BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23722_g2_i1 len=470 path=[1:0-70 72:71-132 134:133-426 428:427-469]

Length=470
                                                                      Score     E

ref|XP_006367961.1|  PREDICTED: viridiflorene synthase-like             192   1e-54   
ref|XP_006358528.1|  PREDICTED: vetispiradiene synthase 1-like          183   1e-51   
ref|XP_009621868.1|  PREDICTED: vetispiradiene synthase 2               175   2e-51   
ref|XP_009766331.1|  PREDICTED: 5-epi-aristolochene synthase 2-like     179   2e-51   
ref|XP_009589983.1|  PREDICTED: 5-epi-aristolochene synthase-like       180   2e-50   
ref|XP_009794139.1|  PREDICTED: vetispiradiene synthase 2-like          179   5e-50   
ref|XP_009593021.1|  PREDICTED: vetispiradiene synthase 2-like          168   5e-49   
ref|XP_011082260.1|  PREDICTED: vetispiradiene synthase 3-like          176   8e-49   
ref|XP_009764785.1|  PREDICTED: vetispiradiene synthase 3-like          175   1e-48   
ref|XP_006358572.1|  PREDICTED: vetispiradiene synthase 1-like          171   2e-48   
ref|XP_009773139.1|  PREDICTED: vetispiradiene synthase 3               174   3e-48   
sp|Q39979.1|VTSS2_HYOMU  RecName: Full=Vetispiradiene synthase 2;...    168   5e-48   Hyoscyamus muticus
ref|XP_009621273.1|  PREDICTED: vetispiradiene synthase 2-like          165   6e-48   
ref|XP_004230359.1|  PREDICTED: vetispiradiene synthase 1               173   7e-48   
ref|XP_009764783.1|  PREDICTED: viridiflorene synthase-like             172   1e-47   
ref|XP_010313902.1|  PREDICTED: vetispiradiene synthase 1 isoform X2    171   2e-47   
ref|XP_004230358.1|  PREDICTED: vetispiradiene synthase 1 isoform X1    171   4e-47   
ref|XP_011082247.1|  PREDICTED: vetispiradiene synthase 3-like          171   4e-47   
ref|XP_011082248.1|  PREDICTED: vetispiradiene synthase 3-like          171   6e-47   
ref|XP_009617319.1|  PREDICTED: LOW QUALITY PROTEIN: vetispiradie...    171   6e-47   
ref|XP_009597892.1|  PREDICTED: vetispiradiene synthase 2-like          162   1e-46   
sp|Q39980.1|VTSS3_HYOMU  RecName: Full=Vetispiradiene synthase 3;...    166   1e-46   Hyoscyamus muticus
ref|NP_001275083.1|  uncharacterized protein LOC102595695               169   2e-46   
sp|Q9XJ32.1|VTSS1_SOLTU  RecName: Full=Vetispiradiene synthase 1        169   2e-46   Solanum tuberosum [potatoes]
gb|AAK15641.1|AF326117_1  sesquiterpene cyclase                         169   2e-46   Capsicum annuum
gb|AAD02268.1|  putative vetispiradiene synthase 3                      169   3e-46   Solanum tuberosum [potatoes]
dbj|BAA82108.1|  vetispiradiene synthase                                169   3e-46   Solanum tuberosum [potatoes]
gb|AAK15642.1|AF326118_1  sesquiterpene cyclase                         168   4e-46   Capsicum annuum
ref|XP_006358531.1|  PREDICTED: viridiflorene synthase-like             168   4e-46   
ref|XP_009599829.1|  PREDICTED: 5-epi-aristolochene synthase 3-like     166   5e-46   
ref|NP_001274950.1|  putative vetispiradiene synthase 3                 168   6e-46   
gb|AAG09950.1|AF171218_1  vetispiradiene synthase                       166   7e-46   Solanum lycopersicum
ref|NP_001275171.1|  putative vetispiradiene synthase 5                 167   1e-45   
gb|AAD02223.1|  vetispiradiene synthase                                 167   1e-45   Solanum tuberosum [potatoes]
ref|XP_004230360.1|  PREDICTED: vetispiradiene synthase 1               167   1e-45   
gb|AAG09949.1|AF171216_1  vetispiradiene synthase                       167   1e-45   Solanum lycopersicum
ref|XP_009595428.1|  PREDICTED: 5-epi-aristolochene synthase            167   2e-45   
dbj|BAN58139.1|  putative vetispiradiene synthase                       167   2e-45   
ref|NP_001239040.1|  viridiflorene synthase                             166   2e-45   
gb|AAA86337.1|  vetispiradiene synthase                                 166   3e-45   Hyoscyamus muticus
sp|Q84LG0.1|5EAS4_NICAT  RecName: Full=Probable 5-epi-aristoloche...    166   3e-45   Nicotiana attenuata
sp|Q39978.2|VTSS1_HYOMU  RecName: Full=Vetispiradiene synthase 1;...    166   4e-45   Hyoscyamus muticus
gb|AAA19216.1|  5-epi-aristolochene synthase                            165   6e-45   Nicotiana tabacum [American tobacco]
gb|AAP79448.1|  epi-arisotolchene synthase 110                          165   6e-45   Nicotiana tabacum [American tobacco]
ref|XP_009762840.1|  PREDICTED: 5-epi-aristolochene synthase-like...    165   7e-45   
pdb|5EAS|A  Chain A, 5-Epi-Aristolochene Synthase From Nicotiana ...    164   2e-44   
pdb|1HX9|A  Chain A, Crystal Structure Of Teas W273s Form 1             164   2e-44   
pdb|5EAT|A  Chain A, 5-Epi-Aristolochene Synthase From Nicotiana ...    164   2e-44   
pdb|4DI5|A  Chain A, Co-Crystal Structure Of Wt 5-Epi-Aristoloche...    164   2e-44   
sp|Q84LF2.1|5EAS3_NICAT  RecName: Full=5-epi-aristolochene syntha...    164   2e-44   Nicotiana attenuata
sp|Q40577.3|5EAS_TOBAC  RecName: Full=5-epi-aristolochene synthas...    164   2e-44   Nicotiana tabacum [American tobacco]
pdb|5EAU|A  Chain A, 5-Epi-Aristolochene Synthase From Nicotiana ...    164   2e-44   
pdb|3M01|A  Chain A, The Crystal Structure Of 5-Epi-Aristolochene...    164   2e-44   
sp|Q84LF0.1|5EAS2_NICAT  RecName: Full=5-epi-aristolochene syntha...    164   2e-44   Nicotiana attenuata
pdb|1HXG|A  Chain A, Crystal Structure Of Teas W273sC440W               163   2e-44   
pdb|1HXC|A  Chain A, Crystal Structure Of Teas C440w                    163   3e-44   
ref|XP_009779916.1|  PREDICTED: 5-epi-aristolochene synthase            163   3e-44   
ref|XP_009771989.1|  PREDICTED: 5-epi-aristolochene synthase-like       163   3e-44   
pdb|3LZ9|A  Chain A, The Crystal Structure Of 5-Epi-Aristolochene...    163   3e-44   
ref|XP_009784555.1|  PREDICTED: 5-epi-aristolochene synthase 3          162   9e-44   
gb|AAF21053.1|AF212433_1  UV-induced sesquiterpene cyclase              161   2e-43   Capsicum annuum
sp|O65323.1|5EAS_CAPAN  RecName: Full=5-epiaristolochene synthase       160   6e-43   Capsicum annuum
emb|CAA06614.1|  5-epi-aristolochene synthase                           159   7e-43   Capsicum annuum var. annuum [chilli pepper]
gb|EYU21954.1|  hypothetical protein MIMGU_mgv1a023164mg                157   7e-42   
gb|AAG17667.1|AF272244_1  5-epi-aristolochene synthase                  155   7e-42   Nicotiana tabacum [American tobacco]
gb|AHM10157.1|  sesquiterpene synthase                                  155   3e-41   
sp|Q84LF1.1|5EAS1_NICAT  RecName: Full=5-epi-aristolochene syntha...    155   3e-41   Nicotiana attenuata
gb|EYU21989.1|  hypothetical protein MIMGU_mgv1a023416mg                151   8e-40   
gb|EYU21983.1|  hypothetical protein MIMGU_mgv1a023510mg                149   3e-39   
gb|EYU31456.1|  hypothetical protein MIMGU_mgv1a004071mg                149   4e-39   
gb|EYU22009.1|  hypothetical protein MIMGU_mgv1a010344mg                142   5e-38   
ref|XP_011073749.1|  PREDICTED: vetispiradiene synthase 3-like          146   5e-38   
gb|AAX40667.1|  sesquiterpene synthase                                  139   8e-38   Fabiana imbricata [pichi]
sp|Q49SP5.1|TPGAS_POGCB  RecName: Full=Germacrene A synthase; Alt...    145   9e-38   Pogostemon cablin
gb|EYU21979.1|  hypothetical protein MIMGU_mgv1a019334mg                144   1e-37   
gb|EYU31458.1|  hypothetical protein MIMGU_mgv1a004009mg                143   3e-37   
gb|EYU32628.1|  hypothetical protein MIMGU_mgv1a005108mg                142   6e-37   
gb|AGN72800.1|  germacrene A                                            142   9e-37   
gb|AGN72803.1|  germacrene A                                            142   1e-36   
gb|AGN72806.1|  germacrene A                                            142   1e-36   
ref|XP_011102294.1|  PREDICTED: gamma-cadinene synthase-like            140   2e-36   
ref|XP_009762844.1|  PREDICTED: probable 5-epi-aristolochene synt...    134   5e-36   
gb|AAX16076.1|  putative sesquiterpene synthase                         139   1e-35   Perilla frutescens var. frutescens
gb|EYU31464.1|  hypothetical protein MIMGU_mgv1a003909mg                139   1e-35   
gb|EYU32629.1|  hypothetical protein MIMGU_mgv1a023948mg                138   2e-35   
ref|XP_011102272.1|  PREDICTED: gamma-cadinene synthase-like            138   2e-35   
ref|XP_006354694.1|  PREDICTED: viridiflorene synthase-like             138   3e-35   
ref|XP_011080337.1|  PREDICTED: gamma-cadinene synthase-like            137   7e-35   
ref|XP_004237611.1|  PREDICTED: vetispiradiene synthase 2               135   3e-34   
ref|NP_001268015.1|  (-)-germacrene D synthase-like                     134   1e-33   
emb|CBI20174.3|  unnamed protein product                                133   1e-33   
emb|CAN62603.1|  hypothetical protein VITISV_009665                     134   1e-33   Vitis vinifera
dbj|BAJ53216.1|  JHL22C18.7                                             131   9e-33   
gb|KDO46372.1|  hypothetical protein CISIN_1g025046mg                   127   9e-33   
ref|XP_010247958.1|  PREDICTED: (-)-germacrene D synthase-like          131   9e-33   
gb|EYU43546.1|  hypothetical protein MIMGU_mgv1a002915mg                131   1e-32   
ref|XP_010319920.1|  PREDICTED: vetispiradiene synthase 3-like          130   2e-32   
gb|AAX16077.1|  valencene synthase                                      129   5e-32   Perilla frutescens var. frutescens
ref|XP_006388008.1|  hypothetical protein POPTR_0408s00200g             129   6e-32   
gb|KDP24702.1|  hypothetical protein JCGZ_25438                         125   6e-32   
ref|XP_011080334.1|  PREDICTED: gamma-cadinene synthase-like            128   8e-32   
gb|KDP35926.1|  hypothetical protein JCGZ_09898                         128   9e-32   
ref|XP_011080426.1|  PREDICTED: gamma-cadinene synthase-like            128   1e-31   
ref|XP_011080335.1|  PREDICTED: gamma-cadinene synthase-like            128   1e-31   
ref|XP_010259732.1|  PREDICTED: (-)-germacrene D synthase-like          127   2e-31   
ref|XP_006371082.1|  hypothetical protein POPTR_0019s03330g             127   2e-31   
ref|XP_006478795.1|  PREDICTED: (-)-germacrene D synthase-like is...    126   3e-31   
ref|XP_006478796.1|  PREDICTED: (-)-germacrene D synthase-like is...    126   3e-31   
dbj|BAJ53220.1|  JHL17M24.4                                             127   4e-31   
ref|XP_006478794.1|  PREDICTED: (-)-germacrene D synthase-like is...    127   4e-31   
ref|XP_006475307.1|  PREDICTED: (E)-beta-farnesene synthase-like ...    126   4e-31   
dbj|BAJ53218.1|  JHL17M24.1                                             126   5e-31   
ref|XP_011009447.1|  PREDICTED: probable terpene synthase 6             126   6e-31   
ref|XP_007021067.1|  Delta-cadinene synthase isozyme A, putative        126   6e-31   
ref|XP_006370875.1|  terpene synthase/cyclase family protein            125   8e-31   
ref|XP_006478792.1|  PREDICTED: (-)-germacrene D synthase-like          125   8e-31   
gb|KDP24704.1|  hypothetical protein JCGZ_25440                         127   8e-31   
ref|XP_006371107.1|  hypothetical protein POPTR_0019s039902g            122   9e-31   
emb|CBI20481.3|  unnamed protein product                                124   1e-30   
ref|XP_010644316.1|  PREDICTED: (-)-germacrene D synthase-like          124   1e-30   
gb|KDO52415.1|  hypothetical protein CISIN_1g008620mg                   125   1e-30   
ref|XP_006469943.1|  PREDICTED: (-)-germacrene D synthase-like          124   1e-30   
gb|AGW18162.1|  terpene synthase 4-2                                    125   1e-30   
ref|XP_010241001.1|  PREDICTED: (-)-germacrene D synthase-like          125   2e-30   
ref|XP_011009446.1|  PREDICTED: probable terpene synthase 6             125   2e-30   
gb|KDO45658.1|  hypothetical protein CISIN_1g039366mg                   124   2e-30   
emb|CBI31267.3|  unnamed protein product                                120   4e-30   
ref|XP_011015428.1|  PREDICTED: probable terpene synthase 6             124   5e-30   
ref|XP_002523635.1|  (+)-delta-cadinene synthase isozyme A, putative    123   6e-30   Ricinus communis
gb|AAV36464.1|  wound-inducible putative cytosolic terpene syntha...    123   6e-30   Medicago truncatula
sp|E3W208.1|SPISS_SANSP  RecName: Full=Sesquiterpene synthase; Sh...    123   6e-30   
ref|XP_007021117.1|  Delta-cadinene synthase isozyme A                  122   1e-29   
dbj|BAJ53221.1|  JHL17M24.6                                             122   1e-29   
gb|AII32478.1|  terpene synthase                                        122   1e-29   
ref|XP_009589518.1|  PREDICTED: vetispiradiene synthase 3-like          117   1e-29   
ref|XP_006371216.1|  hypothetical protein POPTR_0019s06190g             122   1e-29   
ref|XP_002513369.1|  Casbene synthase, chloroplast precursor, put...    122   1e-29   Ricinus communis
gb|KDP35342.1|  hypothetical protein JCGZ_10983                         122   2e-29   
ref|XP_007021120.1|  Delta-cadinene synthase isozyme A                  122   2e-29   
ref|XP_006469889.1|  PREDICTED: (-)-germacrene D synthase-like          122   2e-29   
gb|ADX01384.1|  germacrene D synthase                                   122   2e-29   
ref|XP_011080424.1|  PREDICTED: gamma-cadinene synthase-like            122   2e-29   
gb|KDO83771.1|  hypothetical protein CISIN_1g048111mg                   119   2e-29   
gb|KDO45654.1|  hypothetical protein CISIN_1g0152451mg                  119   2e-29   
gb|AAX40666.1|  sesquiterpene synthase                                  121   2e-29   Fabiana imbricata [pichi]
gb|AFQ23183.1|  sesquiterpene synthase                                  121   2e-29   
emb|CBI20483.3|  unnamed protein product                                122   3e-29   
gb|AAR99061.1|  (-)-germacrene D synthase                               122   3e-29   Populus trichocarpa x Populus deltoides
gb|KHG04103.1|  (-)-germacrene D synthase                               121   3e-29   
dbj|BAJ46125.1|  sesquiterpene synthase                                 121   3e-29   
ref|XP_011080427.1|  PREDICTED: gamma-cadinene synthase-like            121   3e-29   
sp|Q43714.1|DCS3_GOSAR  RecName: Full=(+)-delta-cadinene synthase...    121   3e-29   Gossypium arboreum [tree cotton]
ref|XP_007021123.1|  Delta-cadinene synthase isozyme A                  121   4e-29   
gb|KDO37682.1|  hypothetical protein CISIN_1g025080mg                   118   4e-29   
emb|CAN68620.1|  hypothetical protein VITISV_013313                     121   4e-29   Vitis vinifera
sp|E3W207.1|SAUSS_SANAS  RecName: Full=Sesquiterpene synthase; Sh...    121   4e-29   
ref|XP_002282488.1|  PREDICTED: (-)-germacrene D synthase               121   4e-29   Vitis vinifera
gb|KDP35929.1|  hypothetical protein JCGZ_09901                         120   4e-29   
emb|CAC83059.2|  putative terpenesynthase-1                             120   5e-29   Marrubium vulgare
ref|XP_011009443.1|  PREDICTED: probable terpene synthase 6 isofo...    120   5e-29   
ref|XP_011009444.1|  PREDICTED: probable terpene synthase 6 isofo...    120   5e-29   
gb|KDO45655.1|  hypothetical protein CISIN_1g043754mg                   118   6e-29   
gb|AEI52901.1|  terpene synthase 1                                      120   7e-29   
gb|AGW18157.1|  terpene synthase 4                                      120   7e-29   
ref|XP_004505471.1|  PREDICTED: (-)-germacrene D synthase-like          120   8e-29   
gb|AIC76494.1|  terpene synthase                                        120   8e-29   
gb|AGW18161.1|  terpene synthase 4-1                                    120   9e-29   
sp|F6M8H7.1|SMST_SANMU  RecName: Full=Probable sesquiterpene synt...    120   9e-29   
dbj|BAM24405.1|  sesquiterpene synthase                                 120   1e-28   
gb|KHG04498.1|  (+)-delta-cadinene synthase isozyme A                   120   1e-28   
dbj|BAP75561.1|  linalool synthase                                      120   1e-28   
gb|ACF94469.1|  germacrene B synthase                                   120   1e-28   Cistus creticus subsp. creticus
ref|XP_006371220.1|  hypothetical protein POPTR_0019s06230g             115   1e-28   
emb|CAA77191.1|  (+)-delta-cadinene synthase                            120   1e-28   Gossypium arboreum [tree cotton]
ref|XP_006473871.1|  PREDICTED: (-)-germacrene D synthase-like          119   1e-28   
ref|XP_011080428.1|  PREDICTED: gamma-cadinene synthase-like            119   1e-28   
ref|XP_006370589.1|  hypothetical protein POPTR_0001s44080g             119   2e-28   
ref|XP_008226800.1|  PREDICTED: (-)-alpha-pinene synthase-like          119   2e-28   
ref|XP_006370590.1|  hypothetical protein POPTR_0001s44080g             119   2e-28   
ref|XP_011030746.1|  PREDICTED: (-)-germacrene D synthase-like is...    119   2e-28   
dbj|BAJ53219.1|  JHL17M24.3                                             119   2e-28   
ref|NP_001268213.1|  (-)-germacrene D synthase                          119   2e-28   
sp|F6M8H6.1|SPIST_SANSP  RecName: Full=Probable sesquiterpene syn...    119   2e-28   
ref|XP_006353135.1|  PREDICTED: (-)-germacrene D synthase-like          119   2e-28   
ref|XP_008226806.1|  PREDICTED: (-)-alpha-pinene synthase-like          118   2e-28   
ref|XP_006370591.1|  hypothetical protein POPTR_0001s44080g             119   2e-28   
ref|XP_011030745.1|  PREDICTED: (-)-germacrene D synthase-like is...    119   2e-28   
ref|XP_006371083.1|  hypothetical protein POPTR_0019s03350g             118   3e-28   
ref|XP_006475285.1|  PREDICTED: (-)-germacrene D synthase-like is...    119   3e-28   
ref|XP_006475286.1|  PREDICTED: (-)-germacrene D synthase-like is...    119   3e-28   
emb|CBI20287.3|  unnamed protein product                                119   3e-28   
emb|CAN83470.1|  hypothetical protein VITISV_030783                     118   4e-28   Vitis vinifera
ref|XP_011069502.1|  PREDICTED: vetispiradiene synthase 2-like          113   5e-28   
ref|XP_006475284.1|  PREDICTED: (-)-germacrene D synthase-like          118   5e-28   
ref|XP_006365530.1|  PREDICTED: germacrene C synthase-like              118   6e-28   
ref|XP_008226803.1|  PREDICTED: (-)-alpha-pinene synthase-like          118   6e-28   
ref|XP_006475306.1|  PREDICTED: (E)-beta-farnesene synthase-like        117   9e-28   
ref|XP_002317018.2|  hypothetical protein POPTR_0011s14600g             117   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_006472987.1|  PREDICTED: (-)-germacrene D synthase-like          117   1e-27   
ref|XP_006475310.1|  PREDICTED: (-)-germacrene D synthase-like          119   1e-27   
gb|KHG15264.1|  (+)-delta-cadinene synthase isozyme A                   116   1e-27   
gb|AGV28055.1|  sesquiterpene synthase                                  117   1e-27   
dbj|BAP74389.1|  delta-elemene synthase                                 117   1e-27   
ref|XP_004287071.1|  PREDICTED: (-)-alpha-pinene synthase-like          117   2e-27   
gb|KDP36230.1|  hypothetical protein JCGZ_09950                         116   2e-27   
ref|NP_001268204.1|  uncharacterized protein LOC100257265               116   2e-27   
ref|XP_008232170.1|  PREDICTED: (-)-germacrene D synthase-like          116   2e-27   
sp|F6M8H5.1|SAUST_SANAS  RecName: Full=Probable sesquiterpene syn...    116   2e-27   
ref|XP_006492721.1|  PREDICTED: casbene synthase, chloroplastic-like    116   2e-27   
gb|AGS16741.1|  sesquiterpene synthase                                  116   3e-27   
emb|CBI31269.3|  unnamed protein product                                115   3e-27   
emb|CAN76687.1|  hypothetical protein VITISV_021510                     115   3e-27   Vitis vinifera
gb|AII32471.1|  terpene synthase                                        116   3e-27   
ref|XP_011100634.1|  PREDICTED: germacrene-D synthase-like              116   3e-27   
emb|CDP05818.1|  unnamed protein product                                116   3e-27   
gb|AIC76497.1|  terpene synthase                                        116   3e-27   
ref|XP_009792053.1|  PREDICTED: vetispiradiene synthase 2-like          112   3e-27   
gb|ADR66821.1|  germacrene A synthase                                   115   3e-27   
gb|KDP42348.1|  hypothetical protein JCGZ_02821                         116   4e-27   
ref|XP_011048258.1|  PREDICTED: (-)-germacrene D synthase-like          115   4e-27   
ref|NP_001268028.1|  valencene synthase-like                            115   4e-27   
ref|XP_011095304.1|  PREDICTED: germacrene-D synthase-like              115   4e-27   
ref|XP_008366487.1|  PREDICTED: (-)-alpha-pinene synthase-like          115   4e-27   
gb|AII32473.1|  terpene synthase                                        116   4e-27   
gb|AEP17005.1|  (E)-beta-caryophyllene synthase                         115   4e-27   
ref|XP_007021122.1|  Delta-cadinene synthase isozyme A, putative        117   4e-27   
sp|F6M8H4.1|SAST_SANAL  RecName: Full=Probable sesquiterpene synt...    115   4e-27   
ref|XP_008449179.1|  PREDICTED: (-)-germacrene D synthase-like          114   5e-27   
gb|AII32475.1|  terpene synthase                                        115   5e-27   
ref|XP_011095783.1|  PREDICTED: germacrene-D synthase-like              116   5e-27   
ref|XP_009338882.1|  PREDICTED: (-)-germacrene D synthase-like          115   5e-27   
ref|XP_011090538.1|  PREDICTED: germacrene-D synthase-like              115   6e-27   
gb|KDP37851.1|  hypothetical protein JCGZ_06358                         115   6e-27   
dbj|BAJ53213.1|  JHL23C09.9                                             115   6e-27   
ref|XP_002321642.1|  hypothetical protein POPTR_0015s09710g             115   6e-27   Populus trichocarpa [western balsam poplar]
sp|Q6Q3H2.1|TPSVS_VITVI  RecName: Full=Valencene synthase; Short=...    115   6e-27   Vitis vinifera
sp|B5A435.1|STPS1_SANAL  RecName: Full=Sesquiterpene synthase; Sh...    115   6e-27   Santalum album
ref|XP_008226738.1|  PREDICTED: (-)-alpha-pinene synthase-like is...    115   7e-27   
ref|XP_010694277.1|  PREDICTED: probable sesquiterpene synthase         115   7e-27   
emb|CBI20482.3|  unnamed protein product                                116   8e-27   
ref|XP_008245781.1|  PREDICTED: (-)-alpha-pinene synthase-like          115   9e-27   
ref|XP_010258444.1|  PREDICTED: (-)-germacrene D synthase-like          115   9e-27   
ref|XP_008371259.1|  PREDICTED: (-)-germacrene D synthase-like is...    114   9e-27   
ref|XP_008366777.1|  PREDICTED: LOW QUALITY PROTEIN: (-)-germacre...    114   1e-26   
ref|NP_001239041.1|  sesquiterpene synthase                             114   1e-26   
ref|XP_010092286.1|  (-)-germacrene D synthase                          114   1e-26   
ref|XP_002513340.1|  Casbene synthase, chloroplast precursor            115   1e-26   Ricinus communis
gb|KDP31568.1|  hypothetical protein JCGZ_14793                         113   1e-26   
gb|AEM23828.1|  sesquiterpene synthase                                  114   1e-26   
ref|XP_004288818.1|  PREDICTED: (-)-germacrene D synthase-like          114   1e-26   
ref|XP_002513343.1|  Casbene synthase, chloroplast precursor, put...    115   1e-26   Ricinus communis
emb|CAN66799.1|  hypothetical protein VITISV_037341                     114   1e-26   Vitis vinifera
emb|CAH10289.1|  (E)-beta-farnesene synthase                            114   1e-26   Mentha x piperita
gb|ABK63808.1|  sesquiterpene cyclase                                   114   1e-26   Centella asiatica [Asiatic pennywort]
ref|NP_001268215.1|  valencene synthase                                 114   1e-26   
ref|XP_008371257.1|  PREDICTED: (-)-germacrene D synthase-like is...    114   1e-26   
emb|CAN72015.1|  hypothetical protein VITISV_010524                     114   1e-26   Vitis vinifera
ref|XP_002274445.2|  PREDICTED: valencene synthase-like                 114   1e-26   Vitis vinifera
gb|KDP43261.1|  hypothetical protein JCGZ_22813                         114   1e-26   
ref|XP_008371258.1|  PREDICTED: (-)-germacrene D synthase-like is...    114   1e-26   
ref|XP_002522812.1|  (+)-delta-cadinene synthase isozyme A, putative    114   2e-26   Ricinus communis
ref|XP_009338867.1|  PREDICTED: (-)-germacrene D synthase-like          114   2e-26   
emb|CAN78342.1|  hypothetical protein VITISV_000109                     114   2e-26   Vitis vinifera
ref|XP_008386098.1|  PREDICTED: (-)-alpha-pinene synthase-like          114   2e-26   
ref|XP_004243482.2|  PREDICTED: (-)-germacrene D synthase               114   2e-26   
ref|XP_004303538.1|  PREDICTED: (-)-alpha-pinene synthase-like          114   2e-26   
ref|NP_001268063.1|  uncharacterized protein LOC100267145               114   2e-26   
emb|CDP12281.1|  unnamed protein product                                114   2e-26   
ref|XP_011015484.1|  PREDICTED: valencene synthase-like                 114   2e-26   
gb|KDO83772.1|  hypothetical protein CISIN_1g035568mg                   113   2e-26   
sp|O48935.1|TPSBF_MENPI  RecName: Full=Beta-farnesene synthase          114   2e-26   Mentha x piperita
gb|KDP25759.1|  hypothetical protein JCGZ_23929                         114   2e-26   
gb|AAX44034.1|  (+)-delta-cadinene synthase                             114   2e-26   Gossypium hirsutum [American cotton]
gb|AEK32002.1|  (E)-B-farnesene synthase                                113   2e-26   
emb|CBI20288.3|  unnamed protein product                                114   2e-26   
ref|XP_002513334.1|  Casbene synthase, chloroplast precursor, put...    114   2e-26   Ricinus communis
emb|CAA04773.1|  sesquiterpene cyclase                                  112   3e-26   Fragaria vesca [alpine strawberry]
gb|KDP42347.1|  hypothetical protein JCGZ_02820                         114   3e-26   
emb|CBI31311.3|  unnamed protein product                                108   3e-26   
ref|XP_004242295.1|  PREDICTED: germacrene C synthase-like              114   3e-26   
ref|XP_006364906.1|  PREDICTED: (-)-germacrene D synthase-like          113   4e-26   
emb|CBI31290.3|  unnamed protein product                                114   4e-26   
emb|CBI31262.3|  unnamed protein product                                113   4e-26   
gb|KDP31578.1|  hypothetical protein JCGZ_14803                         111   5e-26   
ref|XP_008227046.1|  PREDICTED: (-)-alpha-pinene synthase-like          113   5e-26   
ref|XP_009757762.1|  PREDICTED: (-)-germacrene D synthase-like is...    112   5e-26   
ref|XP_009758851.1|  PREDICTED: vetispiradiene synthase 1-like          110   5e-26   
gb|KCW52014.1|  hypothetical protein EUGRSUZ_J01453                     112   5e-26   
emb|CBI31274.3|  unnamed protein product                                114   6e-26   
ref|XP_006364159.1|  PREDICTED: (-)-germacrene D synthase-like          112   6e-26   
gb|KDP31579.1|  hypothetical protein JCGZ_14804                         112   6e-26   
ref|XP_009757760.1|  PREDICTED: (-)-germacrene D synthase-like is...    112   6e-26   
ref|XP_009349849.1|  PREDICTED: (-)-germacrene D synthase-like          112   7e-26   
sp|Q5W283.1|TPSCM_MENPI  RecName: Full=Cis-muuroladiene synthase;...    112   7e-26   
ref|XP_010092292.1|  (-)-germacrene D synthase                          112   8e-26   
ref|XP_006473872.1|  PREDICTED: (-)-germacrene D synthase-like          112   9e-26   
ref|XP_007022420.1|  Terpene synthase 21, putative                      111   9e-26   
gb|AEA49039.1|  (E)-beta-farnesene synthase 2                           112   9e-26   
ref|XP_010034417.1|  PREDICTED: (-)-germacrene D synthase-like          112   9e-26   
sp|O23945.2|PINS_FRAVE  RecName: Full=(-)-alpha-pinene synthase; ...    112   9e-26   
gb|KDO69460.1|  hypothetical protein CISIN_1g044370mg                   112   1e-25   
ref|XP_004294324.1|  PREDICTED: (-)-alpha-pinene synthase-like          112   1e-25   
gb|AFE56211.1|  terpene synthase                                        112   1e-25   
ref|XP_006363765.1|  PREDICTED: (-)-germacrene D synthase-like          112   1e-25   
gb|KDP36233.1|  hypothetical protein JCGZ_09953                         111   1e-25   
ref|NP_001275785.1|  valencene synthase                                 112   1e-25   
gb|AAM00426.1|AF411120_1  putative terpene synthase                     112   1e-25   
emb|CDP18843.1|  unnamed protein product                                112   1e-25   
gb|AAQ04608.1|AF441124_1  valencene synthase                            111   1e-25   
emb|CAN81129.1|  hypothetical protein VITISV_002911                     112   1e-25   
emb|CBI31281.3|  unnamed protein product                                108   1e-25   
ref|XP_009344725.1|  PREDICTED: (-)-germacrene D synthase-like          111   1e-25   
ref|XP_002283076.1|  PREDICTED: (-)-germacrene D synthase               111   1e-25   
ref|XP_010644711.1|  PREDICTED: (-)-germacrene D synthase               111   1e-25   
ref|XP_011011288.1|  PREDICTED: (-)-germacrene D synthase-like          110   1e-25   
gb|AEH41845.1|  E-beta-caryophyllene synthase                           111   1e-25   
gb|ADR74199.1|  gamma-cadinene synthase                                 112   1e-25   
gb|KDP43268.1|  hypothetical protein JCGZ_22820                         111   1e-25   
gb|KDP31577.1|  hypothetical protein JCGZ_14802                         111   1e-25   
ref|XP_006367836.1|  PREDICTED: germacrene C synthase-like              111   2e-25   
gb|AAX16121.1|  germacrene-D synthase                                   111   2e-25   
gb|AIC76500.1|  terpene synthase                                        111   2e-25   
emb|CBI20475.3|  unnamed protein product                                111   2e-25   
emb|CDP18846.1|  unnamed protein product                                111   2e-25   
sp|Q9FQ27.1|TPSGB_SOLHA  RecName: Full=(E,E)-germacrene B synthase      111   2e-25   
ref|XP_006367561.1|  PREDICTED: germacrene C synthase-like              111   2e-25   
emb|CDP12283.1|  unnamed protein product                                111   2e-25   
ref|XP_010248057.1|  PREDICTED: probable terpene synthase 2             111   2e-25   
ref|XP_008226805.1|  PREDICTED: (-)-alpha-pinene synthase-like          111   2e-25   
emb|CAN69894.1|  hypothetical protein VITISV_038206                     109   2e-25   
gb|AAG41892.1|AF279456_1  sesquiterpene synthase 2                      110   2e-25   
ref|XP_010644187.1|  PREDICTED: (-)-germacrene D synthase-like          110   2e-25   
gb|AEM23826.1|  sesquiterpene synthase                                  110   2e-25   
emb|CBI31309.3|  unnamed protein product                                107   2e-25   
gb|AGL98418.1|  cadinol synthase                                        110   2e-25   
ref|XP_008449182.1|  PREDICTED: (-)-germacrene D synthase-like          112   2e-25   
ref|XP_006371219.1|  hypothetical protein POPTR_0019s06220g             110   3e-25   
ref|XP_009355684.1|  PREDICTED: (-)-alpha-pinene synthase-like          110   3e-25   
dbj|BAM34474.1|  casbene synthase                                       111   3e-25   
gb|AIM47562.1|  casbene synthase 1                                      111   3e-25   
ref|XP_006476905.1|  PREDICTED: (-)-germacrene D synthase-like          110   3e-25   
gb|KCW84486.1|  hypothetical protein EUGRSUZ_B01315                     109   3e-25   
gb|KDO56474.1|  hypothetical protein CISIN_1g047694mg                   108   3e-25   
gb|ADC92564.1|  (E)-beta farnesene synthase                             110   3e-25   
gb|KDP23707.1|  hypothetical protein JCGZ_23540                         110   3e-25   
ref|NP_001268024.1|  valencene synthase-like                            110   4e-25   
ref|XP_010032599.1|  PREDICTED: (-)-germacrene D synthase-like          110   4e-25   
ref|XP_011005622.1|  PREDICTED: valencene synthase-like isoform X1      110   4e-25   
emb|CBI31305.3|  unnamed protein product                                110   4e-25   
ref|XP_008226801.1|  PREDICTED: (-)-alpha-pinene synthase-like          110   5e-25   
ref|XP_009346480.1|  PREDICTED: (-)-alpha-pinene synthase-like          110   5e-25   
ref|XP_006475314.1|  PREDICTED: (E)-beta-farnesene synthase-like        110   5e-25   
ref|XP_006365934.1|  PREDICTED: germacrene C synthase-like              110   5e-25   
ref|NP_001281061.1|  (-)-alpha-pinene synthase-like                     110   5e-25   
ref|XP_009342460.1|  PREDICTED: (-)-alpha-pinene synthase-like          110   5e-25   
ref|XP_011035527.1|  PREDICTED: (-)-germacrene D synthase-like          110   6e-25   
ref|XP_010057304.1|  PREDICTED: (-)-germacrene D synthase-like          110   6e-25   
ref|XP_006365542.1|  PREDICTED: germacrene C synthase-like              109   6e-25   
ref|XP_010061274.1|  PREDICTED: (-)-germacrene D synthase-like          110   6e-25   
gb|AAT72931.1|  cascarilladiene synthase                                110   6e-25   
gb|AAF74977.1|AF270425_1  (+)-delta-cadinene synthase                   109   6e-25   
gb|AAX44033.1|  (+)-delta-cadinene synthase                             109   6e-25   
ref|XP_006374233.1|  hypothetical protein POPTR_0015s05270g             109   7e-25   
ref|XP_002283070.1|  PREDICTED: (-)-germacrene D synthase               109   7e-25   
gb|AEM23825.1|  sesquiterpene synthase                                  109   7e-25   
ref|XP_006370594.1|  hypothetical protein POPTR_0001s44080g             108   7e-25   
gb|AAG01339.1|  terpene synthase                                        109   7e-25   
ref|XP_008374195.1|  PREDICTED: (-)-alpha-pinene synthase-like          109   7e-25   
ref|XP_002518620.1|  Casbene synthase, chloroplast precursor, put...    107   8e-25   
gb|AIC76495.1|  terpene synthase                                        108   8e-25   
ref|XP_010062946.1|  PREDICTED: (-)-germacrene D synthase-like          109   8e-25   
gb|KHG05331.1|  delta-cadinene synthase isozyme XC14                    109   9e-25   
ref|NP_001239042.1|  sesquiterpene synthase                             109   9e-25   
ref|XP_011005621.1|  PREDICTED: (-)-germacrene D synthase-like          109   9e-25   
ref|XP_007028200.1|  Delta-cadinene synthase isozyme A, putative        109   9e-25   
emb|CDP16468.1|  unnamed protein product                                109   9e-25   
ref|XP_010645872.1|  PREDICTED: LOW QUALITY PROTEIN: valencene sy...    109   1e-24   
ref|XP_006477783.1|  PREDICTED: (-)-germacrene D synthase-like          109   1e-24   
sp|Q5SBP5.1|GCS1_OCIBA  RecName: Full=Gamma-cadinene synthase; Al...    108   1e-24   
ref|XP_008347229.1|  PREDICTED: (-)-germacrene D synthase-like          108   1e-24   
gb|KGN55971.1|  hypothetical protein Csa_3G042380                       108   1e-24   
gb|AGB05616.1|  sesquiterpene synthase 7                                109   1e-24   
sp|Q39761.1|DCS1_GOSAR  RecName: Full=(+)-delta-cadinene synthase...    108   1e-24   
gb|AGB14624.1|  beta-caryophyllene synthase                             108   1e-24   
ref|XP_009334624.1|  PREDICTED: (-)-germacrene D synthase-like          108   1e-24   
ref|XP_010045915.1|  PREDICTED: (-)-germacrene D synthase-like          109   1e-24   
sp|O49853.1|DCS4_GOSAR  RecName: Full=(+)-delta-cadinene synthase...    108   1e-24   
gb|AHL24448.1|  patchoulol synthase variant 1                           108   1e-24   
gb|AGX84976.1|  terpene synthase                                        108   1e-24   
sp|P93665.1|DCS1_GOSHI  RecName: Full=(+)-delta-cadinene synthase...    108   1e-24   
gb|AGZ84810.1|  beta-caryophyllene synthase                             108   1e-24   
ref|XP_010042685.1|  PREDICTED: (-)-germacrene D synthase-like          107   1e-24   
gb|EYU31462.1|  hypothetical protein MIMGU_mgv1a021955mg                105   2e-24   
sp|Q49SP3.1|TPSPS_POGCB  RecName: Full=Patchoulol synthase; Short...    108   2e-24   
ref|XP_002275408.3|  PREDICTED: valencene synthase                      108   2e-24   
ref|XP_011095786.1|  PREDICTED: germacrene-D synthase-like              108   2e-24   
gb|AEP82781.1|  TPS16                                                   108   2e-24   
gb|AJD19683.1|  sesquiterpene synthase Tps3                             108   2e-24   
dbj|BAN81914.1|  beta-caryophyllene synthase                            108   2e-24   
ref|XP_008244606.1|  PREDICTED: (-)-germacrene D synthase-like          108   2e-24   
gb|KHG27433.1|  (+)-delta-cadinene synthase                             106   2e-24   
ref|XP_004151146.1|  PREDICTED: (-)-germacrene D synthase-like          108   2e-24   
ref|XP_004168419.1|  PREDICTED: (-)-germacrene D synthase-like          108   2e-24   
gb|AIM47565.1|  casbene synthase                                        106   2e-24   
ref|XP_008449181.1|  PREDICTED: (-)-germacrene D synthase-like          108   3e-24   
gb|ACI32639.1|  STS1                                                    108   3e-24   
gb|KDO41091.1|  hypothetical protein CISIN_1g008817mg                   107   3e-24   
ref|XP_010049987.1|  PREDICTED: (-)-germacrene D synthase-like          108   3e-24   
sp|I6RAQ6.1|TPS1_MATCR  RecName: Full=(-)-beta-caryophyllene synt...    107   3e-24   
sp|Q39760.1|DCS2_GOSAR  RecName: Full=(+)-delta-cadinene synthase...    107   3e-24   
ref|XP_006365293.1|  PREDICTED: uncharacterized protein LOC102599254    109   3e-24   
ref|XP_009355680.1|  PREDICTED: (-)-alpha-pinene synthase-like          108   4e-24   
ref|XP_004295289.1|  PREDICTED: (-)-germacrene D synthase-like          107   4e-24   
sp|J9RLZ7.1|TPS1_VALOF  RecName: Full=Germacrene C/D synthase; Al...    107   4e-24   
gb|KGN55969.1|  hypothetical protein Csa_3G041370                       105   4e-24   
ref|XP_007021121.1|  Delta-cadinene synthase isozyme A                  107   4e-24   
gb|KDP35928.1|  hypothetical protein JCGZ_09900                         108   4e-24   
ref|XP_004301355.1|  PREDICTED: (-)-germacrene D synthase-like          107   4e-24   
ref|XP_004151591.1|  PREDICTED: (-)-germacrene D synthase-like          105   4e-24   
ref|XP_010042602.1|  PREDICTED: (-)-germacrene D synthase-like          107   5e-24   
ref|XP_007021065.1|  Delta-cadinene synthase isozyme A                  107   5e-24   
gb|KCW44164.1|  hypothetical protein EUGRSUZ_L02418                     107   5e-24   
ref|XP_002274781.1|  PREDICTED: valencene synthase                      107   5e-24   
ref|XP_008244326.1|  PREDICTED: (-)-germacrene D synthase-like          107   5e-24   
ref|XP_009594549.1|  PREDICTED: germacrene C synthase-like              107   6e-24   
ref|XP_004159518.1|  PREDICTED: (-)-germacrene D synthase-like          105   6e-24   
ref|XP_009620125.1|  PREDICTED: (-)-germacrene D synthase-like          106   7e-24   
emb|CBI31294.3|  unnamed protein product                                107   7e-24   
ref|XP_008240971.1|  PREDICTED: (-)-germacrene D synthase-like          106   7e-24   
sp|Q49SP7.1|TPSCS_POGCB  RecName: Full=Gamma-curcumene synthase; ...    106   8e-24   
ref|XP_010323000.1|  PREDICTED: (E,E)-germacrene B synthase-like        105   9e-24   
emb|CAN73125.1|  hypothetical protein VITISV_010755                     106   9e-24   
ref|XP_002275351.1|  PREDICTED: valencene synthase                      106   9e-24   
gb|AII32469.1|  terpene synthase                                        106   9e-24   
ref|XP_002306399.2|  hypothetical protein POPTR_0005s09830g             106   1e-23   
ref|XP_009358866.1|  PREDICTED: (-)-germacrene D synthase-like          106   1e-23   
gb|AGR40502.1|  caryophyllene synthase                                  106   1e-23   
ref|XP_007021068.1|  Delta-cadinene synthase isozyme A                  102   1e-23   
ref|XP_009338863.1|  PREDICTED: (-)-germacrene D synthase-like          106   1e-23   
gb|AGN70884.1|  casbene synthase                                        106   1e-23   
ref|XP_009387443.1|  PREDICTED: alpha-humulene synthase-like            103   1e-23   
ref|XP_008226737.1|  PREDICTED: (-)-alpha-pinene synthase-like is...    106   1e-23   
ref|XP_009617778.1|  PREDICTED: (-)-germacrene D synthase-like          106   1e-23   
ref|XP_011022083.1|  PREDICTED: probable terpene synthase 3             106   1e-23   
ref|XP_004294317.1|  PREDICTED: (-)-germacrene D synthase-like          106   1e-23   
emb|CAN60658.1|  hypothetical protein VITISV_029939                     105   1e-23   
ref|NP_001234481.1|  sesquiterpene synthase 1                           105   1e-23   
ref|XP_009623875.1|  PREDICTED: (-)-germacrene D synthase-like          106   1e-23   
ref|NP_001234060.1|  germacrene C synthase                              105   1e-23   
gb|AJD19682.1|  sesquiterpene synthase Tps1                             106   1e-23   
gb|AAG41890.1|AF279454_1  sesquiterpene synthase 2                      105   1e-23   
ref|XP_010092294.1|  (-)-germacrene D synthase                          105   1e-23   
gb|KHG14851.1|  (+)-delta-cadinene synthase isozyme C2                  106   2e-23   
ref|NP_001234766.1|  caryophyllene/alpha-humulene synthase              105   2e-23   
gb|KHG27356.1|  delta-cadinene synthase isozyme XC14                    105   2e-23   
sp|J7LJN5.1|TPS6_PHYDL  RecName: Full=Beta-caryophyllene synthase...    105   2e-23   
ref|XP_004168401.1|  PREDICTED: (-)-germacrene D synthase-like          104   2e-23   
gb|KHG01539.1|  delta-cadinene synthase isozyme XC1                     105   2e-23   
ref|XP_004298302.1|  PREDICTED: (-)-germacrene D synthase-like          105   2e-23   
gb|AHF22834.1|  drimenol synthase                                       105   2e-23   
ref|XP_004151636.1|  PREDICTED: (-)-germacrene D synthase-like          103   2e-23   
gb|KHG16315.1|  delta-cadinene synthase isozyme XC1                     105   2e-23   
gb|KDP24706.1|  hypothetical protein JCGZ_25442                         105   2e-23   
ref|XP_004302393.1|  PREDICTED: (-)-alpha-pinene synthase-like          105   2e-23   
ref|XP_004151461.1|  PREDICTED: (-)-germacrene D synthase-like          105   2e-23   
ref|XP_009768422.1|  PREDICTED: (-)-germacrene D synthase-like is...    105   2e-23   
ref|XP_009410234.1|  PREDICTED: alpha-humulene synthase-like            104   2e-23   
ref|XP_009410236.1|  PREDICTED: alpha-humulene synthase-like            103   3e-23   
gb|ACI32640.1|  STS2                                                    105   3e-23   
ref|XP_002283344.1|  PREDICTED: (-)-germacrene D synthase               105   3e-23   
ref|XP_007021066.1|  Delta-cadinene synthase isozyme A, putative        104   3e-23   
gb|KCW63955.1|  hypothetical protein EUGRSUZ_G01636                     105   3e-23   
sp|Q49SP6.1|TPGD2_POGCB  RecName: Full=Germacrene D synthase 2; A...    105   3e-23   
ref|XP_010066141.1|  PREDICTED: (-)-germacrene D synthase-like          105   3e-23   
ref|XP_010041907.1|  PREDICTED: (-)-germacrene D synthase-like is...    102   3e-23   
ref|XP_009387042.1|  PREDICTED: alpha-humulene synthase-like            102   3e-23   
ref|XP_009768421.1|  PREDICTED: (-)-germacrene D synthase-like is...    104   4e-23   
gb|ADK94034.1|  alpha-copaene synthase                                  104   4e-23   
gb|ADB90273.1|  casbene synthase                                        105   4e-23   
ref|XP_006356724.1|  PREDICTED: (E,E)-germacrene B synthase-like        104   4e-23   
ref|XP_008452330.1|  PREDICTED: (+)-gamma-cadinene synthase-like        104   4e-23   
ref|XP_009386877.1|  PREDICTED: alpha-humulene synthase-like            104   4e-23   
ref|XP_010049989.1|  PREDICTED: (-)-germacrene D synthase-like          104   5e-23   
ref|XP_009609204.1|  PREDICTED: LOW QUALITY PROTEIN: germacrene C...    105   5e-23   
gb|ACN58564.1|  (E)-beta-caryophyllene synthase                         104   5e-23   
ref|XP_004308569.1|  PREDICTED: (-)-germacrene D synthase-like          104   5e-23   
gb|AIT75876.1|  sesquiterpene synthase                                  104   5e-23   
gb|KHN11066.1|  (-)-germacrene D synthase                               101   5e-23   
gb|AGB14625.1|  germacrene-D synthase                                   104   6e-23   
ref|XP_010683546.1|  PREDICTED: (-)-germacrene D synthase-like is...    104   6e-23   
ref|XP_011095784.1|  PREDICTED: germacrene-D synthase-like              104   6e-23   
ref|XP_010683547.1|  PREDICTED: probable terpene synthase 6 isofo...    103   6e-23   
ref|XP_009803139.1|  PREDICTED: germacrene C synthase-like isofor...    103   6e-23   
gb|KDP46456.1|  hypothetical protein JCGZ_12939                         103   6e-23   
gb|AGW18155.1|  terpene synthase 2                                      103   7e-23   
gb|KHG04018.1|  delta-cadinene synthase isozyme XC1                     102   8e-23   
sp|Q8SA63.1|CARS_ARTAN  RecName: Full=Beta-caryophyllene synthase       103   8e-23   
emb|CAC12732.1|  putative sesquiterpene cyclase                         103   8e-23   
ref|XP_008388200.1|  PREDICTED: (-)-germacrene D synthase-like          103   9e-23   
emb|CAN62604.1|  hypothetical protein VITISV_009666                     103   1e-22   



>ref|XP_006367961.1| PREDICTED: viridiflorene synthase-like [Solanum tuberosum]
Length=560

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKAL++L+D D+ KEL  +GR   +Y+AKERMKE+VR+Y
Sbjct  329  DAIQRWDINEIDRLPDYMKISYKALLDLFD-DYEKELSSDGRSHVVYHAKERMKEIVRSY  387

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+E+KW  +G +PP +EYL NAL +ST Y+L    +L MKS T ++FEWL+ NP I+EA 
Sbjct  388  NVEAKWFIEGHMPPVSEYLSNALVTSTYYLLTTAAYLGMKSATEQDFEWLSTNPKILEAN  447

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R  +++ +YE EK       TGI+CYM DYGV
Sbjct  448  VTLCRVTDDIATYEVEKGRG-QIATGIECYMRDYGV  482



>ref|XP_006358528.1| PREDICTED: vetispiradiene synthase 1-like [Solanum tuberosum]
Length=558

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 117/156 (75%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLPDYMKISYKAL++LY+ D+  EL ++GR   ++YAKERMKE+VR Y
Sbjct  328  DAIQRWDISQIDRLPDYMKISYKALLDLYN-DYETELSKDGRSDVVHYAKERMKEIVRNY  386

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL+ ST Y+L  T +L MK   +E+FEWL +NP I+EA 
Sbjct  387  FVEAKWFIEGYMPPVSEYLSNALAISTYYLLTTTSYLGMKCANKEDFEWLAKNPKILEAN  446

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  447  VTLCRVIDDIATYEVEKGRG-QIATGIECYMRDYGV  481



>ref|XP_009621868.1| PREDICTED: vetispiradiene synthase 2, partial [Nicotiana tomentosiformis]
Length=243

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 119/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLPDYMKIS+KALI+LY ED+ KEL  +GR + ++YAKERMKE+VR Y
Sbjct  13   DAIQRWDISQIDRLPDYMKISFKALIDLY-EDYEKELSTDGRSYVVHYAKERMKEIVRNY  71

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L MKS  RE+FEWL  NP I+EA 
Sbjct  72   FVEAKWFIEGYMPPVSEYLNNALATSTYYLLTTTSYLGMKSAAREDFEWLATNPKILEAN  131

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  132  VTLCRVVDDIATYEVEKGRG-QIATGIECYMRDYGV  166



>ref|XP_009766331.1| PREDICTED: 5-epi-aristolochene synthase 2-like [Nicotiana sylvestris]
Length=385

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WDI++++RLPDYMKISYKAL++L+ ED+ KEL  +GR   +Y+AKER+KE+VR Y
Sbjct  155  DAIERWDISEIDRLPDYMKISYKALLDLH-EDYEKELSSDGRSHVVYHAKERVKELVRNY  213

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            NIE+KW  +G  P F+EYL N L++ST Y    T +L +KS+T ++FEWL +NP I EA+
Sbjct  214  NIEAKWFIEGYKPHFSEYLSNGLATSTYYSCPTTCYLGVKSITEQDFEWLAKNPKIFEAS  273

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             IL R ++++ +YE EKS      TGI+CYM DYGV
Sbjct  274  AILCRIIDDIATYEVEKSRG-QIATGIECYMRDYGV  308



>ref|XP_009589983.1| PREDICTED: 5-epi-aristolochene synthase-like [Nicotiana tomentosiformis]
Length=550

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 118/155 (76%), Gaps = 2/155 (1%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDI++++RLPDYMKISYKAL++L+ ED+ KEL  +GR   +Y+AKER+KE+VR+YN
Sbjct  321  AIERWDISEIDRLPDYMKISYKALLDLH-EDYEKELSSDGRSHVVYHAKERVKELVRSYN  379

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEATV  363
            IE+KW  +G  P F+EYL N L++ST Y    T +L MKS+T ++FEWL +NP I EA+ 
Sbjct  380  IEAKWFIEGYKPHFSEYLSNGLATSTYYSCPTTCYLGMKSITEQDFEWLAKNPKIFEASA  439

Query  364  ILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +L R ++++ +YE EKS      TGI+CYM DYGV
Sbjct  440  LLCRVIDDIATYEVEKSRG-QIATGIECYMRDYGV  473



>ref|XP_009794139.1| PREDICTED: vetispiradiene synthase 2-like [Nicotiana sylvestris]
Length=555

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 122/156 (78%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WD+++++RLPDYMKISYKAL+NLYD D+ KEL   GR   +YYAKERMKE+VR Y
Sbjct  325  DAIQRWDVSEIDRLPDYMKISYKALLNLYD-DYEKELSNYGRSNVVYYAKERMKEIVRNY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+E+KW  +G +PP +EYL NAL +ST Y+L  T +L+MKSVT+++FEWL +NP I+EA 
Sbjct  384  NVEAKWFIEGYMPPVSEYLSNALITSTYYLLTTTSYLAMKSVTKKDFEWLAKNPKILEAN  443

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EKS      TGI+CYM DYGV
Sbjct  444  VTLCRVIDDIATYEVEKSRG-QIATGIECYMRDYGV  478



>ref|XP_009593021.1| PREDICTED: vetispiradiene synthase 2-like, partial [Nicotiana 
tomentosiformis]
Length=209

 Score =   168 bits (426),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 111/151 (74%), Gaps = 2/151 (1%)
 Frame = +1

Query  16   WDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNIESK  195
            WDI +++RLPDYMKISYKAL++L+ ED+ KEL  +GR   +Y+AKER+KE+VR YNIE+K
Sbjct  1    WDICEIDRLPDYMKISYKALLDLH-EDYEKELSSDGRSHVVYHAKERVKELVRNYNIEAK  59

Query  196  WSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEATVILGR  375
            W  +G  P F+EYL N L++S  Y    T +L MKS+T ++FEWL +NP I EA+ +L R
Sbjct  60   WFIEGYKPHFSEYLSNGLATSPYYSCPTTCYLGMKSITEQDFEWLAKNPKIFEASALLCR  119

Query  376  TLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             ++++ +YE EKS      TGI+CYM DYGV
Sbjct  120  VIDDIATYEVEKSRG-QIATGIECYMRDYGV  149



>ref|XP_011082260.1| PREDICTED: vetispiradiene synthase 3-like [Sesamum indicum]
Length=554

 Score =   176 bits (445),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WDIN+++RLPDYMKI YKAL++LYD+ +++EL ++GR FA++YAK  MK++VR+Y
Sbjct  324  DAIERWDINEIDRLPDYMKICYKALLDLYDQ-YDEELRQQGRSFAVHYAKATMKDIVRSY  382

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            NIE+KW  +G +PPFA+Y+ N   +ST Y+L  T F+ M+S  +E F+WL + P I  A 
Sbjct  383  NIEAKWFIEGYMPPFADYMANGFITSTYYLLATTSFIGMESAPKEAFDWLMKKPKIQVAN  442

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V + R ++++ +YE EK     T+TGI+CYMN+Y V
Sbjct  443  VTICRVVDDIATYEIEKKRG-QTVTGIECYMNEYEV  477



>ref|XP_009764785.1| PREDICTED: vetispiradiene synthase 3-like [Nicotiana sylvestris]
Length=554

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 120/156 (77%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLPDYMKIS+KALI+LY ED+ KEL ++GR + ++YAKERMKE+VR Y
Sbjct  324  DAIQRWDISQIDRLPDYMKISFKALIDLY-EDYEKELSKDGRSYVVHYAKERMKEIVRNY  382

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L MKS  +E+FEWL  NP I+EA 
Sbjct  383  FVEAKWFIEGYMPPVSEYLNNALATSTYYLLTTTSYLGMKSAAQEDFEWLATNPKILEAN  442

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  443  VTLCRVVDDIATYEVEKGRG-QIATGIECYMRDYGV  477



>ref|XP_006358572.1| PREDICTED: vetispiradiene synthase 1-like [Solanum tuberosum]
Length=367

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 119/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDINQ++RLPDYMKISYKAL++LY+ D+  EL ++GR   ++YAKERMKE+VR Y
Sbjct  137  DAIQRWDINQIDRLPDYMKISYKALLDLYN-DYEMELSKDGRSDVVHYAKERMKEIVRNY  195

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L MKS  +E+FEWL +NP I+EA 
Sbjct  196  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGMKSANKEDFEWLAKNPKILEAN  255

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  256  VTLCRVIDDIATYEVEKGRG-QIATGIECYMRDYGV  290



>ref|XP_009773139.1| PREDICTED: vetispiradiene synthase 3 [Nicotiana sylvestris]
Length=560

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 120/156 (77%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WD++Q+NRLPDYMKISYKAL++LY+ D+ KEL  +GR   ++YAKERMKE+VR Y
Sbjct  330  DAIQRWDVSQINRLPDYMKISYKALLDLYN-DYEKELSNDGRSSVVHYAKERMKEIVRNY  388

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L MK   +E+FEWL++NP I+EA 
Sbjct  389  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGMKCANKEDFEWLDKNPKILEAN  448

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EKS      TGI+CYM DYGV
Sbjct  449  VTLCRVIDDIATYEVEKSRG-QIATGIECYMRDYGV  483



>sp|Q39979.1|VTSS2_HYOMU RecName: Full=Vetispiradiene synthase 2; Short=HVS2, partial 
[Hyoscyamus muticus]
 gb|AAA86338.1| vetispiradiene synthase, partial [Hyoscyamus muticus]
Length=300

 Score =   168 bits (426),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 117/156 (75%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLP+YMKISYKAL++LYD D+ KEL ++GR   ++YAKERMKE+VR Y
Sbjct  71   DAIQRWDISQIDRLPEYMKISYKALLDLYD-DYEKELSKDGRSDVVHYAKERMKEIVRNY  129

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             IE+KW  +G +P  +EYL NAL++ST Y+L  T +L MKS T+E FEWL  NP I+EA 
Sbjct  130  FIEAKWFIEGYMPSVSEYLSNALATSTYYLLTTTSYLGMKSATKEHFEWLATNPKILEAN  189

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  190  ATLCRVVDDIATYEVEKGRG-QIATGIECYMRDYGV  224



>ref|XP_009621273.1| PREDICTED: vetispiradiene synthase 2-like, partial [Nicotiana 
tomentosiformis]
Length=197

 Score =   165 bits (417),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 117/151 (77%), Gaps = 2/151 (1%)
 Frame = +1

Query  16   WDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNIESK  195
            WDI++++RLP+YMKISYKAL++LYD D+ KEL  +GR   +YYAKERMKE+VR YN+E+K
Sbjct  1    WDISEIDRLPNYMKISYKALLDLYD-DYEKELSNDGRSNVVYYAKERMKEIVRNYNVEAK  59

Query  196  WSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEATVILGR  375
            W  +G +PP +EYL NAL++ST Y+L  T +L MKSVT+++FEWL +NP I+EA V L R
Sbjct  60   WFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGMKSVTKKDFEWLAKNPKILEANVTLCR  119

Query  376  TLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             ++++ +YE EKS      TGI+CYM D GV
Sbjct  120  VIDDIATYEVEKSRG-QIATGIECYMRDNGV  149



>ref|XP_004230359.1| PREDICTED: vetispiradiene synthase 1 [Solanum lycopersicum]
 gb|AEP82772.1| terpene synthase [Solanum lycopersicum]
Length=552

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 120/156 (77%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLPDYMKISYKAL++LYD D+  EL ++GR   ++YAKERMKE+VR Y
Sbjct  322  DAIQRWDISQIDRLPDYMKISYKALLDLYD-DYETELSKDGRSDVVHYAKERMKEIVRNY  380

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L +KS T+E+FEWL +NP I+EA 
Sbjct  381  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSATKEDFEWLAKNPKILEAN  440

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  441  VTLCRVIDDIATYEVEKGRG-QIATGIECYMRDYGV  475



>ref|XP_009764783.1| PREDICTED: viridiflorene synthase-like [Nicotiana sylvestris]
Length=488

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDINQ++ LP+YMK+SYKAL++LY ED+ KEL ++GR   ++YAKERMKEVVR+Y
Sbjct  277  DAIQRWDINQIDELPNYMKLSYKALLDLY-EDYEKELAKDGRSSVVHYAKERMKEVVRSY  335

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E  W  KG +P  ++YL NAL++ST Y+L  T  L MKS   E+FEWL++NP  +E  
Sbjct  336  YVEKIWFIKGYMPHVSQYLNNALATSTYYLLATTSCLGMKSAIEEDFEWLSKNPKFLETN  395

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              L R ++++ SYE EK       T I+CYM DYGV
Sbjct  396  ATLCRVVDDIASYEVEKGRG-QIATRIECYMRDYGV  430



>ref|XP_010313902.1| PREDICTED: vetispiradiene synthase 1 isoform X2 [Solanum lycopersicum]
Length=533

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 120/156 (77%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+QM+RLP+YMK+S+KAL++LY ED+ KEL ++GR   + YAKERMKE+VR Y
Sbjct  303  DAIQRWDISQMDRLPEYMKVSFKALLDLY-EDYEKELSKDGRSDVVQYAKERMKEIVRNY  361

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L +KS T+E+FEWL +NP I+EA 
Sbjct  362  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSATKEDFEWLAKNPKILEAN  421

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  422  VTLCRVVDDIATYEVEKGRG-QIATGIECYMRDYGV  456



>ref|XP_004230358.1| PREDICTED: vetispiradiene synthase 1 isoform X1 [Solanum lycopersicum]
 gb|AEP82773.1| viridiflorene synthase [Solanum lycopersicum]
Length=548

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 120/156 (77%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+QM+RLP+YMK+S+KAL++LY ED+ KEL ++GR   + YAKERMKE+VR Y
Sbjct  318  DAIQRWDISQMDRLPEYMKVSFKALLDLY-EDYEKELSKDGRSDVVQYAKERMKEIVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L +KS T+E+FEWL +NP I+EA 
Sbjct  377  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSATKEDFEWLAKNPKILEAN  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  437  VTLCRVVDDIATYEVEKGRG-QIATGIECYMRDYGV  471



>ref|XP_011082247.1| PREDICTED: vetispiradiene synthase 3-like [Sesamum indicum]
Length=555

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 114/156 (73%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DA+++WDI +++RLPDYMK+ Y+ L++LYD+ + +EL ++GR FA++YAK  MKE+VR+Y
Sbjct  322  DAVERWDIKEIDRLPDYMKMCYRVLLDLYDQ-YEQELRQQGRSFAVHYAKATMKEIVRSY  380

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            NIE+KW  +G +PPFA+Y+ N   +ST Y+L  T F+ M +VT+E F+WL   P I  A 
Sbjct  381  NIEAKWFIEGYMPPFADYMTNGFITSTYYLLAATSFIGMNAVTKEAFDWLVGKPKIQVAN  440

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V + R ++++ +YE EK    S  TGI+CYM DYGV
Sbjct  441  VTICRIVDDVATYEIEKKRGQSA-TGIECYMKDYGV  475



>ref|XP_011082248.1| PREDICTED: vetispiradiene synthase 3-like [Sesamum indicum]
Length=560

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 112/156 (72%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WDI + +RLPDYMKI Y  L++LYD+ + +EL ++GR FA++YAK  MKE+VR+Y
Sbjct  323  DAIERWDIKETDRLPDYMKICYTVLLDLYDQ-YEQELRQQGRSFAVHYAKATMKEIVRSY  381

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            NIE+KW  +G +PPFA+Y+ N   +ST Y+L  T F+ M +VT+E F+WL   P I  A 
Sbjct  382  NIEAKWFIEGYMPPFADYMTNGFITSTYYLLAATSFIGMNAVTKEAFDWLVGKPKIQVAN  441

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V + R ++++ +YE EK    S  TGI+CYM DYGV
Sbjct  442  VTICRIVDDVATYEIEKKRGQSA-TGIECYMKDYGV  476



>ref|XP_009617319.1| PREDICTED: LOW QUALITY PROTEIN: vetispiradiene synthase 3-like 
[Nicotiana tomentosiformis]
Length=551

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 119/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q+NRLPDYMKISYKAL++LY+ D+ KEL  +GR   ++YAKERMKE+VR Y
Sbjct  321  DAIQRWDISQINRLPDYMKISYKALLDLYN-DYEKELSNDGRSSVVHYAKERMKEIVRNY  379

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L MK   +E+FEWL++NP I+EA 
Sbjct  380  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGMKCANKEDFEWLDKNPKILEAN  439

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EKS      TGI+CYM DY V
Sbjct  440  VTLCRVIDDIATYEVEKSRG-QIETGIECYMRDYDV  474



>ref|XP_009597892.1| PREDICTED: vetispiradiene synthase 2-like, partial [Nicotiana 
tomentosiformis]
Length=226

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 116/148 (78%), Gaps = 2/148 (1%)
 Frame = +1

Query  16   WDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNIESK  195
            WDI++++RLP+YMKISYKAL++LYD D+ KEL ++GR   +YYAKERMKE+VR YN+E+K
Sbjct  1    WDISEIDRLPNYMKISYKALLDLYD-DYEKELSDDGRSNVVYYAKERMKEIVRNYNVEAK  59

Query  196  WSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEATVILGR  375
            W  +G +PP +EYL NAL++ST Y+L  T +L MKSVT+++FEWL +NP I+EA V L R
Sbjct  60   WFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGMKSVTKKDFEWLAKNPKILEANVTLCR  119

Query  376  TLNNLGSYEREKSSSLSTITGIDCYMND  459
             ++++ +YE EKS      TGI+CYM D
Sbjct  120  VIDDIATYEVEKSRG-QIATGIECYMRD  146



>sp|Q39980.1|VTSS3_HYOMU RecName: Full=Vetispiradiene synthase 3; Short=HVS3, partial 
[Hyoscyamus muticus]
 gb|AAA86339.1| vetispiradiene synthase, partial [Hyoscyamus muticus]
Length=350

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDINQ++RLPDYMKISYK L++LY +D+  EL ++GR   ++YAKERMKE+VR Y
Sbjct  120  DAIQRWDINQIDRLPDYMKISYKVLLDLY-KDYETELSKDGRSEVVHYAKERMKEIVRNY  178

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL N L++ST Y+L  T +L MK   +E+FEWL +NP I+EA 
Sbjct  179  FVEAKWFIEGYMPPVSEYLNNRLATSTYYLLTTTSYLGMKCANKEDFEWLTKNPKILEAN  238

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  239  VTLCRVIDDIATYEVEKGRG-QIATGIECYMRDYGV  273



>ref|NP_001275083.1| uncharacterized protein LOC102595695 [Solanum tuberosum]
 dbj|BAA82141.1| vetispiradiene synthase [Solanum tuberosum]
Length=549

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 119/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLPDYMKISYKAL++LY+ D+  EL ++GR   ++YAKERMKE+VR Y
Sbjct  319  DAIQRWDISQIDRLPDYMKISYKALLDLYN-DYEMELSKDGRSDVVHYAKERMKEIVRNY  377

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L MKS  +++FEWL +NP I+EA 
Sbjct  378  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGMKSANKQDFEWLAKNPKILEAN  437

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  438  VTLCRVIDDIATYEVEKGRG-QIATGIECYMRDYGV  472



>sp|Q9XJ32.1|VTSS1_SOLTU RecName: Full=Vetispiradiene synthase 1 [Solanum tuberosum]
 dbj|BAA82092.1| vetispiradiene synthase [Solanum tuberosum]
Length=556

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 119/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLPDYMKISYKAL++LY+ D+  EL ++GR   ++YAKERMKE+VR Y
Sbjct  326  DAIQRWDISQIDRLPDYMKISYKALLDLYN-DYEMELSKDGRSDVVHYAKERMKEIVRNY  384

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L MKS  +++FEWL +NP I+EA 
Sbjct  385  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGMKSANKQDFEWLAKNPKILEAN  444

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  445  VTLCRVIDDIATYEVEKGRG-QIATGIECYMRDYGV  479



>gb|AAK15641.1|AF326117_1 sesquiterpene cyclase [Capsicum annuum]
Length=553

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLP+YMKISYKAL++LYD D+ KEL ++GR   ++YAKERMKE+VR Y
Sbjct  323  DAIQRWDISQIDRLPEYMKISYKALLDLYD-DYEKELSKDGRADVVHYAKERMKEIVRNY  381

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L MK  T+E+FEWL  NP I+EA 
Sbjct  382  FVEAKWFIEGHMPPVSEYLSNALATSTYYLLTTTSYLGMKCATKEDFEWLATNPKILEAN  441

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TG++CYM DY V
Sbjct  442  VTLCRVVDDIATYEVEKDRG-QIATGVECYMRDYDV  476



>gb|AAD02268.1| putative vetispiradiene synthase 3 [Solanum tuberosum]
Length=557

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLPDYMKISYKAL++LY  D+  EL ++GR   ++YAKERMKE+VR Y
Sbjct  327  DAIQRWDISQIDRLPDYMKISYKALLDLY-HDYETELSKDGRSDVVHYAKERMKEIVRNY  385

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L +KS  +E+FEWL +NP I+EA 
Sbjct  386  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSANKEDFEWLAKNPKILEAN  445

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  446  VTLCRVIDDIATYEVEKGRG-QIATGIECYMRDYGV  480



>dbj|BAA82108.1| vetispiradiene synthase [Solanum tuberosum]
Length=549

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 119/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLPDYMKISYKAL++LY+ D+  EL ++GR   ++YAKERMKE+VR Y
Sbjct  319  DAIQRWDISQIDRLPDYMKISYKALLDLYN-DYETELSKDGRSDVVHYAKERMKEIVRNY  377

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L +KS  +E+FEWL +NP I+EA 
Sbjct  378  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSANKEDFEWLAKNPKILEAN  437

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  438  VTLCRVIDDIATYEVEKGRG-QIATGIECYMRDYGV  472



>gb|AAK15642.1|AF326118_1 sesquiterpene cyclase [Capsicum annuum]
Length=556

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 115/157 (73%), Gaps = 4/157 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLPDYMKISYKAL++LY+ D+  EL ++GR   +++AKERMKE+VR Y
Sbjct  325  DAIQRWDISQIDRLPDYMKISYKALLDLYN-DYEMELSKDGRSDVVHWAKERMKEIVRNY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSS-TLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEA  357
             +E+KW  +  +PP +EYL NAL++S T Y+L  T +L MK  T+E+F+WL  NP I+EA
Sbjct  384  FVEAKWFIEDYMPPVSEYLSNALATSKTYYLLTTTSYLGMKCATKEDFDWLANNPKILEA  443

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             V L R +  L +YE EK       TGI+CYM DYGV
Sbjct  444  NVTLCRCI-VLATYEVEKGRG-QVATGIECYMRDYGV  478



>ref|XP_006358531.1| PREDICTED: viridiflorene synthase-like [Solanum tuberosum]
Length=555

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLP+YMKISYKAL++LY+ D+  EL  +GR   + YAKERMKE+VR Y
Sbjct  325  DAIQRWDISQIDRLPEYMKISYKALLDLYN-DYETELSNDGRSDVVQYAKERMKEIVRNY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L MKS T+E+FEWL +NP I+EA 
Sbjct  384  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGMKSATKEDFEWLAKNPKILEAN  443

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  444  VTLCRVIDDIATYEVEKGRG-QIATGIECYMRDYGV  478



>ref|XP_009599829.1| PREDICTED: 5-epi-aristolochene synthase 3-like, partial [Nicotiana 
tomentosiformis]
Length=451

 Score =   166 bits (421),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  221  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  279

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G +PP +EYL NAL+++T Y L  T +L MKSVT ++FEWL++NP I+EA+
Sbjct  280  NVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSVTEQDFEWLSKNPKILEAS  339

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  340  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  374



>ref|NP_001274950.1| putative vetispiradiene synthase 3 [Solanum tuberosum]
 gb|AAD02269.1| putative vetispiradiene synthase 4 [Solanum tuberosum]
Length=556

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLPDYMKISYKAL++LY+ D+  EL  +GR   ++YAKERMKE+VR Y
Sbjct  326  DAIQRWDISQIDRLPDYMKISYKALLDLYN-DYETELSMDGRSDVVHYAKERMKEIVRNY  384

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L +KS  +E+FEWL +NP I+EA 
Sbjct  385  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSANKEDFEWLAKNPKILEAN  444

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  445  VTLCRVIDDIATYEVEKGRG-QIATGIECYMRDYGV  479



>gb|AAG09950.1|AF171218_1 vetispiradiene synthase [Solanum lycopersicum]
Length=453

 Score =   166 bits (420),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WD++Q++RLP+YMKISYKAL++LY+ D+  EL  +GR   + YAKERMKE+VR Y
Sbjct  223  DAIQRWDVSQIDRLPEYMKISYKALLDLYN-DYETELSNDGRSDVVQYAKERMKEIVRNY  281

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L MKS T+++FEWL +NP I+EA 
Sbjct  282  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGMKSATKKDFEWLAKNPKILEAN  341

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  342  VTLCRVIDDIATYEVEKGRG-QIATGIECYMRDYGV  376



>ref|NP_001275171.1| putative vetispiradiene synthase 5 [Solanum tuberosum]
 gb|AAD02270.1| putative vetispiradiene synthase 5 [Solanum tuberosum]
 dbj|BAA82109.1| vetispiradiene synthase [Solanum tuberosum]
Length=551

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 119/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLP+YMK+S+KAL++LY ED+ KEL ++GR   ++YAKERMKE+VR Y
Sbjct  321  DAIQRWDISQIDRLPEYMKVSFKALLDLY-EDYEKELSKDGRSDVVHYAKERMKEIVRNY  379

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L +KS T+E+FEWL  NP I+EA 
Sbjct  380  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSATKEDFEWLATNPKILEAN  439

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DY V
Sbjct  440  VTLCRVVDDIATYEVEKGRG-QIATGIECYMRDYDV  474



>gb|AAD02223.1| vetispiradiene synthase [Solanum tuberosum]
Length=550

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 119/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLP+YMK+S+KAL++LY ED+ KEL ++GR   ++YAKERMKE+VR Y
Sbjct  320  DAIQRWDISQIDRLPEYMKVSFKALLDLY-EDYEKELSKDGRSDVVHYAKERMKEIVRNY  378

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L +KS T+E+FEWL  NP I+EA 
Sbjct  379  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGVKSATKEDFEWLATNPKILEAN  438

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DY V
Sbjct  439  VTLCRVVDDIATYEVEKGRG-QIATGIECYMRDYDV  473



>ref|XP_004230360.1| PREDICTED: vetispiradiene synthase 1 [Solanum lycopersicum]
 gb|AEP82771.1| terpene synthase [Solanum lycopersicum]
Length=556

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+ ++RLPDYMKISYKAL++LYD D+  EL ++GR   ++YAKERMKE+VR Y
Sbjct  326  DAIQRWDISHIDRLPDYMKISYKALLDLYD-DYETELSKDGRSDVVHYAKERMKEIVRNY  384

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L +KS  +E+FEWL +NP I+EA 
Sbjct  385  FVEAKWFIEGYMPPVSEYLCNALATSTYYLLTTTSYLGVKSANKEDFEWLAKNPKILEAN  444

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +Y+ EK       TGI+CYM DYGV
Sbjct  445  VTLCRVIDDIATYDVEKGRG-QIATGIECYMRDYGV  479



>gb|AAG09949.1|AF171216_1 vetispiradiene synthase [Solanum lycopersicum]
Length=556

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+ ++RLPDYMKISYKAL++LYD D+  EL ++GR   ++YAKERMKE+VR Y
Sbjct  326  DAIQRWDISHIDRLPDYMKISYKALLDLYD-DYETELSKDGRSDVVHYAKERMKEIVRNY  384

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L +KS  +E+FEWL +NP I+EA 
Sbjct  385  FVEAKWFIEGYMPPVSEYLCNALATSTYYLLTTTSYLGVKSANKEDFEWLAKNPKILEAN  444

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +Y+ EK       TGI+CYM DYGV
Sbjct  445  VTLCRVIDDIATYDVEKGRG-QIATGIECYMRDYGV  479



>ref|XP_009595428.1| PREDICTED: 5-epi-aristolochene synthase [Nicotiana tomentosiformis]
Length=548

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  318  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSTGRSHIVCHAIERMKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G +PP +EYL NAL+++T Y L  T +L MKSVT ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSVTEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  437  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  471



>dbj|BAN58139.1| putative vetispiradiene synthase [Hyoscyamus albus]
Length=553

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDINQ++RLP+YMKISYKAL++LYD D+ KEL ++GR   ++YAKERMKE+VR Y
Sbjct  323  DAIQRWDINQIDRLPEYMKISYKALLDLYD-DYEKELLKDGRSDVVHYAKERMKEIVRNY  381

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             IE+KW  +G +P   EYL NAL++ST Y+L  T +L MKS T+E+FEWL  NP I+EA 
Sbjct  382  FIEAKWFIEGYMPSVTEYLNNALATSTYYLLTTTSYLGMKSATKEDFEWLAMNPKILEAN  441

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              L R ++++ +YE EK       TGI+CYM D+ V
Sbjct  442  ATLCRVVDDIATYEVEKGRG-QIATGIECYMRDHSV  476



>ref|NP_001239040.1| viridiflorene synthase [Solanum lycopersicum]
 sp|G5CV46.1|TPS31_SOLLC RecName: Full=Viridiflorene synthase; Short=SlTPS31 [Solanum 
lycopersicum]
 gb|AEM23833.1| sesquiterpene synthase [Solanum lycopersicum]
 gb|AEP82774.1| viridiflorene synthase [Solanum lycopersicum]
Length=555

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WD++Q++RLP+YMKISYKAL++LY+ D+  EL  +GR   + YAKERMKE+VR Y
Sbjct  325  DAIQRWDVSQIDRLPEYMKISYKALLDLYN-DYETELSNDGRSDVVQYAKERMKEIVRNY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PP +EYL NAL++ST Y+L  T +L MKS T+++FEWL +NP I+EA 
Sbjct  384  FVEAKWFIEGYMPPVSEYLSNALATSTYYLLTTTSYLGMKSATKKDFEWLAKNPKILEAN  443

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  444  VTLCRVIDDIATYEVEKGRG-QIATGIECYMRDYGV  478



>gb|AAA86337.1| vetispiradiene synthase, partial [Hyoscyamus muticus]
Length=520

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLP+YMKISYKAL++LYD D+ KEL ++GR   ++YAKERMKE+V  Y
Sbjct  290  DAIQRWDISQIDRLPEYMKISYKALLDLYD-DYEKELSKDGRSDVVHYAKERMKEIVGNY  348

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             IE KW  +G +P  +EYL NAL++ST Y+L  T +L MKS T+E FEWL  NP I+EA 
Sbjct  349  FIEGKWFIEGYMPSVSEYLSNALATSTYYLLTTTSYLGMKSATKEHFEWLATNPKILEAN  408

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  409  ATLCRVVDDIATYEVEKGRG-QIATGIECYMRDYGV  443



>sp|Q84LG0.1|5EAS4_NICAT RecName: Full=Probable 5-epi-aristolochene synthase 4 [Nicotiana 
attenuata]
 gb|AAO85555.1| 5-epi-aristolochene synthase [Nicotiana attenuata]
Length=548

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 117/156 (75%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  318  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G +PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYGV
Sbjct  437  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGV  471



>sp|Q39978.2|VTSS1_HYOMU RecName: Full=Vetispiradiene synthase 1; Short=HVS1 [Hyoscyamus 
muticus]
 gb|AAA86340.1| vetispiradiene synthase [synthetic construct]
Length=555

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDI+Q++RLP+YMKISYKAL++LYD D+ KEL ++GR   ++YAKERMKE+V  Y
Sbjct  325  DAIQRWDISQIDRLPEYMKISYKALLDLYD-DYEKELSKDGRSDVVHYAKERMKEIVGNY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             IE KW  +G +P  +EYL NAL++ST Y+L  T +L MKS T+E FEWL  NP I+EA 
Sbjct  384  FIEGKWFIEGYMPSVSEYLSNALATSTYYLLTTTSYLGMKSATKEHFEWLATNPKILEAN  443

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  444  ATLCRVVDDIATYEVEKGRG-QIATGIECYMRDYGV  478



>gb|AAA19216.1| 5-epi-aristolochene synthase [Nicotiana tabacum]
Length=550

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 117/156 (75%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  320  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  378

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G +PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  379  NVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEAS  438

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  439  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  473



>gb|AAP79448.1| epi-arisotolchene synthase 110 [Nicotiana tabacum]
Length=548

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ER+KEVVR Y
Sbjct  318  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERVKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G +PP +EYL NAL+++T Y L  T +L MKSVT ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSVTEKDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  437  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  471



>ref|XP_009762840.1| PREDICTED: 5-epi-aristolochene synthase-like isoform X1 [Nicotiana 
sylvestris]
Length=548

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 117/156 (75%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  318  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G  PP +EYL NAL+++T Y L  T +L MKSVT ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYKPPVSEYLSNALATTTYYYLATTSYLGMKSVTEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  437  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  471



>pdb|5EAS|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum
Length=548

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  318  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G  PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  437  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  471



>pdb|1HX9|A Chain A, Crystal Structure Of Teas W273s Form 1
 pdb|1HXA|A Chain A, Crystal Structure Of Teas W273s Form 2
Length=548

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  318  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G  PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  437  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  471



>pdb|5EAT|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum 
With Substrate Analog Farnesyl Hydroxyphosphonate
Length=548

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  318  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G  PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  437  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  471



>pdb|4DI5|A Chain A, Co-Crystal Structure Of Wt 5-Epi-Aristolochene Synthase 
From Nicotiana Tobaccum With Geraniline
Length=535

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  305  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  363

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G  PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  364  NVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEAS  423

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  424  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  458



>sp|Q84LF2.1|5EAS3_NICAT RecName: Full=5-epi-aristolochene synthase 3; Short=NaEAS12 [Nicotiana 
attenuata]
 gb|AAP05760.1|AF484123_1 5-epi-aristolochene synthase 12 [Nicotiana attenuata]
Length=548

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 117/156 (75%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVV+ Y
Sbjct  318  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVKNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G +PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYGV
Sbjct  437  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGV  471



>sp|Q40577.3|5EAS_TOBAC RecName: Full=5-epi-aristolochene synthase; Short=EAS [Nicotiana 
tabacum]
Length=548

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  318  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G  PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  437  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  471



>pdb|5EAU|A Chain A, 5-Epi-Aristolochene Synthase From Nicotiana Tabacum
Length=548

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  318  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G  PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  437  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  471



>pdb|3M01|A Chain A, The Crystal Structure Of 5-Epi-Aristolochene Synthase 
Complexed With (2-Trans,6-Trans)-2-Fluorofarnesyl Diphosphate
 pdb|3M02|A Chain A, The Crystal Structure Of 5-Epi-Aristolochene Synthase 
Complexed With (2-Cis,6-Trans)-2-Fluorofarnesyl Diphosphate
Length=550

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  320  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  378

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G  PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  379  NVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEAS  438

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  439  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  473



>sp|Q84LF0.1|5EAS2_NICAT RecName: Full=5-epi-aristolochene synthase 2; Short=NaEAS37 [Nicotiana 
attenuata]
 gb|AAP05762.1|AF484125_1 5-epi-aristolochene synthase 37 [Nicotiana attenuata]
Length=548

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  318  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G  PP +EYL NAL+++T Y L  T +L MKSV  ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYKPPVSEYLSNALATTTYYYLATTSYLGMKSVAEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYGV
Sbjct  437  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGV  471



>pdb|1HXG|A Chain A, Crystal Structure Of Teas W273sC440W
Length=548

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  318  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G  PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  437  VIIWRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  471



>pdb|1HXC|A Chain A, Crystal Structure Of Teas C440w
Length=548

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  318  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G  PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYTPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  437  VIIWRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  471



>ref|XP_009779916.1| PREDICTED: 5-epi-aristolochene synthase, partial [Nicotiana sylvestris]
Length=540

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 116/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  310  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEVVRNY  368

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G +PP +EYL NAL+++T Y L  T +L +KS T  +FEWL++NP I+EA+
Sbjct  369  NVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGIKSATEHDFEWLSKNPKILEAS  428

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYGV
Sbjct  429  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGV  463



>ref|XP_009771989.1| PREDICTED: 5-epi-aristolochene synthase-like [Nicotiana sylvestris]
Length=548

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 117/156 (75%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKEVVR Y
Sbjct  318  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSVGRSHIVCHAIERMKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G  PP +EYL NAL+++T Y L  T +L MKSVT ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYKPPVSEYLSNALATTTYYYLATTSYLGMKSVTEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EK+      TGI+C M DYG+
Sbjct  437  VIICRVIDDTATYEVEKTRG-QIATGIECCMRDYGI  471



>pdb|3LZ9|A Chain A, The Crystal Structure Of 5-Epi-Aristolochene Synthase 
M4 Mut Complexed With (2-Trans,6-Trans)-2-Fluorofarnesyl Diphospha
 pdb|3M00|A Chain A, Crystal Structure Of 5-Epi-Aristolochene Synthase M4 
Mutant Complexed With (2-Cis,6-Trans)-2-Fluorofarnesyl Diphosphate
Length=550

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 117/156 (75%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ KEL   GR   + +A ERMKE+VR Y
Sbjct  320  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGRSHIVCHAIERMKEIVRNY  378

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G  PP +EYL NAL+++T Y+L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  379  NVESTWFIEGYTPPVSEYLSNALATTTYYLLATTSYLGMKSATEQDFEWLSKNPKILEAS  438

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  439  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  473



>ref|XP_009784555.1| PREDICTED: 5-epi-aristolochene synthase 3 [Nicotiana sylvestris]
Length=548

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 117/156 (75%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WDIN+++RLPDYMKISYKA+++LY +D+ KEL   G+   + +A ERMKEVVR Y
Sbjct  318  DAIRRWDINEIDRLPDYMKISYKAILDLY-KDYEKELSSAGKSHIVSHAIERMKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G +PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  437  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  471



>gb|AAF21053.1|AF212433_1 UV-induced sesquiterpene cyclase [Capsicum annuum]
Length=560

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 117/156 (75%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AIQ+WDI++++RLPDYMKISYKAL+ LY ED+ KEL   GR   +Y+AK+RMKE+VR+Y
Sbjct  330  NAIQRWDISEIDRLPDYMKISYKALLQLY-EDYEKELSSNGRSHVVYHAKQRMKEIVRSY  388

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+E++W  KG +P  +EYL NAL +ST Y+L  T +L MKS T ++FEWL++NP I++A 
Sbjct  389  NVEARWFIKGHMPLVSEYLSNALITSTYYLLTTTSYLGMKSSTEQDFEWLSKNPKILKAN  448

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              + R ++++ +YE EKS      TGI+CY  +YGV
Sbjct  449  ATICRVIDDIATYEVEKSRG-EIATGIECYRREYGV  483



>sp|O65323.1|5EAS_CAPAN RecName: Full=5-epiaristolochene synthase [Capsicum annuum]
 gb|AAC61260.1| sesquiterpene cyclase [Capsicum annuum]
Length=559

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            D IQ+WDI +++ LPDYMKISYKAL++LY +D+ KE+  +GR   +YYAKER+KE+V++Y
Sbjct  329  DVIQRWDIKEIDSLPDYMKISYKALLDLY-KDYEKEMSRDGRSHVVYYAKERLKELVKSY  387

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            NIE+KW  +G +PP +EYL+NA  ++T Y L  T +L MK    ++FEWL++NP I+E  
Sbjct  388  NIEAKWFIEGHMPPASEYLRNAFVTTTYYYLATTSYLGMKYAKEQQFEWLSKNPKILEGC  447

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V + R ++++ +YE EK+    + TGI+CYM DY V
Sbjct  448  VTICRVIDDIATYEVEKNRGQLS-TGIECYMRDYSV  482



>emb|CAA06614.1| 5-epi-aristolochene synthase [Capsicum annuum var. annuum]
Length=559

 Score =   159 bits (403),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            D IQ+WDI +++ LPDYMKISYKAL++LY +D+ KE+  +GR   +YYAKER+KE+V++Y
Sbjct  329  DVIQRWDIKRIDSLPDYMKISYKALLDLY-KDYEKEMSRDGRSHVVYYAKERLKELVKSY  387

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            NIE+KW  +G +PP +EYL+NA  ++T Y L  T +L MK    ++FEWL++NP I+E  
Sbjct  388  NIEAKWFIEGHMPPASEYLRNAFVTTTYYYLATTSYLGMKYAKEQQFEWLSKNPKILEGC  447

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V + R ++++ +YE EK+    + TGI+CYM DY V
Sbjct  448  VTICRVIDDIATYEVEKNRGQLS-TGIECYMRDYSV  482



>gb|EYU21954.1| hypothetical protein MIMGU_mgv1a023164mg [Erythranthe guttata]
Length=550

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 111/157 (71%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WDI +M +LPDYMKI YKA+++LY E +++EL ++ R FA++YAK  MKE+VR+Y
Sbjct  319  DAIERWDIKEMQKLPDYMKICYKAVLDLY-EQYDEELSDQERSFAVHYAKATMKEIVRSY  377

Query  181  NIESKW-SAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEA  357
            NIESKW + +G +P F++Y  N   +ST Y+L  T F+ M S ++E F+WL   P I  A
Sbjct  378  NIESKWFNMEGYMPSFSDYKTNGFITSTYYLLAATSFIGMTSASKEAFDWLINKPKIQVA  437

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             V + R ++++ +YE EK    S  TGI+CYM +YGV
Sbjct  438  NVTICRFVDDIATYEIEKKRGQSG-TGIECYMKEYGV  473



>gb|AAG17667.1|AF272244_1 5-epi-aristolochene synthase, partial [Nicotiana tabacum]
Length=441

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 116/157 (74%), Gaps = 5/157 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKEL-CEEGRIFALYYAKERMKEVVRA  177
            DAIQ+WDIN+++RLPDYMKISYKA+++LY +D+ K+L   E  I    +A ERMKEVVR 
Sbjct  212  DAIQRWDINEIDRLPDYMKISYKAILDLY-KDYEKDLSVPESHIVC--HAIERMKEVVRN  268

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEA  357
            YN+ES W  +G +PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA
Sbjct  269  YNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEA  328

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  329  SVIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  364



>gb|AHM10157.1| sesquiterpene synthase [Nicotiana benthamiana]
Length=548

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AIQ+W I +++RLPDYMKISYKA+++LY+ D+ KEL   GR   + +A +RMKEVVR Y
Sbjct  318  NAIQRWHIKEIDRLPDYMKISYKAILDLYN-DYEKELSSAGRSHIVSHAIQRMKEVVRNY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G  PP +EYL NAL+++T Y L  T +L +KSVT ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYKPPVSEYLSNALATTTYYYLATTSYLGIKSVTEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  437  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGL  471



>sp|Q84LF1.1|5EAS1_NICAT RecName: Full=5-epi-aristolochene synthase 1; Short=NaEAS34 [Nicotiana 
attenuata]
 gb|AAP05761.1|AF484124_1 5-epi-aristolochene synthase 34 [Nicotiana attenuata]
Length=548

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 114/156 (73%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++RLP YMKISYKA+++LY +D+ KEL    +   + +A ERMKEVV  Y
Sbjct  318  DAIQRWDINEIDRLPHYMKISYKAILDLY-KDYEKELSSAEKSHIVCHAIERMKEVVGHY  376

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G +PP +EYL NAL+++T Y L  T +L MKS T ++FEWL++NP I+EA+
Sbjct  377  NVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSATEQDFEWLSKNPKILEAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            VI+ R +++  +YE EKS      TGI+C M DYG+
Sbjct  437  VIICRVIDDTATYEVEKSRG-QIATGIECCMRDYGI  471



>gb|EYU21989.1| hypothetical protein MIMGU_mgv1a023416mg [Erythranthe guttata]
Length=556

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 108/156 (69%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DA+QKWDI++++RLP+YM+I Y+ L++LY E F+ EL  +GR +A+++AKE M+++V +Y
Sbjct  327  DAVQKWDISEIDRLPEYMQILYRVLLDLY-ESFDAELSPKGRSYAVHHAKEAMQQIVGSY  385

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
              E+KW  KG LP F EY+  A  +ST Y+L  T  + M + T + F+WL   P IVEA 
Sbjct  386  YTEAKWFIKGHLPTFDEYMSVAKITSTYYVLTTTSLIGMDNATSQVFDWLLSKPKIVEAN  445

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            V + R ++++G+YE EK       TGIDCYM ++G+
Sbjct  446  VTICRVVDDVGTYEVEKGRG-QEATGIDCYMKEHGL  480



>gb|EYU21983.1| hypothetical protein MIMGU_mgv1a023510mg [Erythranthe guttata]
Length=559

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 108/157 (69%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQKWDI++++RLPDYMKI Y+AL++LY E F+ EL  +GR +A++YAKE  KE+VR+Y
Sbjct  329  DAIQKWDISEIDRLPDYMKICYRALLDLY-ESFDAELSPKGRSYAVHYAKEAAKEIVRSY  387

Query  181  NIESKWSAK-GCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEA  357
              E+KW  K   LP F EY++ A  +   Y L  T F+ M++ T E F+WL   P I+ A
Sbjct  388  YAEAKWFVKRDHLPAFDEYMRQAEITCGCYYLTVTSFVGMENATIEVFDWLLARPKILRA  447

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
               + R ++++ +YE EK    +T TGIDCYMN++GV
Sbjct  448  DNKVTRIIDDISTYEDEKKRGQAT-TGIDCYMNEHGV  483



>gb|EYU31456.1| hypothetical protein MIMGU_mgv1a004071mg [Erythranthe guttata]
Length=545

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 109/156 (70%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            D +++WD+N++ +LPDYMK+ Y+ ++++Y ED+ +E  ++G+ FA+   KE +K++ RAY
Sbjct  314  DVLERWDMNEIGQLPDYMKVVYQYIMSIY-EDYEREATKQGKSFAIPSYKEAVKQLARAY  372

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            NIE  W  +  +PP  EYLKN++ +S+++++    F  MKSVT+E  +WL  NP IV +T
Sbjct  373  NIEQNWIMERKMPPLEEYLKNSVITSSIFVMFTAHFPGMKSVTQETIDWLLSNPKIVVST  432

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             ++GR +++LGS+ERE       +T +DCYM  YG+
Sbjct  433  AMIGRHIDDLGSHERENKEG-KYLTVVDCYMKHYGI  467



>gb|EYU22009.1| hypothetical protein MIMGU_mgv1a010344mg [Erythranthe guttata]
Length=315

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 106/157 (68%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQKWDI++++RLPDYMKI Y+AL++LY E F+ EL  +GR + ++YAKE  KE++R+Y
Sbjct  85   DAIQKWDISEIDRLPDYMKICYRALLDLY-ESFDAELSPKGRSYVVHYAKEAAKEIMRSY  143

Query  181  NIESKWSAK-GCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEA  357
              E+KW  K   LP F EY++ A  +   Y L  T F+ M++ T E  +WL   P I+ A
Sbjct  144  YAEAKWFVKRDHLPAFDEYMRQAEITCGCYYLTVTSFVGMENATIEVSDWLLARPKILRA  203

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
               + R ++++ +YE EK    +T TGIDCYMN++GV
Sbjct  204  DNKVTRIIDDISTYEDEKKRGQAT-TGIDCYMNEHGV  239



>ref|XP_011073749.1| PREDICTED: vetispiradiene synthase 3-like [Sesamum indicum]
Length=554

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 106/153 (69%), Gaps = 2/153 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A ++WDI++++RLP+Y+K  Y+AL+ LY E F +EL +EGR +A+YYAKE +KE+VR+Y
Sbjct  324  EAFERWDISEIDRLPNYIKPFYRALLELY-EHFEEELAQEGRSYAVYYAKEALKELVRSY  382

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            ++E+KW  +G LPPF EYL NAL + T      T  L  +S  REEFEWL Q P ++ A 
Sbjct  383  HVEAKWFIEGYLPPFTEYLNNALITCTYCYHTTTSLLGTESAKREEFEWLRQKPKMLVAG  442

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMND  459
            + + R ++++ +YE EK       TGI+CYM +
Sbjct  443  LTICRVIDDIATYEVEKERG-QIATGIECYMKE  474



>gb|AAX40667.1| sesquiterpene synthase [Fabiana imbricata]
Length=195

 Score =   139 bits (349),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 107/156 (69%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+W+I++++RLPDYMK SYKAL+ ++     +      R + +YYAKERMKE+VR Y
Sbjct  18   DAIQRWNISEIDRLPDYMKTSYKALL-IFTRIMKRNCPRMERSYVVYYAKERMKEIVRNY  76

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+E+KW  +G LP  +EYL NAL++ST Y+L  T +L MKS T+++FEWL  NP  +   
Sbjct  77   NVEAKWFIEGYLPRVSEYLSNALATSTYYLLTTTSYLGMKSATKQDFEWLATNPQFLNPC  136

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             I+ + + NL S + EKS      TGI+CYM DYGV
Sbjct  137  DIMPKLITNLISLQVEKSRG-QIATGIECYMRDYGV  171



>sp|Q49SP5.1|TPGAS_POGCB RecName: Full=Germacrene A synthase; AltName: Full=PatTpsCF2 
[Pogostemon cablin]
 gb|AAS86321.1| germacrene A synthase [Pogostemon cablin]
Length=554

 Score =   145 bits (365),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 105/155 (68%), Gaps = 2/155 (1%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDI ++N LP+Y+K  YK ++ LY +   +EL +EGR +A+YYA E  KE+ R+Y 
Sbjct  324  AIERWDIKEINGLPEYIKGFYKQVLKLYQQ-LEEELAKEGRSYAVYYAIEACKELARSYA  382

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEATV  363
            +E+KW  KG LP F EYL N+L +ST   L    F  ++SVT+E+FEW ++ P I  AT 
Sbjct  383  VEAKWFKKGYLPGFEEYLINSLVTSTAGYLNIISFFGVESVTKEDFEWFSKKPRIAVATQ  442

Query  364  ILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            I+ R ++++ +YE EK    S  TGIDCYM ++GV
Sbjct  443  IITRVIDDIATYEVEKEKGQSA-TGIDCYMKEHGV  476



>gb|EYU21979.1| hypothetical protein MIMGU_mgv1a019334mg [Erythranthe guttata]
Length=564

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQKWDI +++RLPDYMKI Y+ +++LY E F+ EL  +GR FA++YA+E MKE+V +Y
Sbjct  334  DAIQKWDIREIDRLPDYMKICYRVVLDLY-EAFDAELSPKGRSFAVHYAREAMKEIVTSY  392

Query  181  NIESKWSAKG-CLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEA  357
             +E+KW  +G  LP F EY+  A  ++  Y L  T +L M + T E F+WL   P I++ 
Sbjct  393  YVEAKWFVEGDHLPLFDEYMSQAEITAGAYFLTITAYLGMDNATIEVFDWLLAKPNILKT  452

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              ++ R ++++ +YE EK       TGIDCYM ++GV
Sbjct  453  CNVVVRIIDDVATYEDEKKRG-QVATGIDCYMKEHGV  488



>gb|EYU31458.1| hypothetical protein MIMGU_mgv1a004009mg [Erythranthe guttata]
Length=549

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 110/157 (70%), Gaps = 4/157 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            D +++WD+N++ +LPDYMK  +K ++++Y ED+ ++  ++G+ FA+   KE +K++ RA+
Sbjct  317  DVLERWDMNEIGQLPDYMKAVFKYIMSIY-EDYKRDATKQGKSFAIPSYKEAVKQLARAF  375

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            NIE  W  +  +PP  EYLKN++ +S ++++    F  MKSVT+E  +WL +NP IV +T
Sbjct  376  NIEQNWIMERRMPPLEEYLKNSVITSCIFVVFTAHFPGMKSVTQETIDWLLRNPKIVVST  435

Query  361  VILGRTLNNLGSYERE-KSSSLSTITGIDCYMNDYGV  468
             ++GR +++LGS++RE K   L T+  +DCYM  YG+
Sbjct  436  AMMGRLIDDLGSHDRENKEGKLPTV--VDCYMKHYGI  470



>gb|EYU32628.1| hypothetical protein MIMGU_mgv1a005108mg [Erythranthe guttata]
Length=496

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 108/156 (69%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI+KWDI+Q++RLP+Y+K  Y AL++LY + F KEL +EGR +A+ YAKE +KE+VR+Y
Sbjct  266  DAIEKWDISQIDRLPEYIKPFYSALLDLYVQ-FEKELEQEGRSYAITYAKESLKELVRSY  324

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            ++E+KW  +G LPPF EYL NAL + T      T  L  KS    +FEWL+Q P ++ A+
Sbjct  325  HVEAKWFIEGYLPPFNEYLDNALITCTYCYHTTTALLGTKSANEPDFEWLSQKPKMLVAS  384

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + + R ++++ +YE EK+      TGI+ YM ++G 
Sbjct  385  LKICRLIDDIATYEVEKARG-QIATGIESYMKEFGA  419



>gb|AGN72800.1| germacrene A [Lavandula pedunculata subsp. lusitanica]
Length=547

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 107/156 (69%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++W++ +M RLP+Y+K  YKAL+ LY E F +EL +EGR +A +YA E +KE+VR+Y
Sbjct  317  EAIERWNVEEMKRLPEYIKPFYKALLELY-EQFEEELAKEGRSYATHYAIESLKELVRSY  375

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            ++E+KW  +G LPPF EYLKNAL + T      T  L ++S  RE+FEWL++ P ++ A 
Sbjct  376  HVEAKWFIQGYLPPFEEYLKNALITCTYCYHTTTSLLGVESAVREDFEWLSKKPKMLVAG  435

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +++ R ++++ +YE EK       TGI+ YM D G 
Sbjct  436  LLICRVIDDIATYEVEKDRG-QIATGIESYMRDNGA  470



>gb|AGN72803.1| germacrene A [Lavandula stoechas]
Length=542

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 107/156 (69%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++W++ +M RLP+Y+K  YKAL+ LY E F +EL +EGR +A +YA E +KE+VR+Y
Sbjct  312  EAIERWNVEEMKRLPEYIKPFYKALLELY-EQFEEELAKEGRSYATHYAIESLKELVRSY  370

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            ++E+KW  +G LPPF EYLKNAL + T      T  L ++S  RE+FEWL++ P ++ A 
Sbjct  371  HVEAKWFIQGYLPPFEEYLKNALITCTYCYHTTTSLLGVESAVREDFEWLSKKPKMLVAG  430

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +++ R ++++ +YE EK       TGI+ YM D G 
Sbjct  431  LLICRVIDDIATYEVEKDRG-QIATGIESYMRDNGA  465



>gb|AGN72806.1| germacrene A [Lavandula viridis]
Length=543

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 107/156 (69%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++W++ +M RLP+Y+K  YKAL+ LY E F +EL +EGR +A +YA E +KE+VR+Y
Sbjct  313  EAIERWNVEEMKRLPEYIKPFYKALLELY-EQFEEELAKEGRSYATHYAIESLKELVRSY  371

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            ++E+KW  +G LPPF EYLKNAL + T      T  L ++S  RE+FEWL++ P ++ A 
Sbjct  372  HVEAKWFIQGYLPPFEEYLKNALITCTYCYHTTTSLLGVESAVREDFEWLSKKPKMLVAG  431

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +++ R ++++ +YE EK       TGI+ YM D G 
Sbjct  432  LLICRVIDDIATYEVEKDRG-QIATGIESYMRDNGA  466



>ref|XP_011102294.1| PREDICTED: gamma-cadinene synthase-like, partial [Sesamum indicum]
Length=417

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 104/155 (67%), Gaps = 2/155 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            + +++WDIN+++RLPDYMKI Y+ ++++Y ED+ +E  ++G+ FA+ Y +E +K++ RAY
Sbjct  187  EVLERWDINKIDRLPDYMKIFYRFVMSIY-EDYEREAAKQGKSFAVPYFRETVKQLGRAY  245

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N E KW  +  +P F EY KN++ +S +Y++       MKSVT+E  +WL   P IV +T
Sbjct  246  NQELKWVMEREMPTFEEYFKNSVITSCIYVMFTALVPGMKSVTKETIDWLLSEPNIVIST  305

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
              +GR L +LGS+ERE       +T +DCYM  +G
Sbjct  306  ARMGRHLEDLGSHERENKGG-KMLTVVDCYMQQHG  339



>ref|XP_009762844.1| PREDICTED: probable 5-epi-aristolochene synthase 4 [Nicotiana 
sylvestris]
Length=175

 Score =   134 bits (336),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 103/138 (75%), Gaps = 3/138 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAIQ+WDIN+++ L D MKISYKA+++LY +D+ KEL   GR + + +A ERMKEVVR Y
Sbjct  30   DAIQRWDINKIDWLSDCMKISYKAILDLY-KDYEKELSSAGRSYIVRHAIERMKEVVRNY  88

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            N+ES W  +G +PP +EYL NAL+++T Y L  T +L MK  T  +FEWL++NP I+EA+
Sbjct  89   NVESIWFIEGYMPPISEYLSNALATTTYYYLATTSYLGMK--TEHDFEWLSKNPKILEAS  146

Query  361  VILGRTLNNLGSYEREKS  414
            VI+ R +++  +YE EKS
Sbjct  147  VIICRVIDDTATYEVEKS  164



>gb|AAX16076.1| putative sesquiterpene synthase [Perilla frutescens var. frutescens]
Length=550

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 104/156 (67%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++W++ +  RLP+YMK  YKAL+ LY + F +EL  EGR +  YYA E +KE+VR+Y
Sbjct  319  EAIERWNVKETKRLPEYMKPLYKALLELYQQ-FEQELENEGRSYVAYYAIESLKELVRSY  377

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G LPPF EYLKNAL + +      T FL ++S  +E+FEWL+  P ++ A 
Sbjct  378  RVEAKWFIQGYLPPFEEYLKNALITCSYCYHTMTSFLGVESAIKEDFEWLSNKPKMLVAG  437

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +++ R ++++ +YE EK+      TGI+ YM D G 
Sbjct  438  LLICRLVDDIATYEVEKARG-QVATGIESYMKDNGA  472



>gb|EYU31464.1| hypothetical protein MIMGU_mgv1a003909mg [Erythranthe guttata]
Length=555

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 105/156 (67%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            D +++WD+N++ +LPDYMK+ Y+ ++++  E + +E  ++G+ FA+   KE +K++ RAY
Sbjct  323  DVLERWDMNEIGQLPDYMKVVYQFIMSV-SEVYEREATQQGKSFAIPSYKEAVKQLARAY  381

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            NIE  W  +  +PP  EYLKN++ +S ++++    F  MKSVT+E  +WL  NP IV +T
Sbjct  382  NIEQSWIMERKMPPLEEYLKNSVITSCVFVMFTAHFPGMKSVTQETIDWLLSNPKIVVST  441

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             ++GR + +LGS+ERE       +T +DCY+  YG+
Sbjct  442  AMIGRHIEDLGSHERENREG-KYLTVVDCYIKHYGI  476



>gb|EYU32629.1| hypothetical protein MIMGU_mgv1a023948mg [Erythranthe guttata]
Length=549

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 106/155 (68%), Gaps = 2/155 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI+KWDI+Q++RLP Y+K  Y AL++LY + F KEL +E R +A+ YAKE +KE+VR+Y
Sbjct  319  DAIEKWDISQIDRLPQYIKPFYSALLDLYVQ-FEKELEQERRSYAITYAKESLKELVRSY  377

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
            ++E+KW  +G LPPF EYL NAL + T      T  L  KS    +FEWL+Q P ++ A+
Sbjct  378  HVEAKWFIEGYLPPFNEYLDNALITCTYCYHTTTALLGTKSANEPDFEWLSQKPKMLVAS  437

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + + R ++++ +YE EK+      TGI+ YM ++G
Sbjct  438  LKICRLIDDIATYEVEKARG-QIATGIESYMKEFG  471



>ref|XP_011102272.1| PREDICTED: gamma-cadinene synthase-like, partial [Sesamum indicum]
Length=502

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 102/153 (67%), Gaps = 2/153 (1%)
 Frame = +1

Query  7    IQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNI  186
            +++WDI +++RLPDYMKI Y+ ++++Y ED+ +E  ++G+ FA+ Y +E +K++ RAYN 
Sbjct  274  LERWDIKEIDRLPDYMKIFYRFVMSIY-EDYEREAAKQGKSFAVPYFRETVKQLGRAYNQ  332

Query  187  ESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEATVI  366
            E KW  +  +P F EY KN++ +S +Y++       MKSVT+E  +WL   P IV +T  
Sbjct  333  ELKWVMEREMPTFEEYFKNSVITSCIYVMFTALVPGMKSVTKETIDWLLSEPNIVISTAR  392

Query  367  LGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            +GR L +LGS+ERE       +T +DCYM  +G
Sbjct  393  MGRHLEDLGSHERENKGG-KMLTVVDCYMQQHG  424



>ref|XP_006354694.1| PREDICTED: viridiflorene synthase-like [Solanum tuberosum]
Length=554

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 105/153 (69%), Gaps = 2/153 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            + + +WDI++++RLP+YMK  Y +L++L++E + +E+ E+ R   + Y KE MKE+VR+Y
Sbjct  322  EVVDRWDISEVDRLPNYMKPIYTSLLDLFNE-YEREINEQDRFNGVNYVKEAMKEIVRSY  380

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             IE++W  +G +P F +YL NAL + T Y+L P   L MKS +++ F+W+   P I+ A+
Sbjct  381  YIEAEWFIEGKIPSFKDYLNNALVTGTYYLLAPASLLGMKSTSKKTFDWMMNKPKILVAS  440

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMND  459
             I+GR ++++ +Y+ EK      +TGI+CYM +
Sbjct  441  AIIGRVIDDIATYKIEKEKG-QLVTGIECYMQE  472



>ref|XP_011080337.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=555

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 99/154 (64%), Gaps = 2/154 (1%)
 Frame = +1

Query  7    IQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNI  186
            +++WDIN++NRLPDYMKI YK ++++YD D+  E  ++G+ FA+ YAKE +K++ RAYN 
Sbjct  326  LERWDINEINRLPDYMKIVYKFILSIYD-DYEVEAIKQGKSFAIPYAKEAVKQLGRAYNK  384

Query  187  ESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEATVI  366
            E KW     +P F +Y  N + +S +Y++       M+S + E  +WL   P I+ AT  
Sbjct  385  ELKWFMGRQMPTFEDYFANTVYTSCIYVMFTALIPGMQSASEETIDWLMSEPEILIATAK  444

Query  367  LGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +GR + +LG++ERE       +T +DCYM  YG+
Sbjct  445  MGRYVEDLGTHERENKDG-QMLTAVDCYMKQYGI  477



>ref|XP_004237611.1| PREDICTED: vetispiradiene synthase 2 [Solanum lycopersicum]
 gb|AEP82775.1| terpene synthase [Solanum lycopersicum]
Length=554

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 104/153 (68%), Gaps = 2/153 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            + + +WDI++++RLP+YMK  Y +L+ L++E + +E+ E+ R   + Y KE MKE+VR+Y
Sbjct  322  EVVDRWDISEVDRLPNYMKPIYISLLYLFNE-YEREINEQDRFNGVNYVKEAMKEIVRSY  380

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             IE++W  +G +P F EYL NAL + T Y+L P   L M+S ++  F+W+ + P I+ A+
Sbjct  381  YIEAEWFIEGKIPSFEEYLNNALVTGTYYLLAPASLLGMESTSKRTFDWMMKKPKILVAS  440

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMND  459
             I+GR ++++ +Y+ EK      +TGI+CYM +
Sbjct  441  AIIGRVIDDIATYKIEKEKG-QLVTGIECYMQE  472



>ref|NP_001268015.1| (-)-germacrene D synthase-like [Vitis vinifera]
 gb|ADR74198.1| (E,E)-alpha-farnesene synthase [Vitis vinifera]
Length=558

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 108/157 (69%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WD + +++LPDYMK  Y+AL++LY+E   +E+ +EG+++ ++YAKE MK+ +++Y
Sbjct  328  EAIERWDASSIDQLPDYMKCFYRALLDLYEE-MEQEMAKEGKLYRVHYAKELMKKQIQSY  386

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
             +E+KWS +G +P F EY+ N + S    +LI T F+ M   VT+E F+W+   P ++ A
Sbjct  387  FVEAKWSNQGYIPTFDEYMSNGVVSGCCSLLIATSFVGMGDIVTKESFQWVLSRPTMIGA  446

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + I+ R ++++ S+E E+   +   + ++CYM  YGV
Sbjct  447  SQIICRLMDDMASHEFEQ-KRVHVASSVECYMKQYGV  482



>emb|CBI20174.3| unnamed protein product [Vitis vinifera]
Length=559

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 108/157 (69%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WD + +++LPDYMK  Y+AL++LY+E   +E+ +EG+++ ++YAKE MK+ +++Y
Sbjct  329  EAIERWDASSIDQLPDYMKCFYRALLDLYEE-MEQEMAKEGKLYRVHYAKELMKKQIQSY  387

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
             +E+KWS +G +P F EY+ N + S    +LI T F+ M   VT+E F+W+   P ++ A
Sbjct  388  FVEAKWSNQGYIPTFDEYMSNGVVSGCCSLLIATSFVGMGDIVTKESFQWVLSRPTMIGA  447

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + I+ R ++++ S+E E+   +   + ++CYM  YGV
Sbjct  448  SQIICRLMDDMASHEFEQ-KRVHVASSVECYMKQYGV  483



>emb|CAN62603.1| hypothetical protein VITISV_009665 [Vitis vinifera]
Length=587

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 108/157 (69%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WD + +++LPDYMK  Y+AL++LY+E   +E+ +EG+++ ++YAKE MK+ +++Y
Sbjct  329  EAIERWDASSIDQLPDYMKCFYRALLDLYEE-MEQEMAKEGKLYRVHYAKELMKKQIQSY  387

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
             +E+KWS +G +P F EY+ N + S    +LI T F+ M   VT+E F+W+   P ++ A
Sbjct  388  FVEAKWSNQGYIPTFDEYMSNGVVSGCCSLLIATSFVGMGDIVTKESFQWVLSRPTMIGA  447

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + I+ R ++++ S+E E+   +   + ++CYM  YGV
Sbjct  448  SQIICRLMDDMASHEFEQ-KRVHVASSVECYMKQYGV  483



>dbj|BAJ53216.1| JHL22C18.7 [Jatropha curcas]
Length=551

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 104/156 (67%), Gaps = 4/156 (3%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            A+Q+ +I+ +++LP+YMK+ Y+AL+NL+ E  N E   EGR     YAKE  KE+VRAY 
Sbjct  324  AVQRCNIDAIDQLPEYMKVLYRALLNLFAETENDET--EGRSQRTAYAKETFKELVRAYF  381

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEAT  360
            +E+KW  +G +PPF EY+ N L SST  +L    F+ + K V  +E+EW+ +NP IV A+
Sbjct  382  VEAKWFNEGYVPPFEEYISNGLVSSTYSVLPAASFIGLEKVVGSKEYEWVKENPKIVNAS  441

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             ++ R ++++ ++E E+       +GI+CYM +YGV
Sbjct  442  KLISRLMDDVTTHEHEQERE-HCASGIECYMKEYGV  476



>gb|KDO46372.1| hypothetical protein CISIN_1g025046mg [Citrus sinensis]
Length=258

 Score =   127 bits (320),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 103/157 (66%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+Q+WDI  M+ LP+YMK+ YKAL++ Y+E   ++L +EGR   L Y KE+M+E+V+ Y
Sbjct  29   EAVQRWDIGAMDILPEYMKVLYKALLDTYNE-VEQDLAKEGRSSYLRYDKEKMQELVQMY  87

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVEA  357
             +++KWS++G +P + EY    L S   +ML    FL M  V  +E FEW+++NP I  A
Sbjct  88   FVQAKWSSEGYVPTWEEYYPVGLVSGGYFMLATNSFLGMCEVANKEAFEWISKNPKISRA  147

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + ++ R +N++ S++ E+     T TG++CY   +GV
Sbjct  148  SSVISRLMNDIVSHQFEQKRGHVT-TGVECYCKQHGV  183



>ref|XP_010247958.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=564

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 102/157 (65%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WD N+ ++LP+YMK+ Y  L+N+Y+E   +E+ +EGR F + YAKE MK+++ AY
Sbjct  334  DAIRRWDANETDKLPEYMKVIYVTLLNIYNE-IEEEMRKEGRCFCVSYAKEAMKDLIEAY  392

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
             IE+ W  +G +P F E+ K  L +ST  M+    F  M  + T+E F+WL++ P  V++
Sbjct  393  QIEATWLKEGHIPTFEEFSKLGLITSTCIMMTNVIFACMGEMATKEVFDWLSKTPDAVKS  452

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            T I+GR L+++ + E E+       + I+CYM  YGV
Sbjct  453  TCIIGRFLDDIQTNEFEQERG-HVCSSIECYMKQYGV  488



>gb|EYU43546.1| hypothetical protein MIMGU_mgv1a002915mg [Erythranthe guttata]
Length=626

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AIQKWDI++M+RLP+YMKI Y A+++LY E F+ EL  +GR FA++YA+E MKE+V+ Y
Sbjct  396  EAIQKWDISEMDRLPNYMKILYGAVLDLY-EAFDAELSPKGRSFAVHYAREAMKELVKCY  454

Query  181  NIESKWSAKGCLP-PFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEA  357
             +E+KW  +G LP  F EY+ NA++++     + T F+S      E F+WL   P I++ 
Sbjct  455  YVEAKWFTEGYLPSSFDEYMSNAMTTAATDAAVVTSFISSAIAKIEVFDWLLAKPKILQV  514

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              ++ R ++++ +YE E      TI GIDCY  ++GV
Sbjct  515  VNLIVRVIDDIATYELENGRGQVTI-GIDCYKKEHGV  550



>ref|XP_010319920.1| PREDICTED: vetispiradiene synthase 3-like [Solanum lycopersicum]
Length=527

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 102/154 (66%), Gaps = 3/154 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDE-DFNKELCEEGRIFALYYAKERMKEVVRA  177
            + + +WDI++++RLP YMK  Y +L+NL++E +   EL E+ R   ++Y KE MKE+V++
Sbjct  295  EIVDRWDISEVDRLPTYMKPIYISLLNLFNEYEIEIEL-EQDRFNGVHYVKEAMKEIVKS  353

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEA  357
            Y IE++W  +G +P F EYL NAL + T Y+L P   L MK  ++  F+W+   P I+ A
Sbjct  354  YYIEAEWFLEGKIPSFKEYLGNALVTGTYYLLGPASLLGMKLASKRTFDWMMNKPKILVA  413

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMND  459
            + I+GR ++++ +Y+ EK      +TGI+CYM +
Sbjct  414  SAIIGRVIDDIATYKIEKEKG-QLVTGIECYMEE  446



>gb|AAX16077.1| valencene synthase [Perilla frutescens var. frutescens]
Length=550

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 101/155 (65%), Gaps = 2/155 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++W++ +  RLP+YMK  YKAL+ LY + F +EL +EGR +  YYA E +KE+VR+Y
Sbjct  319  EAIERWNVEETKRLPEYMKPLYKALLELYKQ-FEQELEKEGRSYVAYYAIESLKELVRSY  377

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             IE+KW  +G LPP+ EYLKNAL + T      T  L ++S  +E FEWL+  P ++ A 
Sbjct  378  RIEAKWFIQGYLPPYEEYLKNALITCTYCYHTTTSLLGVESAIKENFEWLSNKPKMLVAG  437

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            +++ R ++++ +Y  E+       TGI+ YM D G
Sbjct  438  LLICRLIDDIATYILERGRG-QVATGIESYMKDNG  471



>ref|XP_006388008.1| hypothetical protein POPTR_0408s00200g [Populus trichocarpa]
 gb|ERP46922.1| hypothetical protein POPTR_0408s00200g [Populus trichocarpa]
Length=536

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 107/158 (68%), Gaps = 4/158 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLP-DYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRA  177
            +AI++  +N +++LP DYMK+ Y+AL+NL++E  N ++ ++GR +A YY KE  KE+VR 
Sbjct  303  NAIERCSMNAIDQLPADYMKVLYRALLNLFNETEN-DMGKQGRSYASYYLKEEFKELVRG  361

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVE  354
            Y+ E++W+ K  +P F EY++N L++S   +++   FL M+ V   EE+EWL  NP I++
Sbjct  362  YHAEAEWADKCHVPTFDEYVRNGLTTSAYGVVMAASFLGMEEVAGGEEYEWLKSNPKIIK  421

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            A  ++GR +N+L S+E E+       +G++CYM  Y V
Sbjct  422  AGNMIGRLMNDLASHEDEQKRG-DCASGVECYMKQYDV  458



>gb|KDP24702.1| hypothetical protein JCGZ_25438 [Jatropha curcas]
Length=252

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 99/157 (63%), Gaps = 5/157 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DA ++W+I  +++LPDYMK  YKA ++L++E  N    +EGR +  YY +E  KE++RAY
Sbjct  23   DAFERWNIGAIDQLPDYMKDLYKAFLDLFEETSNIG-SKEGRSYCAYYTREEFKELLRAY  81

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
             +E++W   G +P F EYL N  +SS+  +++   F+ M K    +E+EWL  NP I  A
Sbjct  82   RMEAQWFNDGYVPMFGEYLPNGATSSSYGVILAASFIGMEKFAGFKEYEWLKANPKIANA  141

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              ILGR LN++ S++ E+    S    ++CY N+YGV
Sbjct  142  GKILGRLLNDIVSHKDEQKRGASR---VECYTNEYGV  175



>ref|XP_011080334.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=539

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 100/155 (65%), Gaps = 3/155 (2%)
 Frame = +1

Query  7    IQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNI  186
            +++WD+N++NRLP+YMKI YK L+++YD D+  E  ++ + +A+ YAKE MK++ +AY+ 
Sbjct  313  LERWDVNEINRLPNYMKIVYKFLLSIYD-DYEVEASKQAKSYAVCYAKETMKQLCKAYDK  371

Query  187  ESKWS-AKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEATV  363
              KW+  +  +P F EY+ N + +S +Y+L+     + KS  +E  +WL   P IV A  
Sbjct  372  VLKWAMGQVQIPTFEEYVANMMVTSCVYVLLSPTISAAKSAPKETIDWLMGEPKIVAAAA  431

Query  364  ILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             +GR LN+LGSYERE S   +    + CYM  YGV
Sbjct  432  KIGRYLNDLGSYERE-SKGGNLPVAVRCYMKQYGV  465



>gb|KDP35926.1| hypothetical protein JCGZ_09898 [Jatropha curcas]
Length=556

 Score =   128 bits (322),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DA ++ +I+ +++LPDYMK  YK  ++L++E  N  +C+EGR +  YY KE  KE++RAY
Sbjct  325  DAFERCNISAIDQLPDYMKDLYKTFLDLFEETSNI-VCKEGRSYCAYYTKEAFKELLRAY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
             +E+KWS  G +P F EYL N  +SS+  ++    F+ M K    +E+EWL  NP I  A
Sbjct  384  RMEAKWSNDGYVPTFGEYLHNGATSSSYGVVPAVCFVGMGKFAGIKEYEWLKANPKIANA  443

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              I+GR LN++ S+E E+       + ++CY N+YGV
Sbjct  444  VKIIGRLLNDIVSHEDEQKRG-DCASSVECYKNEYGV  479



>ref|XP_011080426.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=559

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 100/155 (65%), Gaps = 3/155 (2%)
 Frame = +1

Query  7    IQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNI  186
            ++KWDIN+++RLPDYMKI YK ++NL+ ED+  E  ++G++FA+ YA E +KE+ +AYN 
Sbjct  330  LEKWDINELDRLPDYMKIIYKFILNLF-EDYEVEAAKQGKLFAVPYATEAVKEIAKAYNR  388

Query  187  ESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPG-IVEATV  363
             ++W   G +P + EY+ N + +S +Y+ +      +KS ++E  +WL   P   + A+ 
Sbjct  389  HTQWFLGGQMPTYEEYIVNTVVTSCIYVFLTVGVPGLKSASKESIDWLMSEPNKALIAST  448

Query  364  ILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             + R  N++GS ERE S   +  T +DCYM  YGV
Sbjct  449  RICRHANDIGSDERE-SRGGNIPTAVDCYMKQYGV  482



>ref|XP_011080335.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=544

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 102/155 (66%), Gaps = 3/155 (2%)
 Frame = +1

Query  7    IQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNI  186
            +++WD+N++ +LPDYMKI YK ++++Y ED+  E  ++G+ +A+ YAKE +K++ +AY+ 
Sbjct  313  LERWDVNEIYQLPDYMKIVYKFILSIY-EDYEIEASKQGKSYAVCYAKESVKQLCKAYDK  371

Query  187  ESKWS-AKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEATV  363
              KW+  +  +P F EY+ N + +S +Y+L+ +  L+ KS  +E  +WL   P IV A  
Sbjct  372  MLKWAMGQVPMPTFEEYVANMMVTSCVYVLLTSNILAAKSAPKETIDWLMSEPKIVAAAA  431

Query  364  ILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             +GR LN+LGSYERE S   +    + CYM  YGV
Sbjct  432  KIGRYLNDLGSYERE-SKGGNLPVAVRCYMKQYGV  465



>ref|XP_010259732.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=486

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 106/157 (68%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WD+++ ++LP+YMK  Y AL+++Y+E   +E+  EGR + + YAKE MK ++R Y
Sbjct  257  DAIERWDVDETDKLPEYMKAIYLALLDIYNE-IEEEMRNEGRSYCVSYAKEEMKVLIRTY  315

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
              E+KW ++G +P F E L+NAL S    M++ T F+ M  + T+E F+W+++ P IV +
Sbjct  316  FTEAKWFSEGHIPTFKESLENALVSCGYAMILLTSFVGMGEIATKEVFDWVSKTPKIVRS  375

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              ++GR ++++ S E E+     + + I+CYMN+ GV
Sbjct  376  ACLIGRLMDDIVSNEFEQERGHVS-SAIECYMNENGV  411



>ref|XP_006371082.1| hypothetical protein POPTR_0019s03330g [Populus trichocarpa]
 gb|ERP48879.1| hypothetical protein POPTR_0019s03330g [Populus trichocarpa]
Length=549

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 105/158 (66%), Gaps = 4/158 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLP-DYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRA  177
            +AI++  +N +++LP DYMK+ Y+AL+NL++E  N ++ ++GR +A YY KE  KEVVR 
Sbjct  318  NAIERCSMNAIDQLPADYMKVLYRALLNLFNETEN-DMGKQGRSYASYYVKEEFKEVVRG  376

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVE  354
            Y+ E++W+ K  +P F EY++N L++ST  +++   FL M+ V   EE+EWL  NP I++
Sbjct  377  YHAEAEWADKCHVPTFDEYVRNGLATSTYGVIMAASFLGMEEVAGGEEYEWLKSNPKIIK  436

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            A   +GR  N++  +E E+       +G++CYM  Y V
Sbjct  437  AGKTIGRLRNDIVGHEDEQKRG-DCASGVECYMKQYDV  473



>ref|XP_006478795.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Citrus 
sinensis]
Length=487

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 98/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDIN +++LP+YMK+ Y+ALIN+Y E   K+L  + +++ L+YAKE MK  V+ Y 
Sbjct  259  AIERWDINAIDQLPEYMKLCYRALINVYSE-VEKDLASQAKLYRLHYAKEAMKNQVKHYF  317

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  AL SS    L    F+ M   VT+E FEWL  NP  + A+
Sbjct  318  FEAKWYHQNYIPTVDEYMTVALISSGHPNLSAISFVGMGDIVTKESFEWLFSNPRSIRAS  377

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              +GR +N++ S++ E+S      + ++CYMN YG 
Sbjct  378  CAVGRLMNDMASHKFEQSRG-HVASSVECYMNQYGA  412



>ref|XP_006478796.1| PREDICTED: (-)-germacrene D synthase-like isoform X3 [Citrus 
sinensis]
Length=480

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 98/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDIN +++LP+YMK+ Y+ALIN+Y E   K+L  + +++ L+YAKE MK  V+ Y 
Sbjct  252  AIERWDINAIDQLPEYMKLCYRALINVYSE-VEKDLASQAKLYRLHYAKEAMKNQVKHYF  310

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  AL SS    L    F+ M   VT+E FEWL  NP  + A+
Sbjct  311  FEAKWYHQNYIPTVDEYMTVALISSGHPNLSAISFVGMGDIVTKESFEWLFSNPRSIRAS  370

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              +GR +N++ S++ E+S      + ++CYMN YG 
Sbjct  371  CAVGRLMNDMASHKFEQSRG-HVASSVECYMNQYGA  405



>dbj|BAJ53220.1| JHL17M24.4 [Jatropha curcas]
Length=548

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DA ++ +I+ +++LPDYMK  YK +++L++E  N  +C+EGR +  YY KE  KE++RAY
Sbjct  325  DAFERCNISAIDQLPDYMKDLYKNILDLFEETSNI-VCKEGRSYCAYYTKEAFKELLRAY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
             +E+KWS  G +P F EYL N  +SS   +     F+ M K    +E+EWL  NP I  A
Sbjct  384  RMEAKWSNDGYVPTFGEYLHNGATSSGYGVAAAACFVGMEKFAGIKEYEWLKANPKIANA  443

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             +I GR LN++ S+E E+       +G++CY  +YGV
Sbjct  444  VMISGRLLNDIVSHEDEQKKG-DCASGVECYKKEYGV  479



>ref|XP_006478794.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Citrus 
sinensis]
Length=559

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 98/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDIN +++LP+YMK+ Y+ALIN+Y E   K+L  + +++ L+YAKE MK  V+ Y 
Sbjct  331  AIERWDINAIDQLPEYMKLCYRALINVYSE-VEKDLASQAKLYRLHYAKEAMKNQVKHYF  389

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  AL SS    L    F+ M   VT+E FEWL  NP  + A+
Sbjct  390  FEAKWYHQNYIPTVDEYMTVALISSGHPNLSAISFVGMGDIVTKESFEWLFSNPRSIRAS  449

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              +GR +N++ S++ E+S      + ++CYMN YG 
Sbjct  450  CAVGRLMNDMASHKFEQSRG-HVASSVECYMNQYGA  484



>ref|XP_006475307.1| PREDICTED: (E)-beta-farnesene synthase-like isoform X1 [Citrus 
sinensis]
 ref|XP_006475308.1| PREDICTED: (E)-beta-farnesene synthase-like isoform X2 [Citrus 
sinensis]
Length=555

 Score =   126 bits (317),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 63/157 (40%), Positives = 103/157 (66%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+Q+WDI  M+ LP+YMK+ YKAL++ Y+E   ++L +EGR   L Y KE+M+E+V+ Y
Sbjct  326  EAVQRWDIGAMDILPEYMKVLYKALLDTYNE-VEQDLAKEGRSSYLRYDKEKMQELVQMY  384

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
             +++KWS++G +P + EY    L S   +ML    FL M  V  +E FEW+++NP I  A
Sbjct  385  FVQAKWSSEGYVPTWEEYYPVGLVSGGYFMLATNSFLGMCEVANKEAFEWISKNPKISRA  444

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + ++ R +N++ S++ E+     T TG++CY   +GV
Sbjct  445  SSVISRLMNDIVSHQFEQKRGHVT-TGVECYCKQHGV  480



>dbj|BAJ53218.1| JHL17M24.1 [Jatropha curcas]
Length=556

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DA ++ +I+ +++LPDYMK  YK  ++L++E  N  +C+EGR +  YY KE  KE++RAY
Sbjct  325  DAFERCNISAIDQLPDYMKDLYKTFLDLFEETSNI-VCKEGRSYCAYYTKEAFKELLRAY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
             +E+KWS  G +P F EYL N  +SS+  ++    F+ M K    +E+EWL  NP I  A
Sbjct  384  RMEAKWSNDGYVPTFGEYLPNGATSSSYGLVAAVCFVGMEKFAGIKEYEWLKANPKIANA  443

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              I+GR LN++ S+E E+       + ++CY  +YGV
Sbjct  444  VKIIGRLLNDIVSHEDEQKRE-DCASSVECYKKEYGV  479



>ref|XP_011009447.1| PREDICTED: probable terpene synthase 6 [Populus euphratica]
Length=551

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 106/158 (67%), Gaps = 4/158 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLP-DYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRA  177
            +AI++  +N +++LP DYMK+ Y+AL+NL++E  N ++ ++GR +A YY KE  KE+VR 
Sbjct  318  NAIERCSMNAIDQLPADYMKVLYRALLNLFNETEN-DMGKQGRSYASYYVKEAFKELVRG  376

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVE  354
            Y+ E++W+ K  +P F EY++N +++S   +++   FL M+ V   EE+EWL  NP I++
Sbjct  377  YHAEAEWADKCHVPTFDEYVRNGIATSAYGVIMAASFLGMEEVAGGEEYEWLKSNPKIIK  436

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            A  I+GR +N++  +E E+       +G++CYM  Y V
Sbjct  437  AGKIIGRLMNDIVGHEDEQKRG-DCASGVECYMKQYDV  473



>ref|XP_007021067.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
 gb|EOY12592.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
Length=557

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 104/157 (66%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WDIN M+RLP YMK+ YKAL+++Y+E   + + ++G+I+ + YAKE MK++ +AY
Sbjct  326  NAIERWDINCMDRLPAYMKLLYKALLDVYEE-MEEVMAKQGKIYRVQYAKEAMKQLSQAY  384

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
             +E+KW  +  +P   EY+ N L SS   M+  T F+ M   VT+E F+W + NP IV A
Sbjct  385  FVEAKWYHENYVPTVEEYMTNGLVSSGYIMVAITSFVGMGDIVTKEIFDWASNNPKIVRA  444

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + ++ R ++++ S++ E+       + I+CYM  +GV
Sbjct  445  SSMIARLMDDIVSHKFEQERG-HVASAIECYMKQHGV  480



>ref|XP_006370875.1| terpene synthase/cyclase family protein [Populus trichocarpa]
 gb|ERP48672.1| terpene synthase/cyclase family protein [Populus trichocarpa]
Length=558

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 106/158 (67%), Gaps = 4/158 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLP-DYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRA  177
            +AI++  +N +++LP DYMK+ Y+AL+NL++E  N ++ ++GR +A YY KE  KE+VR 
Sbjct  325  NAIERCSMNAIDQLPADYMKVLYRALLNLFNETEN-DMGKQGRYYASYYVKEAFKELVRG  383

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVE  354
            Y+ E++W+ K  +P F EY++N L++S   +++   FL M+ V   EE+EWL  NP I++
Sbjct  384  YHAEAEWADKCHVPTFDEYVRNGLATSAYGVIMAASFLGMEEVAGGEEYEWLKSNPKIIK  443

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            A  ++GR +N++  +E E+       +G++CYM  Y V
Sbjct  444  AGKMIGRLMNDIVGHEDEQKRG-DCASGVECYMKQYDV  480



>ref|XP_006478792.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=559

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 98/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDIN +++LP+YMK+ Y+ALIN+Y E   K+L  +G++  L+YAKE MK  V+ Y 
Sbjct  331  AIERWDINAIDQLPEYMKLCYRALINVYSE-VEKDLVSQGKLSRLHYAKEAMKNQVKHYF  389

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  AL SS    L    F+ M   VT+E FEWL  NP  + A+
Sbjct  390  FEAKWYHQNYVPTVDEYMTVALISSAHPNLSTISFVGMGDIVTKESFEWLFSNPRSIRAS  449

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              +GR +N++ S++ E+S      + ++CYMN YG 
Sbjct  450  CAVGRLMNDMVSHKFEQSRG-HVASSVECYMNQYGA  484



>gb|KDP24704.1| hypothetical protein JCGZ_25440 [Jatropha curcas]
Length=724

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 98/157 (62%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DA ++ +I+ +++LPDYMK  YK  ++L++E  N  +C+EGR +  YY KE  KE++RAY
Sbjct  325  DAFERCNISAIDQLPDYMKDLYKTFLDLFEETSNI-VCKEGRSYCAYYTKEAFKELLRAY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
             +E+KWS  G +P F EYL N  +SS   +     F+ M K    +E+EWL  NP I  A
Sbjct  384  RMEAKWSNDGYVPTFGEYLHNGATSSGYGVAAAACFVGMEKFAGIKEYEWLKANPKIANA  443

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             +I GR LN++ S+E E+       +G++CY  +YGV
Sbjct  444  VMISGRLLNDIVSHEDEQKKG-DCASGVECYKKEYGV  479



>ref|XP_006371107.1| hypothetical protein POPTR_0019s039902g [Populus trichocarpa]
 gb|ERP48904.1| hypothetical protein POPTR_0019s039902g [Populus trichocarpa]
Length=243

 Score =   122 bits (305),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 100/151 (66%), Gaps = 4/151 (3%)
 Frame = +1

Query  22   INQMNRLP-DYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNIESKW  198
            +N ++ LP DYMK+ Y+AL+NL++E  N ++ ++GR +A YY KE  KE+VR Y+ E++W
Sbjct  17   MNAIDHLPADYMKVLYRALLNLFNETEN-DMGKQGRSYASYYVKEAFKELVRGYHAEAEW  75

Query  199  SAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVEATVILGR  375
            + K  +P F EY++N L++S   +++   FL M+ V   EE+EWL  NP I++A  ++GR
Sbjct  76   ADKCHVPTFDEYVRNGLATSAYGVIMAASFLGMEEVAGGEEYEWLKSNPKIIKAGKMIGR  135

Query  376  TLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             +N++  +E E+       +G++CYM  Y V
Sbjct  136  LMNDIVGHEDEQKRG-DCASGVECYMKQYDV  165



>emb|CBI20481.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 100/156 (64%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+++WDI+ +++LP+YM++ Y+AL+++Y E   +E+ +EGR +  YYAKE MK  VRAY
Sbjct  139  EAVERWDISAIDQLPEYMRVCYRALLDVYSE-IEEEIAKEGRSYRFYYAKEAMKNQVRAY  197

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
            + E+KW     +P   EY+  AL +S   ML  T F+ M  +VT E F+W+   P IV A
Sbjct  198  HEEAKWLQVQQIPTMEEYMHVALVTSAYSMLATTSFVGMGDAVTEETFDWVFSQPKIVRA  257

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+ R ++++ S++ E+       + ++CYM  +G
Sbjct  258  SAIICRLMDDMVSHKFEQKRG-HVASAVECYMKQHG  292



>ref|XP_010644316.1| PREDICTED: (-)-germacrene D synthase-like [Vitis vinifera]
Length=397

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 100/156 (64%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+++WDI+ +++LP+YM++ Y+AL+++Y E   +E+ +EGR +  YYAKE MK  VRAY
Sbjct  171  EAVERWDISAIDQLPEYMRVCYRALLDVYSE-IEEEIAKEGRSYRFYYAKEAMKNQVRAY  229

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
            + E+KW     +P   EY+  AL +S   ML  T F+ M  +VT E F+W+   P IV A
Sbjct  230  HEEAKWLQVQQIPTMEEYMHVALVTSAYSMLATTSFVGMGDAVTEETFDWVFSQPKIVRA  289

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+ R ++++ S++ E+       + ++CYM  +G
Sbjct  290  SAIICRLMDDMVSHKFEQKRG-HVASAVECYMKQHG  324



>gb|KDO52415.1| hypothetical protein CISIN_1g008620mg [Citrus sinensis]
Length=559

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 98/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDIN +++LP+YMK+ Y+ALIN+Y E   K+L  + +++ L+YAKE MK  V+ Y 
Sbjct  331  AIERWDINAIDQLPEYMKLCYRALINVYSE-VEKDLASQAKLYRLHYAKEAMKNQVKHYF  389

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  AL SS    L    F+ M   VT+E FEWL  NP  + A+
Sbjct  390  FEAKWYHQNYIPTVDEYMTVALISSGHPNLSAISFVGMGDIVTKESFEWLFSNPRSIRAS  449

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              +GR +N++ S++ E+S      + ++CY+N YG 
Sbjct  450  CAVGRLMNDMASHKFEQSRG-HVASSVECYINQYGA  484



>ref|XP_006469943.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=463

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 100/154 (65%), Gaps = 3/154 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDIN +++LP+YMK+ Y+ALI++Y+E   K+L  +G+++ L+YAKE MK +V+ Y 
Sbjct  233  AIERWDINAIDQLPEYMKLCYRALIDVYNE-VEKDLASQGKLYRLHYAKEAMKNLVKHYL  291

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  AL +S   ML    F+ M   VT+E FEWL  NP  + A+
Sbjct  292  FEAKWCHQNYVPTVDEYMAVALITSASLMLSTISFVGMGDIVTKESFEWLFSNPRSIRAS  351

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDY  462
             ++ R +N++ S++ E+S      + ++CYM  Y
Sbjct  352  SVVNRLMNDIMSHKFEQSRG-HVASSVECYMKQY  384



>gb|AGW18162.1| terpene synthase 4-2 [Copaifera langsdorffii]
Length=556

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 103/158 (65%), Gaps = 7/158 (4%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI KWDI+ M+ LP+YMK+ Y+ L+++YDE   +E  +EGR F + Y KE+M++VVRAY
Sbjct  327  EAINKWDISCMDFLPEYMKLIYQPLLDVYDE-IERETAKEGRAFCVNYGKEQMRKVVRAY  385

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREE-FEWLNQNPGIVEA  357
              E+KW      P F EY++ AL SS   ML    F+ + S+  EE F+W+ ++P IV+A
Sbjct  386  LAEAKWFHNNYTPTFEEYMEVALVSSAYRMLTTVSFIGVGSIATEEAFKWVTKDPKIVKA  445

Query  358  TVILGRTLNNLGS--YEREKSSSLSTITGIDCYMNDYG  465
            ++++ R ++++ S  +E+E+      +  ++CYM  YG
Sbjct  446  SLVICRLMDDIVSRKFEQERG---HVVPALECYMKQYG  480



>ref|XP_010241001.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=564

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WD N+ ++LP+YMK+ Y  L+++Y+E   +E+ +EGR F + YAKE MK+++ AY
Sbjct  334  DAIRRWDANETDKLPEYMKVIYVTLLDIYNE-IEEEMRKEGRCFCVSYAKEAMKDLIEAY  392

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
             IE+ W  +G +P F E+ K  L +ST  M+    F  M  + T+E F+WL++ P  V++
Sbjct  393  QIEATWLKEGHIPTFEEFSKLGLITSTYIMMTNVIFACMGEMATKEVFDWLSKTPDAVKS  452

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + I+GR  +++ + E E+       + I+CYM  YGV
Sbjct  453  SCIIGRFSDDIMTNEFEQERG-HVCSAIECYMKQYGV  488



>ref|XP_011009446.1| PREDICTED: probable terpene synthase 6 [Populus euphratica]
Length=558

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 105/156 (67%), Gaps = 4/156 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLP-DYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRA  177
            +AI++  +N +++LP DYMK+ Y+AL+NL++E  N ++ ++GR +A YY KE  KE+VR 
Sbjct  325  NAIERCSMNAIDQLPADYMKVLYRALLNLFNETEN-DMGKQGRSYASYYVKEAFKELVRG  383

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVE  354
            Y+ E++W+ K  +P F EY++N +++S   +++   FL M+ V   EE+EWL  NP I++
Sbjct  384  YHAEAEWADKRHVPTFDEYVRNGIATSAYGVIMAASFLGMEEVAGGEEYEWLKSNPKIIK  443

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDY  462
            A  I+GR +N++  +E E+       +G++CYM  Y
Sbjct  444  AGKIIGRLMNDIVGHEDEQKRG-DCASGVECYMKQY  478



>gb|KDO45658.1| hypothetical protein CISIN_1g039366mg [Citrus sinensis]
Length=547

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 101/156 (65%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDI+ +++LP+YMK+ Y+AL+++Y E   K+L  +G+++ L+YAK+ MK +V+ Y 
Sbjct  318  AIKRWDISAIDQLPEYMKLCYRALLDVYSEA-EKDLAPQGKLYRLHYAKKAMKNIVKNYF  376

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  AL +S   ML  T F+ M   VT+E FEWL  NP  + A+
Sbjct  377  FEAKWCHQNYIPTMDEYMTVALVTSAYPMLSTTSFVGMGDIVTKESFEWLFSNPRFIRAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             ++ R ++++ S+E E+S      + ++CYM  +G 
Sbjct  437  SVVCRLMDDMASHEFEQSRG-HVASSVECYMKQHGA  471



>emb|CBI31267.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 102/157 (65%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WDIN ++ LP+YMK+ Y  L++LY E  ++EL ++G  + +YYAKE +K  VRAY
Sbjct  23   EAIERWDINSIDHLPEYMKLFYVTLLDLYKE-IDQELEKDGNQYRVYYAKEVLKSQVRAY  81

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
              E+KWS +G +P   EY+  AL ++   +L    F+ M  + T+E F+W+  +P I+ A
Sbjct  82   FAEAKWSHEGYIPTIEEYMLVALVTAGSCILATWSFIGMGEIMTKEAFDWVISDPKIITA  141

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + ++ R ++++ +++ E+       +GI+CYM  YGV
Sbjct  142  STVIFRLMDDITTHKFEQKRG-HVASGIECYMKQYGV  177



>ref|XP_011015428.1| PREDICTED: probable terpene synthase 6 [Populus euphratica]
Length=558

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 105/156 (67%), Gaps = 4/156 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLP-DYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRA  177
            +AI++  +N +++LP DYMK+ Y+AL+NL++E  N ++ ++GR +A YY KE  KE+VR 
Sbjct  325  NAIERCSMNAIDQLPADYMKVLYRALLNLFNETEN-DMGKQGRSYASYYVKEAFKELVRG  383

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVE  354
            Y+ E++W+ K  +P F EY++N +++S   +++   FL M+ V   EE+EWL  NP I++
Sbjct  384  YHAEAEWADKRHVPTFDEYVRNGIATSAYGVIMAASFLGMEEVAGGEEYEWLKSNPKIIK  443

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDY  462
            A  ++GR +N++  +E E+       +G++CYM  Y
Sbjct  444  AGKMIGRLMNDIVGHEDEQKRG-DCASGVECYMKQY  478



>ref|XP_002523635.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis]
 sp|B9SCB6.1|TPS2_RICCO RecName: Full=Probable terpene synthase 2; Short=RcSeTPS2 [Ricinus 
communis]
 gb|EEF38721.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis]
Length=550

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI +WDI+ +++LP+YMK+ YKAL+N+Y+E   + L E+GR + L+YAKE MK++V+AY
Sbjct  322  DAINRWDIDCIDQLPEYMKVCYKALLNVYEE-IERALSEQGRSYRLHYAKEAMKKLVQAY  380

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
             +E+ W  K  +P   EY+  AL S    +L  T F+ M  + T+E F+W + +P IV  
Sbjct  381  LVEANWMNKNYVPTMDEYMSIALVSCAYPLLTVTSFVGMGDIATKEVFDWASNDPKIVRV  440

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              I+ R ++++ S+E E+       + ++CYM   GV
Sbjct  441  ASIICRLMDDIVSHEFEQKRG-HIASSVECYMKQNGV  476



>gb|AAV36464.1| wound-inducible putative cytosolic terpene synthase 1 [Medicago 
truncatula]
 gb|KEH30760.1| sesquiterpene synthase [Medicago truncatula]
Length=562

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 102/158 (65%), Gaps = 7/158 (4%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDI+ M+ LP YMK  YKA++++Y+E   +E+ +EGR F ++YAK  MK +V+AY 
Sbjct  333  AIERWDISCMDFLPQYMKFCYKAVLDVYEE-MEQEMVKEGRAFCVFYAKNEMKRLVQAYF  391

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREE-FEWLNQNPGIVEAT  360
             E+KW ++  +P   EY+   + +S  Y++  T F+ M  +  E+ F+WL  NP IV A+
Sbjct  392  TEAKWFSRNYIPTVDEYMALGIVNSGYYLITATSFIGMGCIATEDVFQWLTNNPKIVNAS  451

Query  361  VILGRTLNNLGS--YEREKSSSLSTITGIDCYMNDYGV  468
              + R ++++ S  +E+E+    S    I+CYMN++GV
Sbjct  452  SKIARLMDDIVSNEFEQERGHGAS---AIECYMNEHGV  486



>sp|E3W208.1|SPISS_SANSP RecName: Full=Sesquiterpene synthase; Short=SspiSesquiTPS [Santalum 
spicatum]
 gb|ADO87006.1| sesquiterpene synthase [Santalum spicatum]
Length=562

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 101/156 (65%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AIQ+WDI  +++LP+YMK  YK+++++Y+E   +E+  +G +F ++YAKE MK++V  Y 
Sbjct  333  AIQRWDIGSLDQLPEYMKPCYKSVLDVYNE-IEEEMDNQGSLFRMHYAKEEMKKIVEGYM  391

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEAT  360
             E+KW  +  +P F EY+  AL ++    L    +L M  + ++E F+WL  +P I+EA+
Sbjct  392  DEAKWCHEKYVPTFQEYMSVALVTAGYTFLTTISYLGMGEIASKEAFDWLFSHPPIIEAS  451

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              +GR ++++ S+E E+       +GI+CYM  YGV
Sbjct  452  ESVGRLMDDMRSHEFEQERG-HVASGIECYMKQYGV  486



>ref|XP_007021117.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12642.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=553

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WDI  +++LPDYMKISYKAL+++Y+E   ++L EEG+ + + YAK+ M  + +AY
Sbjct  324  EAIERWDIKCIDQLPDYMKISYKALLDVYEE--MEQLLEEGKQYRVEYAKKAMIRLAQAY  381

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
             +E+KW    C P F EY  NAL +S   ML  T F+ M   VT+E F W  ++P I+ A
Sbjct  382  LLEAKWMHANCKPTFEEYKANALPTSGYAMLAITAFVGMGDVVTQETFNWAAKDPNIIRA  441

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + I+ R ++++  ++  +       + I+CY+  YGV
Sbjct  442  STIICRFMDDIAEHKFNQRRE-DDCSAIECYVEQYGV  477



>dbj|BAJ53221.1| JHL17M24.6 [Jatropha curcas]
Length=555

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 98/157 (62%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DA ++W+I  +++LPDYMK  YKA ++L++E  N    +EGR +  YY +E  KE++RAY
Sbjct  324  DAFERWNIGAIDQLPDYMKDLYKAFLDLFEETSNIG-SKEGRSYCAYYTREEFKELLRAY  382

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
             +E++W   G +P F EYL N  +SS+  +++   F+ M K    +E+EWL  NP I  A
Sbjct  383  RMEAQWFNDGYVPMFGEYLPNGATSSSYGVILAASFIGMEKFAGFKEYEWLKANPKIANA  442

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              ILGR LN++ S++ E+       + ++CY  +YGV
Sbjct  443  GKILGRLLNDIVSHKDEQKRG-DCASSVECYTKEYGV  478



>gb|AII32478.1| terpene synthase [Populus trichocarpa]
Length=560

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 104/156 (67%), Gaps = 4/156 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLP-DYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRA  177
            +AI++  ++ +++LP +Y+K+ Y+AL+NL+ E    ++ ++GR +A YY KE  KE+ RA
Sbjct  327  NAIERCCMDAIDQLPAEYLKVLYRALLNLFSET-ESDMGKQGRSYASYYLKEAFKELARA  385

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVE  354
            Y +E++W+ +G +P F EY++N L++S+  +     F+ M  V  REE+EWLN NP I++
Sbjct  386  YQVEAQWADEGHVPTFDEYVRNGLATSSYGVTTAASFVEMDEVAGREEYEWLNSNPKIIK  445

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDY  462
            A  ++GR +N++  +E E+       +G++CYM  Y
Sbjct  446  AGKMIGRLMNDIAGHEDEQKRG-DCASGVECYMKQY  480



>ref|XP_009589518.1| PREDICTED: vetispiradiene synthase 3-like, partial [Nicotiana 
tomentosiformis]
Length=197

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = +1

Query  121  GRIFALYYAKERMKEVVRAYNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMK  300
            GR + ++YAKERMKE+VR Y +E+KW  +G +PP +EYL NAL++ST Y+L  T +L MK
Sbjct  1    GRSYVVHYAKERMKEIVRNYFVEAKWFIEGYMPPVSEYLNNALATSTYYLLTTTSYLGMK  60

Query  301  SVTREEFEWLNQNPGIVEATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            S  RE+FEWL  NP I+EA V L R ++++ +YE EK       TGI+CYM DYGV
Sbjct  61   SAAREDFEWLATNPKILEANVTLCRVVDDIATYEVEKGRG-QIATGIECYMRDYGV  115



>ref|XP_006371216.1| hypothetical protein POPTR_0019s06190g [Populus trichocarpa]
 gb|ERP49013.1| hypothetical protein POPTR_0019s06190g [Populus trichocarpa]
Length=561

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 104/156 (67%), Gaps = 4/156 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLP-DYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRA  177
            +AI++  ++ +++LP +Y+K+ Y+AL+NL+ E    ++ ++GR +A YY KE  KE+ RA
Sbjct  328  NAIERCCMDAIDQLPAEYLKVLYRALLNLFSET-ESDMGKQGRSYASYYLKEAFKELARA  386

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVE  354
            Y +E++W+ +G +P F EY++N L++S+  +     F+ M  V  REE+EWLN NP I++
Sbjct  387  YQVEAQWADEGHVPTFDEYVRNGLATSSYGVTTAASFVEMDEVAGREEYEWLNSNPKIIK  446

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDY  462
            A  ++GR +N++  +E E+       +G++CYM  Y
Sbjct  447  AGKMIGRLMNDIAGHEDEQKRG-DCASGVECYMKQY  481



>ref|XP_002513369.1| Casbene synthase, chloroplast precursor, putative [Ricinus communis]
 sp|B9RI00.1|TPS6_RICCO RecName: Full=Probable terpene synthase 6; Short=RcSeTPS6 [Ricinus 
communis]
 gb|EEF48772.1| Casbene synthase, chloroplast precursor, putative [Ricinus communis]
Length=555

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 104/157 (66%), Gaps = 4/157 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A Q+ DI+ ++ LPDYMK+ Y+AL+N +D+   ++  +EGR ++   AKE  KE+VR+Y
Sbjct  326  NAFQRCDIDAIDELPDYMKVLYRALLNFFDQ--IEDEVDEGRSYSTSVAKEAFKELVRSY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMK-SVTREEFEWLNQNPGIVEA  357
             +E++W + G +P F EY++N L +ST  +L    F+ M+ +V  +E++W+  NP IV+A
Sbjct  384  YVEAQWFSDGYVPSFDEYMRNGLITSTYTVLPAASFIGMENTVGEKEYKWVQSNPKIVKA  443

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              I+ R ++++ ++E E+       + I+CYM +YGV
Sbjct  444  AKIICRLMDDITTHEDEQKRG-HCASSIECYMKEYGV  479



>gb|KDP35342.1| hypothetical protein JCGZ_10983 [Jatropha curcas]
Length=568

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            A+Q+ +I+ +++LP+YMK+ Y+AL+NL+ E  N E+  EGR     YAKE   E+VRAY 
Sbjct  341  AVQRCNIDAIDQLPEYMKVLYRALLNLFAEIENDEI--EGRSQRTAYAKE--TELVRAYF  396

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVEAT  360
            +E+KW  +G +PPF EY+ N L SST  +L    F+ +++V   +E+EW+ +NP IV A+
Sbjct  397  VEAKWFNEGYVPPFEEYISNGLVSSTYSVLPAASFIGLENVVGSKEYEWVKENPKIVNAS  456

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             ++ R ++++ ++E E+       +GI+CY+ +YGV
Sbjct  457  KLISRLMDDVTTHEHEQERG-HCASGIECYIQEYGV  491



>ref|XP_007021120.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12645.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=553

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 99/157 (63%), Gaps = 4/157 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WDI  +++LPDYMKISYKAL+++Y+E   ++L EEG+ + + YAK+ M  + +AY
Sbjct  324  DAIERWDIKCIDQLPDYMKISYKALLDVYEE--MEQLLEEGKQYRVEYAKKAMIRLAQAY  381

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
             +E+KW      P F EY  NAL +S   ML  T F+ M   VT+E F W  ++P I+ A
Sbjct  382  LLEAKWMHANYKPTFEEYKANALPTSGYAMLAITAFIGMGDVVTQETFNWAAKDPNIIRA  441

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + I+ R ++++  ++  +       + I+CYM  YGV
Sbjct  442  STIICRFMDDIAEHKFNQRRE-DDCSAIECYMEQYGV  477



>ref|XP_006469889.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=562

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 98/154 (64%), Gaps = 3/154 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDIN +++LP+YMK+ Y ALI++Y E   K+L  +G+++ L+YAKE MK +V+ Y 
Sbjct  332  AIERWDINAIDQLPEYMKLCYGALIDVYSEA-EKDLASQGKLYRLHYAKEAMKNLVKHYL  390

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  AL +S   ML    F+ M   VT+E FEWL  NP  + A+
Sbjct  391  FEAKWCHQNYVPTVDEYMAVALITSASLMLSTISFVGMGDIVTKESFEWLFSNPRSIRAS  450

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDY  462
             ++ R +N++ S++ E+S      + ++CYM  Y
Sbjct  451  SVVNRLMNDIMSHKFEQSRG-HVASSVECYMKQY  483



>gb|ADX01384.1| germacrene D synthase [Citrus hystrix]
Length=541

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 98/155 (63%), Gaps = 3/155 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDIN +++LP+YMK+  +ALIN+Y E   K+L  +G+++ L+YAKE MK  V+ Y 
Sbjct  313  AIERWDINAIDQLPEYMKLCIRALINVYSE-VEKDLVSQGKLYRLHYAKEAMKNQVKHYF  371

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  AL SS    L    F+ +   VT+E FEWL  NP  + A+
Sbjct  372  FEAKWCHQNYVPTVDEYMTVALISSGHPNLSTISFVGLGDIVTKESFEWLFSNPRSIRAS  431

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
              +GR +N++ S++ E+S      + ++CY+N YG
Sbjct  432  CAVGRLMNDMVSHKFEQSRG-HVASSVECYINQYG  465



>ref|XP_011080424.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=558

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 97/154 (63%), Gaps = 2/154 (1%)
 Frame = +1

Query  7    IQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNI  186
            +++WDIN+++RLPDYMKI Y+ ++NLY ED+  E  ++ ++FA+ YAKE +K+V +AYN 
Sbjct  329  LERWDINEIDRLPDYMKIIYRFILNLY-EDYEVEATKQDKLFAVPYAKETLKQVAKAYNQ  387

Query  187  ESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEATVI  366
              +W   G +P + EY+ N + +S +Y ++      +K  ++E  +WL   P  + A+  
Sbjct  388  HMQWFMGGQMPTYEEYIVNTVVTSCIYAILLAIIPGIKFASKETIDWLMTEPKGLIASTR  447

Query  367  LGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + R  +++GS ERE     + +T +DCY   YGV
Sbjct  448  VCRYADDVGSDEREGKGG-TMLTAVDCYAKQYGV  480



>gb|KDO83771.1| hypothetical protein CISIN_1g048111mg, partial [Citrus sinensis]
Length=304

 Score =   119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 99/153 (65%), Gaps = 3/153 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI +WD++ M++LP+YM+I Y+AL++LY E   +EL  +G  + ++YAKE MK +V  Y+
Sbjct  70   AIDRWDMSCMDQLPEYMQIFYEALLDLYKE-IEEELATKGWSYRVHYAKEEMKILVHGYH  128

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             ESKW     +P   EY++ +L +S   ML    FL M S VT+E F+W+++ P I+ A+
Sbjct  129  DESKWFHNNYVPTMEEYMRVSLVTSAYSMLTAASFLGMDSVVTKEAFDWVSEKPRIIRAS  188

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMND  459
             I+GR +N++ S++ E+       + I+CYM +
Sbjct  189  TIIGRLVNDIKSHKFEQERG-HPASAIECYMKE  220



>gb|KDO45654.1| hypothetical protein CISIN_1g0152451mg, partial [Citrus sinensis]
Length=272

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 100/155 (65%), Gaps = 3/155 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDI+ +++LP+YMK+ Y+AL++++ E   K+L  +G+ + LYYAKE MK +V+ Y 
Sbjct  43   AIERWDISAIDQLPEYMKLCYRALLDVFSEA-EKDLAPQGKSYRLYYAKEAMKNMVKNYF  101

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  AL +S   ML  T F+ M   VT+E FEWL  NP  + A+
Sbjct  102  YEAKWCLQNYVPTVDEYMTVALVTSGSPMLSTTSFVGMGDIVTKESFEWLFSNPRFIRAS  161

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
             I+ R ++++ S++ E+S      + ++CYM  +G
Sbjct  162  SIVCRLMDDIVSHKFEQSRG-HVASSVECYMKQHG  195



>gb|AAX40666.1| sesquiterpene synthase [Fabiana imbricata]
Length=546

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 97/157 (62%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++W+IN   +LP YMK+ Y AL+N Y+E   KEL +E + F + Y+   MK++VRAY
Sbjct  315  NAIERWNINASEQLPSYMKLFYLALLNFYNEA-EKELLKENKSFRVNYSIVEMKKLVRAY  373

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
              E++W     +P   +Y+KN + SST  +L+ T  L + K  T+E F+W+   P I  A
Sbjct  374  FQEAQWYNGDNIPTMEQYVKNGIVSSTYLLLVTTSSLGLGKEATKEAFDWIATEPPIAVA  433

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              I+GR  N++ S+ERE        + I+CYMNDYGV
Sbjct  434  ASIIGRLSNDIVSHERELKRG-DVASAIECYMNDYGV  469



>gb|AFQ23183.1| sesquiterpene synthase [Gossypium hirsutum]
 gb|AGX84975.1| terpene synthase [Gossypium hirsutum]
Length=545

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WD N ++RLP YMK+ YKAL++LY+E   K + ++G+ + + YAKE MK++ +AY
Sbjct  314  NAIERWDSNFIDRLPAYMKVFYKALLDLYEE-MEKVMTKQGKSYRVQYAKEAMKQLSQAY  372

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREE-FEWLNQNPGIVEA  357
             IE+KW  +  +P   EYLK AL SS   M+  T F+ M  V  EE F W + NP IV A
Sbjct  373  FIEAKWYHENYVPMVEEYLKTALVSSGYPMVAITSFVGMGDVVTEETFNWASNNPKIVRA  432

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + ++ R ++++ S++ E+       + ++CYM  +GV
Sbjct  433  SSMISRIMDDIVSHKFEQERG-HCASAVECYMKQHGV  468



>emb|CBI20483.3| unnamed protein product [Vitis vinifera]
Length=557

 Score =   122 bits (305),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 60/156 (38%), Positives = 100/156 (64%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+++WDI+ +++LP+YM++ Y+AL+ +Y E   +E+ +EGR + LYYAKE MK  VRAY
Sbjct  327  EAVERWDISAIDQLPEYMRVCYQALLYVYSE-IEEEMAKEGRSYRLYYAKEAMKNQVRAY  385

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
              E+KW     +P   EY+  AL +S   ML  T F+ M  +VT+E F+W+   P IV A
Sbjct  386  YEEAKWLQVQQIPTMEEYMPVALVTSAYSMLATTSFVGMGDAVTKESFDWIFSKPKIVRA  445

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+ R ++++ S++ E+       + ++CYM  +G
Sbjct  446  SAIVCRLMDDMVSHKFEQKRG-HVASAVECYMKQHG  480



>gb|AAR99061.1| (-)-germacrene D synthase [Populus trichocarpa x Populus deltoides]
Length=561

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 101/156 (65%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++W+I  +++LP+YMK++YKAL+++Y E   + +  E R + +YYAKE MK +VRAY
Sbjct  331  DAIERWEITAVDQLPEYMKVTYKALLDVYTE-IEENMVTEERSYRVYYAKEAMKNLVRAY  389

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
             +ESKW  +   P   EY+  AL +S   ML  T F+ M   VT++ F+WL + P I++A
Sbjct  390  YLESKWFHQKHTPTMEEYMAVALVTSGYAMLAATSFVGMGHVVTKDSFDWLFRGPKILKA  449

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+ R ++++ S++ E+       + I+CYM  +G
Sbjct  450  SEIICRLMDDIVSHKFEQKRG-HVASSIECYMKQHG  484



>gb|KHG04103.1| (-)-germacrene D synthase [Gossypium arboreum]
Length=545

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WD N ++RLP YMK+ YKAL++LY+E   K + ++G+ + + YAKE MK++ +AY
Sbjct  314  NAIERWDSNFIDRLPAYMKVFYKALLDLYEE-MEKVMTKQGKSYRVQYAKEAMKQLSQAY  372

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREE-FEWLNQNPGIVEA  357
             IE+KW  +  +P   EYLK AL SS   M+  T F+ M  V  EE F W + NP IV A
Sbjct  373  FIEAKWYHENYVPMVEEYLKTALVSSGYPMVAITSFVGMGDVVTEETFNWASNNPKIVRA  432

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + ++ R ++++ S++ E+       + ++CYM  +GV
Sbjct  433  SSMISRIMDDIVSHKFEQERG-HCASAVECYMKQHGV  468



>dbj|BAJ46125.1| sesquiterpene synthase [Toona sinensis]
Length=556

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 102/157 (65%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WD + M+ LP+YM+I Y+AL++LY+E   KE+ +EG  + ++YAKE MK +VR Y
Sbjct  326  DAIERWDASCMDLLPEYMQIFYEALLDLYNE-IEKEIAKEGWSYRVHYAKEAMKILVRGY  384

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
            + ESKW     +P   EY++ AL +S   ML  + FL M + VT+E F+W+   P I+ A
Sbjct  385  HDESKWFHNNYIPTMEEYMRVALVTSAYTMLTTSSFLGMDNIVTKETFDWVFSGPKIIRA  444

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +  + R ++++ S++ E+    +  + ++CYM  +GV
Sbjct  445  SETISRLMDDVKSHKFEQERGHAA-SAVECYMEQHGV  480



>ref|XP_011080427.1| PREDICTED: gamma-cadinene synthase-like [Sesamum indicum]
Length=561

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 100/157 (64%), Gaps = 6/157 (4%)
 Frame = +1

Query  7    IQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNI  186
            ++KWDIN++ RLPDYMKI Y+ ++NL+ E++  E  ++G++FA+ YAKE +K++ +AYN 
Sbjct  330  LEKWDINEIGRLPDYMKIIYRFILNLF-ENYEIEAAKQGKLFAVSYAKEAVKQISKAYNK  388

Query  187  ESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWL---NQNPGIVEA  357
               W   G +P + EY+ N + +S +Y+ +    L +KS ++E  +WL     N  ++ +
Sbjct  389  HMNWFMGGQMPAYEEYIANTVVTSCIYVFLIVGILGIKSTSKESIDWLMTDEPNKALIAS  448

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            T +  R  +++GS ERE S   S  T +DCY+  YGV
Sbjct  449  TRVC-RHADDVGSDERE-SKDGSMPTAVDCYVKQYGV  483



>sp|Q43714.1|DCS3_GOSAR RecName: Full=(+)-delta-cadinene synthase isozyme A; Short=D-cadinene 
synthase A [Gossypium arboreum]
 gb|AAB41259.1| (+)-delta-cadinene synthase isozyme A [Gossypium arboreum]
 emb|CAA65289.1| (+)-delta-cadinene synthase [Gossypium arboreum]
Length=555

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 101/161 (63%), Gaps = 11/161 (7%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WDI  MN+LP+YMKISYKAL+N+Y+E   + L  +GR + + YAK+ M  +V+AY
Sbjct  325  NAIERWDIKCMNQLPNYMKISYKALLNVYEE-MEQLLANQGRQYRVEYAKKAMIRLVQAY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
             +E+KW+ +   P F E+  NAL +S   ML  T F+ M  V T E F+W   +P I++A
Sbjct  384  LLEAKWTHQNYKPTFEEFRDNALPTSGYAMLAITAFVGMGEVITPETFKWAASDPKIIKA  443

Query  358  TVILGRTLNNLGSYE----REKSSSLSTITGIDCYMNDYGV  468
            + I+ R ++++  ++    RE   S      I+CYM  YGV
Sbjct  444  STIICRFMDDIAEHKFNHRREDDCS-----AIECYMKQYGV  479



>ref|XP_007021123.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
 gb|EOY12648.1| Delta-cadinene synthase isozyme A [Theobroma cacao]
Length=557

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 102/156 (65%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WD N M+RLP YMK+ YKAL+++Y+E   + + ++ + + + YAKE MK++ +AY 
Sbjct  327  AIERWDTNCMDRLPAYMKLFYKALLDVYEE-MEEVMTKQVKSYRVKYAKEAMKQLSQAYF  385

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
            +E+KW  +  +P   EY+ NAL SS   M+  T F+ M + VT+E F+W + NP IV A+
Sbjct  386  VEAKWYHENYVPTVEEYMTNALVSSGYIMVTVTSFVGMGNVVTKETFQWASNNPRIVRAS  445

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             I+ R ++++ S++ E+       + I+CYM  +GV
Sbjct  446  SIIARLMDDIVSHKFEQERG-HVASAIECYMKQHGV  480



>gb|KDO37682.1| hypothetical protein CISIN_1g025080mg [Citrus sinensis]
Length=258

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+Q+WDI  M+ LP+YMK+ YKAL++ ++E   ++L +EGR   L Y KE+M+E+V+ Y
Sbjct  29   EAVQRWDIGAMDILPEYMKVLYKALLDTFNE-IEQDLAKEGRSSYLPYGKEKMQELVQMY  87

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVEA  357
             +++KW ++G +P + EY    L S   +ML    FL M  V  +E FEW++++P I  A
Sbjct  88   FVQAKWFSEGYVPTWDEYYPVGLVSCGYFMLATNSFLGMCDVANKEAFEWISKDPKISTA  147

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + ++ R  N++ S + E+       +G++CY+  YGV
Sbjct  148  SSVICRLRNDIVSQQFEQKRG-HIASGVECYIKQYGV  183



>emb|CAN68620.1| hypothetical protein VITISV_013313 [Vitis vinifera]
Length=557

 Score =   121 bits (303),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 60/156 (38%), Positives = 100/156 (64%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+++WDI+ +++LP+YM++ Y+AL+ +Y E   +E+ +EGR + LYYAKE MK  VRAY
Sbjct  327  EAVERWDISAIDQLPEYMRVCYQALLYVYSE-IEEEMAKEGRSYRLYYAKEAMKNQVRAY  385

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
              E+KW     +P   EY+  AL +S   ML  T F+ M  +VT+E F+W+   P IV A
Sbjct  386  YEEAKWLQVQQIPTMEEYMPVALVTSAYSMLATTSFVGMGDAVTKESFDWIFSKPKIVRA  445

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+ R ++++ S++ E+       + ++CYM  +G
Sbjct  446  SAIVCRLMDDMVSHKFEQKRG-HVASAVECYMKQHG  480



>sp|E3W207.1|SAUSS_SANAS RecName: Full=Sesquiterpene synthase; Short=SauSesquiTPS [Santalum 
austrocaledonicum]
 gb|ADO87005.1| sesquiterpene synthase [Santalum austrocaledonicum]
Length=559

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AIQ+WD+  +++LP+YMK  YK+++++Y+E   +E+  +G +F ++YAKE MK +V  Y
Sbjct  329  EAIQRWDVGSLDQLPEYMKPCYKSILDVYNE-IEEEMANQGSLFRMHYAKEVMKTIVEGY  387

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
              E+KW  +  +P F EY+  AL +S    L    +L M  + ++E FEWL  +P I+EA
Sbjct  388  MDEAKWCHEKYVPTFQEYMSLALVTSGYTFLTTISYLGMGGIASKEAFEWLFSHPPIIEA  447

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +  + R ++++ S++ E+       +GI+CYM  YGV
Sbjct  448  SESICRLMDDMSSHKFEQERG-HVASGIECYMKQYGV  483



>ref|XP_002282488.1| PREDICTED: (-)-germacrene D synthase [Vitis vinifera]
 emb|CBI20289.3| unnamed protein product [Vitis vinifera]
 gb|ADR74225.1| selina-411-diene/intermedeol synthase [synthetic construct]
Length=561

 Score =   121 bits (303),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 56/157 (36%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WD + +++LPDYMK+ Y+AL+++Y+E   +E+ ++G+++ ++YA+  +K  V+AY
Sbjct  331  EAIERWDASSIDQLPDYMKVCYQALLDVYEE-MEEEMTKQGKLYRVHYAQAALKRQVQAY  389

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
             +E+KW  +  +P   EY+ NAL SS   ML  T F+ M   VT+E F+W+  +P ++ A
Sbjct  390  LLEAKWLKQEYIPRMDEYMSNALVSSACSMLTTTSFVGMGDIVTKEAFDWVFSDPKMIRA  449

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + ++ R ++++ S+E E+       + ++CYM  YGV
Sbjct  450  SNVICRLMDDIVSHEFEQKRG-HVASAVECYMKQYGV  485



>gb|KDP35929.1| hypothetical protein JCGZ_09901 [Jatropha curcas]
Length=428

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 98/157 (62%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DA ++W+I  +++LPDYMK  YKA ++L++E  N    +EGR +  YY +E  KE++RAY
Sbjct  199  DAFERWNIGAVDQLPDYMKDLYKAFLHLFEETSNIG-SKEGRSYCAYYTREEFKELLRAY  257

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
             +E++W   G +P F EYL N  +SS+  ++    F+ M K    +E+EWL  +P I  A
Sbjct  258  RMEAQWFNDGYVPMFGEYLPNGATSSSYGVIAAVSFIGMEKFAGFKEYEWLKADPKIANA  317

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + I+GR LN++ S++ E+       + ++CY  +YGV
Sbjct  318  SKIIGRLLNDIVSHKDEQKRG-DCASSVECYTKEYGV  353



>emb|CAC83059.2| putative terpenesynthase-1 [Marrubium vulgare]
Length=545

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 99/157 (63%), Gaps = 5/157 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+Q+WD   ++ LP+Y+K  YK ++ +Y + F +EL  +G+ +A +YA E  KE+ + Y
Sbjct  316  EAMQRWDTKDIDGLPEYIKEIYKLMLKIYQQ-FEEELAMDGKAYATHYAIEAYKELTKGY  374

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +E+KW  +G +PPF EYL NAL ++    L  +  L MKS+ +++ EWL+    ++ AT
Sbjct  375  YVEAKWFIRGYVPPFEEYLSNALVTAGSKYLHFSSLLGMKSIMKKDLEWLSTKRKMIVAT  434

Query  361  VILGRTLNNLGSY-EREKSSSLSTITGIDCYMNDYGV  468
              + R +N++ SY E+E+       TGI+CYM D GV
Sbjct  435  QTISRLVNDISSYVEKERGQP---ATGIECYMKDKGV  468



>ref|XP_011009443.1| PREDICTED: probable terpene synthase 6 isoform X1 [Populus euphratica]
Length=558

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 104/156 (67%), Gaps = 4/156 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLP-DYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRA  177
            +AI++  +N +++LP DYMK+ YKAL+NL++E  N ++ ++GR +A  Y KE  KE+VR 
Sbjct  325  NAIERCSMNAIDQLPADYMKVLYKALLNLFNETEN-DMGKQGRSYASNYVKEAFKELVRG  383

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVE  354
            Y+ E++W+ K  +P F EY++N L++S   +++   FL M+ V   EE+EWL  NP I++
Sbjct  384  YHAEAEWADKCHVPTFDEYVRNGLATSAYGVIMAASFLGMEEVAGGEEYEWLKCNPKIIK  443

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDY  462
            A  ++GR +N++  +E E+       +G++CYM  Y
Sbjct  444  AGKMIGRLMNDIVGHEDEQKRG-DCASGVECYMKQY  478



>ref|XP_011009444.1| PREDICTED: probable terpene synthase 6 isoform X2 [Populus euphratica]
Length=558

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 104/156 (67%), Gaps = 4/156 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLP-DYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRA  177
            +AI++  +N +++LP DYMK+ YKAL+NL++E  N ++ ++GR +A  Y KE  KE+VR 
Sbjct  325  NAIERCSMNAIDQLPADYMKVLYKALLNLFNETEN-DMGKQGRSYASNYVKEAFKELVRG  383

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVE  354
            Y+ E++W+ K  +P F EY++N L++S   +++   FL M+ V   EE+EWL  NP I++
Sbjct  384  YHAEAEWADKCHVPTFDEYVRNGLATSAYGVIMAASFLGMEEVAGGEEYEWLKCNPKIIK  443

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDY  462
            A  ++GR +N++  +E E+       +G++CYM  Y
Sbjct  444  AGKMIGRLMNDIVGHEDEQKRG-DCASGVECYMKQY  478



>gb|KDO45655.1| hypothetical protein CISIN_1g043754mg [Citrus sinensis]
Length=320

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 103/156 (66%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WD++ ++ LP+Y+K+ Y AL++ Y E F K+L  +G ++ L +AKE MK +VR+Y 
Sbjct  90   AIERWDLSAIDLLPEYIKLCYCALLDAYSE-FEKDLASKGILYGLPFAKESMKILVRSYI  148

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
            IE++W  +  +P   EY++ AL S    +L  + FL M+  VT+E FEW++ NP IV+A+
Sbjct  149  IEARWCDQQYVPTMEEYMRVALLSCGYLLLSTSSFLGMEDIVTKEAFEWVSGNPKIVQAS  208

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             I+ R ++++ S++ E+       + ++CYM  +GV
Sbjct  209  SIICRLMDDIVSHKFEQQRG-HVASAVECYMKQHGV  243



>gb|AEI52901.1| terpene synthase 1 [Populus trichocarpa]
Length=561

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 100/156 (64%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++W+I  ++ LP+YMK++YKAL+++Y E   + +  E R + +YYAKE MK  VRAY
Sbjct  331  DAIERWEITAVDLLPEYMKVTYKALLDVYTE-IEENMVNEERSYRVYYAKEAMKNQVRAY  389

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
             +ESKW  +   P   EY+  AL +S   ML  T F+ M + VT++ F+WL + P I++A
Sbjct  390  YLESKWFHQKHTPTMEEYMAVALVTSAYAMLAATSFVGMGRVVTKDSFDWLFRGPKILKA  449

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+ R ++++ S++ E+       + I+CYM  +G
Sbjct  450  SEIICRLMDDIVSHKFEQKRG-HVASSIECYMKQHG  484



>gb|AGW18157.1| terpene synthase 4 [Copaifera officinalis]
Length=557

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 102/158 (65%), Gaps = 7/158 (4%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI KWDI+ M+ LP+YMK+ Y+ L+++YDE   +E  +EGR F + Y KE+M++VVRAY
Sbjct  328  EAIDKWDISCMDFLPEYMKLIYQPLLDVYDE-IERETAKEGRAFCVNYGKEQMRKVVRAY  386

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREE-FEWLNQNPGIVEA  357
              E+KW      P   EY++ A  SS   ML    F+ + S+  EE F+W+ ++P IV+A
Sbjct  387  LAEAKWFHNNYTPTLEEYMEVAQVSSAYSMLTTVSFIGVGSIATEEAFKWVTKDPKIVKA  446

Query  358  TVILGRTLNNLGS--YEREKSSSLSTITGIDCYMNDYG  465
            ++I+ R ++++ S  +E+E+      ++ ++CYM  +G
Sbjct  447  SLIICRLMDDIVSSKFEQERG---HVVSALECYMKQHG  481



>ref|XP_004505471.1| PREDICTED: (-)-germacrene D synthase-like [Cicer arietinum]
Length=563

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 94/157 (60%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WDI  M+ LP+YMK  Y +L++LY+E   +E+ +EGR  +  Y K  +  +V++Y
Sbjct  333  DAIERWDIKCMDFLPEYMKCVYNSLLDLYEE-IEQEMAKEGRTLSAIYVKNELIRLVQSY  391

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
              E+KW     +P   EY+ N + +S  Y+L    F+ M S+ T+E F WL   P IV A
Sbjct  392  FTEAKWFNSKYIPTVEEYVANGIVTSVNYLLTAISFIGMGSIATQETFRWLTNRPKIVSA  451

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + I+GR +N+L S E E+       + I+CYM  YGV
Sbjct  452  SCIIGRLVNDLLSNEFEQKRG-HVASAIECYMKQYGV  487



>gb|AIC76494.1| terpene synthase [Prunus cerasoides var. campanulata]
Length=601

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 97/157 (62%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI +WD+N M+ LPDYM+I Y+ L+NL++E   +++ ++G  + +YYAKE  K   RAY
Sbjct  370  EAIARWDVNCMDELPDYMQIFYQTLLNLFNE-IEEDMVKKGNSYRVYYAKEAWKATARAY  428

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E++W  +GC+P   EY++ A +S    +L     L M   VT+EEFEW   NP I+ A
Sbjct  429  FDEARWLHEGCIPSMEEYMRVATASIGNNLLSTISLLGMGDIVTKEEFEWSLNNPKILRA  488

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + I+ R ++++  Y+ E+       + IDCYM  +GV
Sbjct  489  SNIIFRLMDDMAGYKFEQKRG-HVASSIDCYMKQHGV  524



>gb|AGW18161.1| terpene synthase 4-1 [Copaifera langsdorffii]
Length=557

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 102/158 (65%), Gaps = 7/158 (4%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI KWDI+ M+ LP+YMK+ Y+ L+++YDE   +E  +EGR F + Y KE+M++VVRAY
Sbjct  328  EAIDKWDISCMDFLPEYMKLIYQPLLDVYDE-IERETAKEGRAFCVNYGKEQMRKVVRAY  386

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREE-FEWLNQNPGIVEA  357
              E+KW      P   EY++ AL SS   ML    F+ + S+  EE  +W+ ++P IV+A
Sbjct  387  LAEAKWFHNNYTPTLEEYMEVALVSSAYRMLTTVSFIGVGSIATEEALKWVTKDPKIVKA  446

Query  358  TVILGRTLNNLGS--YEREKSSSLSTITGIDCYMNDYG  465
            ++++ R ++++ S  +E+E+      ++ ++CYM  +G
Sbjct  447  SLVICRLMDDIVSSKFEQERG---HVVSALECYMKQHG  481



>sp|F6M8H7.1|SMST_SANMU RecName: Full=Probable sesquiterpene synthase; Short=SmSTPS [Santalum 
murrayanum]
 gb|AEF32537.1| putative sesquiterpene synthase [Santalum murrayanum]
Length=562

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 100/156 (64%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            A+Q+WD+  +++LP+YMK  YK+++++Y+E   +E+  +G +F ++YAKE MK +V  Y 
Sbjct  333  AMQRWDVGSLDQLPEYMKPCYKSILDVYNE-IEEEMANQGSLFRMHYAKEVMKTIVEGYM  391

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEAT  360
             E+KW  +  +P F EY+  AL +S    L    +L M  + ++E F+WL  +P ++EA+
Sbjct  392  DEAKWCHEKYVPTFQEYMSVALVTSGYTFLTTISYLGMGEIASKEAFDWLFSHPPVIEAS  451

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              +GR ++++ S++ E+       +GI+CYM  YGV
Sbjct  452  ESVGRLMDDMRSHKFEQERG-HVASGIECYMKQYGV  486



>dbj|BAM24405.1| sesquiterpene synthase [Toona sinensis]
Length=556

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WD + M++LP+YM+I Y+AL++LY+E   KE+ +EG  + ++YAKE MK + R Y
Sbjct  326  DAIERWDASCMDQLPEYMQIFYEALLDLYNE-IEKEIAKEGWSYRVHYAKEAMKILARGY  384

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
            + ESKW     +P   EY+  AL +S   ML  + FL M + VT+E F+W+   P I+ A
Sbjct  385  HDESKWFHNNYIPTMEEYMHVALVTSGYTMLTTSSFLGMDNIVTKETFDWVFSGPKIIRA  444

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +  + R ++++ S++ E+    +  + ++CYM  +GV
Sbjct  445  SGTIARLMDDVKSHKFEQERGHAA-SAVECYMEQHGV  480



>gb|KHG04498.1| (+)-delta-cadinene synthase isozyme A [Gossypium arboreum]
 gb|KHG30537.1| (+)-delta-cadinene synthase isozyme A [Gossypium arboreum]
Length=555

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 100/161 (62%), Gaps = 11/161 (7%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WDI  MN+LPDYMKISYKAL+++Y E+  + L  +GR + + YAK+ M  + +AY
Sbjct  325  NAIERWDIKCMNQLPDYMKISYKALLDVY-EEMEQLLANQGRQYRVEYAKKAMIRLAQAY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
             +E+KW+ +   P F E+  NAL +S   ML  T F+ M  V T E F+W   +P I++A
Sbjct  384  LLEAKWTHQNYKPTFEEFRDNALPTSGYAMLAITAFVGMGEVITPETFKWAANDPKIIKA  443

Query  358  TVILGRTLNNLGSYE----REKSSSLSTITGIDCYMNDYGV  468
            + I+ R ++++  ++    RE   S      I+CYM  YGV
Sbjct  444  STIICRFMDDIAEHKFNHRREDDCS-----AIECYMEQYGV  479



>dbj|BAP75561.1| linalool synthase [Citrus unshiu]
Length=565

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 103/156 (66%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WD++ ++ LP+YMK+ Y AL++ Y E F K+L  +G ++ L +AKE MK +VR+Y 
Sbjct  335  AIERWDLSAIDLLPEYMKLCYCALLDAYSE-FEKDLASKGILYGLPFAKESMKILVRSYI  393

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
            IE++W  +  +P   EY++ AL S    +L  + FL M+  VT+E FEW++ NP IV+A+
Sbjct  394  IEARWCDQQYVPTMEEYMRVALLSCGYLLLSTSSFLGMEDIVTKEAFEWVSGNPKIVQAS  453

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             I+ R ++++ S++ E+       + ++CYM  +GV
Sbjct  454  SIICRLMDDIVSHKFEQQRG-HVASAVECYMKQHGV  488



>gb|ACF94469.1| germacrene B synthase [Cistus creticus subsp. creticus]
Length=572

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 99/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI +WDIN +++LP YM+I Y+A I++Y E    ++  E +++ + YAKE MK++VRAY
Sbjct  344  EAILRWDINTISQLPSYMQIYYQAFIDVYSE-MEAQMEVEDKLYCVPYAKEVMKKLVRAY  402

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
            + ESKW     +PP  EY+  AL SS   +L  T F+ M   VT++ FEWL   P I+ A
Sbjct  403  HQESKWFHANYVPPMEEYMSVALVSSGYEVLAATSFVGMGDVVTKDSFEWLFNYPKIITA  462

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            ++I+GR +N++  ++ E+       + ++CY+  YG
Sbjct  463  SLIMGRLMNDIVGHKFEQKRG-HVASAVECYVKQYG  497



>ref|XP_006371220.1| hypothetical protein POPTR_0019s06230g [Populus trichocarpa]
 gb|ERP49017.1| hypothetical protein POPTR_0019s06230g [Populus trichocarpa]
Length=197

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 99/150 (66%), Gaps = 5/150 (3%)
 Frame = +1

Query  22   INQMNRLP-DYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNIESKW  198
            +N +++LP DYMK+ Y+A++NL++E  N ++ ++GR +A YY KE  KE+VR Y+ E++W
Sbjct  1    MNDIDQLPADYMKVLYRAILNLFNETEN-DMGKQGRSYASYYVKEEFKELVRGYHAEAEW  59

Query  199  SAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEATVILGRT  378
            + K  +P F EY+++ L++S   +L    FL M+    EE+EWL  NP I++A  ++GR 
Sbjct  60   ADKCHVPTFDEYVRHGLATSAYGVLKAASFLGMEE--GEEYEWLKSNPKIIKAGKMIGRL  117

Query  379  LNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +N++  +E E+       +G++C++  Y V
Sbjct  118  MNDIVDHEDEQKRG-DCASGVECFIKQYDV  146



>emb|CAA77191.1| (+)-delta-cadinene synthase [Gossypium arboreum]
Length=555

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 101/161 (63%), Gaps = 11/161 (7%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WDI  MN+LP+YMKISYKAL+++Y+E   + L  +GR + + YAK+ M  +V+AY
Sbjct  325  NAIERWDIKCMNQLPNYMKISYKALLDVYEE-MEQLLANQGRQYRVEYAKKAMIRLVQAY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
             +E+KW+ +   P F E+  NAL +S   ML  T F+ M  V T E F+W   +P I++A
Sbjct  384  LLEAKWTHQNYKPTFEEFRDNALPTSGYAMLAITAFVGMGEVITPETFKWAASDPKIIKA  443

Query  358  TVILGRTLNNLGSYE----REKSSSLSTITGIDCYMNDYGV  468
            + I+ R ++++  ++    RE   S      I+CYM  YGV
Sbjct  444  STIICRFMDDIAEHKFNHRREDDCS-----AIECYMKQYGV  479



>ref|XP_006473871.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=547

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 99/153 (65%), Gaps = 3/153 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI +WD++ M++LP+YM+I Y+AL++LY E   +EL  +G  + ++YAKE MK +V  Y+
Sbjct  313  AIDRWDMSCMDQLPEYMQIFYEALLDLYKE-IEEELATKGWSYRVHYAKEEMKILVHGYH  371

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             ESKW     +P   EY++ +L +S   ML    FL M S VT+E F+W+++ P I+ A+
Sbjct  372  DESKWFHNNYVPTMEEYMRVSLVTSAYSMLTAASFLGMDSVVTKEAFDWVSEKPRIIRAS  431

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMND  459
             I+GR +N++ S++ E+       + I+CYM +
Sbjct  432  TIIGRLVNDIKSHKFEQERG-HPASAIECYMKE  463



>ref|XP_011080428.1| PREDICTED: gamma-cadinene synthase-like, partial [Sesamum indicum]
Length=489

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 99/155 (64%), Gaps = 4/155 (3%)
 Frame = +1

Query  7    IQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNI  186
            +++WD+N++ +LPDYMKI YK L+++YD D+  E  + G+ +A+ YAKE MK++ +AY  
Sbjct  259  LERWDVNEIYQLPDYMKILYKFLLSIYD-DYEVEASKLGKSYAVCYAKETMKQLCKAYEK  317

Query  187  ESKWS-AKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEATV  363
              KW+  +  +P F EY+ N + +S +Y+L+ +  +++K  ++E  +WL   P IV A  
Sbjct  318  VLKWAMGQVQIPTFEEYVANMMVTSCVYVLLSS-TMAVKYASKETIDWLMGEPKIVAAAA  376

Query  364  ILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             +GR LN+LGSYERE       I  + CY   YGV
Sbjct  377  KIGRYLNDLGSYERESKGGNLPI-AVRCYTKQYGV  410



>ref|XP_006370589.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
 ref|XP_006370592.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
 gb|ERP67158.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
 gb|ERP67161.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
Length=500

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 99/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++W+I  ++ LP+YMK++YKAL+++Y E   + +  E R + +YYAKE MK  VRAY
Sbjct  270  DAIERWEITAVDLLPEYMKVTYKALLDVYTE-IEENMVNEERSYRVYYAKEAMKNQVRAY  328

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
              ESKW  +   P   EY+  AL +S   ML  T F+ M + VT++ F+WL + P I++A
Sbjct  329  YHESKWFHQKHTPTMEEYMAVALVTSAYAMLAATSFVGMGRVVTKDSFDWLFRGPKILKA  388

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+ R ++++ S++ E+       + I+CYM  +G
Sbjct  389  SEIICRLMDDIVSHKFEQKRG-HVASSIECYMKQHG  423



>ref|XP_008226800.1| PREDICTED: (-)-alpha-pinene synthase-like [Prunus mume]
Length=563

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 95/154 (62%), Gaps = 3/154 (2%)
 Frame = +1

Query  10   QKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNIE  189
            ++W  N M+ LPDYM+I + AL+N+++E   +E+ +EGR +  +YAKE +K   +AY  E
Sbjct  335  RRWHANCMDGLPDYMQIFFHALLNVFNE-IEEEMVKEGRAYRAHYAKEALKTTAKAYFDE  393

Query  190  SKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEATVI  366
            +KW  +GC+P   EY++ A +S+  + L  T  + M   VT+E FEWL  +P I+ A+ I
Sbjct  394  AKWFHEGCIPSMEEYMRVAATSAASFALSTTSLVGMGDIVTKESFEWLFNDPKILRASNI  453

Query  367  LGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + R ++++ S + EK         IDCYM  YGV
Sbjct  454  IVRLMDDIVSSKFEKERG-HVACAIDCYMKQYGV  486



>ref|XP_006370590.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
 gb|ERP67159.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
Length=544

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 99/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++W+I  ++ LP+YMK++YKAL+++Y E   + +  E R + +YYAKE MK  VRAY
Sbjct  314  DAIERWEITAVDLLPEYMKVTYKALLDVYTE-IEENMVNEERSYRVYYAKEAMKNQVRAY  372

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
              ESKW  +   P   EY+  AL +S   ML  T F+ M + VT++ F+WL + P I++A
Sbjct  373  YHESKWFHQKHTPTMEEYMAVALVTSAYAMLAATSFVGMGRVVTKDSFDWLFRGPKILKA  432

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+ R ++++ S++ E+       + I+CYM  +G
Sbjct  433  SEIICRLMDDIVSHKFEQKRG-HVASSIECYMKQHG  467



>ref|XP_011030746.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Populus 
euphratica]
Length=558

 Score =   119 bits (298),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 60/157 (38%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WDI++++ LP+YMK  YK L +++ E     L E GR + + YAKE MK+ V+AY
Sbjct  328  DAIERWDISKIDHLPEYMKFFYKQLFDVFKE-IETGLAEPGRSYRVDYAKEAMKKQVQAY  386

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
             +E++W  + C+P   EY++ +L SS   +L    F+ M   VT++ FEWLN++P IV+A
Sbjct  387  FVEARWLHENCMPTMDEYMRISLISSGYPLLTCISFVGMGDIVTKDAFEWLNKDPKIVKA  446

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              ++ R +++  S++ E+  +    + I+CYMN + V
Sbjct  447  ASVIARLMDDTVSHKFEQERA-HVASAIECYMNQHEV  482



>dbj|BAJ53219.1| JHL17M24.3 [Jatropha curcas]
Length=556

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 97/157 (62%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DA ++ +I  +++LPDYMK  YKA+++L++E  N    +EGR +  YY +E  KE++RAY
Sbjct  325  DAFERCNIGAIDQLPDYMKDFYKAVLDLFEETSNIG-SKEGRSYCAYYTREEFKELLRAY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
             +E++W   G +P F EYL N  +SS+   L    F+ M K    EE+EWL  NP I  A
Sbjct  384  RMEAQWFNDGYVPTFGEYLPNGATSSSYGALAAASFIGMEKFAGCEEYEWLKANPKIANA  443

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + I+GR LN++ S++ E+       + ++CY  +YGV
Sbjct  444  SKIIGRLLNDVVSHKDEQKRG-DCASSVECYTKEYGV  479



>ref|NP_001268213.1| (-)-germacrene D synthase [Vitis vinifera]
 sp|Q6Q3H3.1|TPSGD_VITVI RecName: Full=(-)-germacrene D synthase [Vitis vinifera]
 gb|AAS66357.1| (-)-germacrene D synthase [Vitis vinifera]
Length=557

 Score =   119 bits (298),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 59/156 (38%), Positives = 99/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+++WDI+ +++LP+YM++ Y+AL+ +Y E   +E+ +EGR + LYYAKE MK  VRAY
Sbjct  327  EAVERWDISAIDQLPEYMRVCYQALLYVYSE-IEEEMAKEGRSYRLYYAKEAMKNQVRAY  385

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
              E+KW     +P   EY+  AL +S   ML  T F+ M  +VT+E F+W+   P IV A
Sbjct  386  YEEAKWLQVQQIPTMEEYMPVALVTSAYSMLATTSFVGMGDAVTKESFDWIFSKPKIVRA  445

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+ R ++++  ++ E+       + ++CYM  +G
Sbjct  446  SAIVCRLMDDMVFHKFEQKRG-HVASAVECYMKQHG  480



>sp|F6M8H6.1|SPIST_SANSP RecName: Full=Probable sesquiterpene synthase; Short=SspiSTPS 
[Santalum spicatum]
 gb|AEF32536.1| sesquiterpene synthase [Santalum spicatum]
Length=562

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 99/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AIQ+WDI  +++LP+YMK  YK+++++Y+E   +E+  +G +F ++YAKE MK++V  Y 
Sbjct  333  AIQRWDIGSLDQLPEYMKPCYKSVLDVYNE-IEEEMDNQGSLFRMHYAKEEMKKIVEGYM  391

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEAT  360
             E+KW  +  +P F EY+  AL ++    L    +L M  + ++E F+WL   P I+EA+
Sbjct  392  DEAKWCHEKYVPTFQEYMSVALVTAGYTFLTTISYLGMGEIASKEAFDWLFSRPPIIEAS  451

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              + R ++++ S+E E+       +GI+CYM  YGV
Sbjct  452  ESVCRLMDDMRSHEFEQERG-HVASGIECYMKQYGV  486



>ref|XP_006353135.1| PREDICTED: (-)-germacrene D synthase-like [Solanum tuberosum]
Length=557

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 101/158 (64%), Gaps = 4/158 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGR-IFALYYAKERMKEVVRA  177
            +AI++W+I+   +LP YMKI+Y AL+++Y+E   KEL  E + +  + Y+   MK++++A
Sbjct  325  NAIERWNIDASEQLPPYMKITYHALLDVYNE-MEKELTNENKSLIFVNYSINEMKKLLKA  383

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVE  354
            Y  E+KW     +P   +Y+KN   SST ++L  TF L M  V T++ F+W+   P I+ 
Sbjct  384  YFQETKWYHGKIVPKMEQYVKNGALSSTYHLLATTFLLGMGDVATKDAFDWIATEPPILV  443

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            A+ I+ R LN+L S+E E+       +GI+CYMN+YGV
Sbjct  444  ASGIIARLLNDLVSHEIEQERG-DAASGIECYMNEYGV  480



>ref|XP_008226806.1| PREDICTED: (-)-alpha-pinene synthase-like [Prunus mume]
Length=518

 Score =   118 bits (296),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 64/156 (41%), Positives = 93/156 (60%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDIN M+ LPDYM++ Y  L+N+YDE   +E  +EGR + +YYAKE +K   R Y 
Sbjct  289  AIERWDINCMDELPDYMQVFYHTLLNVYDE-IEEETVKEGRSYRVYYAKEAVKAQARNYF  347

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E++W  K  +P   EY+  A +     +L  T  + M   VT+E FEWL  +P I+ A+
Sbjct  348  AEAQWLHKDYIPSMEEYMSVATACVGNTLLSITSLVGMGDIVTKEAFEWLLNDPRILRAS  407

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             I+ R +++L  YE EK       + I+CYM  YGV
Sbjct  408  NIIFRLMDDLSGYEFEKERE-HVASSIECYMKQYGV  442



>ref|XP_006370591.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
 gb|ERP67160.1| hypothetical protein POPTR_0001s44080g [Populus trichocarpa]
Length=561

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 99/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++W+I  ++ LP+YMK++YKAL+++Y E   + +  E R + +YYAKE MK  VRAY
Sbjct  331  DAIERWEITAVDLLPEYMKVTYKALLDVYTE-IEENMVNEERSYRVYYAKEAMKNQVRAY  389

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
              ESKW  +   P   EY+  AL +S   ML  T F+ M + VT++ F+WL + P I++A
Sbjct  390  YHESKWFHQKHTPTMEEYMAVALVTSAYAMLAATSFVGMGRVVTKDSFDWLFRGPKILKA  449

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+ R ++++ S++ E+       + I+CYM  +G
Sbjct  450  SEIICRLMDDIVSHKFEQKRG-HVASSIECYMKQHG  484



>ref|XP_011030745.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Populus 
euphratica]
Length=563

 Score =   119 bits (298),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 60/157 (38%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WDI++++ LP+YMK  YK L +++ E     L E GR + + YAKE MK+ V+AY
Sbjct  333  DAIERWDISKIDHLPEYMKFFYKQLFDVFKE-IETGLAEPGRSYRVDYAKEAMKKQVQAY  391

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
             +E++W  + C+P   EY++ +L SS   +L    F+ M   VT++ FEWLN++P IV+A
Sbjct  392  FVEARWLHENCMPTMDEYMRISLISSGYPLLTCISFVGMGDIVTKDAFEWLNKDPKIVKA  451

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              ++ R +++  S++ E+  +    + I+CYMN + V
Sbjct  452  ASVIARLMDDTVSHKFEQERA-HVASAIECYMNQHEV  487



>ref|XP_006371083.1| hypothetical protein POPTR_0019s03350g, partial [Populus trichocarpa]
 gb|ERP48880.1| hypothetical protein POPTR_0019s03350g, partial [Populus trichocarpa]
Length=518

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 102/158 (65%), Gaps = 4/158 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLP-DYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRA  177
            DAI++  ++ +++LP +Y+K+ Y+AL+NL++E    ++ ++GR +A YY KE  KE+ R 
Sbjct  285  DAIERCCMDAIDQLPAEYLKVLYRALLNLFNET-ESDMGKQGRSYASYYVKEAFKELTRG  343

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVE  354
            Y +E++W+  G +PPF EY+ N L ++   +++   F+ M  V   EE++WL  NP I++
Sbjct  344  YQVEAQWADVGHVPPFDEYVPNGLETTGYGVIMAASFVEMDEVAGEEEYKWLKSNPQIMK  403

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            A  ++GR +N++  +E E+       +G++CYM  Y V
Sbjct  404  AAKMIGRLMNDIVGHEDEQKRG-DCASGVECYMKQYDV  440



>ref|XP_006475285.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Citrus 
sinensis]
Length=563

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 100/155 (65%), Gaps = 3/155 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDI+ +++LP+YMK+ Y+AL++++ E   K+L  +G+ + LYYAKE MK +V+ Y 
Sbjct  334  AIERWDISAIDQLPEYMKLCYRALLDVFSEA-EKDLAPQGKSYRLYYAKEAMKNMVKNYF  392

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  AL +S   ML  T F+ M   VT+E FEWL  NP  + A+
Sbjct  393  YEAKWCLQNYVPTVDEYMTVALVTSGSPMLSTTSFVGMGDIVTKESFEWLFSNPRFIRAS  452

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
             I+ R ++++ S++ E+S      + ++CYM  +G
Sbjct  453  SIVCRLMDDIVSHKFEQSRG-HVASSVECYMKQHG  486



>ref|XP_006475286.1| PREDICTED: (-)-germacrene D synthase-like isoform X2 [Citrus 
sinensis]
Length=562

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 100/155 (65%), Gaps = 3/155 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDI+ +++LP+YMK+ Y+AL++++ E   K+L  +G+ + LYYAKE MK +V+ Y 
Sbjct  333  AIERWDISAIDQLPEYMKLCYRALLDVFSEA-EKDLAPQGKSYRLYYAKEAMKNMVKNYF  391

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  AL +S   ML  T F+ M   VT+E FEWL  NP  + A+
Sbjct  392  YEAKWCLQNYVPTVDEYMTVALVTSGSPMLSTTSFVGMGDIVTKESFEWLFSNPRFIRAS  451

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
             I+ R ++++ S++ E+S      + ++CYM  +G
Sbjct  452  SIVCRLMDDIVSHKFEQSRG-HVASSVECYMKQHG  485



>emb|CBI20287.3| unnamed protein product [Vitis vinifera]
Length=595

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 104/157 (66%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WD + +++LPDYMK+ Y+AL+++++E   +E+ ++ + + ++YAK+ MK++V+AY
Sbjct  365  EAIERWDASSIDQLPDYMKLCYQALLDVFEE-IEEEMTKQEKPYRVHYAKQAMKKLVQAY  423

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
             +E+KW  +  +P   EY+ NAL S   + L    F+ M   VT++ F+W+  +P +V A
Sbjct  424  FVEAKWLKQEYIPTIEEYMTNALVSCGYFQLATISFVGMGDMVTKKAFDWVFSDPKMVRA  483

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + I+ R ++++  +E E+      ++G+ CYM  YGV
Sbjct  484  SAIICRLMDDIVDHEFEQKRGY-VVSGVQCYMKQYGV  519



>emb|CAN83470.1| hypothetical protein VITISV_030783 [Vitis vinifera]
Length=557

 Score =   118 bits (296),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 59/156 (38%), Positives = 99/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+++WDI+ +++LP+YM++ Y+AL+ +Y E   +E+ +EGR + LYYAKE MK  VRAY
Sbjct  327  EAVERWDISAIDQLPEYMRVCYQALLYVYSE-IEEEMAKEGRSYRLYYAKEAMKNQVRAY  385

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
              E+KW     +P   EY+  AL +S   ML  T  + M  +VT+E F+W+   P IV A
Sbjct  386  YEEAKWLQVQQIPTMEEYMPVALVTSAYSMLATTSLVGMGDAVTKETFDWIFSKPKIVRA  445

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+ R ++++ S++ E+       + ++CYM  +G
Sbjct  446  SAIVCRLMDDMVSHKFEQKRG-HVASAVECYMKQHG  480



>ref|XP_011069502.1| PREDICTED: vetispiradiene synthase 2-like, partial [Sesamum indicum]
Length=175

 Score =   113 bits (282),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 73/106 (69%), Gaps = 1/106 (1%)
 Frame = +1

Query  151  ERMKEVVRAYNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWL  330
            E+MKE+VR+YNIE+KW  +G +PPFA+Y+ N   +ST Y+L  T F+ M +VT+E F+WL
Sbjct  8    EQMKEIVRSYNIEAKWFIEGYMPPFADYMTNGFITSTYYLLAATSFIGMNAVTKEAFDWL  67

Query  331  NQNPGIVEATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
               P I  A V + R ++++ +YE EK    S  TGI+CYM DYGV
Sbjct  68   VGKPKIQVANVTICRIVDDVATYEIEKKRGQSA-TGIECYMKDYGV  112



>ref|XP_006475284.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=565

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 103/156 (66%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WD++ ++ LP+Y+K+ Y AL++ Y E F K+L  +G ++ L +AKE MK +VR+Y 
Sbjct  335  AIERWDLSAIDLLPEYIKLCYCALLDAYSE-FEKDLASKGILYGLPFAKESMKILVRSYI  393

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
            IE++W  +  +P   EY++ AL S    +L  + FL M+  VT+E FEW++ NP IV+A+
Sbjct  394  IEARWCDQQYVPTMEEYMRVALLSCGYLLLSTSSFLGMEDIVTKEAFEWVSGNPKIVQAS  453

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             I+ R ++++ S++ E+       + ++CYM  +GV
Sbjct  454  SIICRLMDDIVSHKFEQQRG-HVASAVECYMKQHGV  488



>ref|XP_006365530.1| PREDICTED: germacrene C synthase-like [Solanum tuberosum]
Length=587

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 100/156 (64%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AIQ+WDIN M+ LP YM+  Y+A+++++DE   +EL +EG+   +YY K  MK++ RAY
Sbjct  356  NAIQRWDINAMDSLPPYMRPFYQAILDIFDE-MEEELTKEGKSDRVYYGKFEMKKLARAY  414

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E++W   G +P   +Y+KNA+ S+T  +L  T  + M+  +T++ FEW+   P I+ A
Sbjct  415  FKEAEWLNAGYIPNCDQYIKNAIVSTTFMVLGTTSLIGMEEFITKDTFEWITNEPSILRA  474

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            +  + R ++++  +E ++       + I+CYMN+YG
Sbjct  475  SSTICRLMDDISDHETDQQRG-HVASVIECYMNEYG  509



>ref|XP_008226803.1| PREDICTED: (-)-alpha-pinene synthase-like [Prunus mume]
Length=556

 Score =   118 bits (295),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 64/156 (41%), Positives = 92/156 (59%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDIN M+ LPDYM++ Y  L+N+YDE   +E  +EGR + +YYAKE  K   R Y 
Sbjct  327  AIERWDINCMDELPDYMQVFYHTLLNVYDE-IEEETVKEGRSYRVYYAKEAFKAQARNYF  385

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E++W  K  +P   EY+  A +     +L  T  + M   VT+E FEWL  +P I+ A+
Sbjct  386  AEAQWLHKDYIPSMEEYMSVATACVGNTLLSITSLVGMGDIVTKEAFEWLLNDPRILRAS  445

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             I+ R +++L  YE EK       + I+CYM  YGV
Sbjct  446  NIIFRLMDDLSGYEFEKERE-HVASSIECYMKQYGV  480



>ref|XP_006475306.1| PREDICTED: (E)-beta-farnesene synthase-like [Citrus sinensis]
Length=555

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 59/157 (38%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+Q+WDI  M+ LP+YMK+ YKAL++ ++E   ++L +EGR   L Y KE+M+E+V+ Y
Sbjct  326  EAVQRWDIGAMDILPEYMKVLYKALLDTFNE-IEQDLAKEGRSSYLPYGKEKMQELVQMY  384

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
             +++KW ++G +P + EY    L S   +ML    FL M  V  +E FEW++++P I  A
Sbjct  385  FVQAKWFSEGYVPTWDEYYPVGLVSCGYFMLATNSFLGMCDVANKEAFEWISKDPKISTA  444

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + ++ R  N++ S + E+       +G++CY+  YGV
Sbjct  445  SSVICRLRNDIVSQQFEQKRG-HIASGVECYIKQYGV  480



>ref|XP_002317018.2| hypothetical protein POPTR_0011s14600g [Populus trichocarpa]
 gb|EEE97630.2| hypothetical protein POPTR_0011s14600g [Populus trichocarpa]
Length=569

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WDI+ ++ LP+YMK  YK L ++Y E    EL  +GR + + YAKE MK+ V+AY
Sbjct  329  DAIERWDISNIDHLPEYMKFFYKQLSDVYKE-IETELAAQGRSYRVDYAKEAMKKQVQAY  387

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
             +E++W  +  +P   EY++ +L SS   +L    F+ M   VT++ FEWLN++P IV+A
Sbjct  388  FVEARWLHENYMPTMDEYMRISLISSGYPLLTCISFVGMGDIVTKDAFEWLNKDPKIVKA  447

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              ++ R ++++ S++ E+       + ++CYMN + V
Sbjct  448  ASLIARLMDDIVSHKFEQERG-HVASAVECYMNQHEV  483



>ref|XP_006472987.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=620

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 98/154 (64%), Gaps = 3/154 (2%)
 Frame = +1

Query  10   QKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNIE  189
            ++WDI+ +++LP+YMK+ Y+AL+++Y E   K+L  +G+++ L+YAK+ MK +V+    E
Sbjct  399  RRWDISAIDQLPEYMKLCYRALLDVYSEA-EKDLAPQGKLYRLHYAKKAMKNIVKNCFFE  457

Query  190  SKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEATVI  366
            +KW  +  +P   EY+  AL +S   ML  T F+ M   VT+E FEWL  NP  + A+ +
Sbjct  458  AKWCHQNYIPTMDEYMTVALVTSAYPMLSTTSFVGMGDIVTKESFEWLFSNPRFIRASSV  517

Query  367  LGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + R ++++ S+E E+S      + ++CYM  +G 
Sbjct  518  VCRLMDDMASHEFEQSRG-HVASSVECYMKQHGA  550



>ref|XP_006475310.1| PREDICTED: (-)-germacrene D synthase-like [Citrus sinensis]
Length=983

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 100/156 (64%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDI+ +++LP+YMK+ Y+AL++++ E   K+L  +G+ + LYYAKE MK +V+ Y 
Sbjct  754  AIERWDISAIDQLPEYMKLCYRALLDVFSEA-EKDLAPQGKSYRLYYAKEAMKNMVKNYF  812

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  AL +S   ML  T F+ M   VT+E FEWL  NP  + A+
Sbjct  813  YEAKWCLQNYVPTVDEYMTVALVTSGSPMLSTTSFVGMGDIVTKESFEWLFSNPRFIRAS  872

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             I+ R ++++ S++ E+S      + ++CYM  +G 
Sbjct  873  SIVCRLMDDIVSHKFEQSRG-HVASSVECYMKQHGA  907


 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 90/140 (64%), Gaps = 2/140 (1%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDI+ +++LP+YMK+ Y+AL+++Y E   K+L  +G+++ L+YAK+ MK +V+   
Sbjct  333  AIKRWDISAIDQLPEYMKLCYRALLDVYSEA-EKDLAPQGKLYRLHYAKKAMKNIVKNCF  391

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  AL +S   ML  T F+ M   VT+E FEWL  NP  + A+
Sbjct  392  FEAKWCHQNYIPTMDEYMTVALVTSAYPMLSTTSFVGMGDIVTKESFEWLFSNPRFIRAS  451

Query  361  VILGRTLNNLGSYEREKSSS  420
             ++ R ++++ S+E     S
Sbjct  452  SVVCRLMDDMASHEETDDGS  471



>gb|KHG15264.1| (+)-delta-cadinene synthase isozyme A [Gossypium arboreum]
Length=452

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 98/157 (62%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WDI  M+ LP++MKISYKAL+++Y+E   +   ++GR + + YAK+ M  + +AY
Sbjct  222  NAIERWDIKCMDELPEFMKISYKALLDVYEE-MEQLTAKQGRQYRVEYAKKAMIRLAQAY  280

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
             +E+KW+ +   P F E+  NAL +S   ML  T F+ M  V T E FEW   +P I++A
Sbjct  281  LLEAKWTHQNYKPTFEEFRDNALPTSGYGMLAITAFVGMGDVITPETFEWATNDPKIIKA  340

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + I+ R ++++  + + K       + I+CYM  YGV
Sbjct  341  STIICRFMDDIAEH-KFKHRREDDCSAIECYMEQYGV  376



>gb|AGV28055.1| sesquiterpene synthase [Azadirachta indica var. indica]
Length=547

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 101/155 (65%), Gaps = 3/155 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDI+ +++LP+YMK+ Y+ L+++Y E   K+L  + +++ LY+AKE MK VV+ Y 
Sbjct  318  AIERWDISVVDQLPEYMKLCYQVLLDVYSE-IEKDLVYQRKLYRLYHAKEAMKTVVKNYF  376

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
            +E+KW  K  +P   EY+  AL +S   ML  T F+ M   VT+E FEWL  NP ++ A+
Sbjct  377  LETKWCHKKYVPKMNEYMIVALVTSAYSMLATTSFVGMGDIVTKEAFEWLFSNPKMIIAS  436

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
             ++ R ++++ S++ E+       + I+C+M ++G
Sbjct  437  SVVCRLMDDIVSHKFEQKRG-HVASSIECFMKEHG  470



>dbj|BAP74389.1| delta-elemene synthase [Citrus jambhiri]
Length=563

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 97/156 (62%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDI+ ++ LP+YMK+ Y+AL+++Y E   K+L  +G+++ L+YAKE MK  V+ Y 
Sbjct  334  AIERWDISAIDELPEYMKLCYRALLDVYSEA-EKDLASQGKLYHLHYAKEAMKNQVKNYF  392

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +  +P   EY+  A  +S   ML  T F+ M   VT+E FEW   NP ++ A+
Sbjct  393  FEAKWCHQNYIPSVDEYMTVASVTSGYPMLSTTSFVGMGDIVTKESFEWSLTNPRVIRAS  452

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             +  R +N++ S++ E+S      + ++CY+  YG 
Sbjct  453  SVAARLMNDMVSHKFEQSRG-HVASCVECYIKQYGA  487



>ref|XP_004287071.1| PREDICTED: (-)-alpha-pinene synthase-like [Fragaria vesca subsp. 
vesca]
Length=557

 Score =   117 bits (292),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 60/157 (38%), Positives = 95/157 (61%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI +WD + M++LPDYM+  Y  L+++ DE   +EL ++GR + ++YAK+ +K   R Y
Sbjct  327  EAIDRWDASCMDQLPDYMQPFYITLLDVIDE-VEEELTKQGRSYRIHYAKDILKNQARLY  385

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E++W  +GC P   EY++ A SS    ML     + M   +T+EEFEWL   P I+ A
Sbjct  386  FAEARWFHEGCTPKMDEYMRVAASSVGNTMLSVVSLVGMGDIITKEEFEWLTNEPKILRA  445

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +  + R ++++  Y+ EK       + IDCYMN+YGV
Sbjct  446  SNTIFRLMDDIAGYKFEKERG-HVASSIDCYMNEYGV  481



>gb|KDP36230.1| hypothetical protein JCGZ_09950 [Jatropha curcas]
Length=555

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 98/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AIQ+WDI  M++LP+YMK+ Y AL+++YDE   +EL E+G    ++YAK+ MK++V+AY 
Sbjct  326  AIQRWDIACMDQLPEYMKLCYMALLDIYDE-MERELSEQGSSSYIHYAKDEMKKLVQAYL  384

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEAT  360
            +E+ W  K  +P   EY+  AL +    +L  T F+ M  + T++ F+W +  P IV A 
Sbjct  385  VEANWMNKDYIPTMDEYMSIALVTCGYSLLTTTSFIGMGDISTKDVFDWSSNGPKIVRAA  444

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             ++ R ++++ S+E E++      + ++CYM   GV
Sbjct  445  SVICRLMDDIVSHEFEQARG-HVASAVECYMKQNGV  479



>ref|NP_001268204.1| uncharacterized protein LOC100257265 [Vitis vinifera]
 ref|XP_010644042.1| PREDICTED: uncharacterized protein LOC100257265 isoform X1 [Vitis 
vinifera]
 gb|ADR74193.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=557

 Score =   116 bits (291),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/156 (36%), Positives = 100/156 (64%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+++WDI+ +++LP+YM++ Y+AL+++Y E   +E+ +EGR +  YYAKE MK+ VRAY
Sbjct  327  EAVERWDISVIDQLPEYMRVCYRALLDVYSE-IEEEMAKEGRSYRFYYAKEAMKKQVRAY  385

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E++W     +P   EY+  A ++S   ML  T F++M   VT+E F+W+   P IV A
Sbjct  386  YEEAQWLQAQQIPTMEEYMPVASATSGYPMLATTSFIAMGDVVTKETFDWVFSEPKIVRA  445

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            +  + R ++++ S++ E+       + ++CYM  +G
Sbjct  446  SATVSRLMDDMVSHKFEQKRG-HVASAVECYMKQHG  480



>ref|XP_008232170.1| PREDICTED: (-)-germacrene D synthase-like [Prunus mume]
Length=559

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 101/156 (65%), Gaps = 8/156 (5%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+++WDI+ M+ LP+YMK+ Y+AL+++Y E   + L  EG +++++YA+E MK +VRAY
Sbjct  334  EAVERWDISAMDHLPEYMKVCYQALLDVYVE-IEENLANEGNLYSIHYAREAMKVLVRAY  392

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
              E+KW  +   P   +Y+  AL++S  +ML  T F+ M  + T++  +W+  +P +V+A
Sbjct  393  FREAKWFHQKYTPTMDDYMSAALNTSN-FMLATTSFVGMGDIATKDSMDWVFDDPKMVKA  451

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
              ++GR +N++ S +R   +S      + CYM +YG
Sbjct  452  ASLIGRIMNDIKSDQRGHVAS-----AVKCYMKEYG  482



>sp|F6M8H5.1|SAUST_SANAS RecName: Full=Probable sesquiterpene synthase; Short=SauSTPS 
[Santalum austrocaledonicum]
 gb|AEF32535.1| sesquiterpene synthase [Santalum austrocaledonicum]
Length=562

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 99/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            A+Q+WD+  +++LP+YMK  YK+++++Y+E    E+  +G +F ++YAKE MK++V  Y 
Sbjct  333  AMQRWDVGSLDQLPEYMKPCYKSILDVYNE-IEVEMDNQGSLFRMHYAKEVMKKLVEGYM  391

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEAT  360
             E+KW  +  +P F EY+  AL +S    L    +L M  + ++E F+WL  +P ++EA+
Sbjct  392  DEAKWCHEKYVPTFQEYMSVALVTSGYTFLTTISYLGMGEIASKEAFDWLFSHPPVIEAS  451

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              +GR +++  S++ E+       +GI+CYM  YGV
Sbjct  452  ESVGRLMDDTRSHKFEQERG-HVASGIECYMKQYGV  486



>ref|XP_006492721.1| PREDICTED: casbene synthase, chloroplastic-like [Citrus sinensis]
 gb|KDO56473.1| hypothetical protein CISIN_1g047877mg [Citrus sinensis]
Length=590

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 97/157 (62%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DA+++WDIN ++ LP+YMK  Y AL+NL+DE  N EL EEGR +++ + K+ MK VVRAY
Sbjct  361  DAVERWDINCVSELPEYMKPLYGALLNLFDE-LNNELAEEGRSYSVSFTKDMMKGVVRAY  419

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTR-EEFEWLNQNPGIVEA  357
             +E++W  +G +PPF E + NA+ + T ++     ++ +  +   + +EWL   P I+ A
Sbjct  420  FVEAQWFREGYVPPFDERMSNAIVTGTCFLDPAAAYIGLGDIAGIDAYEWLRSQPKIMTA  479

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +  L R + +L S + E+       + ++ YM +YG 
Sbjct  480  SFTLSRLIADLVSNKAEQERG-HVASVVESYMKEYGT  515



>gb|AGS16741.1| sesquiterpene synthase [Panax ginseng]
Length=568

 Score =   116 bits (291),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 57/158 (36%), Positives = 103/158 (65%), Gaps = 4/158 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGR-IFALYYAKERMKEVVRA  177
            DAI++WDI+ +++LP YM++ Y+AL+++Y E   +E+   GR ++ ++YAK  +K +V+A
Sbjct  337  DAIERWDISALDQLPVYMRLCYQALLDVYTE-MEEEMARAGRPLYRVHYAKYELKRLVKA  395

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVE  354
            Y  E+KW  KG +P   E+++ AL S+   M+  T F+ M  + T+E FEW++ +P IV 
Sbjct  396  YFEEAKWLHKGYIPTMEEHMEVALVSAGYMMISTTSFVGMTDLATKEAFEWVSNDPLIVR  455

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            A+ ++ R  +++  +E E+       +G++CYM  +GV
Sbjct  456  ASSVINRLTDDIVGHEIEQERG-HVASGVECYMKQHGV  492



>emb|CBI31269.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   115 bits (289),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 57/157 (36%), Positives = 102/157 (65%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WDI+ ++ LP+YMK+ Y  L++LY E  ++EL ++G  + +YYAKE +K  VR+Y
Sbjct  286  EAIERWDISSIDHLPEYMKLFYVTLLDLYKE-IDQELEKDGNQYRVYYAKEVLKSQVRSY  344

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
              E+KWS +G +P   EY+  AL ++   +L    F+ M  + T+E F+W+  +P I+ A
Sbjct  345  FAEAKWSHEGYIPTIEEYMLVALVTAGSCILATWSFIGMGEIMTKEAFDWVISDPKIITA  404

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + ++ R ++++ +++ E+       +GI+CYM  YGV
Sbjct  405  STVIFRLMDDITTHKFEQKRG-QVASGIECYMKQYGV  440



>emb|CAN76687.1| hypothetical protein VITISV_021510 [Vitis vinifera]
Length=488

 Score =   115 bits (288),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 56/156 (36%), Positives = 100/156 (64%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+++WDI+ +++LP+YM++ Y+AL+++Y E   +E+ +EGR +  YYAKE MK+ VRAY
Sbjct  258  EAVERWDISVIDQLPEYMRVCYRALLDVYSE-IEEEMAKEGRSYRFYYAKEAMKKQVRAY  316

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E++W     +    EY+  AL++S   ML  T F++M   VT+E F+W+   P IV A
Sbjct  317  YEEAQWLQAQQIXTMEEYMPVALATSGYLMLATTSFIAMGDVVTKETFDWVFSEPKIVRA  376

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            +  + R ++++ S++ E+       + ++CYM  +G
Sbjct  377  SATVSRLMDDMVSHKFEQKRG-HVASAVECYMKQHG  411



>gb|AII32471.1| terpene synthase [Populus trichocarpa]
Length=553

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI +WD   M++LPDYMKI Y+AL+N++ E   +++ +EG  + ++Y K+ MK +V AY
Sbjct  323  EAIDRWDTKSMDQLPDYMKICYEALLNVFSE-IEEKVAKEGWSYRVHYGKDAMKVLVHAY  381

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E+KW  +  +P   EY++ AL +S   ML    F+ M   VT++ F+W+  +P I+ A
Sbjct  382  FNEAKWFHENHIPTMEEYMQVALVTSGYSMLTTVSFIGMGDMVTKQAFDWVFNHPKIIRA  441

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +  +GR L+++ S++ E+    +  +G++CY+  YG+
Sbjct  442  SETIGRLLDDVKSHKFEQERGHAA-SGVECYIRQYGL  477



>ref|XP_011100634.1| PREDICTED: germacrene-D synthase-like [Sesamum indicum]
Length=553

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 96/154 (62%), Gaps = 7/154 (5%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            D IQ+WD+N + +LP YM+I Y+AL ++Y E    EL + G  + + YAKE MK++VRAY
Sbjct  325  DLIQRWDVNALEQLPSYMRICYEALSDVYIE-IENELEKTGESYRVQYAKEEMKKLVRAY  383

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E+KWS    +P   EY+K A+ SST  ML+ T  + M + VT+++F+W+   P ++ A
Sbjct  384  IEEAKWSYNKDMPRMEEYMKVAIVSSTYMMLLTTSLVGMGNLVTKKDFDWITSEPLLLLA  443

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMND  459
            +  + R  N+L  Y  EK S     T ++CYMN+
Sbjct  444  SATICRLTNDLVGYGFEKKS-----TAVECYMNE  472



>emb|CDP05818.1| unnamed protein product [Coffea canephora]
Length=551

 Score =   116 bits (290),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 58/157 (37%), Positives = 98/157 (62%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++W IN+++RLP YMK  Y+AL+++Y E F ++L +EG+   + Y+K  MK++ + Y
Sbjct  320  DAIERWHINELDRLPSYMKHCYRALLDIYKE-FEEKLAKEGQSDRVNYSKLEMKKLAKGY  378

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
              E+ W   G +P   EY+K AL ++   ML  T  + M  S+T + F+W+   P IV A
Sbjct  379  LQEAIWFHNGYVPKVEEYMKVALVTAGYMMLATTSMVGMGDSLTAQTFDWVTNEPLIVRA  438

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              ++GR ++++  +E E+       T ++CY+N+YGV
Sbjct  439  ASVIGRLMDDMAGHELEQEGG-HVATAVECYVNEYGV  474



>gb|AIC76497.1| terpene synthase [Prunus cerasoides var. campanulata]
Length=563

 Score =   116 bits (290),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 59/154 (38%), Positives = 94/154 (61%), Gaps = 3/154 (2%)
 Frame = +1

Query  10   QKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNIE  189
            Q+W  N M+ LPDYM+I + A++N+++E   +E+ +EGR +  +YAKE  K   +AY  E
Sbjct  335  QRWHANCMDGLPDYMQIFFHAVLNVFNE-IEEEMVKEGRAYRTHYAKEAWKTTAKAYFDE  393

Query  190  SKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEATVI  366
            +KW  +GC+P   EY++ A +S+ ++ +  T  + M   VT+E FEWL  +P I+ A+ I
Sbjct  394  AKWFHEGCIPSMEEYMRVAATSAGIFAVSTTSLVGMGDIVTKESFEWLFNDPKILRASNI  453

Query  367  LGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + R ++++ S   EK         IDCYM  YGV
Sbjct  454  IIRLMDDIVSSRFEKERG-HVACAIDCYMKQYGV  486



>ref|XP_009792053.1| PREDICTED: vetispiradiene synthase 2-like [Nicotiana sylvestris]
Length=218

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 89/140 (64%), Gaps = 3/140 (2%)
 Frame = +1

Query  52   MKISYKALINLYDEDFNKELCEEGRIF-ALYYAKERMKEVVRAYNIESKWSAKGCLPPFA  228
            MK  Y  L++L+ E ++ E+ ++   F  +YY KE MKE+VR+Y  E++W  KG  PPF 
Sbjct  1    MKTVYSTLLDLFKE-YDIEVEKQDMSFNRVYYVKEAMKEIVRSYYTEAQWFIKGKSPPFE  59

Query  229  EYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEATVILGRTLNNLGSYERE  408
            EYL NAL + T Y+L P   L MKS ++  F+W+   P I+ A+ ++GR ++++ +Y+ E
Sbjct  60   EYLSNALITGTYYLLAPASLLGMKSASKAAFDWMMNKPKILVASALIGRVIDDVATYKIE  119

Query  409  KSSSLSTITGIDCYMNDYGV  468
            K      +TGI+CYM ++ +
Sbjct  120  KEKG-QLVTGIECYMKEHNL  138



>gb|ADR66821.1| germacrene A synthase [Vitis vinifera]
Length=555

 Score =   115 bits (289),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 59/157 (38%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WDI  ++ LP+YMK+ Y  L++LY E  ++EL + G  + +YYAKE +K  VRAY
Sbjct  326  EAIERWDIKSIDHLPEYMKLFYVTLLDLYKE-IDQELEKYGNQYRVYYAKEVLKSQVRAY  384

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
              E+KWS +G +P   EY+  AL +S   +L    F+ M  + T+E F+W+  +P I+ A
Sbjct  385  FAEAKWSHEGYIPTIEEYMLVALVTSGSCILATWSFIGMGEIMTKEAFDWVISDPKIITA  444

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + ++ R ++++ +++ E+       +GI+CYM  YGV
Sbjct  445  STVIFRLMDDITTHKFEQKRG-HVASGIECYMKQYGV  480



>gb|KDP42348.1| hypothetical protein JCGZ_02821 [Jatropha curcas]
 gb|AIM47563.1| casbene synthase 2 [Jatropha curcas]
Length=601

 Score =   116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 97/156 (62%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WD++ +NRLP+YMK+ YK ++N +DE F K+L  EG+ +++ Y +E  +E+V+ Y 
Sbjct  371  AIERWDMSLVNRLPNYMKVIYKLILNTFDE-FEKDLEAEGKSYSVKYGREAYQELVKGYY  429

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVEAT  360
            +E+ W A G +P F EY+ N   ++ L ++    F+ +K +   E FEWL   P + +A 
Sbjct  430  LEAIWKADGKVPSFDEYMFNGGVTTGLSLVATVSFMGVKEIKGTEAFEWLKTYPKLNQAG  489

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
                R +N++ S+E E+       + IDCYMN YGV
Sbjct  490  GEFIRLVNDVMSHESEQDRG-HVASCIDCYMNQYGV  524



>ref|XP_011048258.1| PREDICTED: (-)-germacrene D synthase-like [Populus euphratica]
Length=561

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 98/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++W+I  +++LP+YMK++YKAL+++Y E   + +  E R   + YAKE +K  VRAY
Sbjct  331  DAIERWEITAVDQLPEYMKVTYKALLDVYTE-IEENMVTEERSCRVSYAKEALKNQVRAY  389

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
             +ESKW  +   P   EY+  AL +S   ML  T F+ M  +VT++ F+WL   P I++A
Sbjct  390  YLESKWFHQKHTPTMEEYMAVALVTSGYAMLAATSFVGMGHAVTKDSFDWLFSGPKILKA  449

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+ R ++++ S+E E+       + I+CYM  +G
Sbjct  450  SEIICRLMDDIVSHEFEQKRG-HVASSIECYMKQHG  484



>ref|NP_001268028.1| valencene synthase-like [Vitis vinifera]
 gb|ADR74192.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=555

 Score =   115 bits (289),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 59/157 (38%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WDI  ++ LP+YMK+ Y  L++LY E  ++EL + G  + +YYAKE +K  VRAY
Sbjct  326  EAIERWDIKSIDHLPEYMKLFYVTLLDLYKE-IDQELEKYGNQYRVYYAKEVLKSQVRAY  384

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
              E+KWS +G +P   EY+  AL +S   +L    F+ M  + T+E F+W+  +P I+ A
Sbjct  385  FAEAKWSHEGYIPTIEEYMLVALVTSGSCILATWSFIGMGEIMTKEAFDWVISDPKIITA  444

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + ++ R ++++ +++ E+       +GI+CYM  YGV
Sbjct  445  STVIFRLMDDITTHKFEQKRG-HVASGIECYMKQYGV  480



>ref|XP_011095304.1| PREDICTED: germacrene-D synthase-like [Sesamum indicum]
Length=554

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 96/156 (62%), Gaps = 7/156 (4%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            D IQ+WD++ + +LP YM+I Y+AL ++Y E    EL +    + + YAKE MK++V+ Y
Sbjct  326  DLIQRWDVHALEQLPSYMRICYEALSDVYIE-MENELKKTDESYRIQYAKEEMKKLVKTY  384

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E+KWS    +P   EY+K A+ SST  ML+ T  + M + VT+++F+W+   P +V A
Sbjct  385  IEEAKWSYNRYMPRMEEYMKVAIVSSTYMMLLTTSLVGMGNLVTKKDFDWITSEPVLVRA  444

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+GR  N+L  +  EK       T ++CYMN+ G
Sbjct  445  SSIIGRLANDLAGHGFEKKP-----TAVECYMNENG  475



>ref|XP_008366487.1| PREDICTED: (-)-alpha-pinene synthase-like [Malus domestica]
Length=563

 Score =   115 bits (289),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 61/159 (38%), Positives = 97/159 (61%), Gaps = 7/159 (4%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI +WD+N ++ LP+YM+  Y AL+NLY+ D   E+ +EGR + + YA + MK+  R+Y
Sbjct  333  EAIDRWDVNXIDELPEYMQTFYXALLNLYN-DIEAEMAKEGRSYRVPYAIQAMKDQARSY  391

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E++W  +G +P   EY++ A  S +   L   + L M   VT+E FEWL  +P IV A
Sbjct  392  FNEARWLHEGRVPSMEEYMRVATVSISYTFLTTIYLLGMGDVVTKEAFEWLFTDPKIVRA  451

Query  358  TVILGRTLNNLGS--YEREKSSSLSTITGIDCYMNDYGV  468
               + R +N++ S  +E+E+  + S+   +DCYM  YGV
Sbjct  452  ANTIFRLMNDIVSTNFEKERGHAASS---VDCYMKQYGV  487



>gb|AII32473.1| terpene synthase [Populus trichocarpa]
Length=569

 Score =   116 bits (290),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 59/157 (38%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WDI+ ++ LP+YMK  YK L ++Y E    EL  +GR + + YAKE MK+ V+AY
Sbjct  329  DAIERWDISNIDHLPEYMKFFYKQLSDVYKE-IETELAAQGRSYRVDYAKEAMKKQVQAY  387

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
             +E++W  +  +P   EY++ +L SS   +L    F+ M   VT++ FEWLN++P IV+A
Sbjct  388  FVEARWLHENYMPTMDEYMRISLISSGYPLLTCISFVGMGDIVTKDAFEWLNKDPKIVKA  447

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              ++ R ++++ S++ E+       + ++CYMN + V
Sbjct  448  ASLIARLMDDIVSHKFEQERG-HVASAVECYMNQHEV  483



>gb|AEP17005.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=557

 Score =   115 bits (289),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 57/156 (37%), Positives = 97/156 (62%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+++WDI+ +++LP+YM++ Y+AL+ +Y E   +E+  EGR + LYYAKE MK  VRAY
Sbjct  327  EAVERWDISAIDQLPEYMRVCYQALLYVYSE-IEEEMAREGRSYRLYYAKEAMKNQVRAY  385

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSM-KSVTREEFEWLNQNPGIVEA  357
              E+KW     +P   EY+  AL +S   ML  T F+ M  ++T+E  +W+   P IV A
Sbjct  386  YEEAKWPQVQQIPTMEEYMPVALVTSAYSMLATTSFVGMGDALTKETLDWIFSEPKIVRA  445

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+ R ++++  ++ E+       + ++CYM  +G
Sbjct  446  SAIVCRLMDDMVPHKFEQKRG-HVASAVECYMKQHG  480



>ref|XP_007021122.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
 gb|EOY12647.1| Delta-cadinene synthase isozyme A, putative [Theobroma cacao]
Length=716

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 98/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI +WDI+ +++LPDYMK+ YKAL+++Y+E   + + ++G++F + ++KE MK +V+AY 
Sbjct  486  AIARWDISCIDQLPDYMKLCYKALLDVYEE-MEEVMTKQGKLFRVQHSKEEMKRLVQAYF  544

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW  +   P   EY+  AL S   YML+ T  + M   + +E F W + +P IV A+
Sbjct  545  AEAKWLHENYTPTMEEYMPIALKSCGYYMLLMTSLVGMGDIIPKEAFHWASNDPKIVRAS  604

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             I+ R +N+  +++ E+       + ++CYM  YGV
Sbjct  605  SIINRLMNDTSAHKFEQERR-HVPSAVECYMKQYGV  639



>sp|F6M8H4.1|SAST_SANAL RecName: Full=Probable sesquiterpene synthase; Short=SaSTPS [Santalum 
album]
 gb|AEF32534.1| sesquiterpene synthase [Santalum album]
Length=559

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WD+  +++LP+YMK  YK+++ +Y+E   +E+  +G +F ++YAKE MK++V  Y
Sbjct  329  EAIRRWDVGSLDQLPEYMKPCYKSILEVYNE-IEEEMDNQGSLFRMHYAKEVMKKLVEGY  387

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
              E+KW  +  +P F EY+  AL +S    L    +L M  + ++E F+WL  +P ++EA
Sbjct  388  MDEAKWCHEKYVPTFEEYMSVALVTSGYTFLTTMSYLGMGEIASKEAFDWLFSHPPVIEA  447

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +  +GR ++++ S++ E+       +GI+CYM  Y V
Sbjct  448  SESVGRLMDDMRSHKFERERG-HVASGIECYMKQYSV  483



>ref|XP_008449179.1| PREDICTED: (-)-germacrene D synthase-like [Cucumis melo]
Length=392

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 99/159 (62%), Gaps = 7/159 (4%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDE---DFNKELCEEGRIFALYYAKERMKEVVR  174
            AI++WD+N + +LP YMKI Y  ++ LY+E   D NK+       +A++YAKE MK   R
Sbjct  161  AIERWDMNCIVKLPKYMKIFYGVILKLYEEIEKDINKDNVTIP--YAIHYAKEGMKRQCR  218

Query  175  AYNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMK-SVTREEFEWLNQNPGIV  351
            AY  E+KW  +G +P F EY+K A  S+  Y+ +P  F+ M  + ++E FEW+  +P ++
Sbjct  219  AYFAEAKWFHEGYVPTFEEYMKVATVSTCYYLFVPISFVGMGVAASKEAFEWVESDPMLL  278

Query  352  EATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +A+ I+GR +N++ S+  E+       + ++C+M  +G+
Sbjct  279  KASGIIGRLMNDVTSHTFEQERG-DVGSAVECHMKQHGL  316



>gb|AII32475.1| terpene synthase [Populus trichocarpa]
Length=551

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/158 (35%), Positives = 104/158 (66%), Gaps = 4/158 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLP-DYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRA  177
            +AI++  ++ +++LP +Y+K+ Y+AL+NL+ E    ++ ++GR +ALYY KE  KE+ RA
Sbjct  318  NAIERCCMDAIDQLPAEYLKVLYRALLNLFSET-ESDMGKQGRSYALYYVKEAFKELARA  376

Query  178  YNIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVT-REEFEWLNQNPGIVE  354
            Y +E++W+ +G +P F EY++N L++S   ++    F+ M  V  +EE++WL  NP I++
Sbjct  377  YRVEAQWADEGHVPTFDEYVRNGLTTSAYGVITAVSFVGMDEVAGQEEYKWLKSNPKIMK  436

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            A  ++ R +N++  +E E+       +G++C+M  Y V
Sbjct  437  AGKMICRLVNDIVGHEDEQKRG-DCASGVECFMKQYDV  473



>ref|XP_011095783.1| PREDICTED: germacrene-D synthase-like [Sesamum indicum]
Length=627

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 97/155 (63%), Gaps = 7/155 (5%)
 Frame = +1

Query  7    IQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYNI  186
            IQ+WD+N + +LP YMKI Y+AL ++Y E    EL + G  + + YAKE MK++VRAY  
Sbjct  401  IQRWDVNALEQLPSYMKICYEALCDVYIE-MENELEKTGGSYRIKYAKEEMKKLVRAYLE  459

Query  187  ESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEATV  363
            E+KWS    +P   EY+K A+ +ST  ML+ T  + M + VT+++F+W+   P ++ A+ 
Sbjct  460  EAKWSYNKDMPRMEEYMKVAIVTSTYMMLLTTSLVGMGNLVTKKDFDWITSEPLLLLASS  519

Query  364  ILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            I+ R  N+L  Y  EK       T ++CYMN+ GV
Sbjct  520  IICRLTNDLVGYGFEKKP-----TAVECYMNENGV  549



>ref|XP_009338882.1| PREDICTED: (-)-germacrene D synthase-like [Pyrus x bretschneideri]
Length=513

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 99/155 (64%), Gaps = 2/155 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WD++ MN+LP YMKI Y+AL+++Y E  +++L  +G+++ +++A+E MK+ VRAY
Sbjct  284  EAIERWDVSAMNQLPKYMKICYRALLDVYSE-IHEKLPHDGKLYRIHHAREAMKKQVRAY  342

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
              E+K   +  +P   EY+  +L +    +LI T FL M+  T + F+WL  +P  V+A 
Sbjct  343  FDEAKLFHQKHMPSLDEYMSVSLVTCGYQLLITTSFLGMEEATIDSFDWLLTSPPAVKAA  402

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
             I+ R ++++  ++ E+      I  ++CYM  YG
Sbjct  403  TIVCRLMDDIAEHKFEQDKE-HFIGVVNCYMKKYG  436



>ref|XP_011090538.1| PREDICTED: germacrene-D synthase-like [Sesamum indicum]
Length=552

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 94/156 (60%), Gaps = 7/156 (4%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            D +Q+WD+N   +LP Y++I YKALI+ Y E    E+   G  + + YAKE MK++VRAY
Sbjct  326  DVVQRWDVNDPEQLPPYIRICYKALIDAYLE-MEAEVESGGGSYRVQYAKEEMKKLVRAY  384

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E+KW     +P   EY+K AL S    ML  T  + M + VT+E+F+W+   P IV A
Sbjct  385  LEEAKWVYSKYMPTTKEYMKVALVSGAYMMLSTTSLVGMGNLVTKEDFDWVTSEPLIVRA  444

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            + I+ R ++++  +  E+      +T +DCYMN+YG
Sbjct  445  SSIICRLMDDMVGFGFEQK-----VTAVDCYMNEYG  475



>gb|KDP37851.1| hypothetical protein JCGZ_06358 [Jatropha curcas]
Length=525

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 94/156 (60%), Gaps = 6/156 (4%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DA Q+  I+ ++ LP+Y+K  YKA++ L++E  N    E G  +   +AKE  KEV R+Y
Sbjct  289  DAFQRCSIDAIDHLPEYLKHLYKAILKLFEETENNGNIE-GSSYKTSFAKEMFKEVTRSY  347

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
             +ES+W + G +P F EYL+N   + T  +L   FFL +K    ++  WL +NPGIV+ +
Sbjct  348  MLESQWLSDGFIPTFDEYLRNGSITITGDLLASAFFLELKDAGIKDMVWLRENPGIVKVS  407

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             +  R  +++ S+E EK +       ++CYMN++GV
Sbjct  408  KLFARLCDDITSHEGEKKAD-----AVECYMNEFGV  438



>dbj|BAJ53213.1| JHL23C09.9 [Jatropha curcas]
Length=602

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 94/156 (60%), Gaps = 2/156 (1%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WD+  ++ LP YMK+ YK LIN    +F K+L  EG+ +++ Y +E  +E+VR Y 
Sbjct  371  AIERWDMTLIDHLPGYMKVIYKLLINTTYNEFEKDLEAEGKSYSIKYGREAFQELVREYY  430

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTR-EEFEWLNQNPGIVEAT  360
             E+ W A G +P F EY+ N   +S L ++    F+ +K +   +EFEWL   P + +A 
Sbjct  431  QEALWKADGKVPTFDEYIFNGGVTSGLPLVATVSFMGVKEIKGIKEFEWLKTYPKLNQAG  490

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
               GR +N++ S+E E++      + IDCYMN YGV
Sbjct  491  GEFGRMVNDVMSHETEQNRG-HVASCIDCYMNQYGV  525



>ref|XP_002321642.1| hypothetical protein POPTR_0015s09710g [Populus trichocarpa]
 gb|EEF05769.1| hypothetical protein POPTR_0015s09710g [Populus trichocarpa]
Length=553

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI +WD   M++LPDYMKI Y+AL+N++ E   +++ +EG  + ++Y K+ MK +V AY
Sbjct  323  EAIDRWDTKSMDQLPDYMKICYEALLNVFSE-IEEKVAKEGWSYRVHYGKDAMKVLVHAY  381

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E+KW  +  +P   EY++ AL +S   ML    F+ M   VT++ F+W+  +P I+ A
Sbjct  382  FNEAKWFHENHIPTMEEYMQVALVTSGYSMLTTVSFIGMGDMVTKQAFDWVFNHPKIIRA  441

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +  +GR ++++ S++ E+    +  +G++CY+  YG+
Sbjct  442  SETIGRLMDDVKSHKFEQERGHAA-SGVECYIRQYGL  477



>sp|Q6Q3H2.1|TPSVS_VITVI RecName: Full=Valencene synthase; Short=VvVal; AltName: Full=7-epi-alpha-selinene 
synthase [Vitis vinifera]
 gb|AAS66358.1| (+)-valencene synthase [Vitis vinifera]
Length=556

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 104/157 (66%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++WDIN +N+LP+YMK+ Y AL+++Y E   +E+ +EG  + ++YAKE MK  VRAY
Sbjct  327  EAIERWDINSINQLPEYMKLCYVALLDVYKEI-EEEMEKEGNQYRVHYAKEVMKNQVRAY  385

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
              E+KW  +  +P F EY++ AL+SS   +L  T F+ M  + T+E F+W+  +P I+ +
Sbjct  386  FAEAKWLHEEHVPAFEEYMRVALASSGYCLLATTSFVGMGEIATKEAFDWVTSDPKIMSS  445

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +  + R ++++ S++ E+     T + ++CYM  YGV
Sbjct  446  SNFITRLMDDIKSHKFEQKRGHVT-SAVECYMKQYGV  481



>sp|B5A435.1|STPS1_SANAL RecName: Full=Sesquiterpene synthase; Short=SaSesquiTPS1 [Santalum 
album]
 gb|ACF24768.1| sesquiterpene synthase [Santalum album]
Length=559

 Score =   115 bits (288),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 100/156 (64%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            A+Q+WD+  +++LP+YMK  YK+++++Y+E   +E+  +G +F ++YAKE MK++V  Y 
Sbjct  330  AMQRWDVGSLDQLPEYMKPCYKSILDVYNE-IEEEMDNQGSLFRMHYAKEVMKKLVEGYM  388

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEAT  360
             E+KW  +  +P F EY+  AL +S    L    +L M  + ++E F+WL  +P ++EA+
Sbjct  389  DEAKWCHEKYVPTFEEYMPVALVTSGYTFLTTISYLGMGEIASKEAFDWLFSHPPVIEAS  448

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              + R ++++ S++ E+       +GI+CYM  YGV
Sbjct  449  ESVCRLMDDMRSHKFEQERG-HVASGIECYMKQYGV  483



>ref|XP_008226738.1| PREDICTED: (-)-alpha-pinene synthase-like isoform X2 [Prunus 
mume]
Length=564

 Score =   115 bits (287),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 63/159 (40%), Positives = 97/159 (61%), Gaps = 7/159 (4%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI +WD+N  N LPDYMKI Y+AL+NL++E   +E+ +EGR + + YA + MK+  R+Y
Sbjct  334  EAIDRWDLNCSNELPDYMKIFYQALLNLFNE-IEEEMVKEGRSYRVPYAIQAMKDQARSY  392

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E++W  +G +P   EY+  A  S +   L     L M   VT+E FEWL  +P IV A
Sbjct  393  FNEARWLHEGRIPSMDEYMSVATVSISYTFLTTISLLGMGDIVTKESFEWLLNDPKIVRA  452

Query  358  TVILGRTLNNLGS--YEREKSSSLSTITGIDCYMNDYGV  468
               + R ++++ S  +E+E+  + S+   +DCYM  YGV
Sbjct  453  ANTIFRLMDDIVSTNFEKERGHAASS---VDCYMKQYGV  488



>ref|XP_010694277.1| PREDICTED: probable sesquiterpene synthase [Beta vulgaris subsp. 
vulgaris]
Length=551

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 94/158 (59%), Gaps = 4/158 (3%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+Q WD + MN+LPDYMK++Y+AL++ +D  F + L  EGR   + Y +E MK   R Y
Sbjct  319  EAVQGWDKSNMNKLPDYMKLTYEALLDTFD-GFEQSLANEGRSQLVSYVREMMKAQCRGY  377

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIP-TFFLSMKS-VTREEFEWLNQNPGIVE  354
              E+KW  +  +P + EYL +A  ++  Y L+  T FL M    T+  FEW  + P  ++
Sbjct  378  FQEAKWCHEKYVPTYDEYLNDAAITTAGYTLMSGTTFLGMGEFATKAVFEWARETPKPIK  437

Query  355  ATVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            A+ I+GR + ++ SY+ E+       + ++CYM  YGV
Sbjct  438  ASCIIGRLIGDMASYKIERKRE-HVASAVECYMKQYGV  474



>emb|CBI20482.3| unnamed protein product [Vitis vinifera]
Length=725

 Score =   116 bits (290),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 56/156 (36%), Positives = 100/156 (64%), Gaps = 3/156 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+++WDI+ +++LP+YM++ Y+AL+++Y E   +E+ +EGR +  YYAKE MK+ VRAY
Sbjct  327  EAVERWDISVIDQLPEYMRVCYRALLDVYSE-IEEEMAKEGRSYRFYYAKEAMKKQVRAY  385

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E++W     +P   EY+  A ++S   ML  T F++M   VT+E F+W+   P IV A
Sbjct  386  YEEAQWLQAQQIPTMEEYMPVASATSGYPMLATTSFIAMGDVVTKETFDWVFSEPKIVRA  445

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
            +  + R ++++ S++ E+       + ++CYM  +G
Sbjct  446  SATVSRLMDDMVSHKFEQKRG-HVASAVECYMKQHG  480



>ref|XP_008245781.1| PREDICTED: (-)-alpha-pinene synthase-like [Prunus mume]
Length=561

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 97/159 (61%), Gaps = 7/159 (4%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI +WD+N  N LPDYMKI Y+AL+NL++E   +E+ +EGR + + YA + MK+  R+Y
Sbjct  331  EAIDRWDLNCSNELPDYMKIFYQALLNLFNE-IEEEMVKEGRSYRVPYAIQAMKDQARSY  389

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E++W  +G +P   EY+  A  S +   L     L M   VT+E FEWL  +P IV A
Sbjct  390  FNEARWLHEGRIPSMDEYMSVATVSISYTFLTTISLLGMGDIVTKESFEWLLNDPKIVRA  449

Query  358  TVILGRTLNNLGS--YEREKSSSLSTITGIDCYMNDYGV  468
               + R ++++ S  +E+E+  + S+   +DCYM  YGV
Sbjct  450  ANTIFRLMDDIVSTNFEKERGHAASS---VDCYMKQYGV  485



>ref|XP_010258444.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=562

 Score =   115 bits (287),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 102/157 (65%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            DAI++WD+ + ++L +YMK+ Y AL+++Y+E   +++  EGR + +YYAKE M++  RAY
Sbjct  332  DAIERWDVGETDQLLEYMKVIYLALLDVYNE-IEEQVNREGRSYCVYYAKEAMRKQARAY  390

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEA  357
             +E+KW  +G +P   EY+  AL S++  +L    F+ M  + T+E F+W++  P +V+ 
Sbjct  391  LVEAKWFFQGHIPIVEEYMDVALISTSYPLLAVASFVGMGEIATKEAFDWVSNLPNLVKN  450

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            + I+ R ++++ ++E E+       + ++CYM  YGV
Sbjct  451  SSIICRLMDDIMTHEYEQEKG-DVCSSVECYMKQYGV  486



>ref|XP_008371259.1| PREDICTED: (-)-germacrene D synthase-like isoform X3 [Malus domestica]
Length=525

 Score =   114 bits (286),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 53/156 (34%), Positives = 96/156 (62%), Gaps = 2/156 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+++WDI+ M+RLP YMK+ Y+A+++ Y E   ++L  EG ++ ++YA+E MK +VR Y
Sbjct  295  BAVERWDISAMDRLPQYMKVCYQAMLDSYTE-MEEKLRNEGNLYRIHYAREAMKVLVRGY  353

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
              E+KW  +   P   EYL  AL +S+  + + +F      VT++  +W+  +P I++A 
Sbjct  354  MREAKWFHRKYTPTLDEYLSAALDTSSFSLAVTSFIGMGDIVTKDSLDWVFNDPKILKAA  413

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
             ++GR  N++ S++ E+       + ++CYM  Y V
Sbjct  414  SLIGRLKNDIKSHQFEQKRG-HVASAVECYMKQYDV  448



>ref|XP_008366777.1| PREDICTED: LOW QUALITY PROTEIN: (-)-germacrene D synthase-like 
[Malus domestica]
Length=514

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 101/155 (65%), Gaps = 1/155 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +AI++W  + M++LP+YMK+ Y+AL+++Y E  +++L  EG+++ +++A+E MK++VR+Y
Sbjct  282  EAIERWHFSAMDQLPEYMKVCYRALLDIYSE-IHEKLAHEGKLYPMHHAREAMKKLVRSY  340

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTREEFEWLNQNPGIVEAT  360
              E+K   +  +P   EY+  +L +S   +LI T F+ M+  T + F+ L   P  V+A 
Sbjct  341  FNEAKLFRQKHIPSLDEYMSVSLVTSGYLLLITTSFVGMEEATIDSFDXLLTXPQAVKAA  400

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
              +GR +N++ +++ E++     ++ ++CYM  YG
Sbjct  401  STIGRLMNDIVNHKFEQNKKEHFVSAVNCYMKKYG  435



>ref|NP_001239041.1| sesquiterpene synthase [Solanum lycopersicum]
 gb|AEM23832.1| sesquiterpene synthase [Solanum lycopersicum]
 gb|AEP82780.1| TPS17 [Solanum lycopersicum]
Length=554

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 98/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++W+I+   +LP YMKI Y+ L+++YDE   KEL  E + F + Y+   MK+VVR Y 
Sbjct  324  AIERWNIDASEQLPLYMKIIYRDLLDVYDE-IEKELANENKSFLVNYSINEMKKVVRGYF  382

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEAT  360
             E+KW     +P   +Y+KN +S+S   +L  T +L+M +V T++ F+W+   P IV A+
Sbjct  383  QEAKWYYGKKVPTMEQYMKNGISTSAYILLTTTSWLAMGNVATKDAFDWVATEPPIVVAS  442

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              + R LN+L S+E E+    +  + ++CYMN+Y V
Sbjct  443  CYIIRLLNDLVSHEEEQKRG-NAASAVECYMNEYSV  477



>ref|XP_010092286.1| (-)-germacrene D synthase [Morus notabilis]
 gb|EXB50920.1| (-)-germacrene D synthase [Morus notabilis]
Length=562

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 94/155 (61%), Gaps = 2/155 (1%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A ++WD++ M++LP+YMK+ YKAL+N+YDE       E+G+++ L YAKE MK  +RAY
Sbjct  331  EAAERWDVSAMDKLPEYMKVCYKALLNVYDEIEENLATEDGKLYRLDYAKEAMKRQIRAY  390

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEA  357
              E+KW      P   EY+  A  +S   ML  T F+ M   VT++ FEWL  NP +V A
Sbjct  391  VQEAKWFNLNYTPTMEEYMPLARVTSAYAMLATTSFVGMGDIVTKDSFEWLFSNPKLVSA  450

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDY  462
            + ++ R ++++ S+  E+       + ++CYM  +
Sbjct  451  SEVVCRLMDDIVSHMFEQKRG-HVASAVECYMKQH  484



>ref|XP_002513340.1| Casbene synthase, chloroplast precursor [Ricinus communis]
 sp|P59287.1|CASS_RICCO RecName: Full=Casbene synthase, chloroplastic; Flags: Precursor 
[Ricinus communis]
 gb|EEF48743.1| Casbene synthase, chloroplast precursor [Ricinus communis]
Length=601

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 96/157 (61%), Gaps = 3/157 (2%)
 Frame = +1

Query  1    DAIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAY  180
            +A+ +WD++ + +LPDYMK+ YK L+N + E F KEL  EG+ +++ Y +E  +E+VR Y
Sbjct  372  EAVARWDMSCLEKLPDYMKVIYKLLLNTFSE-FEKELTAEGKSYSVKYGREAFQELVRGY  430

Query  181  NIESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSVTR-EEFEWLNQNPGIVEA  357
             +E+ W  +G +P F +YL N   ++ L ++    F+ ++ +T   EF+WL  NP +  A
Sbjct  431  YLEAVWRDEGKIPSFDDYLYNGSMTTGLPLVSTASFMGVQEITGLNEFQWLETNPKLSYA  490

Query  358  TVILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
            +    R +N+L S+  E+       + IDCYMN +GV
Sbjct  491  SGAFIRLVNDLTSHVTEQQRG-HVASCIDCYMNQHGV  526



>gb|KDP31568.1| hypothetical protein JCGZ_14793 [Jatropha curcas]
Length=413

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 94/156 (60%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
             I+ WDI+  ++LPDYMK+ ++AL++ Y E   +E  +EGR F ++YAKE +K+ V AY 
Sbjct  184  VIESWDISMKDQLPDYMKVYFEALLDFYSE-IEEETTKEGRSFCIHYAKEAVKKQVGAYR  242

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEAT  360
             E++W     +P F EY+ NA+ SST  MLI   F +M  V +++ F+WL   P ++   
Sbjct  243  TEARWFNNDYVPTFEEYISNAVISSTYPMLITLSFCAMGEVASKQVFDWLFTEPKLLYTA  302

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              L R +N++ S+E E+       + ++C M  YGV
Sbjct  303  SGLARLINDIMSHEFEQERG-HVASAVECCMKQYGV  337



>gb|AEM23828.1| sesquiterpene synthase [Solanum habrochaites]
Length=554

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 99/156 (63%), Gaps = 3/156 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++W+I+   +LP YMKI Y+ L+++YDE   KEL  E + F + Y+   MK+VVR Y 
Sbjct  324  AIERWNIDASEQLPLYMKIIYRDLLDVYDE-IEKELANENKSFLVNYSINEMKKVVRGYF  382

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKSV-TREEFEWLNQNPGIVEAT  360
             E+KW     +P   +Y+KNA+S+S   +L  T +L+M +V T++ F+W+   P +V A+
Sbjct  383  QEAKWYYGKKVPKMEQYMKNAISTSAYILLTTTSWLAMGNVATKDVFDWVATEPKLVVAS  442

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYGV  468
              + R LN+L S+E E+    +  + ++CYMN+Y V
Sbjct  443  CHIIRLLNDLVSHEEEQKRG-NAASAVECYMNEYSV  477



>ref|XP_004288818.1| PREDICTED: (-)-germacrene D synthase-like [Fragaria vesca subsp. 
vesca]
Length=560

 Score =   114 bits (286),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 59/155 (38%), Positives = 97/155 (63%), Gaps = 3/155 (2%)
 Frame = +1

Query  4    AIQKWDINQMNRLPDYMKISYKALINLYDEDFNKELCEEGRIFALYYAKERMKEVVRAYN  183
            AI++WDI+ M+ LP+YMK  Y+AL+++Y E   + L  EG+ + + YAKE MK  VRAY+
Sbjct  331  AIERWDISAMDVLPEYMKFCYEALLDVYAEA-EQGLASEGKSYRIDYAKEAMKRQVRAYH  389

Query  184  IESKWSAKGCLPPFAEYLKNALSSSTLYMLIPTFFLSMKS-VTREEFEWLNQNPGIVEAT  360
             E+KW      P   EY++ AL +S   ML  T F+ M   VT++ FEW+  +P +V+A+
Sbjct  390  AEAKWFHNNYTPTMDEYMEVALVTSAYSMLATTSFVGMGDIVTKDSFEWIFSDPKMVKAS  449

Query  361  VILGRTLNNLGSYEREKSSSLSTITGIDCYMNDYG  465
             ++ R ++++ S++ E+       + ++CYM  YG
Sbjct  450  AVVCRLMDDIVSHKFEQKRG-HVASAVECYMIQYG  483



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512662103758