNAAI   +   +  AEE S
Sbjct  62   WKAKGFGVSGSVCDVSSRAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFS  121

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKN  410
             I+  N ES YHL+QL +PLLKA+G  SIVFISS+AG ++L  +S Y+++K A+NQLTKN
Sbjct  122  TIMAINFESVYHLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKN  181

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYG------EIMMRTPLKPIAEAN  248
            LACEW +D IR N V+P  ++T         P + +M+       E++ R PL+ + +  
Sbjct  182  LACEWAEDNIRSNAVAPWYIKT---------PMVDQMFSNKTFLEEVINRAPLRRVGDPK  232

Query  247  EISPLVAFLCLPAAASHITGQVILIDGGYT  158
            E+S LVAFLCLP A+S+ITGQ I +DGG T
Sbjct  233  EVSSLVAFLCLP-ASSYITGQTICVDGGVT  261



>ref|XP_009343858.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=271

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 190/255 (75%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            N RWSL G  ALV+GGTRGIG A+VEELAGFGA VHTCSRN+ EL + +++W+AKGF V+
Sbjct  10   NARWSLHGGAALVTGGTRGIGYAVVEELAGFGAAVHTCSRNEAELSKCLEQWKAKGFSVT  69

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD +S  +R++L+  V S FNGKLNILVNN   +  +   +Y +EE S ++ TNLES
Sbjct  70   GSVCDTSSTTEREKLMDQVASTFNGKLNILVNNVGTNIRKPTTEYASEEYSLLMATNLES  129

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL+QL +PLLKA+G  SIVFISS+AG  ++ + S+Y +SKAAINQLTKNLACEW KD 
Sbjct  130  TYHLSQLAHPLLKASGRGSIVFISSVAGVASIASGSIYGASKAAINQLTKNLACEWAKDN  189

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V P   RT++++   +D    +   EI  RTPL+ +AE  E+S LVAFLCLP AA
Sbjct  190  IRSNAVCPWYTRTSLVE-HLLDNK--EFLEEITSRTPLERVAEPEEVSSLVAFLCLP-AA  245

Query  202  SHITGQVILIDGGYT  158
            S+ITGQVI +DGG T
Sbjct  246  SYITGQVISVDGGMT  260



>emb|CDP12722.1| unnamed protein product [Coffea canephora]
Length=265

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/257 (57%), Positives = 189/257 (74%), Gaps = 6/257 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            N  WSL G TALV+GG+RGIG AIV ELA  GA VHT SR + +L +  QEW +KGFKV+
Sbjct  8    NSAWSLSGKTALVTGGSRGIGRAIVVELAQLGATVHTFSRKEADLNECSQEWSSKGFKVT  67

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD +SREQR QLI  V+S+FNGKLNILVNN   +K++ A+++ +EE   I+ TNLES
Sbjct  68   GSVCDASSREQRTQLIEKVSSIFNGKLNILVNNVGTTKMKPAEEFTSEEYDMIMSTNLES  127

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +H +QL YPLLKATG  +IVFISS+AG +++   SVYA++K A+NQLT+NLACEW KD 
Sbjct  128  SFHFSQLAYPLLKATGIGNIVFISSIAGLVSVEGASVYAATKGAMNQLTRNLACEWAKDN  187

Query  382  IRVNTVSPSGVRTTIMKP-EEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
            IRVN ++P  ++T + +  ++ D  + K+      RTP+    E  E+S LVAFLCLP A
Sbjct  188  IRVNCLAPGAIKTPLTESVQDYDEKLKKLDA----RTPMNRAGEPEEVSSLVAFLCLP-A  242

Query  205  ASHITGQVILIDGGYTA  155
            AS+ITGQVI +DGG TA
Sbjct  243  ASYITGQVIAVDGGLTA  259



>gb|KDO69163.1| hypothetical protein CISIN_1g024125mg [Citrus sinensis]
Length=272

 Score =   297 bits (761),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/259 (58%), Positives = 191/259 (74%), Gaps = 14/259 (5%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSLKGMTALV+GGTRGIG A VEELAG GA VHTCSRN+ EL + ++EWQ+KGF VSGS
Sbjct  12   RWSLKGMTALVTGGTRGIGQATVEELAGLGAVVHTCSRNEVELNKCLKEWQSKGFVVSGS  71

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD AS +QR++LI  V S FNGKLNILVNN   +  +   +Y AEE S+I+ TN ES Y
Sbjct  72   VCDAASPDQREKLIQEVGSKFNGKLNILVNNVGTNIRKPTIEYSAEEYSKIMTTNFESTY  131

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL YPLLKA+G  SIVFISS+ G   + + S+Y ++KAA+NQLT+NLACEW KD IR
Sbjct  132  HLCQLVYPLLKASGVGSIVFISSVGGLSHVGSGSIYGATKAAMNQLTRNLACEWAKDNIR  191

Query  376  VNTVSPSGVRTTIMK-----PEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLP  212
             N+V+P   +T++++      E +D  IA        RTPL+ + E  E++ LVA+LCLP
Sbjct  192  TNSVAPWYTKTSLVERLLENKEFVDKVIA--------RTPLQRVGEPEEVASLVAYLCLP  243

Query  211  AAASHITGQVILIDGGYTA  155
             AAS+ITGQ+I +DGG+TA
Sbjct  244  -AASYITGQIISVDGGFTA  261



>ref|XP_006435623.1| hypothetical protein CICLE_v10032389mg [Citrus clementina]
 ref|XP_006486406.1| PREDICTED: tropinone reductase homolog At1g07440-like [Citrus 
sinensis]
 gb|ESR48863.1| hypothetical protein CICLE_v10032389mg [Citrus clementina]
Length=272

 Score =   297 bits (760),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/259 (58%), Positives = 191/259 (74%), Gaps = 14/259 (5%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSLKGMTALV+GGTRGIG A VEELAG GA VHTCSRN+ EL + ++EWQ+KGF VSGS
Sbjct  12   RWSLKGMTALVTGGTRGIGQATVEELAGLGAVVHTCSRNEVELNKCLKEWQSKGFVVSGS  71

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD AS +QR++LI  V S FNGKLNILVNN   +  +   +Y AEE S+I+ TN ES Y
Sbjct  72   VCDAASPDQREKLIQEVGSKFNGKLNILVNNVGTNIRKPTIEYSAEEYSKIMTTNFESTY  131

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL YPLLKA+G  SIVFISS+ G   + + S+Y ++KAA+NQLT+NLACEW KD IR
Sbjct  132  HLCQLVYPLLKASGVGSIVFISSVGGLSHIGSGSIYGATKAAMNQLTRNLACEWAKDNIR  191

Query  376  VNTVSPSGVRTTIMK-----PEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLP  212
             N+V+P   +T++++      E +D  IA        RTPL+ + E  E++ LVA+LCLP
Sbjct  192  TNSVAPWYTKTSLVEHLLENKEFVDKVIA--------RTPLQRVGEPEEVASLVAYLCLP  243

Query  211  AAASHITGQVILIDGGYTA  155
             AAS+ITGQ+I +DGG+TA
Sbjct  244  -AASYITGQIISVDGGFTA  261



>ref|XP_003538424.1| PREDICTED: tropinone reductase homolog At1g07440-like [Glycine 
max]
Length=272

 Score =   297 bits (760),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/263 (58%), Positives = 190/263 (72%), Gaps = 11/263 (4%)
 Frame = -2

Query  952  TYMASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQ  773
            TY AS       RWSL GMTALV+GGTRGIG AIVE+L GFGA VHTCSRNQ EL++ + 
Sbjct  8    TYRAS-------RWSLNGMTALVTGGTRGIGHAIVEDLCGFGATVHTCSRNQAELDKCLT  60

Query  772  EWQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEEL  593
            EW++KGF VSGSVCD++S+  R++ I  VTS+FNGKLNI VNN  ++  +   +Y AE  
Sbjct  61   EWRSKGFLVSGSVCDVSSQPHREKFIQEVTSIFNGKLNIYVNNVGVNYRKPTIEYTAEVY  120

Query  592  SRIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTK  413
            S+I+  NL+S YHL QL YPLLKA+G  SIVFISS+AG ++L   SVYA+ KAA NQLTK
Sbjct  121  SQIMAVNLDSAYHLCQLAYPLLKASGMGSIVFISSIAGVVSLGTGSVYAACKAATNQLTK  180

Query  412  NLACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPL  233
             LACEW KD IR N V P+   T +++    +    K   E++ RTPL  IAE  E+S L
Sbjct  181  YLACEWAKDNIRSNCVVPATTNTPLVEHLLRNK---KYVEEMLSRTPLGRIAEPEEVSAL  237

Query  232  VAFLCLPAAASHITGQVILIDGG  164
            VA+LCLP AAS+ITGQV+L+DGG
Sbjct  238  VAYLCLP-AASYITGQVVLVDGG  259



>emb|CAN63543.1| hypothetical protein VITISV_035429 [Vitis vinifera]
Length=270

 Score =   296 bits (758),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 199/266 (75%), Gaps = 11/266 (4%)
 Frame = -2

Query  940  SEQCGM---NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            ++ CG    + RWSLKGMTALV+GGT+GIG AIVEELAG GA +HTCSR + EL + +++
Sbjct  2    AQTCGXSSGDSRWSLKGMTALVTGGTKGIGHAIVEELAGLGAAIHTCSRKETELNECLKD  61

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            W+AKGF VSGSVCD++SR QR++L+ TV+SVFNGKLNILVNNAAI   +   +  AEE S
Sbjct  62   WKAKGFGVSGSVCDVSSRAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFS  121

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKN  410
             I+  N ES YHL+QL +PLLKA+G  SIVFISS+AG ++L  +S Y+++K A+NQLTKN
Sbjct  122  TIMAINFESVYHLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKN  181

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIA-KMYGE-IMMRTPLKPIAEANEISP  236
            LACEW +D IR N V+P  ++T +     +D  ++ K + E ++ R PL+ + +  E+S 
Sbjct  182  LACEWAEDNIRSNAVAPWYIKTPM-----VDQMLSNKTFLEXVINRAPLRRVGDPKEVSS  236

Query  235  LVAFLCLPAAASHITGQVILIDGGYT  158
            LVAFLCLP A+S+ITGQ I +DGG T
Sbjct  237  LVAFLCLP-ASSYITGQTICVDGGVT  261



>ref|XP_010542622.1| PREDICTED: tropinone reductase homolog At1g07440-like [Tarenaya 
hassleriana]
Length=271

 Score =   296 bits (758),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 195/262 (74%), Gaps = 5/262 (2%)
 Frame = -2

Query  940  SEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQA  761
            +E+   ++RWSL+GMTALV+GGT+GIG AIVEELAGFGA VHTC+RNQ  L+Q ++EWQ 
Sbjct  4    TEKICRDRRWSLRGMTALVTGGTQGIGYAIVEELAGFGARVHTCARNQSLLDQCLREWQT  63

Query  760  KGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRII  581
            KGF+V+GSVCD++SR +R++L+ TV+S F+GKLNIL+NN   S ++   +Y AE+ S  I
Sbjct  64   KGFQVTGSVCDVSSRPEREKLMQTVSSAFDGKLNILINNVGTSIVKPTTEYTAEDFSFHI  123

Query  580  QTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLAC  401
             TNLES YHL+QL +PL+KATG  +IVFISS+AG ++    S+Y ++K AINQL +NLAC
Sbjct  124  TTNLESAYHLSQLAHPLVKATGFGNIVFISSIAGIVSTSVGSIYNATKGAINQLARNLAC  183

Query  400  EWGKDGIRVNTVSPSGVRTTIMKPEEI-DPSIAKMYGEIMMRTPLKPIAEANEISPLVAF  224
            EW  D IRVN+V+P  + T + +   + D +  K    ++ R PL  + E  E+S LVAF
Sbjct  184  EWASDDIRVNSVAPGFIATPMAETAVLGDDNFLK---AVISRKPLARVGEPREVSSLVAF  240

Query  223  LCLPAAASHITGQVILIDGGYT  158
            LCLP AAS+ITGQ I +DGG T
Sbjct  241  LCLP-AASYITGQTICVDGGLT  261



>ref|XP_003552193.1| PREDICTED: tropinone reductase homolog isoform 1 [Glycine max]
Length=264

 Score =   296 bits (757),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 149/259 (58%), Positives = 191/259 (74%), Gaps = 9/259 (3%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSL GMTALV+GGTRGIG AIVEELA FGA VH C+RNQ ++++ ++EW++KG  V+
Sbjct  10   DKRWSLHGMTALVTGGTRGIGHAIVEELAEFGATVHICARNQDDIDKCLEEWKSKGLNVT  69

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL   +QR++L+  V S+F+GKLNILVNNAA +  +K  DY AE++S I+ TN ES
Sbjct  70   GSVCDLLCSDQRKRLMEIVGSIFHGKLNILVNNAATNITKKITDYTAEDISAIMGTNFES  129

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL Q+ +PLLK +GN SIVFISS+AG  ALP  SVYA+SK A+NQ TKNLA EW KD 
Sbjct  130  VYHLCQVAHPLLKDSGNGSIVFISSVAGLKALPVFSVYAASKGAMNQFTKNLALEWAKDN  189

Query  382  IRVNTVSPSGVRT----TIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCL  215
            IR N V+P  V+T     I+   E + SI      ++ +T +  + E  EIS LVAFLCL
Sbjct  190  IRANAVAPGPVKTKLLECIVNSSEGNESI----NGVVSQTFVGRMGETKEISALVAFLCL  245

Query  214  PAAASHITGQVILIDGGYT  158
            P AAS+ITGQVI +DGG+T
Sbjct  246  P-AASYITGQVICVDGGFT  263



>ref|XP_004235263.1| PREDICTED: tropinone reductase homolog [Solanum lycopersicum]
Length=268

 Score =   296 bits (758),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 194/263 (74%), Gaps = 4/263 (2%)
 Frame = -2

Query  946  MASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEW  767
            M++ +   + RWSL G TALV+GGTRGIG A+VEELA  GA V+TCSRN+ EL +++QEW
Sbjct  1    MSTAKAAGSSRWSLSGFTALVTGGTRGIGHAVVEELAELGATVYTCSRNEAELNERLQEW  60

Query  766  QAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSR  587
              KG +V GSVCD +SREQR QL+  V++ F+GKLNIL+NN   +  +   DY AEE + 
Sbjct  61   AVKGLQVKGSVCDASSREQRIQLMENVSAAFDGKLNILINNVGTNIRKPTTDYTAEEYAH  120

Query  586  IIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNL  407
            +  TNLES YHL QL +PLLKA+GN S+VFISS+AG + L + S+Y ++K AINQLT+NL
Sbjct  121  LFSTNLESAYHLCQLAHPLLKASGNGSVVFISSVAGLVHLSSGSIYGATKGAINQLTRNL  180

Query  406  ACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVA  227
            ACEW KD IRVN V+P  ++T+++  E +  +   + G ++ RTPL+   E+ E+S LVA
Sbjct  181  ACEWAKDNIRVNGVAPWYIKTSLV--EHLLENKTFLDG-VISRTPLRRPGESQEVSSLVA  237

Query  226  FLCLPAAASHITGQVILIDGGYT  158
            +LCLP  AS+ITGQVI +DGG+T
Sbjct  238  YLCLP-GASYITGQVIAVDGGFT  259



>ref|XP_007009277.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY18087.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=273

 Score =   296 bits (758),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 191/256 (75%), Gaps = 4/256 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL GMTALV+GGTRGIG AIVEELAG GA V+TCSRN+ EL + ++EW+ KGF VSGS
Sbjct  14   RWSLNGMTALVTGGTRGIGHAIVEELAGLGAAVYTCSRNEAELNKCLKEWEGKGFLVSGS  73

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD +S++QRQ+L+  V S+FNG+LNILVNN   +  +   +Y AEE S++I TN ES Y
Sbjct  74   VCDASSKDQRQKLVENVASLFNGRLNILVNNVGTNIRKPTIEYSAEEYSKLITTNFESSY  133

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL +PLLKA+   SIVFISS+AG + + + S+Y  +KAAINQLTKNLACEW KD IR
Sbjct  134  HLCQLAHPLLKASQVGSIVFISSVAGVMHIGSGSIYGPTKAAINQLTKNLACEWAKDNIR  193

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N V+P  +RT+++   E      ++  +I+ RTPL+ + E  E+S +VAFLCLP A+S+
Sbjct  194  TNCVAPWYIRTSLV---EHLLEKKELLEKIITRTPLQRVGEPEEVSSIVAFLCLP-ASSY  249

Query  196  ITGQVILIDGGYTAGA  149
            ITGQVI +DGG T  A
Sbjct  250  ITGQVISVDGGLTVNA  265



>ref|XP_010033099.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
Length=279

 Score =   296 bits (758),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 189/254 (74%), Gaps = 4/254 (2%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
             RW L GMT LV+GGT+GIG AIVEELA  GA VHTCSRN+ E+ + +++W++KGF+VSG
Sbjct  21   NRWLLHGMTTLVTGGTKGIGHAIVEELARLGATVHTCSRNEAEINECLKDWKSKGFRVSG  80

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            S CD++SR +R++L+ TV+SVF+GKLNIL+NN   + L+   DY AE+ S I+ TN ES 
Sbjct  81   STCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFIMTTNFESA  140

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+QL +PLLKA+G  SIVF+SS+ G +++   S+Y+++K A+NQLTKNLACEW KD I
Sbjct  141  YHLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLACEWAKDNI  200

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            R N+V+P  + T   +P   D    K + E++ RTPL    E  E+S LVAFLCLP AAS
Sbjct  201  RSNSVAPWFILTPQTEPVLSDK---KFHEEVIARTPLGRTGEPEEVSSLVAFLCLP-AAS  256

Query  199  HITGQVILIDGGYT  158
            +ITGQ I +DGG+T
Sbjct  257  YITGQTICVDGGFT  270



>gb|KHN17893.1| Tropinone reductase like [Glycine soja]
Length=272

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/263 (58%), Positives = 190/263 (72%), Gaps = 11/263 (4%)
 Frame = -2

Query  952  TYMASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQ  773
            TY AS       RWSL GMTALV+GGTRGIG AIVE+L GFGA VHTCSRNQ EL++ + 
Sbjct  8    TYRAS-------RWSLNGMTALVTGGTRGIGHAIVEDLCGFGATVHTCSRNQAELDKCLT  60

Query  772  EWQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEEL  593
            EW++KGF VSGSVCD++S+  R++ I  VTS+FNGKLNI VNN  ++  +   +Y AE  
Sbjct  61   EWRSKGFLVSGSVCDVSSQPHREKFIQEVTSIFNGKLNIYVNNVGVNYRKPTIEYTAEVY  120

Query  592  SRIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTK  413
            S+I+  NL+S YHL QL YPLLKA+G  SIVFISS+AG ++L   SVYA+ KAA NQLTK
Sbjct  121  SQIMAVNLDSAYHLCQLAYPLLKASGMGSIVFISSIAGVVSLGTGSVYAACKAATNQLTK  180

Query  412  NLACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPL  233
             LACEW KD IR N V P+   T +++    +    K   E++ RTPL  IA+  E+S L
Sbjct  181  YLACEWAKDNIRSNCVVPATTNTPLVEHLLRNK---KYVEEMLSRTPLGRIAKPEEVSAL  237

Query  232  VAFLCLPAAASHITGQVILIDGG  164
            VA+LCLP AAS+ITGQV+L+DGG
Sbjct  238  VAYLCLP-AASYITGQVVLVDGG  259



>gb|KHN04080.1| Tropinone reductase like [Glycine soja]
Length=264

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/259 (58%), Positives = 190/259 (73%), Gaps = 9/259 (3%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSL GMTALV+GGTRGIG AIVEELA FGA VH C+RNQ ++++ ++EW+ KG  V+
Sbjct  10   DKRWSLHGMTALVTGGTRGIGHAIVEELAEFGATVHICARNQDDIDKCLEEWKNKGLNVT  69

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL   +QR++L+  V S+F+GKLNILVNNAA +  +K  DY AE++S I+ TN ES
Sbjct  70   GSVCDLLCSDQRKRLMEIVGSIFHGKLNILVNNAATNITKKITDYTAEDISAIMGTNFES  129

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL Q+ +PLLK +GN SIVFISS+AG  ALP  SVYA+SK A+NQ TKNLA EW KD 
Sbjct  130  VYHLCQVAHPLLKDSGNGSIVFISSVAGLKALPVFSVYAASKGAMNQFTKNLALEWAKDN  189

Query  382  IRVNTVSPSGVRT----TIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCL  215
            IR N V+P  V+T     I+   E + SI      ++ +T +  + E  EIS LVAFLCL
Sbjct  190  IRANAVAPGPVKTKLLECIVNSSEGNESI----NGVVSQTFVGRMGETKEISALVAFLCL  245

Query  214  PAAASHITGQVILIDGGYT  158
            P AAS+ITGQVI +DGG+T
Sbjct  246  P-AASYITGQVICVDGGFT  263



>gb|AFK45411.1| unknown [Lotus japonicus]
Length=271

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 190/251 (76%), Gaps = 4/251 (2%)
 Frame = -2

Query  907  LKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGSVCD  728
            LKG TALV+GGTRGIG A+VEELA FGA V+TCSRN+ EL   ++EWQ KGF VSGSVCD
Sbjct  15   LKGTTALVTGGTRGIGHAVVEELAEFGATVYTCSRNEVELNACLKEWQEKGFSVSGSVCD  74

Query  727  LASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPYHLA  548
             +S  QR++L   V S FNGKLNILVNN   +  +   +Y AEE S+++ TNL+S +HL+
Sbjct  75   ASSPPQREKLFELVASAFNGKLNILVNNVGTNIRKPTIEYTAEEYSKLMSTNLDSAHHLS  134

Query  547  QLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIRVNT  368
            QL YPLLKA+GN SIVFISS+A    + + +VYA+SKAAINQLTK LACEW KD IR N+
Sbjct  135  QLAYPLLKASGNGSIVFISSVAALAHVGSGAVYAASKAAINQLTKYLACEWAKDNIRSNS  194

Query  367  VSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASHITG  188
            V+P   +T++++P     S  ++  EI+ RTP+K +AE +E+S LV FLCLP AAS+ITG
Sbjct  195  VAPWYTKTSLVEPV---LSNKELVNEILSRTPIKGMAETHEVSSLVTFLCLP-AASYITG  250

Query  187  QVILIDGGYTA  155
            QVI +DGG+TA
Sbjct  251  QVIFVDGGFTA  261



>ref|XP_010920509.1| PREDICTED: tropinone reductase homolog [Elaeis guineensis]
Length=272

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 193/257 (75%), Gaps = 12/257 (5%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL+GMTALV+GGTRGIG A+VEELAGFGA VHTCSR + EL + +++W+A+G +V+GS
Sbjct  15   RWSLQGMTALVTGGTRGIGHAVVEELAGFGATVHTCSRKEGELSECLKKWEAQGLRVTGS  74

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD++  ++R+ L+  V+S+F+GKLNIL+NNA  +  +KA +Y AEE S I+ TNLES +
Sbjct  75   VCDVSIPDRREDLMREVSSLFDGKLNILINNAGTNIRKKAVEYTAEEYSSIMATNLESAF  134

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL +P LKA G  SIVFISS+AG +A+P+ ++YA++K AINQLTKN ACEW KD IR
Sbjct  135  HLCQLAHPFLKAAGRGSIVFISSVAGVVAVPSGTIYAATKGAINQLTKNFACEWAKDNIR  194

Query  376  VNTVSPSGVRTT----IMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
             N V+P  +RT+    ++K EE           ++ RTPL  + E  E+S LVAFLCLP 
Sbjct  195  TNCVAPWYIRTSLVENVIKQEE-------FMERLVDRTPLGRVGEPEEVSSLVAFLCLP-  246

Query  208  AASHITGQVILIDGGYT  158
            AAS+I+GQVI +DGG +
Sbjct  247  AASYISGQVICVDGGMS  263



>ref|XP_010650983.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Vitis vinifera]
Length=270

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 199/266 (75%), Gaps = 11/266 (4%)
 Frame = -2

Query  940  SEQCGM---NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            ++ CG    + RWSLKGMTALV+GGT+GIG AIVEELAG  A +HTCSR + EL++ +++
Sbjct  2    AQTCGFSSGDSRWSLKGMTALVTGGTKGIGHAIVEELAGLVATIHTCSRKETELDECLKD  61

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            W+AKGF VSGSVCD++SR QR++L+ TV+SVFNGKLNILVNNAAI   +   +  AEE S
Sbjct  62   WKAKGFGVSGSVCDVSSRAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFS  121

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKN  410
             I+  N ES YHL+QL +PLLKA+G  SIVFISS+AG ++L  +S Y+++K A+NQLTKN
Sbjct  122  TIMAINFESVYHLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKN  181

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIA-KMYGE-IMMRTPLKPIAEANEISP  236
            LACEW +D IR N V+P  ++T +     +D  ++ K + E ++ R PL+ + +  E+S 
Sbjct  182  LACEWAEDNIRSNAVAPWYIKTPM-----VDQMLSNKTFLEGVINRAPLRRVGDPKEVSS  236

Query  235  LVAFLCLPAAASHITGQVILIDGGYT  158
            LVAFLCLP A+S+ITGQ I +DGG T
Sbjct  237  LVAFLCLP-ASSYITGQTICVDGGVT  261



>emb|CBI16073.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   294 bits (752),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/261 (56%), Positives = 191/261 (73%), Gaps = 16/261 (6%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            + RWSLKGMTALV+GGT+GIG AIVEELAG GA +HTCSR + EL + +++W+AKGF VS
Sbjct  11   DSRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVS  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD++SR QR++L+ TV+SVF GKLNILVNNAAI   +   +  AEE S I+  N ES
Sbjct  71   GSVCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFES  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL+QL +PLLKA+G  SIVFISS+AG +++  +S Y+ +K A+NQLTKNLACEW +D 
Sbjct  131  VYHLSQLAHPLLKASGAGSIVFISSVAGVVSIKYLSAYSVTKGAMNQLTKNLACEWAEDN  190

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYG------EIMMRTPLKPIAEANEISPLVAFL  221
            IR N V+P  ++T         P + +M+       E++ R PL+ + +  E+S LVAFL
Sbjct  191  IRSNAVAPWYIKT---------PMVDQMFSNKTFLEEVINRAPLRRVGDPKEVSSLVAFL  241

Query  220  CLPAAASHITGQVILIDGGYT  158
            CLP A+S+ITGQ I +DGG T
Sbjct  242  CLP-ASSYITGQTICVDGGVT  261



>gb|AFK38962.1| unknown [Medicago truncatula]
Length=269

 Score =   294 bits (752),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 188/255 (74%), Gaps = 8/255 (3%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSLKG TALV+GGTRGIG A+VEELA FGA V TCSRN++EL + + EW+ KGF V GS
Sbjct  12   RWSLKGTTALVTGGTRGIGHAVVEELAEFGATVFTCSRNEEELNKCLNEWKEKGFSVYGS  71

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD +S  QR++LI  V S FNGKLNILV+NA  +  +   +Y AE+ S+++ TNL+S Y
Sbjct  72   VCDASSPSQREELIRQVASAFNGKLNILVSNAGTNVRKPTIEYTAEDYSKVMTTNLDSAY  131

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL YPLLK +GN SIVFISS+A  I++   S+YA SKAAINQLTKNLACEW KD I 
Sbjct  132  HLCQLAYPLLKESGNGSIVFISSVASLISVGTGSIYAVSKAAINQLTKNLACEWAKDNIG  191

Query  376  VNTVSPSGVRTTIMKPEEIDPSIA--KMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
             N V+P   +T++     ++  IA  +   E++ RTP+K IAE +E+S LV FLCLP AA
Sbjct  192  SNCVAPWYTKTSL-----VEQFIANKEFVDEVLSRTPIKRIAETHEVSALVTFLCLP-AA  245

Query  202  SHITGQVILIDGGYT  158
            S+ITGQ + +DGG+T
Sbjct  246  SYITGQTVSVDGGFT  260



>ref|XP_010685684.1| PREDICTED: tropinone reductase homolog At1g07440-like [Beta vulgaris 
subsp. vulgaris]
Length=267

 Score =   294 bits (752),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 144/262 (55%), Positives = 186/262 (71%), Gaps = 4/262 (2%)
 Frame = -2

Query  943  ASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQ  764
            + + C MN+RWSL GMTALV+GGT+G+G AIVEELAG GA VHTC+RN+ ELE   + W+
Sbjct  5    SGKSCMMNKRWSLVGMTALVTGGTKGLGHAIVEELAGLGARVHTCARNETELEACKRNWE  64

Query  763  AKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRI  584
             KGF V+ SVCD+ SR QR+ L+  V+S FNGKLNILVNN      +   +  AEE + +
Sbjct  65   TKGFHVTASVCDVTSRAQRENLMEIVSSEFNGKLNILVNNVGTYVKKPTTELTAEEYATV  124

Query  583  IQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLA  404
            + TNLES YH  QL +PLLKA+G ASI+F+SS+AG +AL   SVY ++K A+NQL KNLA
Sbjct  125  MTTNLESAYHFCQLAHPLLKASGFASIIFMSSVAGVVALDVGSVYGTTKGAMNQLAKNLA  184

Query  403  CEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAF  224
            CEW KD IR N+V+P  +RT +    E+  S  +   ++  RTPL    E  E+S LVAF
Sbjct  185  CEWAKDNIRTNSVAPWYIRTPLT---EVVLSDKEYLAKVKERTPLGRTGEVEEVSSLVAF  241

Query  223  LCLPAAASHITGQVILIDGGYT  158
            LC+P AAS+ITGQ I +DGG+T
Sbjct  242  LCMP-AASYITGQTICVDGGFT  262



>ref|XP_010106547.1| Tropinone reductase-like protein [Morus notabilis]
 gb|EXC10723.1| Tropinone reductase-like protein [Morus notabilis]
Length=264

 Score =   293 bits (751),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 187/255 (73%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            NQRWSL+G TALV+GGT+GIG AIVEELAGFGA V+TCSRN+ EL +++ EW+ KGF+V 
Sbjct  12   NQRWSLEGKTALVTGGTKGIGQAIVEELAGFGATVYTCSRNEVELNERLVEWKRKGFQVY  71

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            G VCD+A    R++L++ V+ +FNGKLNIL+NN   +K      +  E+ S +++TNLES
Sbjct  72   GFVCDVAFEGDRKELVNKVSLLFNGKLNILINNVGTTKPSSTIGHTGEDFSFLMRTNLES  131

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL QL +PLLKA+G ASIVFISS+AG IA+ A + YA +KAA+NQL KNLACEW +D 
Sbjct  132  AYHLCQLCHPLLKASGAASIVFISSIAGVIAIDAGTTYAVTKAAMNQLAKNLACEWARDN  191

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V P   RT + +P   + S  K    +M RTP    AE NE+S LVAFLCLP AA
Sbjct  192  IRSNCVLPGTTRTPLAEPFLSNESYIK---AVMSRTPSGRAAEPNEVSSLVAFLCLP-AA  247

Query  202  SHITGQVILIDGGYT  158
            S+ITGQ I +DGG+T
Sbjct  248  SYITGQAICVDGGFT  262



>ref|XP_002277835.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera]
 emb|CBI31630.3| unnamed protein product [Vitis vinifera]
Length=268

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 191/254 (75%), Gaps = 8/254 (3%)
 Frame = -2

Query  913  WSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGSV  734
            WSL+G TALV+GGTRGIG A+VEELAG G+ VHTCSRN+ EL++ ++EW AKGF V+GSV
Sbjct  13   WSLRGTTALVTGGTRGIGYAVVEELAGLGSTVHTCSRNEAELDKCLREWHAKGFAVTGSV  72

Query  733  CDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPYH  554
            CD + R QR+QL+  V+S+FNGKLNIL+NN   +  +   D+ A E S I+ TNLES YH
Sbjct  73   CDGSDRAQREQLMEKVSSIFNGKLNILINNVGTNIRKPTVDFTAAEYSTIMTTNLESAYH  132

Query  553  LAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIRV  374
            L QL +PLLKA+G  SIVFISS+AG ++L   S+YA++KAA+NQLTKNL+CEW KD IR 
Sbjct  133  LCQLAHPLLKASGAGSIVFISSVAGVLSLGTGSIYAATKAAMNQLTKNLSCEWAKDNIRS  192

Query  373  NTVSPSGVRTTIMKP--EEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            N+V+P  ++T++++   ++ D      +  ++ RTPL+   E  E+S LVAFLCLP  AS
Sbjct  193  NSVAPWYIKTSLVEHLLQKQD-----FFESVISRTPLRRPGEPKEVSSLVAFLCLP-VAS  246

Query  199  HITGQVILIDGGYT  158
            +ITGQVI +DGG T
Sbjct  247  YITGQVICVDGGMT  260



>gb|KCW52641.1| hypothetical protein EUGRSUZ_J02019 [Eucalyptus grandis]
Length=279

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 195/266 (73%), Gaps = 8/266 (3%)
 Frame = -2

Query  943  ASEQCGMNQ----RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKV  776
            AS +C  +     +W L GMTALV+G T+GIG AIV+ELA  GA VHTCSRN+ E+ + +
Sbjct  9    ASRRCSSSNDNKNKWLLHGMTALVTGRTKGIGHAIVKELARLGATVHTCSRNEAEINECL  68

Query  775  QEWQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEE  596
            ++W++KGF+VSGS CD++SR +R++L+ TV+SVF+GKLNIL+NN   + L+   DY AE+
Sbjct  69   KDWKSKGFRVSGSTCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAED  128

Query  595  LSRIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLT  416
             S I+ TN ES YHL+QL +PLLKA+G  SIVF+SS+ G +++   S+Y+++K A+NQLT
Sbjct  129  FSFIMTTNFESTYHLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLT  188

Query  415  KNLACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISP  236
            KNLACEW KD IR N+V+P  + T + +P   D    K + E++ RTPL    E  E+S 
Sbjct  189  KNLACEWAKDNIRSNSVAPWFILTPLAEPVLSDE---KFHEEVIARTPLGRTGEPEEVSS  245

Query  235  LVAFLCLPAAASHITGQVILIDGGYT  158
            LVAFLCLP AAS+ITGQ I +DGG+T
Sbjct  246  LVAFLCLP-AASYITGQTICVDGGFT  270



>gb|AIN39992.1| tropinone reductase I [Datura inoxia]
Length=273

 Score =   293 bits (749),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 193/255 (76%), Gaps = 2/255 (1%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSLKG TALV+GG++GIG AIVEELAG GA V+TCSRN+KEL++ ++ W+ KG  V GS
Sbjct  16   RWSLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWRKKGLNVEGS  75

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCDL SR +R +L+ TV  VF+GKLNILVNNA +   ++AKD+  E+ + I+ TN E+ Y
Sbjct  76   VCDLLSRTERDKLMQTVAHVFDGKLNILVNNAGVVIHKEAKDFTEEDYNIIMGTNFEAAY  135

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL+Q+ YPLLKA+ N +++F+SS+AG  ALP++S+Y++SK AINQ+TKNLACEW KD IR
Sbjct  136  HLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKNLACEWAKDNIR  195

Query  376  VNTVSPSGVRTTIMKPE-EIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            VN+V+P  + T +++   + +P   +     +++TP+    +  E+S L+AFLC P AAS
Sbjct  196  VNSVAPGVILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFP-AAS  254

Query  199  HITGQVILIDGGYTA  155
            +ITGQ+I  DGG+TA
Sbjct  255  YITGQIIWADGGFTA  269



>ref|XP_010910872.1| PREDICTED: tropinone reductase homolog At1g07440-like [Elaeis 
guineensis]
Length=274

 Score =   293 bits (749),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 189/255 (74%), Gaps = 4/255 (2%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            ++WSL G TALV+GGT+GIG AIVE LAGFGA VHTCSR++ EL + ++ W+     V+G
Sbjct  21   KKWSLDGTTALVTGGTKGIGHAIVEGLAGFGATVHTCSRDEAELNKCLERWKTLNIHVTG  80

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCD++SR QR++L+  V S+F GKLNIL+NNA    ++ A D+ AEE S ++ TNLES 
Sbjct  81   SVCDVSSRAQREKLMEGVRSIFQGKLNILINNAGTGIVKPALDFTAEEYSFLMATNLESA  140

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            +HL+QL  PLLKA+G  SIVFIS++AG + +P +S+YA++K A+NQLTKNLACEW  D I
Sbjct  141  FHLSQLAQPLLKASGAGSIVFISAIAGVVGMPNLSIYAATKGALNQLTKNLACEWANDNI  200

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVN V+P  +RT +M+P   D    +     + R P++ I E  E++ LV+FLCLP AAS
Sbjct  201  RVNCVAPGPIRTPLMQPSLDDK---EATARQISRVPMRRIGEPEEVASLVSFLCLP-AAS  256

Query  199  HITGQVILIDGGYTA  155
            +ITGQVI +DGG+TA
Sbjct  257  YITGQVICVDGGWTA  271



>dbj|BAA13547.1| tropinone reductase-I [Hyoscyamus niger]
 dbj|BAA85844.1| tropinone reductase-I [Hyoscyamus niger]
Length=274

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 191/255 (75%), Gaps = 2/255 (1%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSLKG TALV+GG++GIG A+VEELAG GA V+TCSRN+KEL+Q +  W+ +G +V GS
Sbjct  17   RWSLKGTTALVTGGSKGIGYAVVEELAGLGARVYTCSRNEKELQQCLDIWRNEGLQVEGS  76

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCDL  R +R +L+ TV  +FNGKLNILVNNA +   ++AKD+  E+   ++ TN E+ Y
Sbjct  77   VCDLLLRSERDKLMQTVADLFNGKLNILVNNAGVVIHKEAKDFTKEDYDIVLGTNFEAAY  136

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL YP LKA+ N +++F+SS+AG  ALP++S+Y++SKAAINQ+TKNLACEW KD IR
Sbjct  137  HLCQLAYPFLKASQNGNVIFLSSIAGFSALPSVSLYSASKAAINQITKNLACEWAKDNIR  196

Query  376  VNTVSPSGVRTTIMKPE-EIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            VN+V+P  + T +++   + +P   +     +++TP+    + NE+S L+AFLC P AAS
Sbjct  197  VNSVAPGVILTPLIETAIKKNPHQKEEIDNFIVKTPMGRAGKPNEVSALIAFLCFP-AAS  255

Query  199  HITGQVILIDGGYTA  155
            +ITGQ+I  DGG+TA
Sbjct  256  YITGQIIWADGGFTA  270



>gb|AFP55030.1| tropinone reductase I [Atropa belladonna]
Length=272

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 192/255 (75%), Gaps = 2/255 (1%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSLKG TALV+GG++GIG AIVEELAGFGA V+TCSRN+ EL++ +  W+  G KV GS
Sbjct  15   RWSLKGTTALVTGGSKGIGYAIVEELAGFGATVYTCSRNENELQECIDNWRKNGLKVEGS  74

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCDL  R +R++L+ TV   FNGKL+ILVNNA +   ++AKD+ AE+ + ++ TN E+ Y
Sbjct  75   VCDLLLRTEREKLMQTVGDAFNGKLSILVNNAGVVIHKEAKDFTAEDYNIVMGTNFEAAY  134

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL+Q+ YPLLKA+ N +++F+SS+AG  ALP++S+Y++SKAAINQ+TKNLACEW KD IR
Sbjct  135  HLSQIAYPLLKASENGNVIFLSSIAGFSALPSVSLYSASKAAINQMTKNLACEWAKDNIR  194

Query  376  VNTVSPSGVRTTIMKPE-EIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            VN+V+P  + T +++   + +P   +     +++TP+       E+S L+AFLC P AAS
Sbjct  195  VNSVAPGVILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGNPKEVSALIAFLCFP-AAS  253

Query  199  HITGQVILIDGGYTA  155
            +ITGQ+I  DGG+TA
Sbjct  254  YITGQIIWADGGFTA  268



>ref|NP_001275290.1| tropinone reductase 1-like [Solanum tuberosum]
 emb|CAC34420.1| tropinone reductase I [Solanum tuberosum]
Length=264

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 196/258 (76%), Gaps = 2/258 (1%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            + ++WSLKG TALV+GG++GIG AIVEELA FGA V+TCSRN+ EL++ +  W+ KG KV
Sbjct  4    LREKWSLKGTTALVTGGSKGIGYAIVEELANFGARVYTCSRNENELQECLDIWRKKGLKV  63

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
             GSVCDL SR +R++L+ TV  VF+GKLNILVNNA ++  ++AKD+  E+ + I+ TN E
Sbjct  64   EGSVCDLLSRTEREKLMKTVEDVFDGKLNILVNNAGVAIHKEAKDFTKEDYNIIMGTNFE  123

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            + YHL+Q+ YPLLKA+ N +++F+SS+AG  ALP++S+Y++SK AINQ+TKNLACEW KD
Sbjct  124  AAYHLSQIAYPLLKASQNGNVIFVSSIAGFSALPSLSLYSASKGAINQMTKNLACEWAKD  183

Query  385  GIRVNTVSPSGVRTTIMKPE-EIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
             IRVN+V+P+ + T +++   + +P   +     +++TPL    +  E S ++AFLC P 
Sbjct  184  NIRVNSVAPAVILTPLVETAIKKNPQQKEEIDSFVVKTPLGRAGKPEEASAVIAFLCFP-  242

Query  208  AASHITGQVILIDGGYTA  155
            AAS+ITGQ+I  DGG+TA
Sbjct  243  AASYITGQIIWADGGFTA  260



>ref|XP_010650989.1| PREDICTED: tropinone reductase homolog At1g07440 isoform X1 [Vitis 
vinifera]
 emb|CBI16066.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   292 bits (747),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/257 (57%), Positives = 193/257 (75%), Gaps = 8/257 (3%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            + RWSLKGMTALV+GGT+GIG AIVEELAG GA +HTCSR + EL + +++W+AKGF VS
Sbjct  11   DSRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVS  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD++SR QR++L+ TV+SVF GKLNILVNNAAI   +   +  AEE S I+  N ES
Sbjct  71   GSVCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFES  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL+QL +PLLKA+G  SIVFISS+AG +++  +S YA +K A+NQLTKNLACEW +D 
Sbjct  131  VYHLSQLAHPLLKASGAGSIVFISSVAGVVSVKYLSAYAVTKGAMNQLTKNLACEWAEDN  190

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIA-KMYGE-IMMRTPLKPIAEANEISPLVAFLCLPA  209
            IR N V+P  ++T +     +D  ++ K + E ++ R PL+ + +  E+S LVAFLCLP 
Sbjct  191  IRSNAVAPWCIKTPM-----VDQMLSNKTFLEGVINRAPLRRVGDPKEVSSLVAFLCLP-  244

Query  208  AASHITGQVILIDGGYT  158
            A+S+ITGQ I +DGG T
Sbjct  245  ASSYITGQTICVDGGVT  261



>ref|NP_180494.1| tropinone reductase [Arabidopsis thaliana]
 gb|AAC95205.1| putative tropinone reductase [Arabidopsis thaliana]
 gb|AAO64799.1| At2g29330 [Arabidopsis thaliana]
 dbj|BAE99485.1| putative tropinone reductase [Arabidopsis thaliana]
 gb|AEC08235.1| tropinone reductase [Arabidopsis thaliana]
Length=260

 Score =   291 bits (746),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 187/257 (73%), Gaps = 6/257 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M++RWSL+G+TALV+GG  GIG AIVEELAGFGA++H C  ++  L Q + EW+ KGF+V
Sbjct  1    MDKRWSLQGLTALVTGGASGIGHAIVEELAGFGAKIHVCDISKTLLNQSLSEWEKKGFQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            SGSVCD ++R +R+ L+ TVT++F+GKLNILVNN    + +   +YEAE+ S +I TNLE
Sbjct  61   SGSVCDASNRLERETLMQTVTTIFDGKLNILVNNVGTIRTKPTIEYEAEDFSFLISTNLE  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            S YHL+QL++PLLKA+GN  I FISS AG ++  A S+Y  +K A+NQL +NLACEW KD
Sbjct  121  SAYHLSQLSHPLLKASGNGIITFISSAAGIVSFDAASIYGLTKGALNQLARNLACEWAKD  180

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIM-MRTPLKPIAEANEISPLVAFLCLPA  209
            GIR N V+P+ + T + KP   D      + EI+  RTPL    E  E++ LVAFLCLP 
Sbjct  181  GIRANAVAPNFITTALAKPFLEDAG----FNEILSSRTPLGRAGEPREVASLVAFLCLP-  235

Query  208  AASHITGQVILIDGGYT  158
            AAS+ITGQ I +DGG T
Sbjct  236  AASYITGQTICVDGGLT  252



>gb|AGL76989.1| tropinone reductase I [Anisodus luridus]
Length=273

 Score =   292 bits (747),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 197/266 (74%), Gaps = 4/266 (2%)
 Frame = -2

Query  949  YMASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            YM     G   RWSLKG TALV+GG++GIG A+VEELAGFGA V+TCSRN+KEL+Q ++ 
Sbjct  7    YMNGNHGG--TRWSLKGTTALVTGGSKGIGYAVVEELAGFGATVYTCSRNEKELQQCLEI  64

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            W  +G KV GSVCDL  R +R++L+  V  +FNGKLNILVNNA +   ++AKD+  E+ +
Sbjct  65   WSKEGLKVEGSVCDLLLRSEREKLMQAVGDLFNGKLNILVNNAGVVIHKEAKDFTEEDYN  124

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKN  410
             ++ TN E+ YHL+QL YPLLKA+ N +++F+SS+AG  ALP++S+Y++SKAAINQ+TKN
Sbjct  125  IVMGTNFEAAYHLSQLAYPLLKASENGNVIFLSSIAGFSALPSVSLYSASKAAINQMTKN  184

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPE-EIDPSIAKMYGEIMMRTPLKPIAEANEISPL  233
            LACEW K+ IRVN+V+P  + T +++   + +P   +     +++TP+    +  E+S L
Sbjct  185  LACEWAKENIRVNSVAPGIILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGKPKEVSAL  244

Query  232  VAFLCLPAAASHITGQVILIDGGYTA  155
            +AFLC P AAS+ITGQ+I  DGG+TA
Sbjct  245  IAFLCFP-AASYITGQIIWADGGFTA  269



>ref|XP_010650992.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Vitis vinifera]
Length=270

 Score =   292 bits (747),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 198/266 (74%), Gaps = 11/266 (4%)
 Frame = -2

Query  940  SEQCGMNQ---RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            ++ CG +    RWSLKGMTALV+GGT+GIG AIVEELAG GA +HTCSR + EL + +++
Sbjct  2    AQTCGCSSGDGRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKD  61

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            W+AKGF VSGSVCD++SR QR++L+ T++SVFNGKLNIL+NNAAI+  +   +  AEE S
Sbjct  62   WKAKGFGVSGSVCDVSSRAQREKLMQTISSVFNGKLNILINNAAITIQKPTVEVTAEEFS  121

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKN  410
             I+  N ES YHL+Q+ +PLLKA+G  SIVFISS+ G +A   IS Y+ +K A+NQLTKN
Sbjct  122  TIMAINFESVYHLSQIAHPLLKASGAGSIVFISSVCGIVAHKNISAYSVTKGAMNQLTKN  181

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIA-KMYGE-IMMRTPLKPIAEANEISP  236
            LACEW +D IR N V+P  ++T +     +D  ++ K + E ++ RTPL+ + +  E+S 
Sbjct  182  LACEWAEDNIRSNAVAPWYIKTPM-----VDQMLSNKTFLEGVINRTPLRRVGDPKEVSS  236

Query  235  LVAFLCLPAAASHITGQVILIDGGYT  158
            +VAFLCLP A+S+ITGQ I +DGG T
Sbjct  237  VVAFLCLP-ASSYITGQTICVDGGMT  261



>gb|KEH34739.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=271

 Score =   291 bits (746),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 145/252 (58%), Positives = 187/252 (74%), Gaps = 8/252 (3%)
 Frame = -2

Query  907  LKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGSVCD  728
            LKG TALV+GGTRGIG AIVEELA FGA V+TCSRNQ+EL +++ EW+ KGF V GSVCD
Sbjct  15   LKGFTALVTGGTRGIGHAIVEELAEFGATVYTCSRNQEELNKRLNEWKEKGFSVYGSVCD  74

Query  727  LASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPYHLA  548
             +S  QR++LI  V S FNGKLNI VNNA  +  +   +Y AE+ S+++ TNL+S YHL 
Sbjct  75   ASSSSQREELIQNVASSFNGKLNIFVNNAGTNVRKPTIEYTAEDYSKVMTTNLDSAYHLC  134

Query  547  QLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIRVNT  368
            QLTYPLLK +GN SIVFISS+    ++   S+YA+SKAAINQLTK+LACEW KD IR N 
Sbjct  135  QLTYPLLKESGNGSIVFISSVGSLTSVGTGSIYAASKAAINQLTKSLACEWAKDNIRSNC  194

Query  367  VSPSGVRTTIMKPEEIDPSIA--KMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASHI  194
            V+P   +T +     ++  IA  +   +++ RTP+K IAE +E+S LV FLCLP AAS+I
Sbjct  195  VAPWYTKTPL-----VEHLIANEEFVNQVLSRTPIKRIAETHEVSSLVTFLCLP-AASYI  248

Query  193  TGQVILIDGGYT  158
            TGQ++ +DGG+T
Sbjct  249  TGQIVSVDGGFT  260



>ref|XP_002282755.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera]
 emb|CBI31629.3| unnamed protein product [Vitis vinifera]
Length=268

 Score =   291 bits (746),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 188/254 (74%), Gaps = 8/254 (3%)
 Frame = -2

Query  913  WSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGSV  734
            WSL+G TALV+GGTRGIG A+VEELAG GA VHTCSRN+ EL++ ++EW AKGF V+ S+
Sbjct  13   WSLRGTTALVTGGTRGIGYAVVEELAGLGATVHTCSRNEAELDKCLREWHAKGFSVTASI  72

Query  733  CDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPYH  554
            CD + R QR++L+  V+S+FNGKLNILVNN   S  +   DY A E S I+ TNLES YH
Sbjct  73   CDGSDRAQREKLMEKVSSIFNGKLNILVNNVGTSFRKPTVDYTAAEYSTIMTTNLESAYH  132

Query  553  LAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIRV  374
            L QL +PLLKA+G  SIVF+SS+AG ++L   S+YA++KAAINQLTKN ACEW KD IR 
Sbjct  133  LCQLAHPLLKASGAGSIVFVSSVAGVVSLGTGSIYAATKAAINQLTKNFACEWAKDNIRS  192

Query  373  NTVSPSGVRTTIMKP--EEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            N+V+P  ++T++++   ++ D      +  I+ RTPL    E  E++ LVAFLCLP  AS
Sbjct  193  NSVAPWYIKTSLVEHLLQKKD-----FFEGIVSRTPLGRPGEPKEVASLVAFLCLP-VAS  246

Query  199  HITGQVILIDGGYT  158
            +ITGQVI +DGG T
Sbjct  247  YITGQVICVDGGMT  260



>ref|XP_008801625.1| PREDICTED: tropinone reductase homolog At1g07440-like [Phoenix 
dactylifera]
Length=332

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/253 (57%), Positives = 191/253 (75%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL+GMTALV+GGTRGIG A+VEELAG GA VHTCSR + EL + + +W+A+G +V+GS
Sbjct  78   RWSLQGMTALVTGGTRGIGHAVVEELAGLGATVHTCSRKEGELSECLNKWEAQGLRVTGS  137

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCDL+  +QR  L+  V+S+F+GKLNIL+NN   +  +KA +Y AEE S I+ TNLES +
Sbjct  138  VCDLSVPDQRDDLMRKVSSLFDGKLNILINNVGTNIRKKAIEYTAEEYSFIMATNLESAF  197

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL +PLLKA+G  SIVFISS+AG +A+P+ ++YA++K AINQLTKN ACEW KD IR
Sbjct  198  HLCQLAHPLLKASGRGSIVFISSVAGVVAVPSGTIYAATKGAINQLTKNFACEWAKDNIR  257

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N+V+P  +RT++++    D    + +   + RTPL  + E  E+S LVAFLCLP AAS+
Sbjct  258  TNSVAPWYIRTSLVENVIKDEEFMERF---VHRTPLGRVGEPEEVSSLVAFLCLP-AASY  313

Query  196  ITGQVILIDGGYT  158
            I GQVI+ DGG +
Sbjct  314  INGQVIIADGGMS  326



>emb|CAB88214.1| putative tropinone reductase [Solanum tuberosum]
Length=264

 Score =   291 bits (745),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 195/258 (76%), Gaps = 2/258 (1%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            + ++W LKG TALV+GG++GIG AIVEELA FGA V+TCSRN+ EL++ +  W+ KG KV
Sbjct  4    LREKWCLKGTTALVTGGSKGIGYAIVEELANFGARVYTCSRNENELQECLDIWRKKGLKV  63

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
             GSVCDL SR +R++L+ T+  VF+GKLNILVNNA ++  ++AKD+  E+ + I+ TN E
Sbjct  64   EGSVCDLLSRTEREKLMKTIEDVFDGKLNILVNNAGVAIHKEAKDFTKEDYNIIMGTNFE  123

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            + YHL+Q+ YPLLKA+ N +++F+SS+AG  ALP++S+Y++SK AINQ+TKNLACEW KD
Sbjct  124  AAYHLSQIAYPLLKASQNGNVIFVSSIAGFSALPSLSLYSASKGAINQMTKNLACEWAKD  183

Query  385  GIRVNTVSPSGVRT-TIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
             IRVN+V+P+ + T  I    + +P   +    I+++TPL    +  E+S ++AFLC P 
Sbjct  184  NIRVNSVAPAVILTPQIETAIKKNPQQKEEIDSIVVKTPLGRAGKPEEVSAVIAFLCFP-  242

Query  208  AASHITGQVILIDGGYTA  155
            AAS+ITGQ+I  DGG+TA
Sbjct  243  AASYITGQIIWADGGFTA  260



>ref|XP_010423393.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=262

 Score =   291 bits (745),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 191/260 (73%), Gaps = 14/260 (5%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            NQRW+L G TALV+GGTRGIG A+VEELA FGA+VHTCSRNQ EL   + +W++ GF VS
Sbjct  4    NQRWTLAGKTALVTGGTRGIGRAVVEELARFGAKVHTCSRNQDELNACLDDWKSNGFVVS  63

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD + ++QR QLI  V+S F+GKLNIL+NN   +  + A +Y +EE ++I+ TNLES
Sbjct  64   GSVCDASVKDQRDQLIQDVSSAFSGKLNILINNVGTNIRKPAVEYSSEEYAKIMSTNLES  123

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +HL+Q+ +PLLKA+G  +IVFISS+AG + L + S+Y ++K A+NQLT+NLACEW  D 
Sbjct  124  AFHLSQIAHPLLKASGVGNIVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDN  183

Query  382  IRVNTVSPSGVRTTIM-----KPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLC  218
            IR N V+P  ++T+++     K E +D         ++ RTPL  + E  E++ LVAFLC
Sbjct  184  IRTNCVAPWYIKTSLVESLLEKKEFVDA--------VVSRTPLGRVGEPEEVASLVAFLC  235

Query  217  LPAAASHITGQVILIDGGYT  158
            LP AAS+ITGQVI +DGG+T
Sbjct  236  LP-AASYITGQVISVDGGFT  254



>gb|KEH22972.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=266

 Score =   291 bits (745),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 188/257 (73%), Gaps = 2/257 (1%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSL GMTALV+GGTRGIG AIVEELA FGA VH C+RN++++ + ++EW+ KGF V+
Sbjct  11   DKRWSLHGMTALVTGGTRGIGYAIVEELAEFGASVHICARNEEDINKCLEEWKNKGFNVT  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD+   EQR++L+ TV+S+F GKLNILVNNAA    +K  D   E+++  + TN  S
Sbjct  71   GSVCDILFHEQRKKLMETVSSIFQGKLNILVNNAAKPTSKKIIDNTDEDINTTLGTNFVS  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL QL +PLLK +G  SIVF SS+AG  A+P +SVYA++K A+NQ TKNLA EW KD 
Sbjct  131  GYHLCQLAHPLLKQSGYGSIVFTSSVAGLKAIPVLSVYAATKGAVNQFTKNLALEWAKDN  190

Query  382  IRVNTVSPSGVRTTIMKP-EEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
            IR N V+P  V+T++++   + D    K    I+ +TP   + E  EIS LVAFLCLP A
Sbjct  191  IRANAVAPGPVKTSLLESVMDYDSEGYKAIAGIVSQTPTGRMGETKEISALVAFLCLP-A  249

Query  205  ASHITGQVILIDGGYTA  155
            ASHITGQ+I IDGGYT+
Sbjct  250  ASHITGQIIAIDGGYTS  266



>ref|XP_010650991.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Vitis vinifera]
 emb|CBI16061.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   291 bits (745),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 193/255 (76%), Gaps = 8/255 (3%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSLKGMTALV+GGT+GIG AIVEELAG GA +HTCSR + EL + +++W+AKGF VSGS
Sbjct  13   RWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSGS  72

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD++SR QR++L+ T++SVFNGKLNIL+NNAAI+  +   +  AEE S I+  N ES Y
Sbjct  73   VCDVSSRAQREKLMQTISSVFNGKLNILINNAAITIQKPTVEVTAEEFSTIMAINFESVY  132

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL+Q+ +PLLKA+G  SIVFISS+ G +A   IS Y+ +K A+NQLTKNLACEW +D IR
Sbjct  133  HLSQIAHPLLKASGAGSIVFISSVCGIVAHKNISAYSVTKGAMNQLTKNLACEWAEDNIR  192

Query  376  VNTVSPSGVRTTIMKPEEIDPSIA-KMYGE-IMMRTPLKPIAEANEISPLVAFLCLPAAA  203
             N V+P  ++T +     +D  ++ K + E ++ RTPL+ + +  E+S +VAFLCLP A+
Sbjct  193  SNAVAPWYIKTPM-----VDQMLSNKTFLEGVINRTPLRRVGDPKEVSSVVAFLCLP-AS  246

Query  202  SHITGQVILIDGGYT  158
            S+ITGQ I +DGG T
Sbjct  247  SYITGQTICVDGGMT  261



>emb|CAN69507.1| hypothetical protein VITISV_016037 [Vitis vinifera]
Length=270

 Score =   291 bits (745),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 190/255 (75%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            + RWSLKGMTALV+GGT+GIG AIVEELAG GA +HTCSR + EL + +++W+AKGF VS
Sbjct  11   DSRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVS  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD++SR QR++L+ TV+SVF GKLNILVNNAAI   +   +  AEE S I+  N ES
Sbjct  71   GSVCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFES  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL+QL +PLLKA+G  SIVFISS+AG  ++  +S Y+ +K A+NQLTKNLACEW +D 
Sbjct  131  VYHLSQLAHPLLKASGAGSIVFISSVAGVASIKYLSAYSVTKGAMNQLTKNLACEWAEDN  190

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  ++T ++     + +  +   E++ R PL+ + +  E+S LVAFLCLP A+
Sbjct  191  IRSNAVAPWYIKTPMVDQMLSNKTFLE---EVINRAPLRRVGDPKEVSSLVAFLCLP-AS  246

Query  202  SHITGQVILIDGGYT  158
            S+ITGQ I +DGG T
Sbjct  247  SYITGQTICVDGGVT  261



>emb|CDX86485.1| BnaC08g02180D [Brassica napus]
Length=262

 Score =   290 bits (743),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/257 (55%), Positives = 188/257 (73%), Gaps = 6/257 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M+ RWSL+GMT LV+GGT+GIG AIVEELAGFGA VHTC+R+Q  L++ + EW+AKG++V
Sbjct  1    MDSRWSLRGMTGLVTGGTKGIGYAIVEELAGFGARVHTCARDQTLLDECLNEWKAKGYQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            +GSVCD++SR QR +L+ TV+S+F+GKLNIL+NN      + A ++ A++ S  I TNLE
Sbjct  61   TGSVCDVSSRPQRDELMKTVSSLFSGKLNILINNVGTLTSKPATEFTAQDFSSQIATNLE  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            S YHL+QL +PLLKA+G  SIVF+SS+ G ++   +S+Y+ +K  +NQL +NLACEW  D
Sbjct  121  SAYHLSQLAHPLLKASGFGSIVFMSSVCGVVSAGTVSIYSLTKGGMNQLARNLACEWASD  180

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGE-IMMRTPLKPIAEANEISPLVAFLCLPA  209
            GIR N+V+P   RT + +    D    K Y E I  RTPL    E +E++ LV FLCLP 
Sbjct  181  GIRANSVAPWVTRTPLAQDRLDD----KKYAEAICSRTPLGRTCEPSEVASLVTFLCLP-  235

Query  208  AASHITGQVILIDGGYT  158
            AAS+ITGQ I IDGG T
Sbjct  236  AASYITGQTIFIDGGLT  252



>ref|XP_010096620.1| Tropinone reductase-like protein [Morus notabilis]
 gb|EXB65288.1| Tropinone reductase-like protein [Morus notabilis]
Length=275

 Score =   291 bits (744),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 146/253 (58%), Positives = 190/253 (75%), Gaps = 4/253 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            + RWSLKG TA+V+GGTRGIG A+VEELA FGA VHTCSRN++EL++ ++EW+ KG  VS
Sbjct  14   SSRWSLKGTTAVVTGGTRGIGRAVVEELAEFGAAVHTCSRNEEELKRCLKEWEGKGLLVS  73

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD +S+ QR++LI  V S FNGKLNI+VNN   +  +   +Y AEE + ++ TN ES
Sbjct  74   GSVCDASSKTQREKLIQEVASAFNGKLNIIVNNVGTNIRKPTLEYTAEEYTLLLSTNFES  133

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL QL +PLLKA+G  SIVFISS+AG + + + S+YA+SKAAINQLTKNLACEW KD 
Sbjct  134  TYHLCQLAHPLLKASGGGSIVFISSVAGLLNISSGSIYAASKAAINQLTKNLACEWAKDN  193

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P   RT++++   +D    +   EI+ +TPL  +AE  E+S LV +LCLP AA
Sbjct  194  IRSNCVAPWYTRTSLVE-HLLDNK--EFLEEIIDKTPLHRVAEPEEVSSLVTYLCLP-AA  249

Query  202  SHITGQVILIDGG  164
            S+ITGQVI +DGG
Sbjct  250  SYITGQVISVDGG  262



>ref|XP_010414428.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=264

 Score =   290 bits (743),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 190/255 (75%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            N RWSL GMTALV+GG++GIG A+VEEL+  GA VHTC+R++ +L+++++EWQAKGF+V+
Sbjct  4    NSRWSLGGMTALVTGGSKGIGEAVVEELSMMGASVHTCARDETQLQERLREWQAKGFQVT  63

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
             SVCD++SRE+R+ L+ TV+S+F GKLNILVNNA     +   +Y AEE S I+ TNLES
Sbjct  64   TSVCDVSSREKRETLMETVSSLFQGKLNILVNNAGTYISKPTTEYTAEEYSFIMPTNLES  123

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +HL+QL +PLLKA+G+ SIV +SS+AG + +   S+Y ++K A+NQL +NLACEW  D 
Sbjct  124  SFHLSQLAHPLLKASGSGSIVHMSSVAGVVHVNVGSIYGATKGAMNQLARNLACEWASDN  183

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V P  + T ++     D  I K   E+  RTP+  + E NE+S LVAFLCLP AA
Sbjct  184  IRTNAVCPWFITTPLVNDLLHDEEIKK---EVESRTPMGRVGETNEVSSLVAFLCLP-AA  239

Query  202  SHITGQVILIDGGYT  158
            S+ITGQVI +DGG+T
Sbjct  240  SYITGQVICVDGGFT  254



>gb|ACB71202.1| tropinone reductase I [Anisodus acutangulus]
Length=273

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/266 (52%), Positives = 197/266 (74%), Gaps = 4/266 (2%)
 Frame = -2

Query  949  YMASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            YM     G   RWSLKG TALV+GG++GIG A+VEELAGFGA V+TCSRN+KEL+Q ++ 
Sbjct  7    YMNGNHGG--TRWSLKGTTALVTGGSKGIGYAVVEELAGFGATVYTCSRNEKELQQCLEI  64

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            W  +G KV GSVCDL  R +R++L+  V  +FNGKLNILVNNA +   ++AKD+  E+ +
Sbjct  65   WSKEGLKVEGSVCDLLLRSEREKLMQAVGDLFNGKLNILVNNAGVVIHKEAKDFTEEDYN  124

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKN  410
             ++ TN E+ YHL+QL YPLLKA+ N +++F+SS+AG  ALP++S+Y++SKAAINQ+TKN
Sbjct  125  IVMGTNFEAAYHLSQLAYPLLKASENGNVIFLSSIAGFSALPSVSLYSASKAAINQMTKN  184

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPE-EIDPSIAKMYGEIMMRTPLKPIAEANEISPL  233
            LACEW K+ IRVN+V+P  + T +++   + +P   +     +++TP+    +  E+S L
Sbjct  185  LACEWAKENIRVNSVAPGIILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGKPKEVSAL  244

Query  232  VAFLCLPAAASHITGQVILIDGGYTA  155
            ++FLC P AAS+ITGQ+I  DGG+TA
Sbjct  245  ISFLCFP-AASYITGQIIWADGGFTA  269



>gb|ADE76974.1| unknown [Picea sitchensis]
Length=266

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 188/263 (71%), Gaps = 4/263 (2%)
 Frame = -2

Query  946  MASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEW  767
            M        QRWSL+GMTALV+GGT+GIG A+VEELAGFGA V+TC R +K+L   + +W
Sbjct  1    MGESSSSRKQRWSLQGMTALVTGGTKGIGRAVVEELAGFGAAVYTCGRTEKDLNDCLNQW  60

Query  766  QAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSR  587
            +  G  V GS+CDL+SR  R++LI   +S FNGKLNIL+NN   + ++ A  Y AE+ S 
Sbjct  61   KEAGLHVGGSLCDLSSRSAREELIGKASSFFNGKLNILINNVGTNIMKPAVGYTAEDFSF  120

Query  586  IIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNL  407
            I+ TN ES +HL QL++PLLKA+GN SIVF+SS+AG +AL    +YA+SK A+NQ+TKNL
Sbjct  121  IMSTNFESGFHLCQLSHPLLKASGNGSIVFMSSVAGVVALQFAPIYAASKGAMNQITKNL  180

Query  406  ACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVA  227
            A EW  D IRVN V+P   +T  +K    D   AK   +I+ RTPLK IAE +++S LVA
Sbjct  181  AFEWASDKIRVNCVAPWFTKTPFVKEILEDEETAK---KILERTPLKRIAEPHDVSSLVA  237

Query  226  FLCLPAAASHITGQVILIDGGYT  158
            FLCLP +AS+ITGQ+I +DGG T
Sbjct  238  FLCLP-SASYITGQIICVDGGMT  259



>sp|P50162.1|TRN1_DATST RecName: Full=Tropinone reductase 1; AltName: Full=Tropine dehydrogenase; 
AltName: Full=Tropinone reductase I; Short=TR-I 
[Datura stramonium]
 pdb|1AE1|A Chain A, Tropinone Reductase-I Complex With Nadp
 pdb|1AE1|B Chain B, Tropinone Reductase-I Complex With Nadp
 gb|AAA33281.1| tropinone reductase-I [Datura stramonium]
Length=273

 Score =   290 bits (743),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/261 (52%), Positives = 194/261 (74%), Gaps = 2/261 (1%)
 Frame = -2

Query  934  QCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKG  755
             C    RWSLKG TALV+GG++GIG AIVEELAG GA V+TCSRN+KEL++ ++ W+ KG
Sbjct  10   NCNNEGRWSLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKG  69

Query  754  FKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQT  575
              V GSVCDL SR +R +L+ TV  VF+GKLNILVNNA +   ++AKD+  ++ + I+ T
Sbjct  70   LNVEGSVCDLLSRTERDKLMQTVAHVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGT  129

Query  574  NLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEW  395
            N E+ YHL+Q+ YPLLKA+ N +++F+SS+AG  ALP++S+Y++SK AINQ+TK+LACEW
Sbjct  130  NFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEW  189

Query  394  GKDGIRVNTVSPSGVRTTIMKPE-EIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLC  218
             KD IRVN+V+P  + T +++   + +P   +     +++TP+    +  E+S L+AFLC
Sbjct  190  AKDNIRVNSVAPGVILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGKPQEVSALIAFLC  249

Query  217  LPAAASHITGQVILIDGGYTA  155
             P AAS+ITGQ+I  DGG+TA
Sbjct  250  FP-AASYITGQIIWADGGFTA  269



>ref|XP_009621668.1| PREDICTED: tropinone reductase homolog [Nicotiana tomentosiformis]
Length=267

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 186/255 (73%), Gaps = 2/255 (1%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            + RWSL GMTALV+GGTRGIG AIVEELA FGA + TCSRN+K+L++ +++WQ KG+KV+
Sbjct  10   DGRWSLHGMTALVTGGTRGIGHAIVEELASFGATIFTCSRNKKDLDECLEKWQKKGYKVN  69

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GS CDL S +QR QLI   T  FNG+L+ILVNNA +   ++     + + S ++ TN E+
Sbjct  70   GSTCDLFSEDQRNQLIEKATEYFNGRLDILVNNAGVCVPKETTKITSGDCSLMMGTNFEA  129

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL QL YP LK +G ASIVFISS++G +A+P +S+YA++K AINQLTKNLACEWGKD 
Sbjct  130  SYHLCQLAYPFLKVSGKASIVFISSISGIMAIPFVSLYAATKGAINQLTKNLACEWGKDN  189

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IRVN V+P  + T +      D   +K    ++ RTP+  + + NE+S LVA+LC PAAA
Sbjct  190  IRVNAVAPWIIDTALTDSVAEDFE-SKDVENLIKRTPISRMGKPNEVSSLVAYLCFPAAA  248

Query  202  SHITGQVILIDGGYT  158
             +ITGQ+I +DGG T
Sbjct  249  -YITGQIICVDGGKT  262



>ref|XP_007163457.1| hypothetical protein PHAVU_001G235800g [Phaseolus vulgaris]
 gb|ESW35451.1| hypothetical protein PHAVU_001G235800g [Phaseolus vulgaris]
Length=273

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/253 (57%), Positives = 184/253 (73%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RW LKGMTALVSGGTRGIG AIV +LA FGA VHTCSR Q EL++ +++W+++GF+V+GS
Sbjct  14   RWCLKGMTALVSGGTRGIGHAIVSDLAAFGAAVHTCSRTQTELKKCLEKWKSEGFQVTGS  73

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD+ S + R++L+  V S FNGKLNI VNN   +  +   +Y  EE S+++  NL+S +
Sbjct  74   VCDVTSPQDREKLLEEVASTFNGKLNIYVNNVGTNFRKPTIEYSGEEYSQLMTVNLDSSF  133

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL YPLLKA+G   IVF+SS+AG  ++   SVYA+SKAAINQLTKNLACEW KD IR
Sbjct  134  HLCQLAYPLLKASGKGCIVFLSSVAGVTSMGTGSVYAASKAAINQLTKNLACEWAKDNIR  193

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N V P   RT +++    + +      ++M RTPLK IAE  E+S LV FLCLP AAS+
Sbjct  194  SNCVVPWTTRTPLVEHLLQNQTFVD---DVMSRTPLKRIAEPEEVSSLVTFLCLP-AASY  249

Query  196  ITGQVILIDGGYT  158
            ITGQVI +DGG T
Sbjct  250  ITGQVICVDGGVT  262



>ref|XP_010469989.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=264

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 189/253 (75%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL GMTALV+GG++GIG A+VEEL+  GA VHTC+R++ +L+++++EWQAKGF+V+ S
Sbjct  6    RWSLGGMTALVTGGSKGIGEAVVEELSMMGARVHTCARDETQLQERLREWQAKGFQVTTS  65

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            +CD++SREQR+ L+ TV+S+F GKLNILVNNA     +   +Y AEE S I+ TNLES +
Sbjct  66   ICDVSSREQRETLMETVSSLFQGKLNILVNNAGTYISKPTTEYTAEEYSFIMATNLESSF  125

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL+QL +PLLKA+G+ SIV +SS+AG + +   S+Y ++K A+NQL +NLACEW  D IR
Sbjct  126  HLSQLAHPLLKASGSGSIVHMSSVAGVVHVNVGSIYGATKGAMNQLARNLACEWASDNIR  185

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N V P  ++T +      D  I K   E+  RTP+  + E NE+S LVAFLCLP AAS+
Sbjct  186  TNAVCPWLIKTPLANDLLNDEEIKK---EVESRTPMGRVGETNEVSSLVAFLCLP-AASY  241

Query  196  ITGQVILIDGGYT  158
            ITGQVI +DGG+T
Sbjct  242  ITGQVICVDGGFT  254



>emb|CDP00133.1| unnamed protein product [Coffea canephora]
Length=274

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/253 (56%), Positives = 186/253 (74%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL G TALV+GGTRGIG A+VEELA  GA +HTCSRN  +L +++QEW +KG KV+GS
Sbjct  12   RWSLAGKTALVTGGTRGIGFAVVEELAELGATIHTCSRNAAQLNERLQEWASKGLKVTGS  71

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD++SRE R+QL+  V+SVF+GKLNIL+NN   +  +   DY  EE SRI+ TNLES Y
Sbjct  72   VCDVSSRELREQLMQKVSSVFDGKLNILINNVGTNIRKPTTDYIPEEYSRIMATNLESAY  131

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL+QL YPLLKA+G  S VF+SS++G +   + S+Y ++K A+NQLT+NLACEW KD IR
Sbjct  132  HLSQLAYPLLKASGVGSTVFVSSISGLVHSSSGSIYGAAKGAMNQLTRNLACEWAKDNIR  191

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
            VN V+P  +RT +++    +     M   ++ RTPL+   E  E+S LVA+ CLP AAS+
Sbjct  192  VNCVAPWYIRTPLVENLLSNKEFLDM---VISRTPLQRPGEPKEVSSLVAYFCLP-AASY  247

Query  196  ITGQVILIDGGYT  158
            ITGQV+ +DGG T
Sbjct  248  ITGQVVAVDGGMT  260



>ref|XP_010650990.1| PREDICTED: tropinone reductase homolog isoform X2 [Vitis vinifera]
Length=519

 Score =   298 bits (762),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/259 (58%), Positives = 195/259 (75%), Gaps = 8/259 (3%)
 Frame = -2

Query  928  GMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFK  749
            GMN RWSLKGMTALV+GGT+GIG AIVEELAG GA +HTCSR + EL + +++W+AKGF 
Sbjct  258  GMNSRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFG  317

Query  748  VSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNL  569
            VSGSVCD++SR QR++L+ TV+SVF GKLNILVNNAAI   +   +  AEE S I+  N 
Sbjct  318  VSGSVCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINF  377

Query  568  ESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGK  389
            ES YHL+QL +PLLKA+G  SIVFISS+AG +++  +S YA +K A+NQLTKNLACEW +
Sbjct  378  ESVYHLSQLAHPLLKASGAGSIVFISSVAGVVSVKYLSAYAVTKGAMNQLTKNLACEWAE  437

Query  388  DGIRVNTVSPSGVRTTIMKPEEIDPSIA-KMYGE-IMMRTPLKPIAEANEISPLVAFLCL  215
            D IR N V+P  ++T +     +D  ++ K + E ++ R PL+ + +  E+S LVAFLCL
Sbjct  438  DNIRSNAVAPWCIKTPM-----VDQMLSNKTFLEGVINRAPLRRVGDPKEVSSLVAFLCL  492

Query  214  PAAASHITGQVILIDGGYT  158
            P A+S+ITGQ I +DGG T
Sbjct  493  P-ASSYITGQTICVDGGVT  510


 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 191/262 (73%), Gaps = 5/262 (2%)
 Frame = -2

Query  946  MASEQCGM-NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQE  770
            MA   C   + RWSLKGMTALV+GGTRGIG A+VEEL G GA +HTCSR + EL + +++
Sbjct  1    MAQTGCSNGDNRWSLKGMTALVTGGTRGIGHAVVEELTGLGARIHTCSRTETELNEYLRD  60

Query  769  WQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELS  590
            W+ KGF+V+GSVCD++SR QR++L+ TV+S FNGKLNIL+NNA   K  +  ++ AEE S
Sbjct  61   WEGKGFEVTGSVCDVSSRAQREKLMETVSSKFNGKLNILINNAGTGKPGRTVEFTAEEFS  120

Query  589  RIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKN  410
             I+  N E  YHL QL +PLLKA+G  SIV +SS+AG ++L  +S Y ++K A+NQL K+
Sbjct  121  SIMAVNFEFVYHLCQLAHPLLKASGAGSIVLMSSVAGVVSLKYLSAYGATKGALNQLAKS  180

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLV  230
            LACEW +D IR N+++P  ++T++++P     S  +   E++ RTPL  + +  E+S LV
Sbjct  181  LACEWAQDNIRANSIAPWFIKTSLVEPFLSKKSFTE---EVIRRTPLGRVGDPKEVSSLV  237

Query  229  AFLCLPAAASHITGQVILIDGG  164
            AFLCLP A+S+ITGQ I +DGG
Sbjct  238  AFLCLP-ASSYITGQTICVDGG  258



>ref|XP_002520507.1| tropinone reductase, putative [Ricinus communis]
 gb|EEF41920.1| tropinone reductase, putative [Ricinus communis]
Length=268

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 188/255 (74%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            + RWSL+GMTALV+GGT+GIG AIVEELAG GAEV+TCSRN+ +L + + +W+AKGFKV+
Sbjct  7    DSRWSLEGMTALVTGGTKGIGHAIVEELAGLGAEVYTCSRNEVQLNECIHKWKAKGFKVT  66

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD++SR  R+ L++ ++S+FN KLNIL+NN   +  +    Y AE+ S ++ TN ES
Sbjct  67   GSVCDVSSRANREDLMNRISSLFNRKLNILINNVGTNIGKPTVKYTAEDFSYLVNTNFES  126

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL+QL  PLLK +G  SIVF+SS++G +++   ++Y ++KAA+NQLTKNLACEW KD 
Sbjct  127  AYHLSQLAQPLLKGSGAGSIVFMSSVSGVLSVNVGTIYGATKAAMNQLTKNLACEWAKDN  186

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  +RT +    E D +  +    I  RTP+  + EA E+S LVAFLCLP AA
Sbjct  187  IRTNCVAPWFIRTPLT---EQDLNHERFSNSIAARTPMGRVGEAEEVSSLVAFLCLP-AA  242

Query  202  SHITGQVILIDGGYT  158
            S+ITGQ I +DGG T
Sbjct  243  SYITGQTICVDGGMT  257



>ref|NP_001237661.1| uncharacterized protein LOC100306108 [Glycine max]
 gb|ACU14130.1| unknown [Glycine max]
Length=266

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 186/261 (71%), Gaps = 14/261 (5%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSL GMTALV+GGTRGIG AI EELA FGA VH C+R Q+++++ ++EW  KG  ++
Sbjct  11   DKRWSLHGMTALVTGGTRGIGYAIAEELAEFGAAVHICARKQQDIDKCLEEWNKKGLPIT  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GS CD+ SR+QR+ L+  V S+FNGKLNIL+NNA  +  +   DY AE+++ I++TN  S
Sbjct  71   GSACDVLSRDQRENLMKNVASIFNGKLNILINNAGTTTPKNLIDYTAEDVTTIMETNFGS  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL QL +PLLKA+G  SIVFISS+AG  ALP  SVYASSK A+NQ TKN+A EW KD 
Sbjct  131  SYHLCQLAHPLLKASGYGSIVFISSIAGLKALPYSSVYASSKGAMNQFTKNIALEWAKDN  190

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGE-------IMMRTPLKPIAEANEISPLVAF  224
            IR N V+P  V+T ++       SI K   E       I+ +TP+  + +  +ISPLVAF
Sbjct  191  IRANAVAPGTVKTVLLD------SIMKAAAEADKAVEYIVSQTPVGRLGDPEDISPLVAF  244

Query  223  LCLPAAASHITGQVILIDGGY  161
            LCLP AAS+ITGQ+I  DGGY
Sbjct  245  LCLP-AASYITGQIITADGGY  264



>ref|XP_002319563.2| tropinone reductase family protein [Populus trichocarpa]
 gb|EEE95486.2| tropinone reductase family protein [Populus trichocarpa]
Length=267

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/264 (52%), Positives = 194/264 (73%), Gaps = 5/264 (2%)
 Frame = -2

Query  946  MASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEW  767
            M+ E    ++RW L+GMTALV+GGT+G+G AIVEELA  GA VHTC+RNQ ++ ++V+EW
Sbjct  1    MSLESSSRDKRWGLQGMTALVTGGTKGLGCAIVEELAALGAIVHTCARNQDQINERVREW  60

Query  766  QAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSR  587
            + KGFKV+GSVCD++S  +R++L+  V+S+F+GKLNILVNNA  +  +   DY AE+ + 
Sbjct  61   KEKGFKVTGSVCDVSSNAEREKLMKEVSSLFDGKLNILVNNAGTNIYKATLDYTAEDFTS  120

Query  586  IIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIAL-PAISVYASSKAAINQLTKN  410
            ++ TNL+S +HL+QL +PLLKA+G   IVF+SS+   +++ P   +Y++SK A+NQLT+N
Sbjct  121  LMNTNLQSAFHLSQLAHPLLKASGAGKIVFMSSIISVVSMNPQYPLYSASKGAMNQLTRN  180

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLV  230
            LACEW KD IRVN V+P  VRT +      D SIAK   E+  RTP++ + E  E+S +V
Sbjct  181  LACEWAKDNIRVNGVAPWFVRTPLTAHSLDDESIAK---EVFSRTPMRRVGEPGEVSSVV  237

Query  229  AFLCLPAAASHITGQVILIDGGYT  158
            AFLCLPA    +TGQ+I +DGG +
Sbjct  238  AFLCLPAPG-FLTGQIICVDGGMS  260



>ref|NP_180496.1| senescence-associated protein 13 [Arabidopsis thaliana]
 gb|AAC95203.1| putative tropinone reductase [Arabidopsis thaliana]
 gb|AAL38287.1| putative tropinone reductase [Arabidopsis thaliana]
 gb|AAM10204.1| putative tropinone reductase [Arabidopsis thaliana]
 gb|AAM62552.1| putative tropinone reductase [Arabidopsis thaliana]
 gb|AEC08240.1| senescence-associated protein 13 [Arabidopsis thaliana]
Length=269

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 191/257 (74%), Gaps = 5/257 (2%)
 Frame = -2

Query  928  GMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFK  749
            G N RWSL GMTALV+GG++GIG A+VEELA  GA+VHTC+R++ +L+++++EWQAKGF+
Sbjct  8    GENSRWSLGGMTALVTGGSKGIGEAVVEELAMLGAKVHTCARDETQLQERLREWQAKGFQ  67

Query  748  VSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNL  569
            V+ SVCD++SR+QR +L+ TV+S++ GKLNILVNN   S  +   +Y AE+ S ++ TNL
Sbjct  68   VTTSVCDVSSRDQRVKLMETVSSLYQGKLNILVNNVGTSIFKPTTEYTAEDFSFVMATNL  127

Query  568  ESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGK  389
            ES +HL+QL +PLLKA+G+ SIV ISS AG + +   S+Y ++K A+NQL +NLACEW  
Sbjct  128  ESAFHLSQLAHPLLKASGSGSIVLISSAAGVVHVNVGSIYGATKGAMNQLARNLACEWAS  187

Query  388  DGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
            D IR N+V P  + TT +  +  D    K   E +  TP+  + EANE+SPLVAFLCLP 
Sbjct  188  DNIRTNSVCPWYI-TTPLSNDFFDEEFKK---EAVRTTPMGRVGEANEVSPLVAFLCLP-  242

Query  208  AASHITGQVILIDGGYT  158
            +AS+ITGQ I +DGG T
Sbjct  243  SASYITGQTICVDGGAT  259



>gb|KFK43068.1| hypothetical protein AALP_AA1G074500 [Arabis alpina]
Length=260

 Score =   289 bits (739),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 185/255 (73%), Gaps = 7/255 (3%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
             RWSL+GMTALV+GGT+GIG AIVEELAGFGA VHTC ++Q  L++ + EWQAKGF+V+ 
Sbjct  4    NRWSLQGMTALVTGGTKGIGYAIVEELAGFGARVHTCDKDQTPLDECLSEWQAKGFQVTA  63

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCD++SR QR QL+ TV+S+FNGKLNIL+NN     LR   +   E+ S ++ TNLES 
Sbjct  64   SVCDVSSRPQRDQLMKTVSSLFNGKLNILINNVGKFILRPTLECTEEDFSSLMSTNLESA  123

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YH++QL +PLLKA+G  SIVFISS++G I   A S+Y  +K A+NQL +NLACEW  DGI
Sbjct  124  YHISQLAHPLLKASGCGSIVFISSVSG-IVSGASSIYGVTKGAMNQLARNLACEWASDGI  182

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMM-RTPLKPIAEANEISPLVAFLCLPAAA  203
            R N+V+P    T+++K    D    K + E M  RTPL    E  E++ LV FLCLP AA
Sbjct  183  RANSVAPWVTATSLVKKYLDD----KKFSEAMFSRTPLGRACEPREVASLVTFLCLP-AA  237

Query  202  SHITGQVILIDGGYT  158
            S+ITGQ I IDGGYT
Sbjct  238  SYITGQTICIDGGYT  252



>ref|XP_010067435.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Eucalyptus grandis]
Length=271

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 188/253 (74%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RW+L+G TALV+GGTRGIG AIVEEL GFGA VHTCS N +EL + ++EW+ KG  V+GS
Sbjct  12   RWTLRGTTALVTGGTRGIGHAIVEELGGFGATVHTCSWNGEELSKCLKEWEGKGLAVTGS  71

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD++SR+QR+ L+  V+S F G LNIL+NNA  +  +   DY  EE S+I+ TN +S Y
Sbjct  72   VCDVSSRDQRENLMKEVSSKFGGGLNILINNAGTNFRKPTVDYTVEEFSKIMATNFDSAY  131

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL Q+ +PLLKA+G  SI+FISS+AG ++L   SVYA++K AINQ+TKNLACEW KD IR
Sbjct  132  HLCQIAHPLLKASGAGSIIFISSVAGVVSLGNGSVYAAAKGAINQITKNLACEWAKDNIR  191

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N+++P  +RT++++    +    + Y  I+ RTPL+ + E  E++ L AFLCLP AAS+
Sbjct  192  SNSIAPWYIRTSLVENLLKNK---EFYDGIIARTPLQRVGEPREVASLAAFLCLP-AASY  247

Query  196  ITGQVILIDGGYT  158
            ITGQVI +DGG T
Sbjct  248  ITGQVISVDGGMT  260



>ref|XP_010650985.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X3 [Vitis vinifera]
 ref|XP_010650988.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X6 [Vitis vinifera]
Length=270

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 193/257 (75%), Gaps = 8/257 (3%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            + RWSLKGMTALV+GGT+GIG AIVEELAG GA +HTCSR + EL + +++W+AKGF VS
Sbjct  11   DSRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVS  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD++S  QR++L+ TV+SVF GKLNILVNNAAI   +   +  AEE S I+  N ES
Sbjct  71   GSVCDVSSPAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFES  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL+QL +PLLKA+G  SIVFISS+AG ++L  +S Y+++K A+NQLTKNLACEW +D 
Sbjct  131  VYHLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEWAEDN  190

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIA-KMYGE-IMMRTPLKPIAEANEISPLVAFLCLPA  209
            IR N V+P  ++T +     +D  ++ K + E ++ R PL+ + +  E+S LVAFLCLP 
Sbjct  191  IRSNAVAPWYIKTPM-----VDQMLSNKTFLEGVINRAPLRRVGDPKEVSSLVAFLCLP-  244

Query  208  AASHITGQVILIDGGYT  158
            A+S+ITGQ I +DGG T
Sbjct  245  ASSYITGQTICVDGGVT  261



>ref|XP_010414392.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=268

 Score =   289 bits (739),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/264 (53%), Positives = 191/264 (72%), Gaps = 12/264 (5%)
 Frame = -2

Query  937  EQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAK  758
            E  G N RWSL+GMTALV+GG++GIG A+VEELA FGA VHTC+R++ +L+ +++EWQAK
Sbjct  6    ESLGENSRWSLQGMTALVTGGSKGIGEAVVEELAMFGARVHTCARDETQLQDRLREWQAK  65

Query  757  GFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQ  578
            GF+V+ SVCD++SR+QR++L+ TV+S+F GKLNI V N      +   +  AE+ S I+ 
Sbjct  66   GFQVTTSVCDVSSRDQREKLMETVSSLFQGKLNIFVPNVGTGIAKPTTECTAEDFSFIMA  125

Query  577  TNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACE  398
            TNLES +HL+QL +PLLKA+G+ SIV +SS+AG + L   S+Y ++K A+NQL +NLACE
Sbjct  126  TNLESTFHLSQLAHPLLKASGSGSIVLMSSVAGVVNLEGASIYGATKGAMNQLARNLACE  185

Query  397  WGKDGIRVNTVSPSGVRTTIMKP----EEIDPSIAKMYGEIMMRTPLKPIAEANEISPLV  230
            W  D IR N+V P  + T   K     EE+   +  +       TP+K I EANE+S LV
Sbjct  186  WASDNIRSNSVCPWFITTPASKDFLGVEEVKEKVKSV-------TPMKRIGEANEVSSLV  238

Query  229  AFLCLPAAASHITGQVILIDGGYT  158
            AFLCLP AAS+ITGQ+I +DGG+T
Sbjct  239  AFLCLP-AASYITGQIICVDGGFT  261



>ref|XP_009796888.1| PREDICTED: tropinone reductase homolog [Nicotiana sylvestris]
Length=269

 Score =   289 bits (739),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 143/248 (58%), Positives = 186/248 (75%), Gaps = 4/248 (2%)
 Frame = -2

Query  901  GMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGSVCDLA  722
            G TALV+GGTRGIG A+VEELA  GA V+TCSRNQ EL +++QEW  KG +V GSVCD +
Sbjct  17   GFTALVTGGTRGIGHAVVEELAELGATVYTCSRNQAELNERLQEWAEKGLQVKGSVCDAS  76

Query  721  SREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPYHLAQL  542
            SREQR QL+  V+S F+GKLNILVNN   +  +    Y AEE +R++ TNLES YHL QL
Sbjct  77   SREQRVQLMENVSSAFDGKLNILVNNVGTNIRKPTTHYTAEEYARLLSTNLESAYHLCQL  136

Query  541  TYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIRVNTVS  362
             +PLLKA+GN S+VFISS+AG + L + SVY ++K A+NQLT+NLACEW KD IRVN V+
Sbjct  137  AHPLLKASGNGSVVFISSVAGLVHLSSGSVYGATKGALNQLTRNLACEWAKDSIRVNGVA  196

Query  361  PSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASHITGQV  182
            P  +RT+++  E +  +   + G ++ RTPL+   E+ E+S LVA+LCLP  AS+ITGQV
Sbjct  197  PWYIRTSLV--EHLLENKTFLDG-VISRTPLRRPGESQEVSSLVAYLCLP-GASYITGQV  252

Query  181  ILIDGGYT  158
            I +DGG+T
Sbjct  253  IAVDGGFT  260



>gb|KDP30781.1| hypothetical protein JCGZ_13724 [Jatropha curcas]
Length=267

 Score =   289 bits (739),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 194/256 (76%), Gaps = 5/256 (2%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            +RWSLKGMTALV+GGT+GIG AIVEELA FGA VHTCSRNQKEL+Q +Q+WQ+KGFKV+G
Sbjct  11   KRWSLKGMTALVTGGTKGIGHAIVEELAEFGAAVHTCSRNQKELDQCLQKWQSKGFKVTG  70

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCD++ R QR +LI TV+S+F+ KLNILVNNAA +  ++A    AE++S ++ TN ES 
Sbjct  71   SVCDVSIRAQRGKLIETVSSIFDRKLNILVNNAATNTFKEALKDTAEDISTVMSTNFESA  130

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YHL+QL++PLLKA+ N SIV ISS+A  IA+P  +V+A+SK A+ Q+TKNLACEW KD I
Sbjct  131  YHLSQLSHPLLKASQNGSIVNISSIATIIAVPRCAVHAASKGAMQQITKNLACEWAKDMI  190

Query  379  RVNTVSPSGVRTTIMK-PEEIDPSIAKMYGEIMMRT-PLKPIAEANEISPLVAFLCLPAA  206
            RVN + P  V T ++   ++I  S   M  E + R  PL    +  EI+ +VAFLC P A
Sbjct  191  RVNAILPGLVDTPLLDYAKKISGSSEDM--ECLTRAIPLSREGKPEEIASVVAFLCFP-A  247

Query  205  ASHITGQVILIDGGYT  158
            +S+ITGQ I++DGG T
Sbjct  248  SSYITGQNIIVDGGCT  263



>gb|KEH22973.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=265

 Score =   288 bits (738),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 189/256 (74%), Gaps = 1/256 (0%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSL GMTALV+GGTRGIG AIVEELA FGA VH C+RN++++ + ++EW+ KGF V+
Sbjct  11   DKRWSLHGMTALVTGGTRGIGYAIVEELAEFGAAVHVCARNEEDINKCLEEWKNKGFNVT  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD+   EQR++L+ TV+S+F+GKLNILVNNAA    +K  D   E+++  + TN  S
Sbjct  71   GSVCDILFHEQRKRLMETVSSIFHGKLNILVNNAAKPTSKKIIDNTDEDINTTLGTNFVS  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL QL +PLLK +G  SIVF SS+AG  A+P +SVYA++K A+NQ TKNLA EW KD 
Sbjct  131  GYHLCQLAHPLLKQSGYGSIVFTSSVAGLKAIPVLSVYAATKGAVNQFTKNLALEWAKDN  190

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  V+T++++    D    +    ++ +TP+  + E  EIS LVAFLCLP AA
Sbjct  191  IRANAVAPGPVKTSLLQSITNDNEGDEAVDGVVSQTPMGRMGEPKEISSLVAFLCLP-AA  249

Query  202  SHITGQVILIDGGYTA  155
            S+ITGQVI IDGG+T+
Sbjct  250  SYITGQVIAIDGGFTS  265



>ref|XP_009630417.1| PREDICTED: tropinone reductase 1-like [Nicotiana tomentosiformis]
Length=263

 Score =   288 bits (738),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 133/257 (52%), Positives = 192/257 (75%), Gaps = 2/257 (1%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL+G TA+V+GGTRGIG AIVEELA FGA V+TCSRNQ EL++ +++W+ KGFKV GS
Sbjct  6    RWSLQGTTAIVTGGTRGIGHAIVEELASFGANVYTCSRNQMELDECLRQWKTKGFKVEGS  65

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCDL SR QR++ + TV++ F+GK+NIL+NNA ++  +   ++  E+ + ++  N E+ Y
Sbjct  66   VCDLLSRSQREKFMDTVSNYFDGKINILINNAGVAIAKLTTEFTHEDYNTMMGINFEASY  125

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL+QL +P L+A+GN SIVFISS+AG ++LP  S+Y++SK A+NQLT++LACEW KD IR
Sbjct  126  HLSQLAHPFLQASGNGSIVFISSVAGLVSLPLCSIYSASKGAMNQLTRSLACEWAKDNIR  185

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPL-KPIAEANEISPLVAFLCLPAAAS  200
            VN V+P  +RT+++     +P   +   ++ +RTP+   + E  E+S +VAFLC P  AS
Sbjct  186  VNAVAPWIIRTSLIDVASQNPVHKENINKLTIRTPIGGRVGEPKEVSAMVAFLCFP-CAS  244

Query  199  HITGQVILIDGGYTAGA  149
            +ITGQ++ +DGG T  A
Sbjct  245  YITGQIMCVDGGITINA  261



>ref|NP_001118408.1| tropinone reductase-like protein [Arabidopsis thaliana]
 gb|AAC95208.1| putative tropinone reductase [Arabidopsis thaliana]
 gb|AAQ62410.1| At2g29290 [Arabidopsis thaliana]
 dbj|BAD42888.1| putative tropinone reductase [Arabidopsis thaliana]
 gb|AEC08229.1| tropinone reductase-like protein [Arabidopsis thaliana]
Length=262

 Score =   288 bits (737),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 192/256 (75%), Gaps = 4/256 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M++RWSL+GM ALV+GGT+GIG A+VEEL+  GA VHTC+R++ +L+++++EWQ KGF+V
Sbjct  1    MDKRWSLQGMNALVTGGTKGIGEAVVEELSILGARVHTCARDETQLQERLREWQEKGFQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            + S+CD++ REQR++L+ TV+S+F GKLNILVNN     L+   +Y AEE S ++ TNL+
Sbjct  61   TTSICDVSLREQREKLMETVSSLFQGKLNILVNNVGTLMLKPTTEYTAEEFSFLMATNLD  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            S +H++QL +PLLKA+G+ SIV +SS+AG + +   S+Y ++K A+NQL +NLACEW  D
Sbjct  121  SAFHISQLAHPLLKASGSGSIVLMSSIAGVVHVGVGSIYGATKGAMNQLARNLACEWASD  180

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
             IR N + P  + T ++       S+ +M  E   RTP+  + EANE+SPLVAFLCLP A
Sbjct  181  NIRTNAICPWLITTPLISDL---LSVEEMKKEAEERTPMGRVGEANEVSPLVAFLCLP-A  236

Query  205  ASHITGQVILIDGGYT  158
            AS+ITGQVI +DGG T
Sbjct  237  ASYITGQVICVDGGLT  252



>gb|AFK35677.1| unknown [Medicago truncatula]
Length=271

 Score =   288 bits (738),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 186/252 (74%), Gaps = 8/252 (3%)
 Frame = -2

Query  907  LKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGSVCD  728
            LKG TALV+GGTRGIG AIVEELA F A V+TCSRNQ+EL +++ EW+ KGF V GSVCD
Sbjct  15   LKGFTALVTGGTRGIGHAIVEELAEFCATVYTCSRNQEELNKRLNEWKEKGFSVYGSVCD  74

Query  727  LASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPYHLA  548
             +S  QR++LI  V S FNGKLNI VNNA  +  +   +Y AE+ S+++ TNL+S YHL 
Sbjct  75   ASSSSQREELIQNVASSFNGKLNIFVNNAGTNVRKPTIEYTAEDYSKVMTTNLDSAYHLC  134

Query  547  QLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIRVNT  368
            QLTYPLLK +GN SIVFISS+    ++   S+YA+SKAAINQLTK+LACEW KD IR N 
Sbjct  135  QLTYPLLKESGNGSIVFISSVGSLTSVGTGSIYAASKAAINQLTKSLACEWAKDNIRSNC  194

Query  367  VSPSGVRTTIMKPEEIDPSIA--KMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASHI  194
            V+P   +T +     ++  IA  +   +++ RTP+K IAE +E+S LV FLCLP AAS+I
Sbjct  195  VAPWYTKTPL-----VEHLIANEEFVNQVLSRTPIKRIAETHEVSSLVTFLCLP-AASYI  248

Query  193  TGQVILIDGGYT  158
            TGQ++ +DGG+T
Sbjct  249  TGQIVSVDGGFT  260



>gb|KHN17894.1| Tropinone reductase like [Glycine soja]
Length=254

 Score =   288 bits (736),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 146/247 (59%), Positives = 181/247 (73%), Gaps = 4/247 (2%)
 Frame = -2

Query  898  MTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGSVCDLAS  719
            MTALV+GGTRGIG AIV +LA FGA VHTCSRNQ EL + +QEWQ++GF+V+GSVCD++S
Sbjct  1    MTALVTGGTRGIGHAIVNDLAAFGAAVHTCSRNQTELNKCLQEWQSQGFEVTGSVCDVSS  60

Query  718  REQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPYHLAQLT  539
              QR++LI    S FNGKLNI VNN  ++  +   +Y AEE S ++  NL S +HL QL 
Sbjct  61   PPQREKLIQEAASTFNGKLNIYVNNVGVNYRKPTIEYSAEEYSEMMTVNLNSAFHLCQLA  120

Query  538  YPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIRVNTVSP  359
            YPLLKA+G  SIVF+SS+AG  ++   SVYA+SKAAINQLTKNLACEW KD IR N V P
Sbjct  121  YPLLKASGKGSIVFLSSVAGVTSMGTGSVYAASKAAINQLTKNLACEWAKDNIRSNCVVP  180

Query  358  SGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASHITGQVI  179
               RT +++    + +  +   ++M RTPLK IAE  E+S LVAFLCLP AAS+ITGQVI
Sbjct  181  WTTRTPLIEHLLQNQTFVE---DVMSRTPLKRIAEPEEVSSLVAFLCLP-AASYITGQVI  236

Query  178  LIDGGYT  158
              DGG T
Sbjct  237  CADGGVT  243



>ref|XP_011023548.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Populus euphratica]
Length=267

 Score =   288 bits (737),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 195/264 (74%), Gaps = 5/264 (2%)
 Frame = -2

Query  946  MASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEW  767
            M+ E    ++RW L+GM+ALV+GGT+G+G AIVEELA  GA VHTC+RNQ +L ++V+EW
Sbjct  1    MSLESSSRDKRWGLQGMSALVTGGTKGLGCAIVEELAALGAIVHTCARNQDQLNERVREW  60

Query  766  QAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSR  587
            + KGFKV+GSVCD++S  +R++L+  V+S+F+GKLNILVNNA  +  +   DY AE+ + 
Sbjct  61   KEKGFKVTGSVCDVSSNAEREKLMKEVSSLFDGKLNILVNNAGTNIYKATLDYTAEDFTS  120

Query  586  IIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAI-SVYASSKAAINQLTKN  410
            ++ TNL+S +HL+QL +PLLKA+    IVF+SS+A  +++  + ++Y++SK A+NQLT+N
Sbjct  121  LMNTNLQSAFHLSQLAHPLLKASRAGKIVFMSSIASVVSINTLYALYSASKGAMNQLTRN  180

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLV  230
            LACEW KD IRVN V+P  +RT +  P   D +I K   E+  RTP++ + E  E+S +V
Sbjct  181  LACEWAKDNIRVNAVAPWFIRTPLTTPSLDDENILK---EVFNRTPMRRVGEPGEVSSVV  237

Query  229  AFLCLPAAASHITGQVILIDGGYT  158
            AFLCLPA    +TGQVI IDGG +
Sbjct  238  AFLCLPAPG-FLTGQVICIDGGMS  260



>gb|ABK94587.1| unknown [Populus trichocarpa]
Length=267

 Score =   288 bits (737),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 137/264 (52%), Positives = 193/264 (73%), Gaps = 5/264 (2%)
 Frame = -2

Query  946  MASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEW  767
            M+ E    ++RW L+GMTALV+GGT+G+G AIVEELA  GA VHTC+RNQ ++ ++V+EW
Sbjct  1    MSLESSSRDKRWGLQGMTALVTGGTKGLGYAIVEELAALGAIVHTCARNQDQINERVREW  60

Query  766  QAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSR  587
            + KGFKV+GSVCD++S  +R++L+  V+S+F+GKLNILVNNA  +  +   DY AE+ + 
Sbjct  61   KEKGFKVTGSVCDVSSNAEREKLMKEVSSLFDGKLNILVNNAGTNIYKATLDYTAEDFTS  120

Query  586  IIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIAL-PAISVYASSKAAINQLTKN  410
            ++ TNL+S +HL+QL +PLLKA+G   IVF+SS+   +++ P   +Y++SK A+NQLT+N
Sbjct  121  LMNTNLQSAFHLSQLAHPLLKASGAGKIVFMSSIISVVSMNPQYPLYSASKGAMNQLTRN  180

Query  409  LACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLV  230
            LACEW KD IRVN V+P  +RT +      D SI K   E+  RTP++ + E  E+S +V
Sbjct  181  LACEWAKDNIRVNAVAPWFIRTPLTAHSLDDESIVK---EVFNRTPMRRVGEPGEVSSVV  237

Query  229  AFLCLPAAASHITGQVILIDGGYT  158
            AFLCLPA    +TGQVI IDGG +
Sbjct  238  AFLCLPAPG-FLTGQVICIDGGMS  260



>ref|XP_006288477.1| hypothetical protein CARUB_v10001737mg [Capsella rubella]
 gb|EOA21375.1| hypothetical protein CARUB_v10001737mg [Capsella rubella]
Length=263

 Score =   288 bits (737),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 192/260 (74%), Gaps = 14/260 (5%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            NQRW+L G TALV+GGTRGIG A+VEELA FGA+VHTCSRNQ+EL   + +W++ GF V+
Sbjct  5    NQRWTLAGKTALVTGGTRGIGRAVVEELARFGAKVHTCSRNQEELNACLNDWKSNGFVVT  64

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD + R+QR +LI  V+S F+GKLNIL+NN   +  + A DY +EE ++I+ TNLES
Sbjct  65   GSVCDASVRDQRDKLIQDVSSAFSGKLNILINNVGTNIRKPAIDYSSEEYAKIMSTNLES  124

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +H++Q+ +PLLKA+G  +IVFISS+AG + L + ++Y ++K A+NQLT+NLACEW  D 
Sbjct  125  AFHISQIAHPLLKASGVGNIVFISSVAGLVHLSSGAIYGATKGALNQLTRNLACEWASDN  184

Query  382  IRVNTVSPSGVRTTIM-----KPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLC  218
            IR N V+P  ++T+++     K E ++         I+ RTPL  + E  E++ LVAFLC
Sbjct  185  IRTNCVAPWYIKTSLVESLLEKKEFVEA--------IVSRTPLGRVGEPEEVASLVAFLC  236

Query  217  LPAAASHITGQVILIDGGYT  158
            LP AAS+ITGQVI +DGG+T
Sbjct  237  LP-AASYITGQVISVDGGFT  255



>ref|XP_007140493.1| hypothetical protein PHAVU_008G117200g [Phaseolus vulgaris]
 gb|ESW12487.1| hypothetical protein PHAVU_008G117200g [Phaseolus vulgaris]
Length=265

 Score =   288 bits (737),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 138/258 (53%), Positives = 192/258 (74%), Gaps = 5/258 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSL GMTALV+GGTRGIG AIVEELA FGA +H CSR ++++ + ++EW+ KGF V+
Sbjct  11   DKRWSLDGMTALVTGGTRGIGHAIVEELAEFGASIHVCSRKEEDINRCLEEWKKKGFNVT  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD++ R QRQ L+ TV+S+F GKLNILVNNA +   +   D+ AE++S ++ TN ES
Sbjct  71   GSVCDVSHRHQRQTLMETVSSIFQGKLNILVNNAGVDMAKGIIDHTAEDISTVMATNFES  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +HL QL +PLLK +G+ +IVFISS+AG  A+P +S Y++SK A+NQ TKN+A EW KD 
Sbjct  131  AFHLCQLAHPLLKESGSGNIVFISSIAGVQAIPLLSAYSASKGAMNQFTKNVALEWAKDN  190

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSI-AKMYGE-IMMRTPLKPIAEANEISPLVAFLCLPA  209
            IR N V+P  + T ++  + I   + +K Y + +  + P + I EANE+S LVAFLCLP 
Sbjct  191  IRANAVAPGPIWTPLL--DSIREKVGSKEYDDNVTAKIPSRRIGEANEVSSLVAFLCLP-  247

Query  208  AASHITGQVILIDGGYTA  155
            AAS+ITGQ + +DGG+T+
Sbjct  248  AASYITGQTLCVDGGFTS  265



>emb|CAQ19734.1| putative tropinone reductase I [Solanum nigrum subsp. nigrum]
Length=264

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/258 (52%), Positives = 194/258 (75%), Gaps = 2/258 (1%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            + ++WSLKG TALV+GG++GIG AIVEELA FGA V+TCSRN+ EL++ ++ W+  G KV
Sbjct  4    LREKWSLKGTTALVTGGSKGIGYAIVEELANFGARVYTCSRNENELQECLEIWRKNGLKV  63

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
             GSVCDL S  +R++L+  VT+VF+GKLNILVNNA +   + AKD+  E+ + I+  N E
Sbjct  64   EGSVCDLLSHTEREKLMKNVTNVFDGKLNILVNNAGVVIHKDAKDFTKEDYNIIMGINFE  123

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            + YHL+Q+ YPLLKA+ N +I+F+SS+AG  ALP++S+Y++SK AINQLTKNLACEW KD
Sbjct  124  AAYHLSQIAYPLLKASQNGNIIFLSSIAGFSALPSVSLYSASKGAINQLTKNLACEWAKD  183

Query  385  GIRVNTVSPSGVRTTIMKPE-EIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
             IRVN+V+P+ + T +++   + +P   +     +++TP+    +  E+S ++AFLC P 
Sbjct  184  NIRVNSVAPAVILTPLIETAIKKNPKQKEEIDSFVVKTPMGRAGKPEEVSAIIAFLCFP-  242

Query  208  AASHITGQVILIDGGYTA  155
            AAS+ITGQ+I  DGG+TA
Sbjct  243  AASYITGQIIWADGGFTA  260



>gb|ABF95188.1| Tropinone reductase, putative, expressed [Oryza sativa Japonica 
Group]
Length=271

 Score =   288 bits (737),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/261 (52%), Positives = 193/261 (74%), Gaps = 4/261 (2%)
 Frame = -2

Query  940  SEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQA  761
            S + G  +RWSL+G TALV+GGTRGIG A+VEELA  GA VHTCSR ++EL ++++EW+A
Sbjct  8    SAKVGAPRRWSLQGKTALVTGGTRGIGRAVVEELAALGATVHTCSRKEEELSERLKEWEA  67

Query  760  KGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRII  581
            +GF+V+ SVCDL+ R+QR++L+  V  +F GKL+ILVNN   +  +   ++ AEE S ++
Sbjct  68   RGFRVTTSVCDLSVRDQRERLLRQVADLFGGKLDILVNNVGTNIRKPTTEFSAEEYSFMM  127

Query  580  QTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLAC  401
             TNLES YHL QL++PLLKA+G+ SIVFISS+ G +A+ + S+YA +K AINQLTKNLAC
Sbjct  128  ATNLESAYHLCQLSHPLLKASGSGSIVFISSVCGLVAVFSGSLYAMTKGAINQLTKNLAC  187

Query  400  EWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFL  221
            EW +D IR N+++P  +RT++ +    +       G ++ RTPL+ + E  E+S LVAFL
Sbjct  188  EWARDNIRSNSIAPWYIRTSLTEGLLANKDFE---GAVVSRTPLRRVGEPEEVSSLVAFL  244

Query  220  CLPAAASHITGQVILIDGGYT  158
            C+P  +S+ITGQ I +DGG T
Sbjct  245  CMP-GSSYITGQTISVDGGMT  264



>gb|KEH22982.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=266

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 184/256 (72%), Gaps = 2/256 (1%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSL+GMTALV+GGTRG+G AIVEELA FGA VH C+RNQ ++ + ++EW+ KGF V+
Sbjct  11   DQRWSLQGMTALVTGGTRGLGYAIVEELAEFGASVHICARNQDDINKCLEEWKGKGFCVT  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GS CDL  REQR++L+ TV S F GKLNILVNNA I   +   DY  E+++  I TN  S
Sbjct  71   GSTCDLLFREQREKLMETVASTFQGKLNILVNNAGIFTPKPIMDYTDEDIASTIGTNFVS  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL QL +PLLK +G  SIV+ISS++G  ALP +SVYA+SK A+NQ TKNLA EW KD 
Sbjct  131  SYHLCQLAHPLLKQSGYGSIVYISSISGLKALPFVSVYAASKGAMNQCTKNLALEWAKDN  190

Query  382  IRVNTVSPSGVRTTIMK-PEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
            IR N V+P  V T +++   ++   +     +I+ +TP   I E  +IS LVAFLCLP A
Sbjct  191  IRANVVAPGPVMTLLLENAMKLVAGVDNAIKDIVSQTPGGRIGEPKDISGLVAFLCLP-A  249

Query  205  ASHITGQVILIDGGYT  158
            ASHITGQ+I  DGG+T
Sbjct  250  ASHITGQIIAADGGFT  265



>ref|XP_002319562.1| hypothetical protein POPTR_0013s02690g [Populus trichocarpa]
 gb|EEE95485.1| hypothetical protein POPTR_0013s02690g [Populus trichocarpa]
Length=260

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 190/257 (74%), Gaps = 5/257 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M +RWSL+GMTALV+GGT+GIG A+V+ELA  GA VHTC+RNQ +L ++++EW  KGFKV
Sbjct  1    MEKRWSLQGMTALVTGGTKGIGYAVVDELAALGAIVHTCARNQDQLNERIREWNEKGFKV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            +GSVCD++S  +R++L+  V+S F+GKLNILVNNA  +  +   DY AE+ + ++ TNL+
Sbjct  61   TGSVCDVSSDAEREKLMEEVSSRFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQ  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIAL-PAISVYASSKAAINQLTKNLACEWGK  389
            S +HL+QL +PLLKA+G   IVF+SS+   +++ P   +Y++SK A+NQLT+NLACEW K
Sbjct  121  SAFHLSQLAHPLLKASGAGKIVFMSSIGSVVSVNPQYPLYSASKGAMNQLTRNLACEWAK  180

Query  388  DGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
            D IRVN V+P  VRT +      D SIAK   E+  RTP++ + E  E+S +VAFLCLPA
Sbjct  181  DNIRVNGVAPWFVRTPLTAHSLDDESIAK---EVFSRTPMRRVGEPGEVSSVVAFLCLPA  237

Query  208  AASHITGQVILIDGGYT  158
                +TGQ+I +DGG +
Sbjct  238  PG-FLTGQIICVDGGMS  253



>ref|XP_011023546.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=260

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 190/257 (74%), Gaps = 5/257 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M +RWSL+GMTALV+GGT+GIG A+V+ELA  GA VHTC+RNQ++L ++++EW  KGFKV
Sbjct  1    MEKRWSLQGMTALVTGGTKGIGYAVVDELAALGAIVHTCARNQEQLNERIREWNEKGFKV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            +GSVCD++S  +R++L+  V+S F+GKLNILVNNA  +  +   DY AE+ + ++ TNL+
Sbjct  61   TGSVCDVSSDAEREKLMEEVSSRFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQ  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPA-ISVYASSKAAINQLTKNLACEWGK  389
            S +HL+QL +PLLKA+G   IVF+SS+   +++     +Y++SK A+NQLT+NLACEW K
Sbjct  121  SAFHLSQLAHPLLKASGAGKIVFMSSITSVVSINTQYPLYSASKGAMNQLTRNLACEWAK  180

Query  388  DGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
            D IRVN V+P  +RT +  P   D +I K   E+  RTP+K + E  E+S +VAFLCLPA
Sbjct  181  DNIRVNAVAPWFIRTPLTTPSLDDENILK---EVFNRTPMKRVGEPGEVSSVVAFLCLPA  237

Query  208  AASHITGQVILIDGGYT  158
                +TGQVI IDGG +
Sbjct  238  PG-FLTGQVICIDGGMS  253



>ref|XP_010931228.1| PREDICTED: tropinone reductase homolog At1g07440-like [Elaeis 
guineensis]
Length=273

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 190/254 (75%), Gaps = 4/254 (2%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            ++W+L G TALV+GGT+GIG AIVEELAGFGA VHTCSRN+ EL + +++W++    V+G
Sbjct  20   KKWTLNGTTALVTGGTKGIGHAIVEELAGFGATVHTCSRNEAELSKCLEQWKSLNIHVTG  79

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCD++ R +R++L+  V S+F GKLNILVNNA    ++ A  + AEE S ++ TNLES 
Sbjct  80   SVCDVSKRAEREKLMEGVRSIFQGKLNILVNNAGTGIVKAAVHFTAEEYSFLMATNLESA  139

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            +HL+QL +PLLKA+G  SIVFISS+AG +ALP +S+YA++K A+NQLTKNLACEW KD I
Sbjct  140  FHLSQLAHPLLKASGAGSIVFISSVAGVVALPTLSIYAATKGALNQLTKNLACEWIKDNI  199

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            RVN V+P  +RT +++    D    +     + R P+  +AE  E++ LV+FLCLP AAS
Sbjct  200  RVNCVAPGFIRTPLVQSVLEDK---EATAREVSRIPMGRVAEPEEVASLVSFLCLP-AAS  255

Query  199  HITGQVILIDGGYT  158
            +ITGQVI +DGG T
Sbjct  256  YITGQVICVDGGRT  269



>ref|XP_009144385.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Brassica rapa]
Length=262

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 186/256 (73%), Gaps = 4/256 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M++RWSLKGMTALV+GG  GIG AIVEELAGFG +VH C  ++  L Q + EW+ KGF+V
Sbjct  1    MDKRWSLKGMTALVTGGASGIGHAIVEELAGFGCKVHACDLSETLLNQSLCEWKKKGFQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            SGSVCD++ R +R++LI TV+++FNGKLNILVNN   ++++   +Y  ++ S  I TNLE
Sbjct  61   SGSVCDVSCRSEREKLIQTVSTMFNGKLNILVNNVGSARVKPTTEYLEDDFSFHISTNLE  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            S YHL+QL++P LKA+G+ SIVFISS+AG +++   S+Y  +K A+NQL +NLACEW KD
Sbjct  121  SAYHLSQLSHPFLKASGSGSIVFISSVAGVVSIDCGSMYGLTKGALNQLARNLACEWAKD  180

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
            GIR N V+P+ + T + +P   D    K    +  RTPL    E  E++ LVAFLCLP A
Sbjct  181  GIRANAVAPNFIYTALAQPFLDDAGFNK---SLSTRTPLGRPGEPEEVASLVAFLCLP-A  236

Query  205  ASHITGQVILIDGGYT  158
            AS+ITGQ I +DGG T
Sbjct  237  ASYITGQSICVDGGLT  252



>ref|XP_007140484.1| hypothetical protein PHAVU_008G116500g [Phaseolus vulgaris]
 gb|ESW12478.1| hypothetical protein PHAVU_008G116500g [Phaseolus vulgaris]
Length=265

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 188/263 (71%), Gaps = 15/263 (6%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSL GMTALV+GGTRGIG AIVEELA FGA +H CSR ++++ + ++EW+ KGF V+
Sbjct  11   DKRWSLDGMTALVTGGTRGIGHAIVEELAEFGASIHVCSRKEEDINRCLEEWKKKGFNVT  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD+  R QRQ L+ TV+S+F GKLNILVNNA     +K  D+ AE++S I+ TN ES
Sbjct  71   GSVCDVLHRHQRQTLMETVSSIFQGKLNILVNNAGREITKKIIDHTAEDISTIMATNFES  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +HL QL +PLLK +G+ +IVFISS+ G  ALPA+S YA++K A+NQ TKN+A EW KD 
Sbjct  131  AFHLTQLAHPLLKESGSGNIVFISSITGLKALPALSAYAATKGAMNQFTKNVALEWAKDN  190

Query  382  IRVNTVSPSGVRTTIMK-------PEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAF  224
            IR N V+P  + T +++       P+E D ++         + P   I E NE+S LVAF
Sbjct  191  IRANAVAPGPIWTPLLESVMEKSGPKEFDANVTS-------KIPSGRIGEPNEVSSLVAF  243

Query  223  LCLPAAASHITGQVILIDGGYTA  155
            LCLP AAS+I GQ++ +DGG+T+
Sbjct  244  LCLP-AASYINGQILYVDGGFTS  265



>ref|XP_007132035.1| hypothetical protein PHAVU_011G061300g [Phaseolus vulgaris]
 gb|ESW04029.1| hypothetical protein PHAVU_011G061300g [Phaseolus vulgaris]
Length=265

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 183/256 (71%), Gaps = 4/256 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RW L+GMTALV+GG++GIG AIVEELA  GA VHTC+RN+ EL   + +W  KG++V+GS
Sbjct  12   RWCLQGMTALVTGGSKGIGNAIVEELAQLGATVHTCARNEAELNDSLNQWTTKGYRVTGS  71

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD+ASR  RQ+LI  V+S FNGKLNILVNN   +  ++  D+  E+ S +I TNLES Y
Sbjct  72   VCDVASRVNRQELIARVSSQFNGKLNILVNNVGTNIKKQTVDFTEEDFSFLINTNLESAY  131

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            H++QL +PLLKA+  ASIVFISS+AG +++   S+Y ++K AINQLT+NLACEW KD IR
Sbjct  132  HISQLAHPLLKASEAASIVFISSVAGEVSVNIGSIYGATKGAINQLTRNLACEWAKDNIR  191

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N V P  ++T +      D   AK+    + RT L  + EA E+S LVAFLCLP AAS+
Sbjct  192  TNCVGPGPIKTPLGDTVFKD---AKVLNSFISRTALGRLGEAEEVSSLVAFLCLP-AASY  247

Query  196  ITGQVILIDGGYTAGA  149
            ITGQ I +DGG+   A
Sbjct  248  ITGQTIYVDGGFIVNA  263



>gb|AFK36946.1| unknown [Medicago truncatula]
Length=266

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/257 (55%), Positives = 185/257 (72%), Gaps = 2/257 (1%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSL GMTALV+GGTRGIG AIVEELA FGA VH C+RN++++ + ++EW+ KGF V+
Sbjct  11   DKRWSLHGMTALVTGGTRGIGYAIVEELAEFGASVHICARNEEDINKCLEEWKNKGFNVT  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD+   EQR++L+ TV+S+F GKLNILVNNAA    +K  D   E+++  + TN  S
Sbjct  71   GSVCDILFHEQRKKLMETVSSIFQGKLNILVNNAAKPTSKKIIDNTDEDINTTLGTNFVS  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL QL +PLLK +G  SIVF SS+AG  A+P +SVY ++K A+NQ TKNLA EW KD 
Sbjct  131  GYHLCQLAHPLLKQSGYGSIVFTSSVAGLKAIPVLSVYTATKGAVNQFTKNLALEWAKDN  190

Query  382  IRVNTVSPSGVRTTIMKP-EEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
            IR N V+P  V+T++++   + D    K    I+ +TP   + E  EIS LVAF C P A
Sbjct  191  IRANAVAPGPVKTSLLESVMDYDSEGYKAIAGIVSQTPTGRMGETKEISALVAFFCFP-A  249

Query  205  ASHITGQVILIDGGYTA  155
            ASHITGQ+I IDGGYT+
Sbjct  250  ASHITGQIIAIDGGYTS  266



>ref|XP_006294815.1| hypothetical protein CARUB_v10023866mg [Capsella rubella]
 gb|ABW81154.1| TRL17 [Capsella rubella]
 gb|EOA27713.1| hypothetical protein CARUB_v10023866mg [Capsella rubella]
Length=263

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 190/256 (74%), Gaps = 4/256 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M++RWSL+GMTALV+GGT+GIG A+VEEL+  GA VHTC+R++ +L+++++EWQAKGF+V
Sbjct  1    MDKRWSLQGMTALVTGGTKGIGEAVVEELSMLGARVHTCARDETQLQERLREWQAKGFQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            S S CD+ SREQR++L+ TV+S+F GKLNILVNN     ++   +Y  EE S I+ TNLE
Sbjct  61   STSTCDVTSREQREKLMETVSSLFQGKLNILVNNVGTFIVKPTTEYTGEEYSLIMATNLE  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            S +HL+QL++PLLKA+G+ SIV +SS+AG +     S+Y  +K A+NQL +NLACEW +D
Sbjct  121  SAFHLSQLSHPLLKASGSGSIVLMSSIAGLVHANVGSIYGITKGAMNQLARNLACEWARD  180

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
             IR N V P  + T ++     +  I K   E++ RTPL  + E NE++ LVAFLCLP A
Sbjct  181  SIRTNAVCPWYIATPLVNDLLKEGEIIK---EVVSRTPLGRVGEPNEVASLVAFLCLP-A  236

Query  205  ASHITGQVILIDGGYT  158
            AS+ITGQ I IDGG T
Sbjct  237  ASYITGQSICIDGGLT  252



>gb|KEH30187.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=268

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 191/255 (75%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            N +WSL GMTALV+GGTRGIG AIVEEL GFGA+VHTC+RN+ +L + +++W   GF+V+
Sbjct  9    NHKWSLNGMTALVTGGTRGIGYAIVEELMGFGAKVHTCARNEDDLNKCLKDWNHLGFEVT  68

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GS+CD++  +QR+ L+  V+SVFNGKLNIL+NN   +  +   D+ A E SR+I TNL S
Sbjct  69   GSICDVSVPQQREVLMEDVSSVFNGKLNILINNVGTNIRKPMIDFTAAEFSRLIDTNLGS  128

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +H+ QL YPLLKA+G  S+VFISS++G ++L ++SV  ++K AINQLT+NLACEW KD 
Sbjct  129  TFHMCQLAYPLLKASGVGSVVFISSVSGFVSLKSMSVQGATKGAINQLTRNLACEWAKDN  188

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  +RT+++  E++  S      E+  RTPL+ + +  E+S LVAFLCLP A+
Sbjct  189  IRSNAVAPWYIRTSMV--EQV-LSNKDYLEEVYSRTPLRRLGDPAEVSSLVAFLCLP-AS  244

Query  202  SHITGQVILIDGGYT  158
            S+ITGQ+I +DGG +
Sbjct  245  SYITGQIICVDGGMS  259



>gb|AFK33539.1| unknown [Lotus japonicus]
Length=271

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/251 (59%), Positives = 188/251 (75%), Gaps = 4/251 (2%)
 Frame = -2

Query  907  LKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGSVCD  728
            LKG TALV+GGTRGIG A+VEELA FGA V+TCSRN+ EL   ++EWQ KGF VSGSVCD
Sbjct  15   LKGTTALVTGGTRGIGHAVVEELAEFGATVYTCSRNEVELNACLKEWQEKGFSVSGSVCD  74

Query  727  LASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPYHLA  548
             +S  QR++L   V S FNGKLNILVNN   +  +   +Y AEE S+++ TNL+S +HL+
Sbjct  75   ASSPPQREKLFELVASAFNGKLNILVNNVGTNIRKPTIEYTAEEYSKLMSTNLDSAHHLS  134

Query  547  QLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIRVNT  368
            QL YPLLKA+GN SIVFISS+A    + + +VYA+SKAAINQLTK LACEW K  IR N+
Sbjct  135  QLAYPLLKASGNGSIVFISSVAALAHVGSGAVYAASKAAINQLTKYLACEWAKGNIRSNS  194

Query  367  VSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASHITG  188
            V+P   +T++++P     S  ++  EI+ RTP+K +AE +E+S LV FLCLP AAS+ TG
Sbjct  195  VAPWYTKTSLVEP---VLSNKELVNEILSRTPIKRMAETHEVSSLVTFLCLP-AASYTTG  250

Query  187  QVILIDGGYTA  155
            QVI +DGG+TA
Sbjct  251  QVISVDGGFTA  261



>gb|KFK41764.1| hypothetical protein AALP_AA2G169200 [Arabis alpina]
Length=257

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/258 (54%), Positives = 193/258 (75%), Gaps = 8/258 (3%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M++RWSL+GMTALV+GG  GIG AIVEELAGFGA++H C  +   L Q + +W+ KGFKV
Sbjct  1    MDKRWSLQGMTALVTGGASGIGYAIVEELAGFGAQIHVCDISDTSLNQCLSQWENKGFKV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            SGSV D++SR +R++++ TV+S+FNGKLNI VNN AI + +   +YE ++ +  I TNLE
Sbjct  61   SGSVADVSSRPEREKVMQTVSSLFNGKLNIFVNNVAILRAKPTIEYEEDDFAIHISTNLE  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            + YH  QL++PLLKA+G  SIVFISS+AG +++ A S+Y+ +K A+NQL +NLACEW KD
Sbjct  121  AAYHFCQLSHPLLKASGFGSIVFISSVAGVVSVGAGSIYSLTKGALNQLARNLACEWAKD  180

Query  385  GIRVNTVSPSGVRTTIMKP--EEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLP  212
            GIR N+V+P+ ++T   +P  E++D ++  ++G    RTPL    E NE++ LV FLCLP
Sbjct  181  GIRANSVAPNIIKTPASQPYLEDVDFTMG-LFG----RTPLGRAGEPNEVASLVVFLCLP  235

Query  211  AAASHITGQVILIDGGYT  158
             AAS+ITGQ I +DGG T
Sbjct  236  -AASYITGQTICVDGGLT  252



>emb|CDO98529.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/253 (57%), Positives = 186/253 (74%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL G TALV+GGT GIG AIV ELA  GA VHTC+R + +L +++QEW + GFKVSGS
Sbjct  57   RWSLSGATALVTGGTHGIGRAIVVELAQLGATVHTCARKEADLNERLQEWSSMGFKVSGS  116

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD +SREQR QLI  VTS+F GKLNILVNN   SK + ++ + +EE   ++ TNLES +
Sbjct  117  VCDASSREQRTQLIEKVTSIFGGKLNILVNNVGTSKGKPSEKFTSEEYDMMMSTNLESCF  176

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            H +QL YPLLKA+G  +IVFISS+AG +++  +SVYA++K A+NQLTKNLACEW KD IR
Sbjct  177  HFSQLAYPLLKASGMGNIVFISSVAGLVSIQGLSVYAAAKGAMNQLTKNLACEWAKDNIR  236

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
            VN V+P  +RT +   + +  S  K + +   R P+  + E  EIS LVAF+CLP A+S+
Sbjct  237  VNCVAPGVIRTQL--SQAVLNSDEK-WKKFKSRIPMNRVGEPEEISSLVAFVCLP-ASSY  292

Query  196  ITGQVILIDGGYT  158
            +TGQVI +DGG T
Sbjct  293  VTGQVIAVDGGLT  305



>emb|CDY14094.1| BnaC02g02110D [Brassica napus]
Length=263

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 189/255 (74%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSL G TALV+GGTRGIG A+VEELA FGA VHTCSRNQ+ELE  + +W++ G  V+
Sbjct  5    DKRWSLAGKTALVTGGTRGIGRAVVEELARFGATVHTCSRNQEELESCLDDWKSNGLVVT  64

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD + R+QR++LI  V+S F+GKLNIL+NN   +  +   +Y +E+ ++I+ TNLES
Sbjct  65   GSVCDASVRDQREKLIQEVSSAFSGKLNILINNVGTNLRKPTVEYSSEDYAKIMSTNLES  124

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +H +Q+ +PLLKA+G  SIVFISS+AG + + + SVY ++K A+NQLT+NLACEW  D 
Sbjct  125  AFHFSQIAHPLLKASGVGSIVFISSVAGLVHVSSGSVYGATKGALNQLTRNLACEWAGDN  184

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  ++T+++KP        +    I+ RTPL  + E  E+S LVAFLCLP AA
Sbjct  185  IRTNCVAPWYIKTSLVKPLLEKEGFEEA---IVSRTPLGRVGEPEEVSSLVAFLCLP-AA  240

Query  202  SHITGQVILIDGGYT  158
            S+ITGQVI +DGG+T
Sbjct  241  SYITGQVISVDGGFT  255



>ref|XP_007140482.1| hypothetical protein PHAVU_008G116300g [Phaseolus vulgaris]
 gb|ESW12476.1| hypothetical protein PHAVU_008G116300g [Phaseolus vulgaris]
Length=266

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 186/260 (72%), Gaps = 4/260 (2%)
 Frame = -2

Query  931  CGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGF  752
            C  +Q+WSL GMTALV+GGTRGIG A+ EELA FGA VH C+R Q+++++ ++EW  KGF
Sbjct  8    CFKDQKWSLHGMTALVTGGTRGIGYAVAEELAEFGASVHICARKQQDIDKCLEEWNRKGF  67

Query  751  KVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTN  572
             ++GS CD+ SR+QR+ L+  V S+F+GKLNIL+NNA  +  +   DY AE++S I+ TN
Sbjct  68   SITGSSCDVLSRDQRENLMRDVASIFDGKLNILINNAGTTVPKNLIDYTAEDISTIMGTN  127

Query  571  LESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWG  392
             ES YHL QL +PLLKA+G  +IVFISS+AG  + P  SVYASSK A+NQ TKN+A EW 
Sbjct  128  FESSYHLCQLAHPLLKASGYGNIVFISSIAGLKSFPFSSVYASSKGAMNQFTKNVALEWA  187

Query  391  KDGIRVNTVSPSGVRTTIMK--PEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLC  218
            KD IR N V+P  V+T ++    E +D   +K+      +T    I E  +IS +VAFLC
Sbjct  188  KDNIRANAVAPGFVKTELLDFILESLDEG-SKIIEATKAKTMAGRIGEPKDISGMVAFLC  246

Query  217  LPAAASHITGQVILIDGGYT  158
            LP AAS+ITGQ+I IDGGYT
Sbjct  247  LP-AASYITGQIITIDGGYT  265



>ref|XP_011023547.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=260

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 189/257 (74%), Gaps = 5/257 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M +RWSL+GMTALV+GGT+GIG A+V+ELA  GA VHTC+RN+ +L ++++EW  KGFKV
Sbjct  1    MEKRWSLQGMTALVTGGTKGIGYAVVDELAALGAIVHTCARNKDQLNERIREWNEKGFKV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            +GSVCD++S  +R++L+  V+S F+GKLNILVNNA  +  +   DY AE+ + ++ TNL+
Sbjct  61   TGSVCDVSSDAEREKLMEEVSSRFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQ  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPA-ISVYASSKAAINQLTKNLACEWGK  389
            S +HL+QL +PLLKA+G   IVF+SS+   +++     VY++SK A+NQLT+NLACEW K
Sbjct  121  SAFHLSQLAHPLLKASGAGKIVFMSSIGSVVSVNTQYPVYSASKGAMNQLTRNLACEWAK  180

Query  388  DGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
            D IRVN V+P  +RT +  P   D +I K   E+  RTP+K + E  E+S +VAFLCLPA
Sbjct  181  DNIRVNAVAPWFIRTPLTTPSLDDENILK---EVFNRTPMKRVGEPGEVSSVVAFLCLPA  237

Query  208  AASHITGQVILIDGGYT  158
                +TGQVI IDGG +
Sbjct  238  PG-FLTGQVICIDGGMS  253



>gb|EAY89400.1| hypothetical protein OsI_10905 [Oryza sativa Indica Group]
Length=277

 Score =   287 bits (734),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/259 (53%), Positives = 192/259 (74%), Gaps = 4/259 (2%)
 Frame = -2

Query  940  SEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQA  761
            S + G  +RWSL+G TALV+GGTRGIG A+VEELA  GA VHTCSR ++EL ++++EW+A
Sbjct  8    SAKVGAPRRWSLQGKTALVTGGTRGIGRAVVEELAALGATVHTCSRKEEELSERLKEWEA  67

Query  760  KGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRII  581
            +GF+V+ SVCDL+ R+QR++L+  V  +F GKL+ILVNN   +  +   ++ AEE S ++
Sbjct  68   RGFRVTTSVCDLSVRDQRERLLRQVADLFGGKLDILVNNVGTNIRKPTTEFSAEEYSFMM  127

Query  580  QTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLAC  401
             TNLES YHL QL++PLLKA+G+ SIVFISS+ G +A+ + S+YA +K AINQLTKNLAC
Sbjct  128  ATNLESAYHLCQLSHPLLKASGSGSIVFISSVCGLVAVFSGSLYAMTKGAINQLTKNLAC  187

Query  400  EWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFL  221
            EW +D IR N+++P  +RT++ +    +       G ++ RTPL+ + E  E+S LVAFL
Sbjct  188  EWARDNIRSNSIAPWYIRTSLTEGLLANKDFE---GAVVSRTPLRRVGEPEEVSSLVAFL  244

Query  220  CLPAAASHITGQVILIDGG  164
            C+P  +S+ITGQ I +DGG
Sbjct  245  CMP-GSSYITGQTISVDGG  262



>emb|CDY45434.1| BnaA05g12670D [Brassica napus]
Length=262

 Score =   286 bits (733),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 186/256 (73%), Gaps = 4/256 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M++RWSLKGMTALV+GG  GIG AIVEELAGFG +VH C  ++  L Q + EW+ KGF+V
Sbjct  1    MDKRWSLKGMTALVTGGASGIGHAIVEELAGFGCKVHACDLSETLLNQSLCEWKKKGFQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            SGSVCD++ R +R++L+ TV+++FNGKLNILVNN   ++++   +Y  ++ S  I TNLE
Sbjct  61   SGSVCDVSCRSEREKLMQTVSTMFNGKLNILVNNVGSARVKPTTEYLEDDFSFHISTNLE  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            S YHL+QL++P LKA+G+ SIVFISS+AG +++   S+Y  +K A+NQL +NLACEW KD
Sbjct  121  SAYHLSQLSHPFLKASGSGSIVFISSVAGVVSIDCGSMYGLTKGALNQLARNLACEWAKD  180

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
            GIR N V+P+ + T + +P   D    K    +  RTPL    E  E++ LVAFLCLP A
Sbjct  181  GIRANAVAPNFIYTALAQPFLDDAGFNK---SLSTRTPLGRPGEPEEVASLVAFLCLP-A  236

Query  205  ASHITGQVILIDGGYT  158
            AS+ITGQ I +DGG T
Sbjct  237  ASYITGQSICVDGGLT  252



>ref|XP_009110944.1| PREDICTED: tropinone reductase homolog At1g07440-like [Brassica 
rapa]
Length=262

 Score =   286 bits (733),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 186/256 (73%), Gaps = 4/256 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M+ RWSL+GMTALV+GGT+GIG AIVEELAGFGA VHTC+R+Q  L++ + EW+ KGF+V
Sbjct  1    MDSRWSLRGMTALVTGGTKGIGYAIVEELAGFGARVHTCARDQTLLDECLSEWKEKGFQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            +GSVCD++SR QR +L+ TV+S+F+GKLNIL+NN      +   ++ A++ S  I TNL+
Sbjct  61   TGSVCDVSSRAQRDELMKTVSSLFSGKLNILINNVGTLVSKPTTEFTAQDFSGQIATNLD  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            S YH +QL +PLLKA+G  SIVF+SS+ G ++   +S+Y+ +K  +NQL +NLACEW  D
Sbjct  121  SAYHFSQLAHPLLKASGFGSIVFLSSVCGVVSSGFVSIYSLTKGCMNQLARNLACEWASD  180

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
            GIR N+V+P   +T +++    D   A+    I  RTPL    E  E++ LV FLCLP A
Sbjct  181  GIRANSVAPWMTKTPLVQKRLDDEKFAE---AIFSRTPLGRACEPGEVASLVTFLCLP-A  236

Query  205  ASHITGQVILIDGGYT  158
            AS+ITGQ I IDGG+T
Sbjct  237  ASYITGQTICIDGGFT  252



>ref|XP_010542627.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Tarenaya hassleriana]
Length=273

 Score =   286 bits (733),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/261 (53%), Positives = 192/261 (74%), Gaps = 4/261 (2%)
 Frame = -2

Query  940  SEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQA  761
            +E+   ++RWSL+GMTALV+GGT+GIG AIVEELAGFGA VHTC+RNQ  L + +++WQ 
Sbjct  4    TEKSYRDRRWSLEGMTALVTGGTKGIGYAIVEELAGFGARVHTCARNQSLLNECLRKWQT  63

Query  760  KGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRII  581
            KGF+V+GSVCD++SR +R++L+ TV+S F+GKL+IL+NN   S ++   +Y AE+ S  I
Sbjct  64   KGFQVTGSVCDVSSRSEREKLMQTVSSTFDGKLSILINNVGTSIVKPTTEYTAEDFSFHI  123

Query  580  QTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLAC  401
             TNLES YHL+QL +PLLKA+G+ +IVFISS+AG ++    S+  ++K A+NQL +NLAC
Sbjct  124  TTNLESAYHLSQLAHPLLKASGSGNIVFISSIAGIVSTSVGSICNATKGAVNQLARNLAC  183

Query  400  EWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFL  221
            EW  D IRVN+V+P  + T + +    D +  K    ++ R PL  + E  E+S +V FL
Sbjct  184  EWASDNIRVNSVAPGFIATPMAETVLGDDNFLK---AVISRKPLGRVGEPREVSSMVVFL  240

Query  220  CLPAAASHITGQVILIDGGYT  158
            CLP AAS+ITGQ I +DGG T
Sbjct  241  CLP-AASYITGQTICVDGGLT  260



>ref|XP_004249378.1| PREDICTED: tropinone reductase 1 isoform X2 [Solanum lycopersicum]
Length=264

 Score =   286 bits (732),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/258 (52%), Positives = 194/258 (75%), Gaps = 2/258 (1%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            + ++WSL+G TALV+GG++GIG AIVEELA FGA V+TCSRN+ EL++ +  W+ KG KV
Sbjct  4    LREKWSLEGTTALVTGGSKGIGYAIVEELANFGARVYTCSRNENELQKCLDIWRKKGLKV  63

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
             GSVCDL S  +R++L+  +  VF+GKLNILVNNA +   ++AKD+  E+ + I+ TN E
Sbjct  64   EGSVCDLLSHTEREKLMKNIEDVFDGKLNILVNNAGVVIYKEAKDFTKEDYNIIMGTNFE  123

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            + YHL+Q+ YPLLK++ N +I+F+SS+AG  ALP++S+Y++SK AINQ+TKNLACEW KD
Sbjct  124  AGYHLSQIAYPLLKSSQNGNIIFVSSIAGFSALPSLSLYSASKGAINQMTKNLACEWAKD  183

Query  385  GIRVNTVSPSGVRTTIMKPE-EIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
             IRVN+V+P+ + T +++   + +P   +     +++TPL    +  E+S +VAFLC P 
Sbjct  184  NIRVNSVAPAVILTPLIETAIKKNPQQKEEIDSFVVKTPLGRAGKPEEVSAVVAFLCFP-  242

Query  208  AASHITGQVILIDGGYTA  155
            AAS+ITGQ+I  DGG+TA
Sbjct  243  AASYITGQIIWADGGFTA  260



>ref|XP_010491151.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=262

 Score =   286 bits (732),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 190/260 (73%), Gaps = 14/260 (5%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            NQRW+L G TALV+GGTRGIG A+VEELA FGA+VHTCSRNQ EL   + +W++ GF VS
Sbjct  4    NQRWTLAGKTALVTGGTRGIGRAVVEELARFGAKVHTCSRNQDELNACLNDWKSNGFVVS  63

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD + ++QR +LI  V+S F+GKLNIL+NN   +  +   +Y +E+ ++I+ TNLES
Sbjct  64   GSVCDASVKDQRDKLIQDVSSAFSGKLNILINNVGTNIRKPTVEYSSEDYAKIMSTNLES  123

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +HL+Q+ +PLLKA+G  ++VFISS+AG + L + S+Y ++K A+NQLT+NLACEW  D 
Sbjct  124  AFHLSQIAHPLLKASGVGNVVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDN  183

Query  382  IRVNTVSPSGVRTTIM-----KPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLC  218
            IR N V+P  ++T+++     K E +D         ++ RTPL  + E  E++ LVAFLC
Sbjct  184  IRTNCVAPWYIKTSLVETLLEKKEFVDA--------VVSRTPLGRVGEPEEVASLVAFLC  235

Query  217  LPAAASHITGQVILIDGGYT  158
            LP AAS+ITGQVI +DGG+T
Sbjct  236  LP-AASYITGQVISVDGGFT  254



>ref|XP_009772417.1| PREDICTED: tropinone reductase homolog [Nicotiana sylvestris]
Length=263

 Score =   286 bits (732),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 190/257 (74%), Gaps = 2/257 (1%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL+G TA+V+GGTRGIG AIVEELA FGA V+TCSRNQ EL++ +++W+ KG KV GS
Sbjct  6    RWSLQGTTAIVTGGTRGIGHAIVEELASFGANVYTCSRNQMELDECLRQWKTKGSKVEGS  65

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCDL SR QR++ + TV+S F+GK+NIL+NNAA++  +   ++  E+ + ++  N E+ Y
Sbjct  66   VCDLLSRSQREKFMDTVSSYFDGKINILINNAAVAIAKLTTEFTHEDYNTMMGINFEASY  125

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL+QL +P LKA+GN SIVFISS+AG ++LP  S+Y++SK A+NQL ++LACEW KD IR
Sbjct  126  HLSQLAHPFLKASGNGSIVFISSVAGLVSLPLCSIYSASKGAMNQLARSLACEWAKDNIR  185

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPL-KPIAEANEISPLVAFLCLPAAAS  200
            VN V+P  +RT+++     +P   +   ++  RTP+   + E  E+S +VAFLC P  AS
Sbjct  186  VNAVAPWIIRTSLIDAASQNPVHKENINKLTSRTPIGGRVGEPKEVSAMVAFLCFP-CAS  244

Query  199  HITGQVILIDGGYTAGA  149
            +ITGQ++ +DGG T  A
Sbjct  245  YITGQIMCVDGGITINA  261



>ref|XP_006355361.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=263

 Score =   286 bits (732),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 190/257 (74%), Gaps = 6/257 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            + RWSL GMTALV+GGTRGIG AIVEELA FGA ++TCSRN+K+L++ +++WQ KG+KV+
Sbjct  6    DGRWSLHGMTALVTGGTRGIGYAIVEELASFGASIYTCSRNKKDLDECLEKWQTKGYKVN  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GS CDL   +QR +LI   T  FNGKL+ILVNNAAI   ++     + + S ++ TN E+
Sbjct  66   GSTCDLFLEDQRIELIDKATQHFNGKLDILVNNAAICVPKETAQITSADCSLMMGTNFEA  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             Y+L QL YP LK +G ASIVFISS++G +A+P +S+YA++K AINQLTKNLACEWGKD 
Sbjct  126  SYNLCQLAYPYLKGSGKASIVFISSISGIMAIPFVSLYAATKGAINQLTKNLACEWGKDN  185

Query  382  IRVNTVSPSGVRTTIMK--PEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
            IRVN V+P  + T +     E+ + S  +   +++ RTP+  + + NE+S LVA+LC PA
Sbjct  186  IRVNAVAPWIIDTALTDTVAEDFESSDVE---KLIKRTPISRMGKPNEVSSLVAYLCFPA  242

Query  208  AASHITGQVILIDGGYT  158
            AA +ITGQ+I +DGG T
Sbjct  243  AA-YITGQIICVDGGKT  258



>emb|CDY04977.1| BnaAnng01590D [Brassica napus]
Length=263

 Score =   286 bits (732),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 189/255 (74%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSL G TALV+GGTRGIG A+VEELA FGA VHTCSR+Q+EL+  + +W++ G  V+
Sbjct  5    DKRWSLAGKTALVTGGTRGIGRAVVEELARFGATVHTCSRSQEELKSCLDDWKSNGLVVT  64

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD + R+QR++LI  V+S F+GK+NILVNN   +  +   +Y +E+ ++I+ TNLES
Sbjct  65   GSVCDASDRDQREKLIQEVSSAFSGKINILVNNVGTNLRKPTVEYSSEDYAKIMSTNLES  124

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +H +QL +PLLKA+G  SIVFISS+AG + L + SVY ++K A+NQLT+NLACEW  D 
Sbjct  125  AFHFSQLAHPLLKASGVGSIVFISSVAGLVHLSSGSVYGATKGALNQLTRNLACEWAGDN  184

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  ++T+++KP        +    I+ RTPL  + E  E+S LVAFLCLP AA
Sbjct  185  IRTNCVAPWYIKTSLVKPLLEKKGFEEA---IVSRTPLGRVGEPEEVSSLVAFLCLP-AA  240

Query  202  SHITGQVILIDGGYT  158
            S+ITGQVI +DGG+T
Sbjct  241  SYITGQVISVDGGFT  255



>emb|CDX86486.1| BnaC08g02170D [Brassica napus]
Length=262

 Score =   286 bits (731),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 185/256 (72%), Gaps = 4/256 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M+ RWSL+GMTALV+GG RGIG AIVEELAGFGA++HTC R+Q  L++ + EW+AKGF+V
Sbjct  1    MDSRWSLQGMTALVTGGARGIGYAIVEELAGFGAKIHTCDRDQTLLDECLSEWKAKGFQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            +GSVCD++SR QR  L+ TV+S+F+GKLNIL+NN      +   ++ A++ S  I TNLE
Sbjct  61   TGSVCDVSSRPQRDGLMKTVSSLFSGKLNILINNVGTLVSKPTTEFTAQDFSGQIATNLE  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            S YH +QL +PLLKA+G  SIVF+SS+ G ++   +S+Y+ +K  +NQL +NLACEW  D
Sbjct  121  SAYHFSQLAHPLLKASGFGSIVFLSSVCGVVSSGFVSIYSLTKGGMNQLARNLACEWASD  180

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
            GIR N+V+P   +T +++    D   A+    I  RTPL    E  E++ LV FLCLP A
Sbjct  181  GIRANSVAPWMTKTPLVQKRLDDEKFAE---AIFSRTPLGRACEPREVASLVTFLCLP-A  236

Query  205  ASHITGQVILIDGGYT  158
            AS+ITGQ I IDGG+T
Sbjct  237  ASYITGQTICIDGGFT  252



>gb|KDP35687.1| hypothetical protein JCGZ_09125 [Jatropha curcas]
Length=267

 Score =   286 bits (732),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 192/265 (72%), Gaps = 9/265 (3%)
 Frame = -2

Query  940  SEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQA  761
            +E     +RWSLKG TALV+GGT+GIG AIVEELA FGA VHTCSRNQKEL+Q +QEWQ+
Sbjct  4    AEMSSRGKRWSLKGKTALVTGGTKGIGHAIVEELAEFGAVVHTCSRNQKELDQCLQEWQS  63

Query  760  KGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRII  581
            KGFKV+GSVCD+++R QR++LI  V+S+F+GKLNILVNNA   K ++A    AE++S I+
Sbjct  64   KGFKVTGSVCDVSNRTQREKLIDVVSSIFDGKLNILVNNAGTCKFKEALKDTAEDISTIM  123

Query  580  QTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLAC  401
             TN ES YHL+QL++PLLKA+   +IV ISS+   +ALP  ++YA+SK A+ Q+TKNLAC
Sbjct  124  STNFESAYHLSQLSHPLLKASEYGNIVNISSITSIVALPLCTIYAASKGAMQQITKNLAC  183

Query  400  EWGKDGIRVNTVSPSGVRTTIM---KPEEIDPSIAKMYGEIMMRT-PLKPIAEANEISPL  233
            EW  D IRVN V P    T ++   K    +P +     E M R+ PL    +  EI+ +
Sbjct  184  EWANDMIRVNAVLPGFTDTPLLDFAKKSWDNPEVE----EQMTRSIPLSREGKPEEIASV  239

Query  232  VAFLCLPAAASHITGQVILIDGGYT  158
            V FLCLPA+A +ITGQ+I+ DGG T
Sbjct  240  VTFLCLPASA-YITGQIIIADGGCT  263



>gb|AGY46257.1| tropinone reductase I [Withania somnifera]
Length=273

 Score =   286 bits (732),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 192/255 (75%), Gaps = 2/255 (1%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSLKG TALV+GG++GIG AIVEELAG GA V+TCSRN+ EL+Q ++ W+ KG KV GS
Sbjct  16   RWSLKGTTALVTGGSKGIGYAIVEELAGLGATVYTCSRNENELQQCLEIWREKGLKVEGS  75

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            +CDL  R +R++L+ TV  VF+GKLNILVNNA +   ++AKD+  ++ + I+ TN E+ Y
Sbjct  76   ICDLLVRTEREKLMQTVADVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAY  135

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL+Q+ YPLLKA+ N +++F+SS+AG  ALP++S+Y++SK AINQ+TKNLACEW KD IR
Sbjct  136  HLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKNLACEWAKDNIR  195

Query  376  VNTVSPSGVRTTIMKPE-EIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            VN+V+P  + T +++   + +P         +++TP+    +  E++ ++AFLC P AAS
Sbjct  196  VNSVAPGVIVTPLVEAAIKKNPQQKDEIDNFVVKTPMGRAGKPEEVAAVIAFLCFP-AAS  254

Query  199  HITGQVILIDGGYTA  155
            ++TGQ+I  DGG+TA
Sbjct  255  YVTGQIIWADGGFTA  269



>ref|XP_010510516.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=268

 Score =   286 bits (732),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/264 (53%), Positives = 189/264 (72%), Gaps = 12/264 (5%)
 Frame = -2

Query  937  EQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAK  758
            E  G N RWSL+GMTALV+GG++GIG A+VEELA  GA VHTC+R++ +L+ +++EWQAK
Sbjct  6    ESLGENSRWSLQGMTALVTGGSKGIGEAVVEELAMLGARVHTCARDETQLQDRLREWQAK  65

Query  757  GFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQ  578
            GF+V+ SVCD++SR+QR++L+ TV+S+F GKLNI V N      +   +  AE+ S I+ 
Sbjct  66   GFQVTTSVCDVSSRDQREKLMETVSSLFQGKLNIFVPNVGTGIAKPTTECTAEDFSFIMA  125

Query  577  TNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACE  398
            TNLES +HL+QL +PLLKA+G+ SIV +SS+AG + L   S+Y ++K A+NQL +NLACE
Sbjct  126  TNLESTFHLSQLAHPLLKASGSGSIVLMSSVAGVVNLEGTSIYGATKGAMNQLARNLACE  185

Query  397  WGKDGIRVNTVSPSGVRTTIMKP----EEIDPSIAKMYGEIMMRTPLKPIAEANEISPLV  230
            W  D IR N+V P  + T   K     EE+   +  +       TP+K I EANE+S LV
Sbjct  186  WASDNIRTNSVCPWFITTPASKDFLGVEEVKEKVKSV-------TPMKRIGEANEVSSLV  238

Query  229  AFLCLPAAASHITGQVILIDGGYT  158
            AFLCLP AAS+ITGQ I +DGG+T
Sbjct  239  AFLCLP-AASYITGQTICVDGGFT  261



>ref|XP_008221978.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=270

 Score =   286 bits (732),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 191/258 (74%), Gaps = 5/258 (2%)
 Frame = -2

Query  928  GMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGF-  752
            G + RWSL+GMTALV+GGT+GIG AIVEELAG GA +HTCSRN+ +L   + +W+ KGF 
Sbjct  8    GKDSRWSLRGMTALVTGGTKGIGYAIVEELAGLGATIHTCSRNEVQLNDCLSQWKMKGFD  67

Query  751  KVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTN  572
            +V+GSVCD+ S+ QR++LI+ V+S+FNGKLNIL+NN   ++++ A +   E+ S I+ TN
Sbjct  68   QVTGSVCDVVSKAQREELINKVSSLFNGKLNILINNVGTAEIKPAIESTTEDYSFIMSTN  127

Query  571  LESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWG  392
            LES YH +QL +PLLKA+G  +I+F+SS+AG ++L   S+YA++K A+NQL KNLACEW 
Sbjct  128  LESAYHFSQLAHPLLKASGAGNIIFMSSVAGVVSLGTASIYAATKGAMNQLAKNLACEWA  187

Query  391  KDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLP  212
            KD IR N+V+P  +RT + +P   + +  +    +  R PL    E  E+S LVAFLC P
Sbjct  188  KDNIRTNSVAPWFIRTPLTEPLLSNQNFLE---AVNSRCPLGRTGEPKEVSALVAFLCFP  244

Query  211  AAASHITGQVILIDGGYT  158
             AAS+ITGQ+I +DGG+T
Sbjct  245  -AASYITGQIICVDGGFT  261



>ref|XP_003558258.1| PREDICTED: tropinone reductase homolog At1g07440-like [Brachypodium 
distachyon]
Length=270

 Score =   286 bits (732),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 187/253 (74%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL G TALV+GGTRGIG A+VEELA  GA VHTCSR + EL ++++EW+AKGF+V+GS
Sbjct  13   RWSLHGKTALVTGGTRGIGRAVVEELAALGAAVHTCSRKESELRERLKEWEAKGFRVTGS  72

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD++ R+QR+ L+  V   F GKL+ILVNN   +  +   +Y A++ S I+ TNLES Y
Sbjct  73   VCDVSVRDQRELLLRDVAGRFAGKLDILVNNVGTNFTKPTTEYSADDYSFIMTTNLESAY  132

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL +PLLKA+G+ASIVFISS++G +A+ + S+YA +K A+NQL KNLAC+W KD IR
Sbjct  133  HLCQLAHPLLKASGSASIVFISSVSGVVAISSGSIYAMTKGAMNQLAKNLACDWAKDNIR  192

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N+V+P  ++T++    E + +       I+ RTP++ + E  E+S LVAFLC+P A+S+
Sbjct  193  TNSVAPWYIKTSLT---EENLAREDFVDSIVRRTPMRRVGEPEEVSSLVAFLCMP-ASSY  248

Query  196  ITGQVILIDGGYT  158
            ITGQ I +DGG T
Sbjct  249  ITGQTISVDGGMT  261



>gb|KEH22981.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=266

 Score =   286 bits (731),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 182/256 (71%), Gaps = 2/256 (1%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            +QRWSL+GMTALV+GGTRGIG AIVEELA FGA VH C+RNQ+++ + ++EW+ KGF V+
Sbjct  11   DQRWSLQGMTALVTGGTRGIGYAIVEELAEFGASVHICARNQEDINKCLEEWKGKGFCVT  70

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GS CDL   +QRQ+L+ TV  VF+GKLNILVNNA I   +   DY  E+++  I TN  S
Sbjct  71   GSTCDLLFHDQRQKLMETVALVFDGKLNILVNNAGIFTPKPIMDYTDEDITTTIGTNFVS  130

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL QL +PLLK +GN SIVFISS+AG  A P  SVYA+SK A+NQ  KNLA EW KD 
Sbjct  131  GYHLCQLAHPLLKQSGNGSIVFISSIAGLKAWPFASVYAASKGAMNQCAKNLALEWAKDN  190

Query  382  IRVNTVSPSGVRTTIMK-PEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
            IR N V+P  V T + +   ++   +  +  +++  TP   I E  +IS LVAFLCLP A
Sbjct  191  IRANVVAPGAVMTILFENAAKLAGRVDNVVEDMVSLTPSGRIGEPKDISGLVAFLCLP-A  249

Query  205  ASHITGQVILIDGGYT  158
            ASHITGQ+I  DGG+T
Sbjct  250  ASHITGQIIAADGGFT  265



>emb|CDY68057.1| BnaAnng26060D [Brassica napus]
Length=262

 Score =   286 bits (731),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 186/256 (73%), Gaps = 4/256 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M+ RWSL+GMTALV+GGT+GIG AIVEELAGFGA VHTC+R+Q  L++ + EW+ KGF+V
Sbjct  1    MDSRWSLRGMTALVTGGTKGIGYAIVEELAGFGARVHTCARDQTLLDECLSEWKEKGFQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            +GSVCD++SR QR +L+ TV+S+F+GKLNIL+NN      +   ++ A++ S  I TNL+
Sbjct  61   TGSVCDVSSRPQRDELMKTVSSLFSGKLNILINNVGTLVSKPTTEFTAQDFSGQIATNLD  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            S YH +QL +PLLKA+G  SIVF+SS+ G ++   +S+Y+ +K  +NQL +NLACEW  D
Sbjct  121  SAYHFSQLAHPLLKASGFGSIVFLSSVCGVVSSGFVSIYSLTKGCMNQLARNLACEWASD  180

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
            GIR N+V+P   +T +++    D   A+    I  RTPL    E  E++ LV FLCLP A
Sbjct  181  GIRANSVAPWMTKTPLVQKRLDDEKFAE---AIFSRTPLGRACEPREVASLVTFLCLP-A  236

Query  205  ASHITGQVILIDGGYT  158
            AS+ITGQ I IDGG+T
Sbjct  237  ASYITGQTICIDGGFT  252



>ref|XP_010452515.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=262

 Score =   286 bits (731),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 189/260 (73%), Gaps = 14/260 (5%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            NQRW+L G TALV+GGTRGIG A+VEELA FGA+VHTCSRNQ EL   +  W++ GF VS
Sbjct  4    NQRWTLAGKTALVTGGTRGIGRAVVEELARFGAKVHTCSRNQDELNSCLNNWKSNGFVVS  63

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD + ++QR +LI  V+S F+GKLNIL+NN   +  +   +Y +E+ ++I+ TNLES
Sbjct  64   GSVCDASLKDQRDKLIQDVSSAFSGKLNILINNVGTNIRKPTVEYSSEDYAKIMSTNLES  123

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +HL+Q+ +PLLKA+G  +IVFISS+AG + L + S+Y ++K A+NQLT+NLACEW  D 
Sbjct  124  AFHLSQIAHPLLKASGVGNIVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDN  183

Query  382  IRVNTVSPSGVRTTIM-----KPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLC  218
            IR N V+P  ++T+++     K E +D         ++ RTPL  + E  E++ LVAFLC
Sbjct  184  IRTNCVAPWYIKTSLVESLLEKKEFVDA--------VVSRTPLGRVGEPEEVASLVAFLC  235

Query  217  LPAAASHITGQVILIDGGYT  158
            LP AAS+ITGQVI +DGG+T
Sbjct  236  LP-AASYITGQVISVDGGFT  254



>emb|CAD20555.1| tropinone reductase I [Calystegia sepium]
Length=263

 Score =   286 bits (731),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 186/253 (74%), Gaps = 1/253 (0%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            +WSL+GMTALV+GGTRGIG  IVEELAGFGAEV+ CSR Q E+++ V +W+ KGFKV+GS
Sbjct  7    KWSLQGMTALVTGGTRGIGYGIVEELAGFGAEVYICSRKQNEVDECVGKWREKGFKVAGS  66

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
             CD++SR QR++LI  V   FNGKLNILVNNA     + A +++AE+ + I+ TN E+ +
Sbjct  67   ACDISSRTQREELIKNVAHHFNGKLNILVNNAGTILPKDATEFKAEDYTLIMGTNFEASF  126

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL QL +P LKA+   +IVF SS+AG I +   ++YA+SK AINQ+TKNLACEW KD IR
Sbjct  127  HLCQLAHPFLKASSMGTIVFNSSVAGIIPVFKTTLYAASKGAINQVTKNLACEWAKDNIR  186

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
            VN+V+P  +RT ++   + +   ++    ++ RTP+    E  E+S LVAFLCLP AAS+
Sbjct  187  VNSVAPWVIRTKLVNDFDSESEGSEEIERMIRRTPISRPGEVGEVSSLVAFLCLP-AASY  245

Query  196  ITGQVILIDGGYT  158
            ITGQ I +DGGYT
Sbjct  246  ITGQTICVDGGYT  258



>gb|AIN39993.1| tropinone reductase I [Brugmansia arborea]
Length=272

 Score =   286 bits (731),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 196/269 (73%), Gaps = 6/269 (2%)
 Frame = -2

Query  946  MASEQCGMN----QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQK  779
            M   +  MN    +RWSLKG TALV+GG++GIG AIVEELAG GA V+TCSRN+KEL++ 
Sbjct  1    MEESKVSMNDKNEERWSLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELQEC  60

Query  778  VQEWQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAE  599
            +  W+  G  V GSVCDL SR +R++L+ TV  +F+ KLNILVNNA +   ++AKD+  E
Sbjct  61   LDFWRKNGLNVEGSVCDLLSRTEREKLMQTVAHIFDEKLNILVNNAGVVIHKEAKDFTEE  120

Query  598  ELSRIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQL  419
            + + I+ TN E+ YHL+Q+ YPLLKA+ N +++F+SS+AG  ALP++S+Y++SK AINQ+
Sbjct  121  DYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQM  180

Query  418  TKNLACEWGKDGIRVNTVSPSGVRTTIMKPE-EIDPSIAKMYGEIMMRTPLKPIAEANEI  242
            TK+LACEW KD IRVN+V+P  + T +++   + +P   +     +++TP+    +  E+
Sbjct  181  TKSLACEWAKDNIRVNSVAPGVILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGKPQEV  240

Query  241  SPLVAFLCLPAAASHITGQVILIDGGYTA  155
            S L+AFLC P AAS+ITGQ+I  DGG+TA
Sbjct  241  SALIAFLCFP-AASYITGQIIWADGGFTA  268



>emb|CDO98530.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   286 bits (731),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 144/253 (57%), Positives = 189/253 (75%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL G TALV+GGTRGIG AIVEELA  GA VHT +R + EL Q +QEW  KG+K++GS
Sbjct  12   RWSLLGKTALVTGGTRGIGRAIVEELAQLGATVHTLARKEAELNQLLQEWSYKGYKITGS  71

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            +CD +SREQR ++I  V+S+F+GKLNILVNN      + A+D+ AEE   I+  NLES +
Sbjct  72   ICDASSREQRIEIIEKVSSLFDGKLNILVNNVGTGVRKPAEDFTAEEYHMIMSVNLESCF  131

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL+QL YPLLK++ N +IVFISS+AG + L   SVY+++KAA+NQLT+NLACEW KD IR
Sbjct  132  HLSQLAYPLLKSSENGNIVFISSVAGLVGLQYSSVYSATKAAMNQLTRNLACEWAKDNIR  191

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
            VN+V+P  +RT +++ + I  +      +I  RTP++ I E  E+S LVAFLCLP AAS+
Sbjct  192  VNSVAPWFIRTPLVE-DWIGAN--DNLKKIESRTPMRRIGEPEEVSSLVAFLCLP-AASY  247

Query  196  ITGQVILIDGGYT  158
            ITGQV+ +DGG T
Sbjct  248  ITGQVVPVDGGMT  260



>emb|CDY45432.1| BnaA05g12690D [Brassica napus]
Length=262

 Score =   285 bits (730),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 184/256 (72%), Gaps = 4/256 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M++RWSL+G TALV+GG  GIG AIVEELAGFGA++H C  ++  L + + EW+ KGFKV
Sbjct  1    MDKRWSLEGTTALVTGGGSGIGYAIVEELAGFGAKIHVCDISETLLNKSLSEWEKKGFKV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            SGSVCD+ SR +R+ L+ TV+S+FNGKL+I VNN    +L+   +Y+A++    I TNLE
Sbjct  61   SGSVCDVTSRPERETLMQTVSSLFNGKLDIFVNNVGGGRLKPTTEYDADDFDFHIATNLE  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
              +H  QL++PLLKA+G  SI+FISS+AG ++    S+Y+ +K A+NQL +NLACEW KD
Sbjct  121  PAFHFCQLSHPLLKASGYGSIIFISSVAGVVSFECGSIYSLAKGALNQLARNLACEWAKD  180

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
            GIR N V+P+ ++T + +P   D S  +   E+  RTPL    E NE++ LV FLCLP A
Sbjct  181  GIRANAVAPNAIKTPLSQPYLDDVSFKE---ELFGRTPLGRAGEPNEVASLVVFLCLP-A  236

Query  205  ASHITGQVILIDGGYT  158
            AS+ITGQ I +DGG T
Sbjct  237  ASYITGQTICVDGGLT  252



>ref|XP_008223763.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=270

 Score =   286 bits (731),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 140/258 (54%), Positives = 188/258 (73%), Gaps = 5/258 (2%)
 Frame = -2

Query  928  GMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGF-  752
            G + RWSL GMTALV+GGT+GIG AIVEELAG GA VHTCSRN+ +L   + +W+ KGF 
Sbjct  8    GKDSRWSLHGMTALVTGGTKGIGYAIVEELAGLGATVHTCSRNEVQLNDCLSQWKIKGFD  67

Query  751  KVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTN  572
            +V+GSVCD+ S+ QR++LI+ V+S+F+GKLNIL+NN    K++ A +   E+ S I+ TN
Sbjct  68   QVTGSVCDVVSKAQREELINKVSSLFHGKLNILINNVGTFKIKPAIESTTEDYSFIMSTN  127

Query  571  LESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWG  392
            LES YH +QL +PLLKA+G  +I+F+SS+AG +++   ++YA++K A+NQL KNLACEW 
Sbjct  128  LESAYHFSQLAHPLLKASGAGNIIFMSSVAGVVSVGTATIYAATKGAMNQLAKNLACEWA  187

Query  391  KDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLP  212
            KD IR N+V+P  +RT + +P   D    K    I  R PL  I E  E+S LVAFLC P
Sbjct  188  KDNIRTNSVAPWFIRTPLTEPLLSD---QKFMEAINSRCPLGRIGEPKEVSALVAFLCFP  244

Query  211  AAASHITGQVILIDGGYT  158
             AAS+ITGQ I +DGG+T
Sbjct  245  -AASYITGQTICVDGGFT  261



>ref|XP_004307471.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=271

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 186/256 (73%), Gaps = 4/256 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL G TALV+GGTRGIG A+VEELA  GA V TCSRN +ELE+ ++EW AKGF+++G 
Sbjct  12   RWSLTGTTALVTGGTRGIGYAVVEELASLGAYVFTCSRNAEELERCLKEWSAKGFRITGI  71

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD++ + +R++L+  V   F G+LNI VNN   +  +   +Y  EE S+++ TNLES Y
Sbjct  72   VCDVSVKSEREKLMEQVGVSFAGRLNIFVNNVGTNIRKPTTEYTFEEYSKVMSTNLESTY  131

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL Q+ +PLLK +G  S+VFISS+AG ++L + ++YA+SKAAINQLTKNLACEW KD IR
Sbjct  132  HLCQIAHPLLKGSGAGSVVFISSVAGLVSLGSGTIYAASKAAINQLTKNLACEWAKDNIR  191

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N V+P   RT++++    D    K   E+  RTPL  +AE  E+S LVAFLCLP AAS+
Sbjct  192  SNAVAPWYTRTSLVEHMLEDK---KFLEEVTSRTPLNRVAEPEEVSSLVAFLCLP-AASY  247

Query  196  ITGQVILIDGGYTAGA  149
            ITGQ+I +DGG TA +
Sbjct  248  ITGQIICVDGGMTANS  263



>ref|NP_850131.1| tropinone reductase-like protein [Arabidopsis thaliana]
 dbj|BAH19401.1| AT2G29340 [Arabidopsis thaliana]
 gb|AEC08236.1| tropinone reductase-like protein [Arabidopsis thaliana]
Length=262

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 187/256 (73%), Gaps = 4/256 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M++RWSLKGMTALV+GG  GIG AIVEELAGFGA +H C  ++ +L Q + EW+ KGF+V
Sbjct  1    MDKRWSLKGMTALVTGGASGIGYAIVEELAGFGARIHVCDISEAKLNQSLSEWEKKGFQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            SGSVCD+ASR +R++L+ TV+S F+GKLNILV+N  + + +   +Y  ++ +  I +N+E
Sbjct  61   SGSVCDVASRPEREELMQTVSSQFDGKLNILVSNVGVIRSKPTTEYTEDDFAFHISSNVE  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            + YH +QL++PLLKA+G  SI+F+SS+AG I+  A S+Y  +K A+ QL KNLACEW KD
Sbjct  121  AAYHFSQLSHPLLKASGYGSIIFVSSIAGVISFDAGSIYGLTKGALIQLAKNLACEWAKD  180

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
            GIR N V+P+ + T + +    D S  K    ++ RTPL  + E NE++ LVAFLCLP A
Sbjct  181  GIRANAVAPNVINTPLSQSYLEDVSFKKA---LLSRTPLGRVGEPNEVASLVAFLCLP-A  236

Query  205  ASHITGQVILIDGGYT  158
            AS+ITGQ I +DGG T
Sbjct  237  ASYITGQTICVDGGLT  252



>emb|CDO98527.1| unnamed protein product [Coffea canephora]
Length=279

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 184/253 (73%), Gaps = 4/253 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL G TALV+GGT GIG AIV ELA  GA VHTC+R + +L +++QEW + GFKVSGS
Sbjct  24   RWSLSGATALVTGGTHGIGRAIVVELAQLGATVHTCARKEADLNERLQEWSSMGFKVSGS  83

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD +SR+QR +LI  V+S+FNGKLNILVNN    K +  +++ +EE   ++ TNLES +
Sbjct  84   VCDASSRDQRIRLIEKVSSIFNGKLNILVNNVGTCKAKPPEEFTSEEYDMMMSTNLESCF  143

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            H +QL YPLLKA+G  +IVFISS+ G +++   S+YAS+K A+NQLTKNLACEW KD IR
Sbjct  144  HFSQLAYPLLKASGIGNIVFISSVGGLVSVQGFSIYASTKGAVNQLTKNLACEWAKDNIR  203

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
            VN V+P  VRT +   + +  S  K + +   R P+K   +  EIS L+AFLCLP AAS+
Sbjct  204  VNCVAPGVVRTQL--SQAVLNSDEK-WKKFKSRIPMKRDGKPEEISSLIAFLCLP-AASY  259

Query  196  ITGQVILIDGGYT  158
            ITGQVI +DGG T
Sbjct  260  ITGQVIAVDGGLT  272



>ref|XP_010068031.1| PREDICTED: tropinone reductase 1-like [Eucalyptus grandis]
Length=210

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSLKG TALV+GGTRGIG AIV ELAG GA VHTCSRN+KEL ++V+EW+ KGF+V 
Sbjct  10   DRRWSLKGKTALVTGGTRGIGYAIVAELAGLGASVHTCSRNEKELNERVEEWRGKGFQVR  69

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCDL    Q+++LI TV+SVF+GKLNILVNNAA   L+   D+  E+ S +++ NLES
Sbjct  70   GSVCDLTCNTQKEELIKTVSSVFDGKLNILVNNAATVVLKGVLDHRPEDCSYVLKANLES  129

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
            PYHL QL +PLLKA+G+ +IVF+SS+AG +ALPA+S+Y++SK AINQLTKNLACEW KD 
Sbjct  130  PYHLCQLAHPLLKASGDGNIVFLSSIAGVVALPALSIYSASKGAINQLTKNLACEWAKDN  189

Query  382  IRVNTVSPSGVRTTIMKP  329
            IR+NTV+P  V+TTI KP
Sbjct  190  IRINTVAPGPVKTTITKP  207



>gb|ABW81120.1| putative tropinone reductase-14 [Boechera divaricarpa]
Length=262

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 190/256 (74%), Gaps = 4/256 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M++RWSL+GMTALV+GGT+GIG A+VEEL+  GA VHTC+R++ +L+++++EWQAKGF+V
Sbjct  1    MDKRWSLQGMTALVTGGTKGIGEAVVEELSMLGARVHTCARDETQLQERLREWQAKGFQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            S S+CD++SREQR++L+ TV ++F GKLNILVNNA     +   ++ AEE S I+ TNLE
Sbjct  61   STSICDVSSREQREKLMETVAALFQGKLNILVNNAGTFIFKPTTEFTAEEYSFIMATNLE  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            S +HL+QL +PLLKA+G+  IV +SS+AG + +   S+Y ++K A+NQL +NLACEW  D
Sbjct  121  SAFHLSQLAHPLLKASGSGRIVLMSSVAGVVHVNVGSIYGATKGAMNQLARNLACEWASD  180

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
             IR N + P  + T ++     +  + K   E + RTPL  + E NE++ LVAFLCLP A
Sbjct  181  NIRTNAICPWLIVTPLVNDLLNEEEVKK---EAVRRTPLGRVGEPNEVASLVAFLCLP-A  236

Query  205  ASHITGQVILIDGGYT  158
            AS+ITGQ I +DGG T
Sbjct  237  ASYITGQTICVDGGLT  252



>emb|CDX98899.1| BnaC09g49360D [Brassica napus]
Length=262

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 190/257 (74%), Gaps = 8/257 (3%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSL G  ALV+GGTRGIG AIVEELA  GA+VHTCSRNQ+EL+  + +W++ G  VS
Sbjct  4    DRRWSLAGKAALVTGGTRGIGRAIVEELARLGAKVHTCSRNQEELKACLDDWKSNGLVVS  63

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD + R+QR++LI  V+S F+GKLNILVNN   S  +   +Y +E+ ++I+ TNLES
Sbjct  64   GSVCDASDRDQREKLIQEVSSAFSGKLNILVNNVGTSVRKPTVEYTSEDYAKIMSTNLES  123

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +H++Q+ +PLLKA+G  SIVFISS+AG + L   S+Y ++K A+NQLT+NLACEW  D 
Sbjct  124  AFHISQIAHPLLKASGVGSIVFISSVAGLVRLSTASIYGATKGALNQLTRNLACEWAGDN  183

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAK--MYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
            IR N+V+P  ++T++     ++P + K      ++ RTPL  + E  E++ LVAFLCLP 
Sbjct  184  IRTNSVAPWYIKTSL-----VEPLLEKKGFVDAVVDRTPLGRVGEPEEVASLVAFLCLP-  237

Query  208  AASHITGQVILIDGGYT  158
            AAS+ITGQVI +DGG+T
Sbjct  238  AASYITGQVIAVDGGFT  254



>gb|AFK34404.1| unknown [Lotus japonicus]
Length=265

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 181/254 (71%), Gaps = 5/254 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSL+GMTALV+GG++GIG  IVEELA  GA VHTCSRN+ +L + + +W +KG++V+GS
Sbjct  12   RWSLQGMTALVTGGSKGIGYEIVEELAHLGATVHTCSRNEAQLTESLHQWASKGYRVTGS  71

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            VCD ASR QR+ LI  V+S FNGKLNILVNN   + L+   DY  ++ S +  TNLES +
Sbjct  72   VCDAASRAQREDLIARVSSEFNGKLNILVNNVGTNILKPTVDYTEDDFSFLTNTNLESAF  131

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            H+ QL++PLLKA+G ASIVFISS+AG I     S+Y ++K AINQLT+NLACEW  D IR
Sbjct  132  HITQLSHPLLKASGAASIVFISSIAGLITFNG-SIYGAAKGAINQLTRNLACEWANDNIR  190

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAASH  197
             N V+P  +RT + +    D    K+   I  R PL  I  A E+S +VAFLCLP AAS 
Sbjct  191  TNCVAPGPIRTPLAESALKDE---KLVTSITSRIPLGRIGRAEEVSSMVAFLCLP-AASF  246

Query  196  ITGQVILIDGGYTA  155
            +TGQ+I +DGG TA
Sbjct  247  MTGQIISVDGGMTA  260



>ref|XP_004979872.1| PREDICTED: tropinone reductase homolog At1g07440-like [Setaria 
italica]
Length=262

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/257 (55%), Positives = 184/257 (72%), Gaps = 5/257 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M +RWSL G TALV+GG++GIG AIVEELAGFGA VHTC+RN  ELE   + W+ KG +V
Sbjct  8    MAERWSLAGATALVTGGSKGIGHAIVEELAGFGARVHTCARNAAELEACRRRWEEKGLQV  67

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            + SVCD++ R  R+ L+ TV   F+GKL+ILVNNA  S  + A D   E+ + I+ TNLE
Sbjct  68   TVSVCDVSVRSDREDLMATVKDTFDGKLDILVNNAGQSLFKAAADCTGEDYASIMATNLE  127

Query  565  SPYHLAQLTYPLLKATGN-ASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGK  389
            S +HL+QL +PLL A+    S+V ISS+AG I LPA++VY+ +K A+NQLT++LA EW  
Sbjct  128  SCFHLSQLAHPLLLASSTGGSVVHISSVAGFIGLPALAVYSMTKGAMNQLTRSLAAEWAH  187

Query  388  DGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
            DGIRVN V+P GVRT I     IDP + K   + M R P+  IAE  E++ +VAFLC+P 
Sbjct  188  DGIRVNCVAPGGVRTDISNDRTIDPELVK---KEMARLPMGRIAEPEEVASMVAFLCMP-  243

Query  208  AASHITGQVILIDGGYT  158
            AAS++TGQVI +DGG T
Sbjct  244  AASYMTGQVICVDGGRT  260



>ref|XP_009125632.1| PREDICTED: tropinone reductase homolog At1g07440-like [Brassica 
rapa]
Length=263

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 189/255 (74%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSL G TALV+GGTRGIG A+VEELA FGA VHTCSR+Q+EL+  + +W++ G  ++
Sbjct  5    DKRWSLAGKTALVTGGTRGIGRAVVEELARFGATVHTCSRSQEELKSCLDDWKSNGLVIT  64

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD + R+QR+ LI  V+SVF+GK+NILVNN   +  +   +Y +E+ ++I+ TNLES
Sbjct  65   GSVCDASVRDQRENLIQEVSSVFSGKINILVNNVGTNLRKPTVEYTSEDYAKIMSTNLES  124

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +H +Q+ +PLLKA+G  SIVFISS+AG + L + SVY ++K A+NQLT+NLACEW  D 
Sbjct  125  AFHFSQIAHPLLKASGVGSIVFISSVAGLVHLSSGSVYGATKGALNQLTRNLACEWAGDN  184

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  ++T+++KP        +    I+ RTPL  + E  E+S LVAFLCLP AA
Sbjct  185  IRTNCVAPWYIKTSLVKPLLEKKGFEEA---IVSRTPLGRVGEPEEVSSLVAFLCLP-AA  240

Query  202  SHITGQVILIDGGYT  158
            S+ITGQVI +DGG+T
Sbjct  241  SYITGQVISVDGGFT  255



>dbj|BAC65128.2| short chain alcohol dehydrogenase-like protein [Daucus carota]
Length=302

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 188/263 (71%), Gaps = 19/263 (7%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            N RWSL GMTALV+GGTRGIG AIVEELA  GA V+TCSRN++EL ++++EW+AKGF V+
Sbjct  43   NSRWSLAGMTALVTGGTRGIGHAIVEELAELGACVYTCSRNEQELNERLEEWRAKGFDVT  102

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD++S  +R+QL   ++S F GKL+IL+NN   +  R  ++Y AE+ S ++ TNLE+
Sbjct  103  GSVCDVSSVTEREQLFQRISSCFGGKLHILINNVGTNIRRATENYTAEQYSIVMATNLEA  162

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAG--HIALPAISVYASSKAAINQLTKNLACEWGK  389
            PYH  QL YPLLKA+G+  IVF SS+AG  H+  P  SVY ++K AINQLTKNLACEW K
Sbjct  163  PYHACQLAYPLLKASGSGCIVFNSSVAGLVHLGTPG-SVYGAAKGAINQLTKNLACEWAK  221

Query  388  DGIRVNTVSPSGVRTTIMKPEEIDPSIAKMY------GEIMMRTPLKPIAEANEISPLVA  227
            D IR N V+P  ++T         P + K++        ++ RTPL+   E  E+S LVA
Sbjct  222  DNIRTNCVAPGYIKT---------PPVEKLFERKNFLDRLVSRTPLRRPGETEEVSSLVA  272

Query  226  FLCLPAAASHITGQVILIDGGYT  158
            +LC+P AAS+ITGQ+I IDGG T
Sbjct  273  YLCMP-AASYITGQIIAIDGGLT  294



>emb|CDY62820.1| BnaC04g56400D [Brassica napus]
Length=263

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 186/257 (72%), Gaps = 5/257 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M+ RWSL+GMTALV+GG  GIG AIVEELA FGA +H C  ++  L Q + EW+ KGF+V
Sbjct  1    MDNRWSLEGMTALVTGGASGIGHAIVEELASFGARIHVCDISETLLNQSLSEWEKKGFQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            SGS+CD++SR +R+ L+ TV+++F+GKL+ILVNN A+   +   +Y+A + S  I TNLE
Sbjct  61   SGSICDVSSRPERETLMQTVSAIFDGKLSILVNNVAVVHTKPTTEYDANDFSFQISTNLE  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            S YHL+QL++PLLKA+G  SIV ISS+ G +++   S+Y+ +K A+NQL KNLACEW +D
Sbjct  121  SAYHLSQLSHPLLKASGFGSIVMISSVGGVVSMCCGSIYSLAKGALNQLAKNLACEWARD  180

Query  385  GIRVNTVSPSGVRTTIM-KPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
            GIR N+V+P+ V  T M KP   D    K    ++ RTPL    E NE++ LVAFLCLP 
Sbjct  181  GIRTNSVAPNFVNNTTMAKPFFKDADYEK---SLLNRTPLGRAGEPNEVASLVAFLCLP-  236

Query  208  AASHITGQVILIDGGYT  158
            AAS+ITGQ I +DGG T
Sbjct  237  AASYITGQTICVDGGLT  253



>ref|XP_002873234.1| hypothetical protein ARALYDRAFT_487407 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49493.1| hypothetical protein ARALYDRAFT_487407 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/257 (54%), Positives = 191/257 (74%), Gaps = 8/257 (3%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSL G TALV+GGTRGIG A+VEELA FGA+VHTCSRNQ+EL   + +W++ G  VS
Sbjct  4    DKRWSLAGKTALVTGGTRGIGRAVVEELAKFGAKVHTCSRNQEELNACLNDWKSNGLVVS  63

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD + R+QR++LI   +S F+GKLNILVNN   +  +   +Y +EE ++I+ TNLES
Sbjct  64   GSVCDASVRDQREKLIQEASSAFSGKLNILVNNVGTNVRKPTVEYSSEEYAKIMTTNLES  123

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +HL+Q+ +PLLKA+G  SIVFISS+AG + L + S+Y ++K A+NQLT+NLACEW +D 
Sbjct  124  AFHLSQIAHPLLKASGVGSIVFISSVAGLVHLQSGSIYGATKGALNQLTRNLACEWARDN  183

Query  382  IRVNTVSPSGVRTTIMKP--EEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
            IR N V+P  ++T++++   E+ D         ++ RTPL  + E  E++ LVAFLCLP 
Sbjct  184  IRTNCVAPWYIKTSLVETLLEKKD-----FVEAVVSRTPLGRVGEPEEVASLVAFLCLP-  237

Query  208  AASHITGQVILIDGGYT  158
            AAS+ITGQVI +DGG+T
Sbjct  238  AASYITGQVISVDGGFT  254



>ref|XP_007140477.1| hypothetical protein PHAVU_008G115900g [Phaseolus vulgaris]
 gb|ESW12471.1| hypothetical protein PHAVU_008G115900g [Phaseolus vulgaris]
Length=266

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 187/260 (72%), Gaps = 8/260 (3%)
 Frame = -2

Query  931  CGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGF  752
            C  ++RWSL GMTALV+GGTRGIG AI EELA FGA VH C+RNQ ++++ V+EW  KGF
Sbjct  8    CFKDKRWSLHGMTALVTGGTRGIGLAIAEELAEFGAVVHVCARNQHDIDRCVEEWNKKGF  67

Query  751  KVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTN  572
            +++GSVCD+ S++QR+ L+  V S+F GKLNILVNNA  +  +   DY  E+++ ++ TN
Sbjct  68   RITGSVCDVLSQDQRENLMKNVASIFQGKLNILVNNAGTASTKSVLDYTGEDVTTLMGTN  127

Query  571  LESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWG  392
             E+ +HL QL +PLLKA+G  +IVFISS+AG  A P  S YA+SK A+NQ TKN+A EW 
Sbjct  128  FEACFHLCQLAHPLLKASGYGNIVFISSVAGLKAFPLCSAYAASKGALNQFTKNVALEWA  187

Query  391  KDGIRVNTVSPSGVRT----TIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAF  224
            KD IR NTV+P  V+T     +M+  +++ ++ +    ++  +P   I E  +IS +VAF
Sbjct  188  KDNIRANTVAPGAVKTDLLDALMECADVNKNVVE---AVVTESPAGRIGEPKDISGMVAF  244

Query  223  LCLPAAASHITGQVILIDGG  164
            LCLP AAS+ITGQ+I +DGG
Sbjct  245  LCLP-AASYITGQIITVDGG  263



>gb|AGB56644.1| tropinone reductase I [Withania coagulans]
Length=273

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/255 (52%), Positives = 191/255 (75%), Gaps = 2/255 (1%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RWSLKG TALV+GG++GIG A VEELAG GA V+TCSRN+ EL+Q ++ W+ KGFKV GS
Sbjct  16   RWSLKGTTALVTGGSKGIGYATVEELAGLGATVYTCSRNENELQQCLEIWREKGFKVEGS  75

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            +CDL  R + ++L+ TV  VF+GKLNILVNNA +   ++AKD+  ++ + I+ TN E+ Y
Sbjct  76   ICDLLVRTEHEKLMQTVADVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAY  135

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL+Q+ YPLLKA+ N +++F+SS+AG  ALP++S+Y++SK AINQ+TKNLACEW KD IR
Sbjct  136  HLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKNLACEWAKDNIR  195

Query  376  VNTVSPSGVRTTIMKPE-EIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            VN+V+P  + T +++   + +P         +++TP+    +  E++ ++AFLC P AAS
Sbjct  196  VNSVAPGVIVTPLVEAAIKKNPQQKDEIDNFVVKTPMGRAGKPGEVAAVIAFLCFP-AAS  254

Query  199  HITGQVILIDGGYTA  155
            ++TGQ+I  DGG+TA
Sbjct  255  YVTGQIIWADGGFTA  269



>ref|XP_010658532.1| PREDICTED: tropinone reductase homolog At1g07440 isoform X1 [Vitis 
vinifera]
Length=272

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 187/265 (71%), Gaps = 3/265 (1%)
 Frame = -2

Query  943  ASEQCGMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQ  764
            A+E    + RWSLKG TALV+GGT GIG AIVEELAG GA V+TCSR + +L   +++W 
Sbjct  4    AAESSCSDLRWSLKGATALVTGGTLGIGYAIVEELAGMGAAVYTCSRTESKLNNLLRDWN  63

Query  763  AKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRI  584
            AKGF V GSVCD++ R QR+QLI  V+S FNGKLNIL+NN   +  +   +Y A + S +
Sbjct  64   AKGFDVRGSVCDVSDRAQREQLIEKVSSGFNGKLNILINNVGTNFSKPTIEYTAADFSAL  123

Query  583  IQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLA  404
            + TN+ES YHL QL YPLLKA+G  SIVFISS+AG ++    S+YA++KAA+NQ+TK+LA
Sbjct  124  MATNIESGYHLCQLAYPLLKASGAGSIVFISSVAGVVSTGTGSIYAATKAAMNQITKSLA  183

Query  403  CEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAF  224
            CEW KD IR N V+P   RT ++  E++  +   M  E++ RTPL    E  EIS L  F
Sbjct  184  CEWAKDNIRSNCVAPFCTRTPLI--EQVMLAKKSMMEEVVSRTPLGRPGEPQEISSLATF  241

Query  223  LCLPAAASHITGQVILIDGGYTAGA  149
            LC+P  AS+ITGQVI +DGG TA A
Sbjct  242  LCMP-CASYITGQVISVDGGLTANA  265



>ref|XP_009140976.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Brassica rapa]
Length=273

 Score =   285 bits (728),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/258 (54%), Positives = 187/258 (72%), Gaps = 5/258 (2%)
 Frame = -2

Query  928  GMNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFK  749
            G+  RWSL+GMTALV+GG RGIG AIVEELA FGA+VH C  ++  L Q + EWQ KGF+
Sbjct  10   GVKSRWSLQGMTALVTGGARGIGFAIVEELAAFGAKVHVCDISETLLNQSLNEWQKKGFQ  69

Query  748  VSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNL  569
            VSGSVCD++SR +R+ L+ TV+S+F GKLN+LVNN    + +   +Y AE+ S  I TNL
Sbjct  70   VSGSVCDVSSRPERETLMQTVSSLFGGKLNVLVNNVGGVRAKPTLEYTAEDFSFHITTNL  129

Query  568  ESPYHLAQLTYPLLKATGNASIVFISSLAGHI-ALPAISVYASSKAAINQLTKNLACEWG  392
            ES YHL+QL++PLLKA+G+ SIVFISS+AG + A   +S+Y+++K A+NQL +NLACEW 
Sbjct  130  ESAYHLSQLSHPLLKASGSGSIVFISSIAGVVSAANYVSIYSATKGALNQLARNLACEWA  189

Query  391  KDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLP  212
            +DGIR N V+P+ + T + +P   D  + +    +  RTPL    E  E++ LV FLCLP
Sbjct  190  RDGIRANAVAPNVINTPLSQPFLDDLGLKE---SLFSRTPLGRAGEPREVASLVVFLCLP  246

Query  211  AAASHITGQVILIDGGYT  158
             AAS+ITGQ I +DGG T
Sbjct  247  -AASYITGQTICVDGGLT  263



>ref|XP_004237405.1| PREDICTED: tropinone reductase homolog [Solanum lycopersicum]
Length=263

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/257 (54%), Positives = 190/257 (74%), Gaps = 6/257 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            + RWSL GMTALV+GGTRGIG AIVEELA FGA ++TCSRN+K+L++ +++WQ KG+KV+
Sbjct  6    DGRWSLHGMTALVTGGTRGIGYAIVEELASFGASIYTCSRNKKDLDECLEKWQTKGYKVN  65

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GS CDL   +QR +LI   T  FNG+L+ILVNNAAI   ++     + + S ++ TN E+
Sbjct  66   GSTCDLFLEDQRIELIGKATQHFNGELDILVNNAAICVPKETTQITSADCSLMMGTNFEA  125

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             Y+L QL YP LK +G AS+VFISS++G +A+P +S+YA++K AINQLTKNLACEWGKD 
Sbjct  126  SYNLCQLAYPFLKGSGKASVVFISSISGIMAIPFVSLYAATKGAINQLTKNLACEWGKDN  185

Query  382  IRVNTVSPSGVRTTIMK--PEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPA  209
            IRVN V+P  + T +     E+ + S  +   +++ RTP+  + + NE+S LVA+LC PA
Sbjct  186  IRVNAVAPWIIDTALTDTVAEDFESSDVE---KLIKRTPISRMGKPNEVSSLVAYLCFPA  242

Query  208  AASHITGQVILIDGGYT  158
            AA +ITGQ+I +DGG T
Sbjct  243  AA-YITGQIICVDGGKT  258



>ref|XP_007205726.1| hypothetical protein PRUPE_ppa010064mg [Prunus persica]
 gb|EMJ06925.1| hypothetical protein PRUPE_ppa010064mg [Prunus persica]
Length=266

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 188/254 (74%), Gaps = 4/254 (2%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            +RWSL+G+TALV+GGT+GIG AIVEELAG GA +HTC+RN+ +L   + +W+ KGF+V+G
Sbjct  8    RRWSLEGLTALVTGGTKGIGHAIVEELAGLGATIHTCARNEVDLNDCLSQWEKKGFQVTG  67

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCD+ SR QR++LI+ V+S+F+GKLNIL+NN   S L+   ++ AE+ + ++ TNLES 
Sbjct  68   SVCDVVSRAQREELINKVSSLFDGKLNILINNVGTSILKPTMEFTAEDYTFLMSTNLESA  127

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            YH  QL +PLLKA+G  +IVF+SS+AG +++   S Y+++K AINQL KNLACEW KD I
Sbjct  128  YHFCQLAHPLLKASGAGNIVFLSSVAGVVSVEVGSAYSATKGAINQLAKNLACEWAKDNI  187

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            R+N+V+P  ++T + +    D    K+   I  RTPL    E  E+S LVAFLCLP AAS
Sbjct  188  RINSVAPWFIKTPLAEHFLSDEFFLKI---INSRTPLGRPGEPEEVSALVAFLCLP-AAS  243

Query  199  HITGQVILIDGGYT  158
            +ITGQ I +DGG T
Sbjct  244  YITGQTICVDGGMT  257



>gb|AFD23287.1| tropinone reductase I, partial [Dendrobium nobile]
Length=268

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 185/257 (72%), Gaps = 5/257 (2%)
 Frame = -2

Query  919  QRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSG  740
            +RWSL G TALV+GG++GIG AIVEELA  GA VHTCSRN++ELE  + +W+   F ++G
Sbjct  17   RRWSLSGATALVTGGSKGIGYAIVEELAALGASVHTCSRNEEELESCLHKWRCLNFNITG  76

Query  739  SVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESP  560
            SVCD++S EQR +LI  V+S+F+GKLNIL+NNA     ++  D  AE+ S ++ TNLES 
Sbjct  77   SVCDVSSHEQRVKLIEKVSSLFHGKLNILINNAGTYLRKQIVDSTAEDYSFMMSTNLESA  136

Query  559  YHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGI  380
            +HL+QL +PLLKA+G  SIVFISS+AG +  P I++Y+++K A+NQLTKN A EWGKDGI
Sbjct  137  FHLSQLAHPLLKASGEGSIVFISSIAGLLGYPDIAIYSATKGALNQLTKNFASEWGKDGI  196

Query  379  RVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAAS  200
            R N V+P   RT +  P   D  +A+     M   PL  I E  E++ + AFLCLP AAS
Sbjct  197  RTNCVAPGVTRTPLSIPYLEDEEVARK----MAILPLGRIGEPEEVASITAFLCLP-AAS  251

Query  199  HITGQVILIDGGYTAGA  149
            +ITGQ+I +DGG T GA
Sbjct  252  YITGQIICVDGGRTLGA  268



>ref|NP_196225.1| putative tropine dehydrogenase [Arabidopsis thaliana]
 dbj|BAA98195.1| short chain alcohol dehydrogenase-like [Arabidopsis thaliana]
 gb|AAO22710.1| putative short chain alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAO42448.1| putative short chain alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AED90960.1| putative tropine dehydrogenase [Arabidopsis thaliana]
Length=264

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 188/255 (74%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSL G TALV+GGTRGIG A+VEELA FGA+VHTCSRNQ+EL   + +W+A G  VS
Sbjct  4    DKRWSLAGKTALVTGGTRGIGRAVVEELAKFGAKVHTCSRNQEELNACLNDWKANGLVVS  63

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD + R+QR++LI   +S F+GKLNIL+NN   +  +   +Y +EE ++I+ TNLES
Sbjct  64   GSVCDASVRDQREKLIQEASSAFSGKLNILINNVGTNVRKPTVEYSSEEYAKIMSTNLES  123

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +HL+Q+ +PLLKA+G  SIVFISS+AG + L + S+Y ++K A+NQLT+NLACEW  D 
Sbjct  124  AFHLSQIAHPLLKASGVGSIVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDN  183

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N V+P  ++T+++   E      +    ++ RTPL  + E  E+S LVAFLCLP A+
Sbjct  184  IRTNCVAPWYIKTSLV---ETLLEKKEFVEAVVSRTPLGRVGEPEEVSSLVAFLCLP-AS  239

Query  202  SHITGQVILIDGGYT  158
            S+ITGQVI +DGG+T
Sbjct  240  SYITGQVISVDGGFT  254



>ref|XP_010521892.1| PREDICTED: tropinone reductase homolog At1g07440-like [Tarenaya 
hassleriana]
Length=272

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 186/256 (73%), Gaps = 4/256 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M+ RWSL+GMTALV+GG RGIG AIVEELAGFGA +HTC +++  L Q ++EW+ KGF+V
Sbjct  1    MDSRWSLRGMTALVTGGARGIGHAIVEELAGFGARIHTCDKSEVHLNQSLREWKEKGFQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            SGSVCD++SR QR++L+HTV+S+F GKLNIL+NN  I   +   +Y AE+ S  + TNLE
Sbjct  61   SGSVCDVSSRPQREKLMHTVSSLFGGKLNILINNVGICVTKPTVEYTAEDYSLQMTTNLE  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            S +HL+QL +PLLKA+G  SIV ++S+ G +++P+ S+  +SK A+NQL +NLACEW  +
Sbjct  121  STFHLSQLGHPLLKASGYGSIVLVTSIGGVVSVPSGSICGASKGAMNQLARNLACEWASE  180

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
            GIR N V+PS V T +    +   S   +   I  RTPL    E  E++ LV FLCLP A
Sbjct  181  GIRANAVAPSLVLTPL---GQYIASHKNLQEGIESRTPLGRTGEPKEVAALVTFLCLP-A  236

Query  205  ASHITGQVILIDGGYT  158
            AS+ITGQ I +DGG+T
Sbjct  237  ASYITGQTICVDGGFT  252



>ref|XP_008358998.1| PREDICTED: tropinone reductase homolog At1g07440-like [Malus 
domestica]
Length=264

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 190/259 (73%), Gaps = 7/259 (3%)
 Frame = -2

Query  925  MNQR---WSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKG  755
            MN R   WSL+GMTALV+GGT+GIG AIVEELAG GA VHTCSRN+ +L   + +W+ KG
Sbjct  1    MNSRERTWSLRGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCLSQWEKKG  60

Query  754  FKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQT  575
            F+V+GSVCD+ S+ QR++LI+ V+S+F+GKLNIL+NN  I + +   +Y AE+ S I+ T
Sbjct  61   FQVTGSVCDVVSKTQREELINKVSSLFDGKLNILINNVGIVEAKATVEYTAEDYSFIMST  120

Query  574  NLESPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEW  395
            NLES Y+  QL++PLLKA G A+IVF+SS AG +++   S+Y+++K A+NQL KNLACEW
Sbjct  121  NLESAYNFCQLSHPLLKAAGAANIVFLSSTAGVVSINGASIYSAAKGAMNQLAKNLACEW  180

Query  394  GKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCL  215
             KD IR N+V+P  + T + +P   +    +M   I  R PL+   E  E+S LVAFLCL
Sbjct  181  AKDNIRTNSVAPWFITTPLSEPVLRNEKKLEM---INSRCPLRRPGEPEEVSSLVAFLCL  237

Query  214  PAAASHITGQVILIDGGYT  158
            P AAS+ITGQ I++DGG T
Sbjct  238  P-AASYITGQTIIVDGGVT  255



>ref|XP_002879210.1| hypothetical protein ARALYDRAFT_481850 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ABW81044.1| putative tropinon-reductase- [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55469.1| hypothetical protein ARALYDRAFT_481850 [Arabidopsis lyrata subsp. 
lyrata]
Length=269

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/255 (53%), Positives = 189/255 (74%), Gaps = 5/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            N RWSL GMTALV+GG++GIG A+VEELA  GA VHTC+R++ +L+++++EWQAKGF+V+
Sbjct  10   NSRWSLGGMTALVTGGSKGIGEAVVEELAILGARVHTCARDETQLQERLREWQAKGFQVT  69

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
             SVCD++SR+QR +L+ TV+S++ GKLNILVNN   S  +   +Y AE+ S ++ TNLES
Sbjct  70   TSVCDVSSRDQRVKLMETVSSLYQGKLNILVNNVGTSIFKPTTEYTAEDFSFVMATNLES  129

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             +HL+QL++PLLKA+G+ SIV +SS AG + +   S+Y ++K A+NQL +NLACEW  D 
Sbjct  130  AFHLSQLSHPLLKASGSGSIVLMSSTAGVVHVNVGSIYGATKGAMNQLARNLACEWASDN  189

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N+V P  + TT +  +  D    K   E +  TP+  + EANE+S LVAFLCLP +A
Sbjct  190  IRTNSVCPWYI-TTPLSNDFFDEEFKK---EAVRNTPMGRVGEANEVSSLVAFLCLP-SA  244

Query  202  SHITGQVILIDGGYT  158
            S+ITGQ I +DGG T
Sbjct  245  SYITGQTICVDGGAT  259



>ref|XP_008387076.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
Length=264

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 189/255 (74%), Gaps = 4/255 (2%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVS  743
            ++RWSLKGMTALV+GGT+GIG AIVEELAG GA VHTCSRN+ +L   + +W+ KGF+V+
Sbjct  5    DKRWSLKGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCLSQWEKKGFQVT  64

Query  742  GSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLES  563
            GSVCD+ S+ QR++LI+ V+S+F+GKLNIL+NN   ++ +   +Y AE+ S ++  NLES
Sbjct  65   GSVCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFMMSINLES  124

Query  562  PYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDG  383
             YHL QL++PLLKA+G+A+IVF+SS+AG ++L   S+Y+++K AINQL KNLACEW KD 
Sbjct  125  AYHLCQLSHPLLKASGSANIVFLSSVAGVVSLEVGSIYSATKGAINQLAKNLACEWAKDK  184

Query  382  IRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAAA  203
            IR N+V+P  + T +    E+     K    I  R PL    E  E+S LVAFLCLP AA
Sbjct  185  IRTNSVAPWFITTPL---GEMFLGNKKKSAVINSRCPLGRPGEPEEVSSLVAFLCLP-AA  240

Query  202  SHITGQVILIDGGYT  158
            S+ITGQ I +DGG T
Sbjct  241  SYITGQTITVDGGVT  255



>emb|CAN69508.1| hypothetical protein VITISV_016038 [Vitis vinifera]
Length=298

 Score =   285 bits (729),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/283 (51%), Positives = 195/283 (69%), Gaps = 32/283 (11%)
 Frame = -2

Query  922  NQRWSLKGMTALVSGGTRGIGA----------------------------AIVEELAGFG  827
            + RWSLKGMTALV+GGT+GIG                             AIVEELAG G
Sbjct  11   DSRWSLKGMTALVTGGTKGIGFVMLPVFYVFGLDYTFLPIYKCMYQLCRHAIVEELAGLG  70

Query  826  AEVHTCSRNQKELEQKVQEWQAKGFKVSGSVCDLASREQRQQLIHTVTSVFNGKLNILVN  647
            A +HTCSR + EL + +++W+AKGF VSGSVCD++SR QR++L+ T++SVFNGKLNIL+N
Sbjct  71   ATIHTCSRKETELNECLKDWKAKGFGVSGSVCDVSSRAQREKLMQTISSVFNGKLNILIN  130

Query  646  NAAISKLRKAKDYEAEELSRIIQTNLESPYHLAQLTYPLLKATGNASIVFISSLAGHIAL  467
            NAAIS  +   +  AEE S I+ TN ES YHL+Q+ +PLLKA+G  SIVFISS++G +A 
Sbjct  131  NAAISIQKPTIEVTAEEFSTIMATNFESVYHLSQIAHPLLKASGAGSIVFISSVSGIVAH  190

Query  466  PAISVYASSKAAINQLTKNLACEWGKDGIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEI  287
              IS Y+ +K A+NQLTKNLACEW KD IR N V+P  ++T +++    + +  +   E+
Sbjct  191  KNISAYSVTKGAMNQLTKNLACEWAKDNIRSNAVAPWYIKTPMVEQMLTNQAFLE---EV  247

Query  286  MMRTPLKPIAEANEISPLVAFLCLPAAASHITGQVILIDGGYT  158
            + R PL+ + +  E+S LVAFLCLP A+S+ITGQ+I +DGG T
Sbjct  248  INRAPLRRVGDPKEVSSLVAFLCLP-ASSYITGQIICVDGGMT  289



>ref|XP_010414408.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=261

 Score =   283 bits (725),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 191/256 (75%), Gaps = 5/256 (2%)
 Frame = -2

Query  925  MNQRWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKV  746
            M +RWSL+GMTALV+GG++GIG A+VEEL+  GA VHTC+R++ +L++ +++WQAKGF+V
Sbjct  1    MEKRWSLQGMTALVTGGSKGIGEAVVEELSMLGARVHTCARDETQLQESLRKWQAKGFQV  60

Query  745  SGSVCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLE  566
            S S+CD++SREQR++LI TV+S+F GKLNILVNNA     +   ++  EE S I+ TNLE
Sbjct  61   STSICDVSSREQREKLIETVSSLFQGKLNILVNNAGTFIDKPTTEFTTEEYSFIMATNLE  120

Query  565  SPYHLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKD  386
            S +HL+QL++PLLKA+ +  IVF+SS++G +     SVY ++K A+NQL +NLACEW  D
Sbjct  121  SAFHLSQLSHPLLKASSSGGIVFMSSVSG-VVHTGSSVYGATKGAMNQLGRNLACEWASD  179

Query  385  GIRVNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPLKPIAEANEISPLVAFLCLPAA  206
             IRVN+V P  + T ++     D  + K    +  RTP+  + EANE+S LVAFLCLP A
Sbjct  180  NIRVNSVCPWVITTPLVADMLSDEKVNK---AVESRTPMGRVGEANEVSLLVAFLCLP-A  235

Query  205  ASHITGQVILIDGGYT  158
            AS+ITGQ I +DGG+T
Sbjct  236  ASYITGQTICVDGGFT  251



>ref|XP_006341201.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=263

 Score =   283 bits (725),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 190/255 (75%), Gaps = 4/255 (2%)
 Frame = -2

Query  916  RWSLKGMTALVSGGTRGIGAAIVEELAGFGAEVHTCSRNQKELEQKVQEWQAKGFKVSGS  737
            RW+L+G TA+V+GGTRGIG AIVEELA FGA V+TCSRNQ EL++ +++W+AKGFKV GS
Sbjct  6    RWTLQGNTAIVTGGTRGIGYAIVEELASFGANVYTCSRNQMELDECLRKWKAKGFKVGGS  65

Query  736  VCDLASREQRQQLIHTVTSVFNGKLNILVNNAAISKLRKAKDYEAEELSRIIQTNLESPY  557
            +CDL SR QRQ+ +  V+S F+GK+NIL+NNAA+     A +   E+ + ++ TN E+ Y
Sbjct  66   MCDLLSRTQRQKFMDNVSSYFDGKINILINNAAVIVSNLATESTHEDYNTMMGTNFEASY  125

Query  556  HLAQLTYPLLKATGNASIVFISSLAGHIALPAISVYASSKAAINQLTKNLACEWGKDGIR  377
            HL+QL +P LKA+ N  IVFISS+AG ++LP  S+Y+++K A+NQLT++LACEW  D IR
Sbjct  126  HLSQLAHPFLKASKNGRIVFISSVAGFVSLPFCSIYSAAKGAMNQLTRSLACEWAMDNIR  185

Query  376  VNTVSPSGVRTTIMKPEEIDPSIAKMYGEIMMRTPL--KPIAEANEISPLVAFLCLPAAA  203
            VN V+P  ++T++++    D  + K   +++ RTP+  +P  E  E+S +VAFLC P  A
Sbjct  186  VNAVAPWVIKTSLIEAASQDSEVKKRINKLVSRTPIGGRP-GEPKEVSAMVAFLCFP-CA  243

Query  202  SHITGQVILIDGGYT  158
            S+ITGQ++ +DGG T
Sbjct  244  SYITGQIMCVDGGIT  258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2715430209141