BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23712_g1_i5 len=1973 path=[5011:0-527 2461:528-674 @5685@!:675-1454
6465:1455-1764 8006:1765-1766 2049:1767-1972]

Length=1973
                                                                      Score     E

ref|XP_006366741.1|  PREDICTED: protein arginine N-methyltransfer...    525   2e-173   
ref|XP_006366742.1|  PREDICTED: protein arginine N-methyltransfer...    521   7e-172   
ref|XP_010322901.1|  PREDICTED: protein arginine N-methyltransfer...    517   2e-170   
ref|XP_010322903.1|  PREDICTED: protein arginine N-methyltransfer...    513   9e-169   
ref|XP_009800535.1|  PREDICTED: protein arginine N-methyltransfer...    505   1e-165   
ref|XP_009621715.1|  PREDICTED: protein arginine N-methyltransfer...    502   2e-164   
ref|XP_007210286.1|  hypothetical protein PRUPE_ppa002907mg             496   7e-164   
ref|XP_008238521.1|  PREDICTED: protein arginine N-methyltransfer...    499   1e-163   
ref|XP_006838157.1|  hypothetical protein AMTR_s00106p00104330          432   2e-163   
ref|XP_010322899.1|  PREDICTED: protein arginine N-methyltransfer...    499   3e-163   
ref|XP_011081252.1|  PREDICTED: protein arginine N-methyltransfer...    498   8e-163   
ref|XP_010662493.1|  PREDICTED: protein arginine N-methyltransfer...    496   2e-162   
ref|XP_010322900.1|  PREDICTED: protein arginine N-methyltransfer...    495   1e-161   
ref|XP_011081251.1|  PREDICTED: protein arginine N-methyltransfer...    490   1e-159   
ref|XP_011081253.1|  PREDICTED: protein arginine N-methyltransfer...    489   1e-159   
ref|XP_004299441.1|  PREDICTED: protein arginine N-methyltransfer...    485   1e-158   
ref|XP_002528925.1|  protein arginine n-methyltransferase, putative     483   8e-158   Ricinus communis
ref|XP_009334505.1|  PREDICTED: protein arginine N-methyltransfer...    484   1e-157   
ref|XP_009334506.1|  PREDICTED: protein arginine N-methyltransfer...    478   1e-157   
ref|XP_006477200.1|  PREDICTED: protein arginine N-methyltransfer...    482   5e-157   
ref|XP_010264285.1|  PREDICTED: protein arginine N-methyltransfer...    480   1e-156   
ref|XP_010264283.1|  PREDICTED: protein arginine N-methyltransfer...    479   1e-155   
ref|XP_002303351.2|  arginine N-methyltransferase family protein        479   1e-155   Populus trichocarpa [western balsam poplar]
emb|CDP09960.1|  unnamed protein product                                476   3e-154   
ref|XP_008369459.1|  PREDICTED: protein arginine N-methyltransfer...    475   3e-154   
ref|XP_008437081.1|  PREDICTED: protein arginine N-methyltransfer...    474   1e-153   
gb|EYU32841.1|  hypothetical protein MIMGU_mgv1a022108mg                472   3e-153   
ref|XP_003525834.2|  PREDICTED: protein arginine N-methyltransfer...    471   1e-152   
ref|XP_004152403.1|  PREDICTED: protein arginine N-methyltransfer...    468   2e-151   
ref|XP_011031876.1|  PREDICTED: protein arginine N-methyltransfer...    465   4e-150   
ref|XP_006579630.1|  PREDICTED: protein arginine N-methyltransfer...    464   6e-150   
gb|KDP39866.1|  hypothetical protein JCGZ_03397                         461   3e-149   
ref|XP_010110826.1|  hypothetical protein L484_011809                   461   2e-148   
ref|XP_004516821.1|  PREDICTED: protein arginine N-methyltransfer...    457   4e-148   
ref|XP_004516820.1|  PREDICTED: protein arginine N-methyltransfer...    458   1e-147   
gb|KEH31648.1|  arginine N-methyltransferase                            453   4e-147   
gb|KHG01433.1|  Protein arginine N-methyltransferase 1.6 -like pr...    456   8e-147   
gb|AES90914.2|  arginine N-methyltransferase                            453   3e-146   
ref|XP_007039849.1|  Arginine N-methyltransferase 1.6 isoform 3         452   6e-146   
ref|XP_007039847.1|  Arginine methyltransferase 7, putative isofo...    453   1e-145   
ref|XP_007039850.1|  Arginine methyltransferase 7, putative isofo...    452   1e-145   
ref|XP_007039848.1|  Arginine methyltransferase 7, putative isofo...    452   2e-145   
ref|XP_003608717.1|  Protein arginine N-methyltransferase               455   8e-145   
ref|XP_010941140.1|  PREDICTED: protein arginine N-methyltransfer...    450   3e-144   
ref|XP_010941139.1|  PREDICTED: protein arginine N-methyltransfer...    449   5e-144   
gb|KCW77779.1|  hypothetical protein EUGRSUZ_D02075                     442   3e-143   
ref|XP_006440322.1|  hypothetical protein CICLE_v10023597mg             442   3e-142   
ref|XP_010053469.1|  PREDICTED: protein arginine N-methyltransfer...    440   1e-140   
ref|XP_010695157.1|  PREDICTED: protein arginine N-methyltransfer...    438   2e-140   
gb|KCW77777.1|  hypothetical protein EUGRSUZ_D02075                     440   4e-140   
gb|KCW77778.1|  hypothetical protein EUGRSUZ_D02075                     440   4e-140   
ref|XP_007146021.1|  hypothetical protein PHAVU_006G006200g             437   7e-140   
ref|XP_009386347.1|  PREDICTED: protein arginine N-methyltransfer...    437   1e-139   
gb|EYU33534.1|  hypothetical protein MIMGU_mgv1a019619mg                429   2e-139   
ref|XP_010322902.1|  PREDICTED: protein arginine N-methyltransfer...    436   3e-139   
ref|XP_004964287.1|  PREDICTED: protein arginine N-methyltransfer...    422   1e-133   
ref|XP_004964286.1|  PREDICTED: protein arginine N-methyltransfer...    421   1e-133   
ref|XP_002436330.1|  hypothetical protein SORBIDRAFT_10g000540          419   1e-132   Sorghum bicolor [broomcorn]
ref|NP_001141412.1|  uncharacterized protein LOC100273522               417   4e-132   Zea mays [maize]
gb|AFW86217.1|  hypothetical protein ZEAMMB73_654010                    417   1e-131   
ref|XP_008658259.1|  PREDICTED: uncharacterized protein LOC100273...    417   1e-131   
ref|XP_008658261.1|  PREDICTED: uncharacterized protein LOC100273...    417   1e-131   
ref|XP_008658260.1|  PREDICTED: uncharacterized protein LOC100273...    416   1e-131   
ref|XP_006656546.1|  PREDICTED: protein arginine N-methyltransfer...    409   3e-129   
ref|XP_010264284.1|  PREDICTED: protein arginine N-methyltransfer...    409   5e-129   
gb|EEE64946.1|  hypothetical protein OsJ_19828                          407   2e-128   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79835.1|  hypothetical protein OsI_21299                          407   2e-128   Oryza sativa Indica Group [Indian rice]
ref|NP_001056556.1|  Os06g0105500                                       407   3e-128   Oryza sativa Japonica Group [Japonica rice]
sp|A2Y8B9.3|ANM7_ORYSI  RecName: Full=Protein arginine N-methyltr...    406   7e-128   Oryza sativa Indica Group [Indian rice]
ref|XP_003561238.1|  PREDICTED: protein arginine N-methyltransfer...    405   2e-127   
ref|XP_010434803.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    404   5e-127   
ref|XP_010440130.1|  PREDICTED: protein arginine N-methyltransfer...    398   3e-126   
dbj|BAK05792.1|  predicted protein                                      402   4e-126   
gb|KFK26525.1|  hypothetical protein AALP_AA8G260400                    399   5e-125   
ref|XP_010440129.1|  PREDICTED: protein arginine N-methyltransfer...    396   5e-124   
ref|XP_010542205.1|  PREDICTED: protein arginine N-methyltransfer...    395   1e-123   
ref|XP_002870146.1|  predicted protein                                  394   4e-123   
ref|XP_010449758.1|  PREDICTED: protein arginine N-methyltransfer...    392   2e-122   
ref|NP_567508.1|  protein arginine N-methyltransferase 7                389   3e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145712.1|  PREDICTED: protein arginine N-methyltransfer...    384   3e-119   
emb|CDY40533.1|  BnaC01g19790D                                          384   3e-119   
emb|CDY60190.1|  BnaA01g35410D                                          384   4e-119   
ref|XP_006414329.1|  hypothetical protein EUTSA_v10024535mg             378   5e-117   
gb|EPS70481.1|  hypothetical protein M569_04274                         377   5e-117   
ref|XP_008794808.1|  PREDICTED: protein arginine N-methyltransfer...    376   7e-116   
gb|EYU32837.1|  hypothetical protein MIMGU_mgv1a024512mg                372   1e-115   
gb|KDO61457.1|  hypothetical protein CISIN_1g0442451mg                  347   4e-109   
gb|KHN04362.1|  Protein arginine N-methyltransferase 1.6                341   4e-104   
gb|EMS53458.1|  hypothetical protein TRIUR3_03298                       331   1e-100   
gb|EMT27966.1|  hypothetical protein F775_10263                         302   5e-89    
ref|XP_008794807.1|  PREDICTED: protein arginine N-methyltransfer...    269   9e-79    
ref|XP_001784898.1|  protein arginine N-methyltransferase               272   3e-77    
ref|XP_002988698.1|  hypothetical protein SELMODRAFT_427394             262   2e-74    
ref|XP_002986285.1|  hypothetical protein SELMODRAFT_425255             261   8e-74    
ref|XP_002986287.1|  hypothetical protein SELMODRAFT_425258             258   1e-73    
ref|XP_002988702.1|  hypothetical protein SELMODRAFT_447442             259   2e-73    
ref|XP_002990150.1|  hypothetical protein SELMODRAFT_185054             259   4e-73    
ref|XP_002986371.1|  hypothetical protein SELMODRAFT_425264             266   1e-72    
gb|AAL11573.1|AF424579_1  AT4g16570/dl4310w                             232   8e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870148.1|  predicted protein                                  202   2e-56    
gb|AFW86216.1|  hypothetical protein ZEAMMB73_654010                    197   4e-53    
gb|ACN27197.1|  unknown                                                 197   4e-53    Zea mays [maize]
emb|CAB10433.1|  hypothetical protein                                   186   6e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002988700.1|  hypothetical protein SELMODRAFT_427398             166   1e-40    
ref|XP_005504811.1|  PREDICTED: protein arginine N-methyltransfer...    163   3e-39    
ref|XP_010219995.1|  PREDICTED: protein arginine N-methyltransfer...    162   5e-39    
ref|XP_008965527.1|  PREDICTED: protein arginine N-methyltransfer...    160   8e-39    
ref|XP_009429398.1|  PREDICTED: protein arginine N-methyltransfer...    162   8e-39    
ref|XP_006258220.1|  PREDICTED: protein arginine N-methyltransfer...    161   9e-39    
ref|XP_008965526.1|  PREDICTED: protein arginine N-methyltransfer...    160   1e-38    
ref|XP_008965525.1|  PREDICTED: protein arginine N-methyltransfer...    161   1e-38    
gb|EAW83232.1|  protein arginine methyltransferase 7, isoform CRA_e     160   1e-38    
ref|XP_008965522.1|  PREDICTED: protein arginine N-methyltransfer...    161   1e-38    
ref|XP_010193298.1|  PREDICTED: protein arginine N-methyltransfer...    159   1e-38    
ref|XP_008965523.1|  PREDICTED: protein arginine N-methyltransfer...    160   1e-38    
ref|XP_003936376.2|  PREDICTED: protein arginine N-methyltransfer...    161   2e-38    
ref|XP_008965521.1|  PREDICTED: protein arginine N-methyltransfer...    160   2e-38    
ref|XP_007992049.1|  PREDICTED: protein arginine N-methyltransfer...    159   2e-38    
dbj|BAB14215.1|  unnamed protein product                                160   2e-38    Homo sapiens [man]
ref|XP_009195014.1|  PREDICTED: protein arginine N-methyltransfer...    160   2e-38    
ref|XP_005256049.1|  PREDICTED: protein arginine N-methyltransfer...    160   2e-38    
dbj|BAG53431.1|  unnamed protein product                                159   2e-38    Homo sapiens [man]
ref|XP_008965519.1|  PREDICTED: protein arginine N-methyltransfer...    160   2e-38    
ref|NP_001171753.1|  protein arginine N-methyltransferase 7 isofo...    160   2e-38    Homo sapiens [man]
ref|XP_006019120.1|  PREDICTED: protein arginine N-methyltransfer...    160   3e-38    
ref|XP_008965517.1|  PREDICTED: protein arginine N-methyltransfer...    160   3e-38    
gb|EAW83231.1|  protein arginine methyltransferase 7, isoform CRA_d     160   3e-38    
ref|XP_008965520.1|  PREDICTED: protein arginine N-methyltransfer...    160   3e-38    
ref|XP_008965516.1|  PREDICTED: protein arginine N-methyltransfer...    160   3e-38    
ref|XP_007992045.1|  PREDICTED: protein arginine N-methyltransfer...    159   3e-38    
ref|XP_009897442.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    160   3e-38    
ref|XP_007992044.1|  PREDICTED: protein arginine N-methyltransfer...    159   3e-38    
ref|NP_061896.1|  protein arginine N-methyltransferase 7 isoform 1      160   4e-38    Homo sapiens [man]
ref|XP_008965510.1|  PREDICTED: protein arginine N-methyltransfer...    160   4e-38    
ref|XP_007429235.1|  PREDICTED: protein arginine N-methyltransfer...    158   4e-38    
ref|XP_008965515.1|  PREDICTED: protein arginine N-methyltransfer...    160   5e-38    
ref|XP_005592409.1|  PREDICTED: protein arginine N-methyltransfer...    158   5e-38    
ref|XP_002992539.1|  hypothetical protein SELMODRAFT_430728             159   5e-38    
ref|XP_010353347.1|  PREDICTED: protein arginine N-methyltransfer...    159   5e-38    
gb|EHH60505.1|  hypothetical protein EGM_11877                          158   6e-38    
gb|EHH31787.1|  hypothetical protein EGK_12925                          157   6e-38    
ref|XP_007992043.1|  PREDICTED: protein arginine N-methyltransfer...    159   7e-38    
ref|XP_005025773.1|  PREDICTED: protein arginine N-methyltransfer...    159   8e-38    
ref|XP_001099129.2|  PREDICTED: protein arginine N-methyltransfer...    158   1e-37    Macaca mulatta [rhesus macaque]
dbj|BAG51772.1|  unnamed protein product                                158   1e-37    Homo sapiens [man]
ref|XP_007429234.1|  PREDICTED: protein arginine N-methyltransfer...    158   1e-37    
ref|XP_009884748.1|  PREDICTED: protein arginine N-methyltransfer...    157   1e-37    
ref|XP_003262970.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    158   1e-37    
ref|XP_005592408.1|  PREDICTED: protein arginine N-methyltransfer...    158   1e-37    
ref|XP_008255735.1|  PREDICTED: protein arginine N-methyltransfer...    156   2e-37    
ref|XP_009862795.1|  PREDICTED: protein arginine N-methyltransfer...    157   2e-37    
ref|XP_001099228.1|  PREDICTED: protein arginine N-methyltransfer...    158   2e-37    Macaca mulatta [rhesus macaque]
ref|XP_009249137.1|  PREDICTED: protein arginine N-methyltransfer...    157   2e-37    
ref|XP_009884740.1|  PREDICTED: protein arginine N-methyltransfer...    157   2e-37    
gb|KFP74008.1|  Protein arginine N-methyltransferase 7                  157   2e-37    
ref|XP_009862794.1|  PREDICTED: protein arginine N-methyltransfer...    157   2e-37    
ref|XP_010126413.1|  PREDICTED: protein arginine N-methyltransfer...    157   2e-37    
ref|XP_002826617.1|  PREDICTED: protein arginine N-methyltransfer...    157   2e-37    
ref|XP_009939264.1|  PREDICTED: protein arginine N-methyltransfer...    157   3e-37    
ref|XP_009884732.1|  PREDICTED: protein arginine N-methyltransfer...    157   3e-37    
ref|XP_010126412.1|  PREDICTED: protein arginine N-methyltransfer...    157   3e-37    
gb|KGL82134.1|  Protein arginine N-methyltransferase 7                  157   3e-37    
ref|XP_008984356.1|  PREDICTED: protein arginine N-methyltransfer...    157   3e-37    
ref|XP_009939263.1|  PREDICTED: protein arginine N-methyltransfer...    157   3e-37    
ref|XP_008112156.1|  PREDICTED: protein arginine N-methyltransfer...    155   3e-37    
ref|XP_009249136.1|  PREDICTED: protein arginine N-methyltransfer...    156   4e-37    
ref|XP_009972231.1|  PREDICTED: protein arginine N-methyltransfer...    156   4e-37    
ref|XP_009249129.1|  PREDICTED: protein arginine N-methyltransfer...    157   4e-37    
ref|XP_008832222.1|  PREDICTED: protein arginine N-methyltransfer...    155   4e-37    
ref|XP_008832229.1|  PREDICTED: protein arginine N-methyltransfer...    155   4e-37    
ref|XP_010174684.1|  PREDICTED: protein arginine N-methyltransfer...    156   4e-37    
gb|KFZ51183.1|  Protein arginine N-methyltransferase 7                  156   5e-37    
ref|XP_002711658.1|  PREDICTED: protein arginine N-methyltransfer...    156   5e-37    Oryctolagus cuniculus [domestic rabbit]
ref|XP_004273243.1|  PREDICTED: protein arginine N-methyltransfer...    156   5e-37    
ref|XP_009972230.1|  PREDICTED: protein arginine N-methyltransfer...    156   6e-37    
ref|XP_008832215.1|  PREDICTED: protein arginine N-methyltransfer...    155   7e-37    
ref|XP_010205492.1|  PREDICTED: protein arginine N-methyltransfer...    155   8e-37    
ref|XP_004273242.1|  PREDICTED: protein arginine N-methyltransfer...    156   8e-37    
ref|XP_003223006.1|  PREDICTED: protein arginine N-methyltransfer...    155   8e-37    
gb|KGL86637.1|  Protein arginine N-methyltransferase 7                  155   1e-36    
ref|XP_008832205.1|  PREDICTED: protein arginine N-methyltransfer...    155   1e-36    
ref|XP_010017137.1|  PREDICTED: protein arginine N-methyltransfer...    155   1e-36    
ref|XP_007113368.1|  PREDICTED: protein arginine N-methyltransfer...    155   1e-36    
ref|XP_003758489.1|  PREDICTED: protein arginine N-methyltransfer...    155   2e-36    
ref|XP_010053472.1|  PREDICTED: protein arginine N-methyltransfer...    142   2e-36    
ref|XP_009467501.1|  PREDICTED: protein arginine N-methyltransfer...    154   2e-36    
ref|XP_004313874.1|  PREDICTED: protein arginine N-methyltransfer...    154   2e-36    
ref|XP_009641538.1|  PREDICTED: protein arginine N-methyltransfer...    154   2e-36    
gb|KFQ53514.1|  Protein arginine N-methyltransferase 7                  154   2e-36    
ref|XP_006010765.1|  PREDICTED: protein arginine N-methyltransfer...    154   2e-36    
ref|XP_009641537.1|  PREDICTED: protein arginine N-methyltransfer...    154   3e-36    
ref|XP_009195013.1|  PREDICTED: protein arginine N-methyltransfer...    154   3e-36    
ref|XP_009467500.1|  PREDICTED: protein arginine N-methyltransfer...    154   3e-36    
ref|XP_010281742.1|  PREDICTED: protein arginine N-methyltransfer...    154   4e-36    
ref|XP_009195012.1|  PREDICTED: protein arginine N-methyltransfer...    154   4e-36    
ref|XP_005608413.1|  PREDICTED: protein arginine N-methyltransfer...    153   4e-36    
ref|XP_003209740.1|  PREDICTED: protein arginine N-methyltransfer...    154   4e-36    
gb|KFP19614.1|  Protein arginine N-methyltransferase 7                  154   4e-36    
ref|XP_009571084.1|  PREDICTED: protein arginine N-methyltransfer...    153   4e-36    
ref|XP_008065522.1|  PREDICTED: protein arginine N-methyltransfer...    154   5e-36    
ref|XP_005152296.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    153   6e-36    
gb|KFQ74234.1|  Protein arginine N-methyltransferase 7                  152   6e-36    
ref|XP_007198238.1|  PREDICTED: protein arginine N-methyltransfer...    153   7e-36    
gb|KFR01626.1|  Protein arginine N-methyltransferase 7                  153   7e-36    
ref|XP_007198235.1|  PREDICTED: protein arginine N-methyltransfer...    154   7e-36    
ref|XP_009571083.1|  PREDICTED: protein arginine N-methyltransfer...    153   7e-36    
ref|XP_005444644.1|  PREDICTED: protein arginine N-methyltransfer...    152   7e-36    
ref|XP_007902874.1|  PREDICTED: protein arginine N-methyltransfer...    153   7e-36    
ref|XP_008516459.1|  PREDICTED: protein arginine N-methyltransfer...    153   7e-36    
ref|XP_005233549.1|  PREDICTED: protein arginine N-methyltransfer...    152   8e-36    
ref|XP_004690271.1|  PREDICTED: protein arginine N-methyltransfer...    153   8e-36    
ref|XP_001496929.1|  PREDICTED: protein arginine N-methyltransfer...    153   9e-36    Equus caballus [domestic horse]
ref|XP_004015141.1|  PREDICTED: protein arginine N-methyltransfer...    152   1e-35    
ref|XP_005233548.1|  PREDICTED: protein arginine N-methyltransfer...    152   1e-35    
ref|XP_005444643.1|  PREDICTED: protein arginine N-methyltransfer...    152   1e-35    
gb|EJW83377.1|  protein arginine N-methyltransferase 7                  114   1e-35    
ref|XP_007477291.1|  PREDICTED: protein arginine N-methyltransfer...    152   1e-35    
ref|XP_010812776.1|  PREDICTED: protein arginine N-methyltransfer...    150   1e-35    
ref|XP_009814319.1|  PREDICTED: protein arginine N-methyltransfer...    152   2e-35    
ref|XP_004015140.1|  PREDICTED: protein arginine N-methyltransfer...    152   2e-35    
ref|XP_007477290.1|  PREDICTED: protein arginine N-methyltransfer...    152   2e-35    
ref|XP_008565333.1|  PREDICTED: protein arginine N-methyltransfer...    152   2e-35    
ref|XP_006047715.1|  PREDICTED: protein arginine N-methyltransfer...    152   2e-35    
ref|XP_001505676.1|  PREDICTED: protein arginine N-methyltransfer...    151   3e-35    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_005692235.1|  PREDICTED: protein arginine N-methyltransfer...    151   3e-35    
ref|XP_005896582.1|  PREDICTED: protein arginine N-methyltransfer...    151   3e-35    
ref|XP_007450007.1|  PREDICTED: protein arginine N-methyltransfer...    151   3e-35    
ref|XP_005592406.1|  PREDICTED: protein arginine N-methyltransfer...    152   3e-35    
ref|XP_006909857.1|  PREDICTED: protein arginine N-methyltransfer...    151   3e-35    
ref|XP_009275016.1|  PREDICTED: protein arginine N-methyltransfer...    151   3e-35    
ref|XP_010303550.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    151   3e-35    
ref|XP_009502869.1|  PREDICTED: protein arginine N-methyltransfer...    151   4e-35    
ref|XP_009676556.1|  PREDICTED: protein arginine N-methyltransfer...    150   4e-35    
ref|XP_010073991.1|  PREDICTED: protein arginine N-methyltransfer...    150   5e-35    
ref|NP_001005831.1|  protein arginine N-methyltransferase 7             150   5e-35    Gallus gallus [bantam]
ref|XP_009088893.1|  PREDICTED: protein arginine N-methyltransfer...    150   6e-35    
ref|XP_009949116.1|  PREDICTED: protein arginine N-methyltransfer...    150   6e-35    
ref|XP_005956910.1|  PREDICTED: protein arginine N-methyltransfer...    150   6e-35    
ref|XP_010849278.1|  PREDICTED: protein arginine N-methyltransfer...    150   7e-35    
tpg|DAA20070.1|  TPA: protein arginine N-methyltransferase 7            150   7e-35    
ref|XP_009676558.1|  PREDICTED: protein arginine N-methyltransfer...    150   7e-35    
ref|XP_009926628.1|  PREDICTED: protein arginine N-methyltransfer...    149   7e-35    
ref|XP_004600955.1|  PREDICTED: protein arginine N-methyltransfer...    150   7e-35    
gb|KFQ11527.1|  Protein arginine N-methyltransferase 7                  150   7e-35    
ref|XP_005218626.1|  PREDICTED: protein arginine N-methyltransfer...    150   7e-35    
ref|NP_001095460.1|  protein arginine N-methyltransferase 7             150   8e-35    Bos taurus [bovine]
ref|XP_009926627.1|  PREDICTED: protein arginine N-methyltransfer...    149   8e-35    
ref|XP_009088892.1|  PREDICTED: protein arginine N-methyltransfer...    150   8e-35    
ref|XP_005956909.1|  PREDICTED: protein arginine N-methyltransfer...    150   9e-35    
ref|XP_006156972.1|  PREDICTED: protein arginine N-methyltransfer...    150   9e-35    
ref|XP_004907125.1|  PREDICTED: protein arginine N-methyltransfer...    149   1e-34    
ref|XP_004661720.1|  PREDICTED: protein arginine N-methyltransfer...    149   1e-34    
ref|XP_010002727.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    149   1e-34    
ref|XP_004907124.1|  PREDICTED: protein arginine N-methyltransfer...    149   1e-34    
gb|KFO12222.1|  Protein arginine N-methyltransferase 7                  149   1e-34    
ref|XP_009926625.1|  PREDICTED: protein arginine N-methyltransfer...    149   1e-34    
ref|XP_006117632.1|  PREDICTED: protein arginine N-methyltransfer...    149   2e-34    
gb|KFO73380.1|  Protein arginine N-methyltransferase 7                  149   2e-34    
ref|XP_006117633.1|  PREDICTED: protein arginine N-methyltransfer...    148   2e-34    
ref|XP_004625893.1|  PREDICTED: protein arginine N-methyltransfer...    149   2e-34    
ref|XP_004907122.1|  PREDICTED: protein arginine N-methyltransfer...    149   2e-34    
ref|XP_006156974.1|  PREDICTED: protein arginine N-methyltransfer...    149   2e-34    
gb|EHB17053.1|  Protein arginine N-methyltransferase 7                  149   3e-34    
ref|XP_006117628.1|  PREDICTED: protein arginine N-methyltransfer...    149   3e-34    
gb|KFV44517.1|  Protein arginine N-methyltransferase 7                  148   3e-34    
ref|XP_005403642.1|  PREDICTED: protein arginine N-methyltransfer...    149   3e-34    
ref|XP_009319079.1|  PREDICTED: protein arginine N-methyltransfer...    148   3e-34    
ref|XP_008499504.1|  PREDICTED: protein arginine N-methyltransfer...    147   3e-34    
gb|KFM05829.1|  Protein arginine N-methyltransferase 7                  148   3e-34    
gb|KFW95770.1|  Protein arginine N-methyltransferase 7                  148   3e-34    
ref|XP_009700047.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    148   4e-34    
ref|XP_005403641.1|  PREDICTED: protein arginine N-methyltransfer...    148   4e-34    
ref|XP_008499503.1|  PREDICTED: protein arginine N-methyltransfer...    148   4e-34    
ref|XP_004584231.1|  PREDICTED: protein arginine N-methyltransfer...    148   4e-34    
ref|XP_005490847.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    148   4e-34    
ref|XP_004431821.1|  PREDICTED: protein arginine N-methyltransfer...    147   5e-34    
ref|XP_004431820.1|  PREDICTED: protein arginine N-methyltransfer...    147   5e-34    
ref|XP_004175038.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    147   8e-34    
ref|XP_008309829.1|  PREDICTED: protein arginine N-methyltransfer...    147   8e-34    
gb|KFP65839.1|  Protein arginine N-methyltransferase 7                  147   9e-34    
ref|XP_005876503.1|  PREDICTED: protein arginine N-methyltransfer...    147   9e-34    
gb|KFV08770.1|  Protein arginine N-methyltransferase 7                  147   9e-34    
ref|XP_008935704.1|  PREDICTED: protein arginine N-methyltransfer...    146   9e-34    
ref|XP_007113367.1|  PREDICTED: protein arginine N-methyltransfer...    147   9e-34    
ref|XP_006941726.1|  PREDICTED: protein arginine N-methyltransfer...    145   9e-34    
ref|XP_007517832.1|  PREDICTED: protein arginine N-methyltransfer...    147   1e-33    
ref|XP_006099530.1|  PREDICTED: protein arginine N-methyltransfer...    147   1e-33    
ref|XP_006941724.1|  PREDICTED: protein arginine N-methyltransfer...    146   1e-33    
ref|XP_005306363.1|  PREDICTED: protein arginine N-methyltransfer...    146   1e-33    
ref|XP_010148340.1|  PREDICTED: protein arginine N-methyltransfer...    145   1e-33    
ref|XP_005345478.1|  PREDICTED: protein arginine N-methyltransfer...    146   1e-33    
ref|XP_004459668.1|  PREDICTED: protein arginine N-methyltransfer...    146   2e-33    
ref|XP_005345479.1|  PREDICTED: protein arginine N-methyltransfer...    146   2e-33    
ref|XP_006986907.1|  PREDICTED: protein arginine N-methyltransfer...    146   2e-33    
ref|XP_010148339.1|  PREDICTED: protein arginine N-methyltransfer...    145   2e-33    
ref|XP_006941721.1|  PREDICTED: protein arginine N-methyltransfer...    146   2e-33    
ref|XP_006878948.1|  PREDICTED: protein arginine N-methyltransfer...    145   2e-33    
ref|XP_006941725.1|  PREDICTED: protein arginine N-methyltransfer...    145   2e-33    
ref|XP_003998233.1|  PREDICTED: protein arginine N-methyltransfer...    145   2e-33    
ref|XP_005526394.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    145   2e-33    
ref|XP_004459666.1|  PREDICTED: protein arginine N-methyltransfer...    146   2e-33    
ref|XP_006941723.1|  PREDICTED: protein arginine N-methyltransfer...    145   3e-33    
ref|XP_009555410.1|  PREDICTED: protein arginine N-methyltransfer...    145   3e-33    
ref|XP_006941715.1|  PREDICTED: protein arginine N-methyltransfer...    145   3e-33    
ref|XP_006941720.1|  PREDICTED: protein arginine N-methyltransfer...    145   3e-33    
ref|XP_006860390.1|  PREDICTED: protein arginine N-methyltransfer...    145   4e-33    
ref|XP_005076375.1|  PREDICTED: protein arginine N-methyltransfer...    144   4e-33    
gb|KFV83056.1|  Protein arginine N-methyltransferase 7                  145   5e-33    
gb|KFQ17996.1|  Protein arginine N-methyltransferase 7                  144   5e-33    
ref|XP_005422785.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    144   5e-33    
ref|XP_008965518.1|  PREDICTED: protein arginine N-methyltransfer...    145   5e-33    
gb|KFW64891.1|  Protein arginine N-methyltransferase 7                  144   6e-33    
ref|XP_006769812.1|  PREDICTED: protein arginine N-methyltransfer...    144   6e-33    
ref|XP_003472188.2|  PREDICTED: protein arginine N-methyltransfer...    144   6e-33    
gb|ELK25579.1|  Protein arginine N-methyltransferase 7                  144   6e-33    
ref|XP_005306366.1|  PREDICTED: protein arginine N-methyltransfer...    143   7e-33    
ref|XP_005306368.1|  PREDICTED: protein arginine N-methyltransfer...    143   7e-33    
ref|XP_005318408.1|  PREDICTED: protein arginine N-methyltransfer...    144   8e-33    
ref|XP_006203789.1|  PREDICTED: protein arginine N-methyltransfer...    144   8e-33    
ref|XP_005052612.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    144   8e-33    
ref|XP_010394922.1|  PREDICTED: protein arginine N-methyltransfer...    144   9e-33    
ref|XP_006203788.1|  PREDICTED: protein arginine N-methyltransfer...    144   9e-33    
ref|XP_005318407.1|  PREDICTED: protein arginine N-methyltransfer...    144   1e-32    
gb|ETE68476.1|  Protein arginine N-methyltransferase 7                  141   2e-32    
ref|NP_001014175.1|  protein arginine N-methyltransferase 7             143   2e-32    
ref|XP_008138358.1|  PREDICTED: protein arginine N-methyltransfer...    143   2e-32    
ref|XP_006180655.1|  PREDICTED: protein arginine N-methyltransfer...    142   2e-32    
ref|XP_004393400.1|  PREDICTED: protein arginine N-methyltransfer...    143   2e-32    
ref|XP_008636998.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    143   2e-32    
ref|XP_005306357.1|  PREDICTED: protein arginine N-methyltransfer...    143   2e-32    
ref|XP_006180654.1|  PREDICTED: protein arginine N-methyltransfer...    142   2e-32    
dbj|BAD32582.1|  mKIAA1933 protein                                      143   3e-32    
ref|NP_663379.1|  protein arginine N-methyltransferase 7                142   3e-32    
gb|AAH57177.1|  Protein arginine N-methyltransferase 7                  142   3e-32    
ref|XP_006641366.1|  PREDICTED: protein arginine N-methyltransfer...    142   3e-32    
ref|XP_010960823.1|  PREDICTED: protein arginine N-methyltransfer...    142   3e-32    
ref|XP_010960822.1|  PREDICTED: protein arginine N-methyltransfer...    142   4e-32    
ref|XP_007558673.1|  PREDICTED: protein arginine N-methyltransfer...    141   4e-32    
ref|XP_010977544.1|  PREDICTED: protein arginine N-methyltransfer...    142   4e-32    
ref|XP_010977543.1|  PREDICTED: protein arginine N-methyltransfer...    142   5e-32    
ref|XP_005796319.1|  PREDICTED: protein arginine N-methyltransfer...    142   5e-32    
ref|XP_002735081.2|  PREDICTED: protein arginine N-methyltransfer...    142   5e-32    
ref|XP_008700642.1|  PREDICTED: protein arginine N-methyltransfer...    141   5e-32    
gb|AAF00134.1|AF149806_1  hypothetical protein                          137   6e-32    
gb|KFO63117.1|  Protein arginine N-methyltransferase 7                  141   6e-32    
ref|XP_004371702.1|  PREDICTED: protein arginine N-methyltransfer...    141   7e-32    
ref|XP_008700641.1|  PREDICTED: protein arginine N-methyltransfer...    141   9e-32    
ref|XP_007938591.1|  PREDICTED: protein arginine N-methyltransfer...    141   1e-31    
ref|XP_007558560.1|  PREDICTED: protein arginine N-methyltransfer...    140   1e-31    
gb|EDL11357.1|  protein arginine N-methyltransferase 7, isoform C...    140   1e-31    
ref|XP_010747368.1|  PREDICTED: protein arginine N-methyltransfer...    140   1e-31    
ref|XP_010766163.1|  PREDICTED: protein arginine N-methyltransfer...    139   2e-31    
ref|NP_001017321.1|  protein arginine methyltransferase 7               140   2e-31    
emb|CDQ82797.1|  unnamed protein product                                140   2e-31    
ref|XP_010882375.1|  PREDICTED: protein arginine N-methyltransfer...    140   2e-31    
ref|XP_005928472.1|  PREDICTED: protein arginine N-methyltransfer...    139   3e-31    
ref|XP_004566180.1|  PREDICTED: protein arginine N-methyltransfer...    139   3e-31    
ref|XP_005620836.1|  PREDICTED: protein arginine N-methyltransfer...    138   4e-31    
ref|XP_008409998.1|  PREDICTED: protein arginine N-methyltransfer...    139   5e-31    
ref|XP_008409999.1|  PREDICTED: protein arginine N-methyltransfer...    139   5e-31    
ref|XP_003799476.1|  PREDICTED: protein arginine N-methyltransfer...    139   5e-31    
ref|XP_010960824.1|  PREDICTED: protein arginine N-methyltransfer...    139   5e-31    
ref|XP_536808.2|  PREDICTED: protein arginine N-methyltransferase...    139   6e-31    
ref|XP_004069855.1|  PREDICTED: protein arginine N-methyltransfer...    138   6e-31    
ref|XP_010977545.1|  PREDICTED: protein arginine N-methyltransfer...    138   8e-31    
ref|XP_007090409.1|  PREDICTED: protein arginine N-methyltransfer...    137   8e-31    
ref|NP_001080010.1|  protein arginine N-methyltransferase 7             138   8e-31    
gb|KDO61456.1|  hypothetical protein CISIN_1g0442452mg                  132   1e-30    
ref|XP_004801928.1|  PREDICTED: protein arginine N-methyltransfer...    137   1e-30    
ref|XP_004801926.1|  PREDICTED: protein arginine N-methyltransfer...    137   1e-30    
ref|XP_004744573.1|  PREDICTED: protein arginine N-methyltransfer...    137   1e-30    
ref|XP_004744575.1|  PREDICTED: protein arginine N-methyltransfer...    137   1e-30    
ref|XP_007090408.1|  PREDICTED: protein arginine N-methyltransfer...    137   1e-30    
gb|EFB25513.1|  hypothetical protein PANDA_012376                       137   1e-30    
ref|XP_002923256.1|  PREDICTED: protein arginine N-methyltransfer...    137   1e-30    
ref|XP_004744571.1|  PREDICTED: protein arginine N-methyltransfer...    137   2e-30    
ref|XP_004801924.1|  PREDICTED: protein arginine N-methyltransfer...    137   2e-30    
ref|XP_007090400.1|  PREDICTED: protein arginine N-methyltransfer...    137   2e-30    
ref|XP_007090406.1|  PREDICTED: protein arginine N-methyltransfer...    137   2e-30    
ref|XP_007090407.1|  PREDICTED: protein arginine N-methyltransfer...    136   2e-30    
gb|AAV52838.1|  protein arginine methyltransferase 7                    136   2e-30    
ref|XP_003417187.1|  PREDICTED: protein arginine N-methyltransfer...    137   2e-30    
ref|XP_005751263.1|  PREDICTED: protein arginine N-methyltransfer...    136   3e-30    
gb|AAV52837.1|  protein arginine methyltransferase 7 alpha              136   3e-30    
ref|XP_007643033.1|  PREDICTED: protein arginine N-methyltransfer...    136   3e-30    
ref|XP_007090404.1|  PREDICTED: protein arginine N-methyltransfer...    136   3e-30    
gb|ERE79775.1|  protein arginine N-methyltransferase 7-like isofo...    136   3e-30    
gb|ERE79776.1|  protein arginine N-methyltransferase 7-like isofo...    136   3e-30    
ref|XP_003504355.1|  PREDICTED: protein arginine N-methyltransfer...    136   4e-30    
gb|AAK20884.1|AF336043_1  arginine N-methyltransferase p82 isoform      136   4e-30    
ref|XP_003504356.1|  PREDICTED: protein arginine N-methyltransfer...    136   4e-30    
gb|AAH44492.1|  Prmt7 protein                                           136   4e-30    
sp|Q99MI9.3|ANM7_CRILO  RecName: Full=Protein arginine N-methyltr...    136   4e-30    
ref|NP_956797.2|  protein arginine N-methyltransferase 7                136   4e-30    
ref|XP_003967158.1|  PREDICTED: protein arginine N-methyltransfer...    135   5e-30    
ref|XP_008931667.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    135   6e-30    
ref|XP_005449357.1|  PREDICTED: protein arginine N-methyltransfer...    135   6e-30    
ref|XP_006721262.1|  PREDICTED: protein arginine N-methyltransfer...    133   1e-29    
ref|XP_007198236.1|  PREDICTED: protein arginine N-methyltransfer...    134   2e-29    
ref|XP_009926626.1|  PREDICTED: protein arginine N-methyltransfer...    133   3e-29    
ref|XP_002127943.1|  PREDICTED: protein arginine N-methyltransfer...    133   5e-29    
ref|XP_002611415.1|  hypothetical protein BRAFLDRAFT_63957              130   2e-28    
ref|XP_004907123.1|  PREDICTED: protein arginine N-methyltransfer...    130   4e-28    
ref|XP_004057916.1|  PREDICTED: protein arginine N-methyltransfer...    129   8e-28    
ref|XP_005103799.1|  PREDICTED: protein arginine N-methyltransfer...    129   1e-27    
ref|XP_005218627.1|  PREDICTED: protein arginine N-methyltransfer...    129   1e-27    
ref|XP_004273244.1|  PREDICTED: protein arginine N-methyltransfer...    127   2e-27    
emb|CAF98945.1|  unnamed protein product                                127   4e-27    
ref|XP_006941722.1|  PREDICTED: protein arginine N-methyltransfer...    127   5e-27    
ref|XP_007198237.1|  PREDICTED: protein arginine N-methyltransfer...    125   9e-27    
ref|XP_008565341.1|  PREDICTED: protein arginine N-methyltransfer...    125   1e-26    
ref|XP_008296200.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    125   1e-26    
ref|XP_005306364.1|  PREDICTED: protein arginine N-methyltransfer...    125   2e-26    
ref|XP_008516461.1|  PREDICTED: protein arginine N-methyltransfer...    124   2e-26    
ref|XP_010129861.1|  PREDICTED: protein arginine N-methyltransfer...    122   3e-26    
gb|KFO86918.1|  Protein arginine N-methyltransferase 7                  122   4e-26    
ref|XP_005178620.1|  PREDICTED: protein arginine N-methyltransfer...    124   5e-26    
ref|XP_005178621.1|  PREDICTED: protein arginine N-methyltransfer...    123   5e-26    
gb|KFZ52928.1|  Protein arginine N-methyltransferase 7                  120   1e-25    
ref|XP_004431822.1|  PREDICTED: protein arginine N-methyltransfer...    121   3e-25    
ref|XP_780353.2|  PREDICTED: protein arginine N-methyltransferase...    121   3e-25    
gb|ETL47599.1|  hypothetical protein L916_02672                         121   4e-25    
ref|XP_010394923.1|  PREDICTED: protein arginine N-methyltransfer...    120   4e-25    
ref|XP_005256048.1|  PREDICTED: protein arginine N-methyltransfer...    120   4e-25    
ref|XP_008900016.1|  hypothetical protein PPTG_07489                    120   4e-25    
ref|XP_007090405.1|  PREDICTED: protein arginine N-methyltransfer...    120   5e-25    
ref|XP_009050932.1|  hypothetical protein LOTGIDRAFT_213858             120   6e-25    
ref|XP_009481038.1|  PREDICTED: protein arginine N-methyltransfer...    115   8e-25    
gb|ELK14535.1|  Protein arginine N-methyltransferase 7                  119   1e-24    
ref|XP_009536099.1|  hypothetical protein PHYSODRAFT_527383             119   1e-24    
gb|KFO20018.1|  Protein arginine N-methyltransferase 7                  117   2e-24    
gb|ETP52157.1|  hypothetical protein F442_02793                         118   4e-24    
gb|ETM00686.1|  hypothetical protein L917_02615                         117   5e-24    
gb|ETO83092.1|  hypothetical protein F444_02823                         117   5e-24    
ref|XP_010610681.1|  PREDICTED: protein arginine N-methyltransfer...    115   5e-24    
ref|XP_008551526.1|  PREDICTED: protein arginine N-methyltransfer...    117   5e-24    
gb|ETI54360.1|  hypothetical protein F443_02811                         117   5e-24    
gb|ETK94206.1|  hypothetical protein L915_02699                         117   5e-24    
gb|ELT87312.1|  hypothetical protein CAPTEDRAFT_168548                  117   6e-24    
ref|XP_002906064.1|  arginine N-methyltransferase, putative             115   2e-23    
ref|XP_001604530.2|  PREDICTED: protein arginine N-methyltransfer...    115   2e-23    
ref|WP_036946328.1|  hypothetical protein                             71.2    2e-23    
gb|ETM53871.1|  hypothetical protein L914_02694                         115   4e-23    
gb|EZA46347.1|  Protein arginine N-methyltransferase                    114   5e-23    
gb|EFX82005.1|  hypothetical protein DAPPUDRAFT_188007                  114   5e-23    
gb|EFN66197.1|  Protein arginine N-methyltransferase 7                  112   9e-23    
ref|XP_004801927.1|  PREDICTED: protein arginine N-methyltransfer...    113   1e-22    
ref|XP_004744574.1|  PREDICTED: protein arginine N-methyltransfer...    113   1e-22    
gb|ELW50360.1|  Protein arginine N-methyltransferase 7                  112   2e-22    
gb|EFZ21437.1|  hypothetical protein SINV_09473                         112   3e-22    
ref|XP_003492977.1|  PREDICTED: protein arginine N-methyltransfer...    111   4e-22    
ref|XP_004801925.1|  PREDICTED: protein arginine N-methyltransfer...    110   6e-22    
ref|XP_004744572.1|  PREDICTED: protein arginine N-methyltransfer...    110   6e-22    
ref|XP_001662010.1|  protein arginine n-methyltransferase               110   6e-22    
ref|XP_003702009.1|  PREDICTED: protein arginine N-methyltransfer...    110   7e-22    
ref|XP_001864603.1|  arginine N-methyltransferase 7                     110   8e-22    
ref|XP_001653774.1|  protein arginine n-methyltransferase               109   9e-22    
ref|NP_611753.4|  arginine methyltransferase 7                          110   9e-22    
gb|ACI46519.1|  FI04436p                                                110   1e-21    
ref|XP_967203.1|  PREDICTED: protein arginine N-methyltransferase...    110   1e-21    
ref|XP_008193899.1|  PREDICTED: protein arginine N-methyltransfer...    109   1e-21    
ref|XP_011051541.1|  PREDICTED: protein arginine N-methyltransfer...    109   2e-21    
ref|XP_002092553.1|  GE11609                                            109   2e-21    
ref|XP_002082724.1|  GD25084                                            108   2e-21    
ref|XP_001960837.1|  GF11303                                            108   3e-21    
ref|XP_001902303.1|  Protein arginine N-methyltransferase               108   3e-21    
ref|XP_002040022.1|  GM15586                                            108   3e-21    
gb|AAM29595.1|  RH41322p                                                108   5e-21    
ref|XP_001976343.1|  GG20071                                            108   5e-21    
gb|EYC12572.1|  hypothetical protein Y032_0046g1305                     106   1e-20    
gb|EYC12571.1|  hypothetical protein Y032_0046g1305                     106   1e-20    
gb|AAO01020.1|  CG9882-PA                                               106   1e-20    
ref|XP_003396874.1|  PREDICTED: protein arginine N-methyltransfer...    106   1e-20    
ref|XP_002138277.1|  GA24672                                            105   2e-20    
gb|EYC12570.1|  hypothetical protein Y032_0046g1305                     105   2e-20    
gb|EYC12569.1|  hypothetical protein Y032_0046g1305                     105   3e-20    
ref|XP_006618967.1|  PREDICTED: protein arginine N-methyltransfer...    105   3e-20    
ref|XP_006618966.1|  PREDICTED: protein arginine N-methyltransfer...    105   3e-20    
ref|XP_003692942.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    105   3e-20    
ref|XP_006565517.1|  PREDICTED: protein arginine N-methyltransfer...    104   6e-20    
gb|EKC36858.1|  Protein arginine N-methyltransferase 7                  104   6e-20    
ref|XP_392453.3|  PREDICTED: protein arginine N-methyltransferase...    104   6e-20    
ref|WP_035792994.1|  hypothetical protein                             66.2    6e-20    
ref|XP_002049032.1|  GJ20986                                            103   1e-19    
ref|XP_003141461.1|  protein arginine N-methyltransferase               102   2e-19    
ref|XP_002015890.1|  GL11301                                            102   2e-19    
ref|XP_001995281.1|  GH23070                                            102   3e-19    
ref|XP_002062714.1|  GK19600                                            102   3e-19    
gb|KFB43933.1|  AGAP006938-PA-like protein                              102   3e-19    
emb|CCD82350.1|  putative protein arginine n-methyltransferase          102   3e-19    
gb|ETN66620.1|  arginine N-methyltransferase 7                          102   4e-19    
gb|EJD75486.1|  arginine N-methyltransferase 7                          102   4e-19    
gb|ACL53428.1|  unknown                                               97.8    5e-19    
ref|XP_002870147.1|  hypothetical protein ARALYDRAFT_355089           97.4    5e-19    
emb|CDS25667.1|  protein arginine N methyltransferase 7                 101   7e-19    
gb|KGB36427.1|  Protein arginine N-methyltransferase 7                  100   1e-18    
ref|XP_308819.4|  AGAP006938-PA                                         100   1e-18    
ref|XP_005768836.1|  hypothetical protein EMIHUDRAFT_210815             100   2e-18    
ref|XP_009832161.1|  hypothetical protein H257_08080                    100   2e-18    
ref|XP_004537933.1|  PREDICTED: protein arginine N-methyltransfer...  99.8    2e-18    



>ref|XP_006366741.1| PREDICTED: protein arginine N-methyltransferase 1.6-like isoform 
X1 [Solanum tuberosum]
Length=738

 Score =   525 bits (1352),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 245/366 (67%), Positives = 298/366 (81%), Gaps = 3/366 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR T++GQL+ES  LWK+HDL+N E+
Sbjct  185   VSEILDSELLGEGLIPTLQHAHDQLLVDNPKTVPYRATVYGQLIESTGLWKLHDLYNTEK  244

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D I LVP+GMD+ +CVK QQF MHCDA+ E IKLLSEPFK+FDFDFW+RPDS R  E
Sbjct  245   EVLDEIRLVPEGMDSALCVKRQQFSMHCDALEEDIKLLSEPFKVFDFDFWRRPDSHRVME  304

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVK--DPSLSCSEAWCDHW  1209
             L ++AT  GT HAIISWWLLQLD +GT+FYST PKWI CPS ++  + S+S S+ WCDHW
Sbjct  305   LNVQATNTGTVHAIISWWLLQLDEKGTIFYSTAPKWISCPSSMEGFNSSISWSQNWCDHW  364

Query  1210  KQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSP  1389
             KQCVWFIP  GLS+ KDE V L AVHTD ++SY +KT SQN+E+ Q +LSAQ CQ+ L P
Sbjct  365   KQCVWFIPKKGLSLLKDEEVSLLAVHTDTSISYEMKTLSQNLELGQSELSAQKCQITLLP  424

Query  1390  ERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGL  1569
             E+IA+Y D NWRCSMLKAI NA+KQK   LC+V DDSIFL +AL H A+ S+V+SLFPGL
Sbjct  425   EKIALYSDVNWRCSMLKAIKNAMKQKTPSLCVVVDDSIFLAVALAHLAKGSHVLSLFPGL  484

Query  1570  QDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPW  1749
             Q+KG QYLQAVAA+N YS D ++V +K S  LT Q +  +++DLL+ EPFYYG++SVLPW
Sbjct  485   QEKGAQYLQAVAAANGYSKDHVEV-QKMSELLTSQSSQEKQIDLLVGEPFYYGNNSVLPW  543

Query  1750  QNLRFW  1767
             QNLRFW
Sbjct  544   QNLRFW  549


 Score =   220 bits (561),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 133/177 (75%), Gaps = 9/177 (5%)
 Frame = +2

Query  20   MLSLFCKTLNPTF---PLRVTSSHSFSLPRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWV  190
            M  LF KTLNP F   P   T S +F++   +        SGSRMFQLK+DPLTGNSEWV
Sbjct  1    MQCLFPKTLNPQFFLRPFNTTRSKAFTVRSMSSG------SGSRMFQLKVDPLTGNSEWV  54

Query  191  VIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSM  370
            VIEE +        LLA TSYLDMLND+ RN+A+REAIDKT+TKPCHVLDIGAGTGLLSM
Sbjct  55   VIEEDEASGDATKQLLANTSYLDMLNDTRRNKAYREAIDKTITKPCHVLDIGAGTGLLSM  114

Query  371  MAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            MAA+AM   DS  +S SKGMVTACESYLPMVKLMRKVL ANG++R IRIINKRS  L
Sbjct  115  MAAQAMDNGDSVESSGSKGMVTACESYLPMVKLMRKVLHANGMQRKIRIINKRSDEL  171



>ref|XP_006366742.1| PREDICTED: protein arginine N-methyltransferase 1.6-like isoform 
X2 [Solanum tuberosum]
Length=737

 Score =   521 bits (1341),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 246/366 (67%), Positives = 297/366 (81%), Gaps = 4/366 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR T++GQL+ES  LWK+HDL+N E+
Sbjct  185   VSEILDSELLGEGLIPTLQHAHDQLLVDNPKTVPYRATVYGQLIESTGLWKLHDLYNTEK  244

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D I LVP+GMD+ +CVK QQF MHCDA+ E IKLLSEPFK+FDFDFW+RPDS R  E
Sbjct  245   EVLDEIRLVPEGMDSALCVKRQQFSMHCDALEEDIKLLSEPFKVFDFDFWRRPDSHRVME  304

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVK--DPSLSCSEAWCDHW  1209
             L ++AT  GT HAIISWWLLQLD +GT+FYST PKWI CPS ++  + S+S S+ WCDHW
Sbjct  305   LNVQATNTGTVHAIISWWLLQLDEKGTIFYSTAPKWISCPSSMEGFNSSISWSQNWCDHW  364

Query  1210  KQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSP  1389
             KQCVWFIP  GLS+ KDE V L AVHTD ++SY +KT SQN+E+ Q +LSAQ CQ+ L P
Sbjct  365   KQCVWFIPKKGLSLLKDEEVSLLAVHTDTSISYEMKTLSQNLELGQSELSAQKCQITLLP  424

Query  1390  ERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGL  1569
             E+IA+Y D NWRCSMLKAI NA+KQK   LC+V DDSIFL +AL H A+ S+V+SLFPGL
Sbjct  425   EKIALYSDVNWRCSMLKAIKNAMKQKTPSLCVVVDDSIFLAVALAHLAKGSHVLSLFPGL  484

Query  1570  QDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPW  1749
             Q+KG QYLQAVAA+N YS D ++V +K S  LT Q +   K+DLL+ EPFYYG++SVLPW
Sbjct  485   QEKGAQYLQAVAAANGYSKDHVEV-QKMSELLTSQSS-QEKIDLLVGEPFYYGNNSVLPW  542

Query  1750  QNLRFW  1767
             QNLRFW
Sbjct  543   QNLRFW  548


 Score =   220 bits (561),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 133/177 (75%), Gaps = 9/177 (5%)
 Frame = +2

Query  20   MLSLFCKTLNPTF---PLRVTSSHSFSLPRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWV  190
            M  LF KTLNP F   P   T S +F++   +        SGSRMFQLK+DPLTGNSEWV
Sbjct  1    MQCLFPKTLNPQFFLRPFNTTRSKAFTVRSMSSG------SGSRMFQLKVDPLTGNSEWV  54

Query  191  VIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSM  370
            VIEE +        LLA TSYLDMLND+ RN+A+REAIDKT+TKPCHVLDIGAGTGLLSM
Sbjct  55   VIEEDEASGDATKQLLANTSYLDMLNDTRRNKAYREAIDKTITKPCHVLDIGAGTGLLSM  114

Query  371  MAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            MAA+AM   DS  +S SKGMVTACESYLPMVKLMRKVL ANG++R IRIINKRS  L
Sbjct  115  MAAQAMDNGDSVESSGSKGMVTACESYLPMVKLMRKVLHANGMQRKIRIINKRSDEL  171



>ref|XP_010322901.1| PREDICTED: protein arginine N-methyltransferase 1.6 isoform X3 
[Solanum lycopersicum]
Length=736

 Score =   517 bits (1331),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 242/366 (66%), Positives = 296/366 (81%), Gaps = 3/366 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR T++GQLVES DLWK+HDL+N E+
Sbjct  183   VSEILDSELLGEGLIPTLQHAHDQLLVDNPKTVPYRATVYGQLVESTDLWKLHDLYNTEK  242

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D I LVP+GMD+ +CVK QQF MHCDA+ E IKLLSEPFK+FDFDFW+RPDS R T+
Sbjct  243   EVLDEICLVPEGMDSALCVKRQQFSMHCDALEEDIKLLSEPFKVFDFDFWRRPDSHRVTK  302

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVK--DPSLSCSEAWCDHW  1209
             L ++AT  G  HA+ISWWLLQLD +GT+FYST PKWI CPS V+  + S+S S+ WCDHW
Sbjct  303   LSVQATDTGAVHAVISWWLLQLDEKGTIFYSTAPKWISCPSSVEGFNSSISWSQNWCDHW  362

Query  1210  KQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSP  1389
             KQCVWFIP  GLS+ KDE V L AVHTD ++SY +KT SQN+E+ Q ++SAQ  Q+ L P
Sbjct  363   KQCVWFIPKKGLSLLKDEEVSLLAVHTDTSISYEMKTLSQNLELEQSEVSAQKYQITLLP  422

Query  1390  ERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGL  1569
             E+IA+Y D NWRCSMLKAI NA+KQK   LC+V DDSIFL +AL H A+ S+V+SLFPGL
Sbjct  423   EKIALYSDVNWRCSMLKAIKNAMKQKTPSLCVVVDDSIFLAVALAHLAKGSHVLSLFPGL  482

Query  1570  QDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPW  1749
             Q+KG  YLQAVA +N YS D ++V +K S  LT Q +  +++DLL+ EPFYYG++SVLPW
Sbjct  483   QEKGALYLQAVATANGYSKDHVEV-QKMSELLTSQSSQEKQIDLLVGEPFYYGNNSVLPW  541

Query  1750  QNLRFW  1767
             QNLRFW
Sbjct  542   QNLRFW  547


 Score =   246 bits (628),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIE  199
            M  LF KTLNP F LR     SF+  RS    VR+MSSGSRMFQLK+DPLTGNSEWVVIE
Sbjct  1    MQCLFPKTLNPQFFLR-----SFNNTRSKAFTVRSMSSGSRMFQLKVDPLTGNSEWVVIE  55

Query  200  ESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAA  379
            E +        LLA TSYLDMLND+ RN+A+REAIDKT+TKPCHVLDIGAGTGLLSMMAA
Sbjct  56   EDEASGDATKQLLANTSYLDMLNDTRRNKAYREAIDKTITKPCHVLDIGAGTGLLSMMAA  115

Query  380  RAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            RAM   DS  +S SKGMVTACESYLPMVKLMRKVL ANG++R IRIINKRS  L
Sbjct  116  RAMDLGDSVESSGSKGMVTACESYLPMVKLMRKVLHANGMQRKIRIINKRSDEL  169



>ref|XP_010322903.1| PREDICTED: protein arginine N-methyltransferase 1.6 isoform X5 
[Solanum lycopersicum]
Length=735

 Score =   513 bits (1320),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 243/366 (66%), Positives = 295/366 (81%), Gaps = 4/366 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR T++GQLVES DLWK+HDL+N E+
Sbjct  183   VSEILDSELLGEGLIPTLQHAHDQLLVDNPKTVPYRATVYGQLVESTDLWKLHDLYNTEK  242

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D I LVP+GMD+ +CVK QQF MHCDA+ E IKLLSEPFK+FDFDFW+RPDS R T+
Sbjct  243   EVLDEICLVPEGMDSALCVKRQQFSMHCDALEEDIKLLSEPFKVFDFDFWRRPDSHRVTK  302

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVK--DPSLSCSEAWCDHW  1209
             L ++AT  G  HA+ISWWLLQLD +GT+FYST PKWI CPS V+  + S+S S+ WCDHW
Sbjct  303   LSVQATDTGAVHAVISWWLLQLDEKGTIFYSTAPKWISCPSSVEGFNSSISWSQNWCDHW  362

Query  1210  KQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSP  1389
             KQCVWFIP  GLS+ KDE V L AVHTD ++SY +KT SQN+E+ Q ++SAQ  Q+ L P
Sbjct  363   KQCVWFIPKKGLSLLKDEEVSLLAVHTDTSISYEMKTLSQNLELEQSEVSAQKYQITLLP  422

Query  1390  ERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGL  1569
             E+IA+Y D NWRCSMLKAI NA+KQK   LC+V DDSIFL +AL H A+ S+V+SLFPGL
Sbjct  423   EKIALYSDVNWRCSMLKAIKNAMKQKTPSLCVVVDDSIFLAVALAHLAKGSHVLSLFPGL  482

Query  1570  QDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPW  1749
             Q+KG  YLQAVA +N YS D ++V +K S  LT Q +   K+DLL+ EPFYYG++SVLPW
Sbjct  483   QEKGALYLQAVATANGYSKDHVEV-QKMSELLTSQSS-QEKIDLLVGEPFYYGNNSVLPW  540

Query  1750  QNLRFW  1767
             QNLRFW
Sbjct  541   QNLRFW  546


 Score =   246 bits (628),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIE  199
            M  LF KTLNP F LR     SF+  RS    VR+MSSGSRMFQLK+DPLTGNSEWVVIE
Sbjct  1    MQCLFPKTLNPQFFLR-----SFNNTRSKAFTVRSMSSGSRMFQLKVDPLTGNSEWVVIE  55

Query  200  ESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAA  379
            E +        LLA TSYLDMLND+ RN+A+REAIDKT+TKPCHVLDIGAGTGLLSMMAA
Sbjct  56   EDEASGDATKQLLANTSYLDMLNDTRRNKAYREAIDKTITKPCHVLDIGAGTGLLSMMAA  115

Query  380  RAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            RAM   DS  +S SKGMVTACESYLPMVKLMRKVL ANG++R IRIINKRS  L
Sbjct  116  RAMDLGDSVESSGSKGMVTACESYLPMVKLMRKVLHANGMQRKIRIINKRSDEL  169



>ref|XP_009800535.1| PREDICTED: protein arginine N-methyltransferase 1.6 [Nicotiana 
sylvestris]
Length=746

 Score =   505 bits (1301),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 244/366 (67%), Positives = 293/366 (80%), Gaps = 5/366 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHDNLL ++P+TVPYR TI+GQ+VES DLWK+HDLFNNE+
Sbjct  193   VSEILDSELLGEGLIPTLQHAHDNLLSDNPKTVPYRATIYGQMVESTDLWKLHDLFNNEK  252

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
                D I LVP  MDT + VK QQF MHCDA+ +GIKLLSE FK+FDFDFW+RP+S RETE
Sbjct  253   GVLDEIRLVPDKMDTALYVKRQQFSMHCDAL-KGIKLLSETFKVFDFDFWRRPESHRETE  311

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVK--DPSLSCSEAWCDHW  1209
             L +KAT  GT HAIISWWLLQLD  GTVFYST PKWI CPS V+  + S+S  + WCDHW
Sbjct  312   LSVKATDTGTIHAIISWWLLQLDETGTVFYSTAPKWISCPSSVEGLNSSISRCQNWCDHW  371

Query  1210  KQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSP  1389
             KQCVWFIP  GLS+ KDE V+L AVHTD ++SY VKT SQN+++ + +LS Q  Q+ L P
Sbjct  372   KQCVWFIPKKGLSLLKDEEVNLLAVHTDTSISYEVKTLSQNLKLGRSELSTQKYQITLPP  431

Query  1390  ERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGL  1569
             E+IA+Y D +WRCSML AI NA+KQK   LC+V DDS+FL +AL H A+ S+V+SLFPG 
Sbjct  432   EKIALYSDVSWRCSMLNAIKNAVKQKMPSLCVVVDDSLFLAVALAHLAKGSHVLSLFPGF  491

Query  1570  QDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPW  1749
             Q+KG QYLQAVA+SN YS D ++V +K S  LT Q +  RK+DL++ EPFYYG++SVLPW
Sbjct  492   QEKGAQYLQAVASSNSYSKDHVEV-QKMSELLTSQSS-RRKIDLIVGEPFYYGNNSVLPW  549

Query  1750  QNLRFW  1767
             QNLRFW
Sbjct  550   QNLRFW  555


 Score =   235 bits (599),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 137/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIE  199
            M  LF KTLN  F  R  ++   S PRS    VR+MSS SRMFQLK+DPLTGNSEWVVIE
Sbjct  6    MQCLFPKTLNHKFFFRSFNNIPKS-PRSKAFTVRSMSSASRMFQLKVDPLTGNSEWVVIE  64

Query  200  ESDTPEQTPTP-LLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMA  376
            E +    + T  LLA TSYLDMLND+ RN A+REAIDKT+TKPCHVLDIGAGTGLLSMMA
Sbjct  65   EDEASGDSNTQQLLANTSYLDMLNDTRRNEAYREAIDKTITKPCHVLDIGAGTGLLSMMA  124

Query  377  ARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            ARAMG  DS  +S SKG+VTACESYLPMVKLMRKVL ANG++R IRIINKRS  L
Sbjct  125  ARAMGHGDSVESSGSKGIVTACESYLPMVKLMRKVLHANGMQRKIRIINKRSDEL  179



>ref|XP_009621715.1| PREDICTED: protein arginine N-methyltransferase 1.6 [Nicotiana 
tomentosiformis]
Length=740

 Score =   502 bits (1292),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 240/366 (66%), Positives = 292/366 (80%), Gaps = 5/366 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHDNLL ++P+TVPYR TI+GQ+VES DLWK+HDLFNNE+
Sbjct  187   VSEILDSELLGEGLIPTLQHAHDNLLSDNPKTVPYRATIYGQMVESSDLWKLHDLFNNEK  246

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
                D I LVP  MDT +CVK QQF MHCDA+ + IKLLSEPFK+FDFDFW+RP+S RETE
Sbjct  247   GVLDEIRLVPDEMDTALCVKRQQFSMHCDALKD-IKLLSEPFKVFDFDFWRRPESHRETE  305

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVK--DPSLSCSEAWCDHW  1209
             + +KAT  GT HAIISWWLLQLD  GTVFYST PKWI CPS V+  + S+S  + WCDHW
Sbjct  306   MSVKATDTGTIHAIISWWLLQLDETGTVFYSTAPKWISCPSCVEGLNSSISRCQNWCDHW  365

Query  1210  KQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSP  1389
             KQCVWFIP  GLS+ KDE V+L AVHTD ++SY +KT SQN+++ + +LS Q  Q+ L P
Sbjct  366   KQCVWFIPKKGLSLLKDEEVNLLAVHTDTSISYEMKTLSQNLKLGRSELSTQKYQITLPP  425

Query  1390  ERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGL  1569
             E+IA+Y D +WRCS+L AI NA+KQK   LC+V DDS+FL +AL H A+ S+V+SLFPG 
Sbjct  426   EKIALYSDVSWRCSILNAIKNAMKQKLPSLCVVVDDSLFLAVALAHLAKGSHVLSLFPGF  485

Query  1570  QDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPW  1749
             Q+KG QYLQAVA SN Y  D ++V +K S  LT Q +  RK+D+++ EPFYYG++SVLPW
Sbjct  486   QEKGAQYLQAVATSNGYLKDHVEV-QKMSELLTSQSS-RRKIDMIVGEPFYYGNNSVLPW  543

Query  1750  QNLRFW  1767
             QNLRFW
Sbjct  544   QNLRFW  549


 Score =   236 bits (601),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 139/175 (79%), Gaps = 3/175 (2%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIE  199
            M  LF KTLNP   L  +S ++    RS    VR+MSSGSRMFQLK+DPLTGNSEWV+IE
Sbjct  1    MQCLFPKTLNP--KLFFSSFNNIPKSRSKAFTVRSMSSGSRMFQLKVDPLTGNSEWVIIE  58

Query  200  ESDTPEQTPTP-LLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMA  376
            E +    + T  LLA TSYLDMLND+ RN+A+REAIDKT+TKPCHVLDIGAGTGLLSMMA
Sbjct  59   EDEASGDSNTKQLLANTSYLDMLNDTRRNKAYREAIDKTITKPCHVLDIGAGTGLLSMMA  118

Query  377  ARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            ARAMG  DS  +S SKG+VTACESYLPMVKLMRKVL ANG++R IRI+NKRS  L
Sbjct  119  ARAMGHGDSVESSGSKGIVTACESYLPMVKLMRKVLHANGMQRKIRILNKRSDEL  173



>ref|XP_007210286.1| hypothetical protein PRUPE_ppa002907mg [Prunus persica]
 gb|EMJ11485.1| hypothetical protein PRUPE_ppa002907mg [Prunus persica]
Length=622

 Score =   496 bits (1277),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 233/364 (64%), Positives = 278/364 (76%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+L+HAHD LLVE+ ETVPY+ T +GQLVES  LWK+HDL  NE 
Sbjct  153   VSEILDSELLGEGLIPSLKHAHDMLLVENSETVPYKATTYGQLVESTFLWKLHDLHGNEA  212

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KASD I LVP G+D I+ VK QQ+  HCDAI + +KLLSEPFKIF+FDFWKRPDS  ETE
Sbjct  213   KASDGILLVPTGLDNILGVKPQQYAFHCDAIGKEVKLLSEPFKIFEFDFWKRPDSHGETE  272

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + +KAT  G  HA+ISWW+LQLDREGT+FYST P+WI  P +           WCDHWKQ
Sbjct  273   VHVKATNDGRVHAVISWWILQLDREGTIFYSTAPRWISLPGNTSHGD------WCDHWKQ  326

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G+S+ KDE V LHAVHTDI++SY +K Q+   E+ QY     D +L L PER
Sbjct  327   CVWFVPGEGMSITKDEEVCLHAVHTDISISYNLKNQASRNEIMQYGFKNGDFKLILPPER  386

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IAIYGD  WR +M  AI+N+L+ +  PLCIVADDSIFLT+ + H ++ S+V+S FPGLQD
Sbjct  387   IAIYGDSEWRHTMFSAISNSLQGRVDPLCIVADDSIFLTLLVAHLSKTSHVMSFFPGLQD  446

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG QYLQAVA SN +SMD ++ L KR + LTM DTH +KVDLLI EPFYYG D +LPWQN
Sbjct  447   KGFQYLQAVANSNGFSMDRVEFLNKRKTKLTMHDTHQKKVDLLIGEPFYYGMDGMLPWQN  506

Query  1756  LRFW  1767
             LRFW
Sbjct  507   LRFW  510


 Score =   189 bits (481),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 111/143 (78%), Gaps = 12/143 (8%)
 Frame = +2

Query  128  SSGSRMFQLKLDPLTGNSEWVVIEESDTPEQT-----PTPLLATTSYLDMLNDSPRNRAF  292
             S  R FQL+++P+TGNSEWVVIEE +  EQT        LLATTSYLDMLNDS RNRAF
Sbjct  4    QSAQRAFQLRVNPITGNSEWVVIEEDEPEEQTFNGGSQNALLATTSYLDMLNDSHRNRAF  63

Query  293  REAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLM  472
            REAIDKT++ PCHVLDIG+GTGLLSMMAARAMG       S +  MVTACESYLPMVKLM
Sbjct  64   REAIDKTISTPCHVLDIGSGTGLLSMMAARAMG-------SMTCRMVTACESYLPMVKLM  116

Query  473  RKVLRANGIERGIRIINKRSKIL  541
            +KV+R NG+E  I++INKRS  L
Sbjct  117  KKVVRLNGMENQIKLINKRSDEL  139



>ref|XP_008238521.1| PREDICTED: protein arginine N-methyltransferase 1.6 [Prunus mume]
Length=724

 Score =   499 bits (1285),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 234/364 (64%), Positives = 279/364 (77%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+LQHAHD LLVE+PETVPY+ T +GQLVES  LWK+HDL  NE 
Sbjct  177   VSEILDSELLGEGLIPSLQHAHDMLLVENPETVPYKATTYGQLVESTFLWKLHDLHGNEA  236

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KASD I LVP G+D I+ VK QQ+  HCDAI + +KLLSEPFKIF+FDFWKRPDS  ETE
Sbjct  237   KASDGILLVPTGLDNILGVKPQQYAFHCDAIGKEVKLLSEPFKIFEFDFWKRPDSHGETE  296

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + +K+T  G  HA+ISWW+LQLDREGT+FYST P+WI  P +           WCDHWKQ
Sbjct  297   VHVKSTNDGRVHAVISWWILQLDREGTIFYSTAPRWISLPGNTSHGD------WCDHWKQ  350

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G+S+ KDE V LHAVHTDI++SY +K Q+   E+ QY     D +L L PER
Sbjct  351   CVWFVPGEGMSITKDEEVCLHAVHTDISISYNLKNQASRNEIMQYGFKNGDFKLILPPER  410

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IAIYGD  WR +M  AI+N+L+ +  PLCIVADDSIFLT+ + H ++ S+V+S FPGLQD
Sbjct  411   IAIYGDSEWRHTMFSAISNSLQGRVDPLCIVADDSIFLTLLVAHLSKTSHVMSFFPGLQD  470

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG QYLQAVA SN +SMD ++ L KR + LTM DTH +KVDLLI EPFYYG D +LPWQN
Sbjct  471   KGFQYLQAVANSNGFSMDRVEFLNKRKTKLTMHDTHQKKVDLLIGEPFYYGMDGMLPWQN  530

Query  1756  LRFW  1767
             LRFW
Sbjct  531   LRFW  534


 Score =   192 bits (488),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 125/179 (70%), Gaps = 21/179 (12%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIE  199
            MLS   KTL P  PL         + R  R +  +  S  R FQL+++P+TGNSEWVVIE
Sbjct  1    MLSRVSKTLFPKLPL-------CCILRFARAM--SSQSAQRAFQLRVNPITGNSEWVVIE  51

Query  200  ESDTPEQT-----PTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLL  364
            E +  EQT        LLATTSYLDMLNDS RNRAFREAIDKT++ PCHVLDIG+GTGLL
Sbjct  52   EDEPEEQTFNGGSQNSLLATTSYLDMLNDSHRNRAFREAIDKTISTPCHVLDIGSGTGLL  111

Query  365  SMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            SMMAARAMG       S +  MVTACESYLPMVKLM+KV+R NG+E  I++INKRS  L
Sbjct  112  SMMAARAMG-------SMTCRMVTACESYLPMVKLMKKVVRLNGMENQIKLINKRSDEL  163



>ref|XP_006838157.1| hypothetical protein AMTR_s00106p00104330 [Amborella trichopoda]
 gb|ERN00726.1| hypothetical protein AMTR_s00106p00104330 [Amborella trichopoda]
Length=758

 Score =   432 bits (1112),  Expect(2) = 2e-163, Method: Compositional matrix adjust.
 Identities = 212/373 (57%), Positives = 260/373 (70%), Gaps = 3/373 (1%)
 Frame = +1

Query  658   LNFNNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHD  837
             L  N  VSEILDSELLGEGLIPTLQHAHD LL  +P+TVPYR TI+GQLVE   L KMHD
Sbjct  147   LRANILVSEILDSELLGEGLIPTLQHAHDTLLTSNPQTVPYRATIYGQLVECAFLHKMHD  206

Query  838   LFNNEEKASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPD  1017
             L++NE  ASD IHLVP G++T I VK QQ+P HC  +S+ IK LSEP+KIF FDFW+RPD
Sbjct  207   LYSNEALASDDIHLVPTGLETAIYVKPQQYPFHCSPLSKDIKALSEPYKIFTFDFWRRPD  266

Query  1018  SSRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKD--PSLSCSE  1191
             S  E E+ IK    G  HA+ISWW+LQLD +GT+FYST P WI+   D  +       + 
Sbjct  267   SYAENEVKIKVNCDGNVHAVISWWVLQLDSDGTIFYSTAPSWINSSCDNPEVLRGFPGAS  326

Query  1192  AWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQYKLSAQD  1368
              WCDHWKQCVW  P +G+ V K+E V + A+H   +  Y + K    + E+       +D
Sbjct  327   DWCDHWKQCVWVCPRMGMPVSKNEQVLIQAIHEKTSFRYNLRKISVPSKELGPCNFHIRD  386

Query  1369  CQLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNV  1548
               L LSPERIAIYGD++WR SML     AL++K SPLC+VADDS+F TI     + +SNV
Sbjct  387   NSLVLSPERIAIYGDQDWRLSMLTTATKALQKKNSPLCVVADDSVFWTILTASLSTSSNV  446

Query  1549  ISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYG  1728
             +S+ PGL  KG QYL AVA +N   +D +KVL KR+S+LTM DT  RKVDLL+AEPFY G
Sbjct  447   LSMLPGLHMKGSQYLHAVAKANGIDIDRVKVLGKRASSLTMDDTDQRKVDLLVAEPFYNG  506

Query  1729  SDSVLPWQNLRFW  1767
             ++  LPWQNLRFW
Sbjct  507   NEGSLPWQNLRFW  519


 Score =   173 bits (439),  Expect(2) = 2e-163, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (80%), Gaps = 1/134 (1%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            R+FQLK+DPL+GN E  V+      E+ P  LL++TSYLDMLNDS RNRAF EAI KT+T
Sbjct  7    RVFQLKMDPLSGNIE-WVVVSEAEEEEEPKSLLSSTSYLDMLNDSRRNRAFHEAIKKTIT  65

Query  320  KPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGI  499
            +PCHVLDIGAGTGLLSMMA++AM   D +  S + GMVTACE+YLPMVKLM+KVLRANG+
Sbjct  66   RPCHVLDIGAGTGLLSMMASKAMHELDKSEFSSTHGMVTACEAYLPMVKLMKKVLRANGM  125

Query  500  ERGIRIINKRSKIL  541
            E  IR+I+KRS  L
Sbjct  126  ENQIRVIHKRSDEL  139



>ref|XP_010322899.1| PREDICTED: protein arginine N-methyltransferase 1.6 isoform X1 
[Solanum lycopersicum]
Length=769

 Score =   499 bits (1286),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 242/399 (61%), Positives = 296/399 (74%), Gaps = 36/399 (9%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQ------------------  801
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR T++GQ                  
Sbjct  183   VSEILDSELLGEGLIPTLQHAHDQLLVDNPKTVPYRATVYGQVFDHGFIFKYSFADSHWV  242

Query  802   ---------------LVESKDLWKMHDLFNNEEKASDTIHLVPKGMDTIICVKHQQFPMH  936
                            LVES DLWK+HDL+N E++  D I LVP+GMD+ +CVK QQF MH
Sbjct  243   PFGYKAVIFPQLTFQLVESTDLWKLHDLYNTEKEVLDEICLVPEGMDSALCVKRQQFSMH  302

Query  937   CDAISEGIKLLSEPFKIFDFDFWKRPDSSRETELLIKATKGGTAHAIISWWLLQLDREGT  1116
             CDA+ E IKLLSEPFK+FDFDFW+RPDS R T+L ++AT  G  HA+ISWWLLQLD +GT
Sbjct  303   CDALEEDIKLLSEPFKVFDFDFWRRPDSHRVTKLSVQATDTGAVHAVISWWLLQLDEKGT  362

Query  1117  VFYSTGPKWIHCPSDVK--DPSLSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHT  1290
             +FYST PKWI CPS V+  + S+S S+ WCDHWKQCVWFIP  GLS+ KDE V L AVHT
Sbjct  363   IFYSTAPKWISCPSSVEGFNSSISWSQNWCDHWKQCVWFIPKKGLSLLKDEEVSLLAVHT  422

Query  1291  DINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPERIAIYGDKNWRCSMLKAINNALKQKA  1470
             D ++SY +KT SQN+E+ Q ++SAQ  Q+ L PE+IA+Y D NWRCSMLKAI NA+KQK 
Sbjct  423   DTSISYEMKTLSQNLELEQSEVSAQKYQITLLPEKIALYSDVNWRCSMLKAIKNAMKQKT  482

Query  1471  SPLCIVADDSIFLTIALGHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKK  1650
               LC+V DDSIFL +AL H A+ S+V+SLFPGLQ+KG  YLQAVA +N YS D ++V +K
Sbjct  483   PSLCVVVDDSIFLAVALAHLAKGSHVLSLFPGLQEKGALYLQAVATANGYSKDHVEV-QK  541

Query  1651  RSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQNLRFW  1767
              S  LT Q +  +++DLL+ EPFYYG++SVLPWQNLRFW
Sbjct  542   MSELLTSQSSQEKQIDLLVGEPFYYGNNSVLPWQNLRFW  580


 Score =   246 bits (629),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIE  199
            M  LF KTLNP F LR     SF+  RS    VR+MSSGSRMFQLK+DPLTGNSEWVVIE
Sbjct  1    MQCLFPKTLNPQFFLR-----SFNNTRSKAFTVRSMSSGSRMFQLKVDPLTGNSEWVVIE  55

Query  200  ESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAA  379
            E +        LLA TSYLDMLND+ RN+A+REAIDKT+TKPCHVLDIGAGTGLLSMMAA
Sbjct  56   EDEASGDATKQLLANTSYLDMLNDTRRNKAYREAIDKTITKPCHVLDIGAGTGLLSMMAA  115

Query  380  RAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            RAM   DS  +S SKGMVTACESYLPMVKLMRKVL ANG++R IRIINKRS  L
Sbjct  116  RAMDLGDSVESSGSKGMVTACESYLPMVKLMRKVLHANGMQRKIRIINKRSDEL  169



>ref|XP_011081252.1| PREDICTED: protein arginine N-methyltransferase 1.6 isoform X2 
[Sesamum indicum]
Length=748

 Score =   498 bits (1281),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 234/366 (64%), Positives = 280/366 (77%), Gaps = 2/366 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LL+E P+TVPYR TI+GQLVE   LW+MHDL N E 
Sbjct  195   VSEILDSELLGEGLIPTLQHAHDKLLIEYPQTVPYRATIYGQLVECPYLWEMHDLVNREA  254

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
               SD I LVP GM  ++ +K QQ+ MHC+++ EGIKLLSEPFK+FDFDFW+RPDSSRETE
Sbjct  255   AVSDGIRLVPNGMFDLLGIKRQQYAMHCNSMKEGIKLLSEPFKVFDFDFWRRPDSSRETE  314

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKD--PSLSCSEAWCDHW  1209
             L IKAT  GT HAIISWWLLQLD EGT+FYSTGP W+HCPSD+K+   S   S  WCDHW
Sbjct  315   LQIKATNDGTVHAIISWWLLQLDSEGTIFYSTGPDWVHCPSDLKELNSSFPSSGNWCDHW  374

Query  1210  KQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSP  1389
             KQ VWF  + GL V KDE V LHAVHT+ ++SY  +T      V  +     DCQ+ L P
Sbjct  375   KQSVWFTSSSGLHVFKDEEVLLHAVHTETSISYQFETSQDKKSVTLHDFCIPDCQIVLPP  434

Query  1390  ERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGL  1569
             ERIA+YGD  WRC ML A+  AL+Q    LC+VADDSIFL IA+ H  ++S+VI LFPGL
Sbjct  435   ERIALYGDNCWRCLMLNALRKALRQSVHQLCLVADDSIFLAIAVAHLCKSSHVIPLFPGL  494

Query  1570  QDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPW  1749
              +KG +YLQ VAA+N+Y+MD I++LKK+    T+QD++ RK+ L +AEPFYYG+DSVLPW
Sbjct  495   GNKGSEYLQRVAAANNYTMDRIEILKKKDLQSTLQDSNQRKISLFVAEPFYYGNDSVLPW  554

Query  1750  QNLRFW  1767
             QNLRFW
Sbjct  555   QNLRFW  560


 Score =   209 bits (531),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 134/184 (73%), Gaps = 13/184 (7%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSG-------SRMFQLKLDPLTGN  178
            MLS+  K L+ TFP R   S + +   +    VR MSS         RMFQLK+DPLTG 
Sbjct  1    MLSILLKPLHFTFPRR---SATATATAAAAAAVRGMSSSLDSGGLTQRMFQLKVDPLTGR  57

Query  179  SEWVVIEES--DTPEQT-PTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGA  349
            SEWVVIEE   D   QT P  LLA TSYLDMLNDS RNRAFR+AIDKTVT PCHVLDIGA
Sbjct  58   SEWVVIEEEEEDIGNQTTPKALLAATSYLDMLNDSRRNRAFRQAIDKTVTGPCHVLDIGA  117

Query  350  GTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKR  529
            GTGLLSMMAA+AMG +DS  +S   GMVTACESYLPMVKLM+KVLRANG++  IRIINKR
Sbjct  118  GTGLLSMMAAQAMGLSDSKGSSGLNGMVTACESYLPMVKLMKKVLRANGMDGKIRIINKR  177

Query  530  SKIL  541
            S  L
Sbjct  178  SDEL  181



>ref|XP_010662493.1| PREDICTED: protein arginine N-methyltransferase 1.6 [Vitis vinifera]
 emb|CBI31925.3| unnamed protein product [Vitis vinifera]
Length=738

 Score =   496 bits (1278),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 238/366 (65%), Positives = 280/366 (77%), Gaps = 2/366 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+ +TVPYR T +GQLVESK LWK+HDL+NNE 
Sbjct  183   VSEILDSELLGEGLIPTLQHAHDMLLVENAKTVPYRATTYGQLVESKFLWKLHDLYNNEA  242

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KA D + LVP G +TI+ +K QQ+ MHCDAI E IKLLSEPFKIF+FDF KRPDS  ETE
Sbjct  243   KALDNVCLVPAGQETILSIKQQQYAMHCDAIKEEIKLLSEPFKIFEFDFSKRPDSHEETE  302

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEA--WCDHW  1209
             L IKA   G+ HA++SWW+LQLD EGT+FYST PKWI  P ++       S A  WCDHW
Sbjct  303   LHIKAIDNGSVHAVVSWWILQLDCEGTIFYSTAPKWISVPFNINKSQTPFSSAGDWCDHW  362

Query  1210  KQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSP  1389
             KQCVWFIP  G+ V K E VHLHA+HTDI++SY +KTQ    E+ Q+ L A+D QL LSP
Sbjct  363   KQCVWFIPGKGIYVSKHEEVHLHAIHTDISISYNLKTQLSRTEIGQHDLFARDSQLILSP  422

Query  1390  ERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGL  1569
             ER+AIYGD  WR SML AI N L+ K   LC+V DDSIFL I + H +R S+VISLFPGL
Sbjct  423   ERVAIYGDSEWRLSMLTAIKNTLQGKVISLCVVTDDSIFLAILIAHLSRTSHVISLFPGL  482

Query  1570  QDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPW  1749
             +DKG QYLQAVA  N +SMD ++VL+   + LT  DT  +KVDLLI EPFYYG++ +LPW
Sbjct  483   RDKGTQYLQAVADVNGFSMDRVEVLQNWKTCLTTLDTRQKKVDLLIGEPFYYGNEGMLPW  542

Query  1750  QNLRFW  1767
             QNLRFW
Sbjct  543   QNLRFW  548


 Score =   209 bits (533),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 118/144 (82%), Gaps = 3/144 (2%)
 Frame = +2

Query  119  RNMSSGS--RMFQLKLDPLTGNSEWVVIEESDTPEQTPT-PLLATTSYLDMLNDSPRNRA  289
            R MSS S  R+FQLKLDPLTGNSEWVVI+E D   + P+ PLL+TTSYLDMLNDS RNRA
Sbjct  26   RTMSSSSAQRLFQLKLDPLTGNSEWVVIDEEDQVSENPSEPLLSTTSYLDMLNDSRRNRA  85

Query  290  FREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKL  469
            FREAIDKTVTK C VLDIGAGTGLLSMMAARAMG  DS +   ++GMVTACESYLPMVKL
Sbjct  86   FREAIDKTVTKNCRVLDIGAGTGLLSMMAARAMGSGDSVACPRTEGMVTACESYLPMVKL  145

Query  470  MRKVLRANGIERGIRIINKRSKIL  541
            MRKVL  NG+ R I +INKRS  L
Sbjct  146  MRKVLHLNGMGRKINVINKRSDEL  169



>ref|XP_010322900.1| PREDICTED: protein arginine N-methyltransferase 1.6 isoform X2 
[Solanum lycopersicum]
Length=768

 Score =   495 bits (1275),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 243/399 (61%), Positives = 295/399 (74%), Gaps = 37/399 (9%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQ------------------  801
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR T++GQ                  
Sbjct  183   VSEILDSELLGEGLIPTLQHAHDQLLVDNPKTVPYRATVYGQVFDHGFIFKYSFADSHWV  242

Query  802   ---------------LVESKDLWKMHDLFNNEEKASDTIHLVPKGMDTIICVKHQQFPMH  936
                            LVES DLWK+HDL+N E++  D I LVP+GMD+ +CVK QQF MH
Sbjct  243   PFGYKAVIFPQLTFQLVESTDLWKLHDLYNTEKEVLDEICLVPEGMDSALCVKRQQFSMH  302

Query  937   CDAISEGIKLLSEPFKIFDFDFWKRPDSSRETELLIKATKGGTAHAIISWWLLQLDREGT  1116
             CDA+ E IKLLSEPFK+FDFDFW+RPDS R T+L ++AT  G  HA+ISWWLLQLD +GT
Sbjct  303   CDALEEDIKLLSEPFKVFDFDFWRRPDSHRVTKLSVQATDTGAVHAVISWWLLQLDEKGT  362

Query  1117  VFYSTGPKWIHCPSDVK--DPSLSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHT  1290
             +FYST PKWI CPS V+  + S+S S+ WCDHWKQCVWFIP  GLS+ KDE V L AVHT
Sbjct  363   IFYSTAPKWISCPSSVEGFNSSISWSQNWCDHWKQCVWFIPKKGLSLLKDEEVSLLAVHT  422

Query  1291  DINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPERIAIYGDKNWRCSMLKAINNALKQKA  1470
             D ++SY +KT SQN+E+ Q ++SAQ  Q+ L PE+IA+Y D NWRCSMLKAI NA+KQK 
Sbjct  423   DTSISYEMKTLSQNLELEQSEVSAQKYQITLLPEKIALYSDVNWRCSMLKAIKNAMKQKT  482

Query  1471  SPLCIVADDSIFLTIALGHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKK  1650
               LC+V DDSIFL +AL H A+ S+V+SLFPGLQ+KG  YLQAVA +N YS D ++V +K
Sbjct  483   PSLCVVVDDSIFLAVALAHLAKGSHVLSLFPGLQEKGALYLQAVATANGYSKDHVEV-QK  541

Query  1651  RSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQNLRFW  1767
              S  LT Q +   K+DLL+ EPFYYG++SVLPWQNLRFW
Sbjct  542   MSELLTSQSS-QEKIDLLVGEPFYYGNNSVLPWQNLRFW  579


 Score =   246 bits (628),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIE  199
            M  LF KTLNP F LR     SF+  RS    VR+MSSGSRMFQLK+DPLTGNSEWVVIE
Sbjct  1    MQCLFPKTLNPQFFLR-----SFNNTRSKAFTVRSMSSGSRMFQLKVDPLTGNSEWVVIE  55

Query  200  ESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAA  379
            E +        LLA TSYLDMLND+ RN+A+REAIDKT+TKPCHVLDIGAGTGLLSMMAA
Sbjct  56   EDEASGDATKQLLANTSYLDMLNDTRRNKAYREAIDKTITKPCHVLDIGAGTGLLSMMAA  115

Query  380  RAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            RAM   DS  +S SKGMVTACESYLPMVKLMRKVL ANG++R IRIINKRS  L
Sbjct  116  RAMDLGDSVESSGSKGMVTACESYLPMVKLMRKVLHANGMQRKIRIINKRSDEL  169



>ref|XP_011081251.1| PREDICTED: protein arginine N-methyltransferase 1.6 isoform X1 
[Sesamum indicum]
Length=749

 Score =   490 bits (1261),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 232/367 (63%), Positives = 280/367 (76%), Gaps = 3/367 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LL+E P+TVPYR TI+GQLVE   LW+MHDL N E 
Sbjct  195   VSEILDSELLGEGLIPTLQHAHDKLLIEYPQTVPYRATIYGQLVECPYLWEMHDLVNREA  254

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
               SD I LVP GM  ++ +K QQ+ MHC+++ EGIKLLSEPFK+FDFDFW+RPDSSRETE
Sbjct  255   AVSDGIRLVPNGMFDLLGIKRQQYAMHCNSMKEGIKLLSEPFKVFDFDFWRRPDSSRETE  314

Query  1036  LLIKATKGGTAHAIISWWL-LQLDREGTVFYSTGPKWIHCPSDVKD--PSLSCSEAWCDH  1206
             L IKAT  GT HAIISW++ LQLD EGT+FYSTGP W+HCPSD+K+   S   S  WCDH
Sbjct  315   LQIKATNDGTVHAIISWYMILQLDSEGTIFYSTGPDWVHCPSDLKELNSSFPSSGNWCDH  374

Query  1207  WKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLS  1386
             WKQ VWF  + GL V KDE V LHAVHT+ ++SY  +T      V  +     DCQ+ L 
Sbjct  375   WKQSVWFTSSSGLHVFKDEEVLLHAVHTETSISYQFETSQDKKSVTLHDFCIPDCQIVLP  434

Query  1387  PERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPG  1566
             PERIA+YGD  WRC ML A+  AL+Q    LC+VADDSIFL IA+ H  ++S+VI LFPG
Sbjct  435   PERIALYGDNCWRCLMLNALRKALRQSVHQLCLVADDSIFLAIAVAHLCKSSHVIPLFPG  494

Query  1567  LQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLP  1746
             L +KG +YLQ VAA+N+Y+MD I++LKK+    T+QD++ RK+ L +AEPFYYG+DSVLP
Sbjct  495   LGNKGSEYLQRVAAANNYTMDRIEILKKKDLQSTLQDSNQRKISLFVAEPFYYGNDSVLP  554

Query  1747  WQNLRFW  1767
             WQNLRFW
Sbjct  555   WQNLRFW  561


 Score =   209 bits (531),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 134/184 (73%), Gaps = 13/184 (7%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSG-------SRMFQLKLDPLTGN  178
            MLS+  K L+ TFP R   S + +   +    VR MSS         RMFQLK+DPLTG 
Sbjct  1    MLSILLKPLHFTFPRR---SATATATAAAAAAVRGMSSSLDSGGLTQRMFQLKVDPLTGR  57

Query  179  SEWVVIEES--DTPEQT-PTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGA  349
            SEWVVIEE   D   QT P  LLA TSYLDMLNDS RNRAFR+AIDKTVT PCHVLDIGA
Sbjct  58   SEWVVIEEEEEDIGNQTTPKALLAATSYLDMLNDSRRNRAFRQAIDKTVTGPCHVLDIGA  117

Query  350  GTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKR  529
            GTGLLSMMAA+AMG +DS  +S   GMVTACESYLPMVKLM+KVLRANG++  IRIINKR
Sbjct  118  GTGLLSMMAAQAMGLSDSKGSSGLNGMVTACESYLPMVKLMKKVLRANGMDGKIRIINKR  177

Query  530  SKIL  541
            S  L
Sbjct  178  SDEL  181



>ref|XP_011081253.1| PREDICTED: protein arginine N-methyltransferase 1.6 isoform X3 
[Sesamum indicum]
Length=743

 Score =   489 bits (1260),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 232/367 (63%), Positives = 280/367 (76%), Gaps = 3/367 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LL+E P+TVPYR TI+GQLVE   LW+MHDL N E 
Sbjct  195   VSEILDSELLGEGLIPTLQHAHDKLLIEYPQTVPYRATIYGQLVECPYLWEMHDLVNREA  254

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
               SD I LVP GM  ++ +K QQ+ MHC+++ EGIKLLSEPFK+FDFDFW+RPDSSRETE
Sbjct  255   AVSDGIRLVPNGMFDLLGIKRQQYAMHCNSMKEGIKLLSEPFKVFDFDFWRRPDSSRETE  314

Query  1036  LLIKATKGGTAHAIISWWL-LQLDREGTVFYSTGPKWIHCPSDVKD--PSLSCSEAWCDH  1206
             L IKAT  GT HAIISW++ LQLD EGT+FYSTGP W+HCPSD+K+   S   S  WCDH
Sbjct  315   LQIKATNDGTVHAIISWYMILQLDSEGTIFYSTGPDWVHCPSDLKELNSSFPSSGNWCDH  374

Query  1207  WKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLS  1386
             WKQ VWF  + GL V KDE V LHAVHT+ ++SY  +T      V  +     DCQ+ L 
Sbjct  375   WKQSVWFTSSSGLHVFKDEEVLLHAVHTETSISYQFETSQDKKSVTLHDFCIPDCQIVLP  434

Query  1387  PERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPG  1566
             PERIA+YGD  WRC ML A+  AL+Q    LC+VADDSIFL IA+ H  ++S+VI LFPG
Sbjct  435   PERIALYGDNCWRCLMLNALRKALRQSVHQLCLVADDSIFLAIAVAHLCKSSHVIPLFPG  494

Query  1567  LQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLP  1746
             L +KG +YLQ VAA+N+Y+MD I++LKK+    T+QD++ RK+ L +AEPFYYG+DSVLP
Sbjct  495   LGNKGSEYLQRVAAANNYTMDRIEILKKKDLQSTLQDSNQRKISLFVAEPFYYGNDSVLP  554

Query  1747  WQNLRFW  1767
             WQNLRFW
Sbjct  555   WQNLRFW  561


 Score =   209 bits (531),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 134/184 (73%), Gaps = 13/184 (7%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSG-------SRMFQLKLDPLTGN  178
            MLS+  K L+ TFP R   S + +   +    VR MSS         RMFQLK+DPLTG 
Sbjct  1    MLSILLKPLHFTFPRR---SATATATAAAAAAVRGMSSSLDSGGLTQRMFQLKVDPLTGR  57

Query  179  SEWVVIEES--DTPEQT-PTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGA  349
            SEWVVIEE   D   QT P  LLA TSYLDMLNDS RNRAFR+AIDKTVT PCHVLDIGA
Sbjct  58   SEWVVIEEEEEDIGNQTTPKALLAATSYLDMLNDSRRNRAFRQAIDKTVTGPCHVLDIGA  117

Query  350  GTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKR  529
            GTGLLSMMAA+AMG +DS  +S   GMVTACESYLPMVKLM+KVLRANG++  IRIINKR
Sbjct  118  GTGLLSMMAAQAMGLSDSKGSSGLNGMVTACESYLPMVKLMKKVLRANGMDGKIRIINKR  177

Query  530  SKIL  541
            S  L
Sbjct  178  SDEL  181



>ref|XP_004299441.1| PREDICTED: protein arginine N-methyltransferase 1.6-like [Fragaria 
vesca subsp. vesca]
Length=687

 Score =   485 bits (1248),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 225/364 (62%), Positives = 282/364 (77%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+LQHAHD LLVESPETVP+R T +GQLVES  LWK+HDL  NE 
Sbjct  147   VSEILDSELLGEGLIPSLQHAHDVLLVESPETVPFRATTYGQLVESTFLWKLHDLHGNEA  206

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +A D I LVP G + ++ VK QQ+  HCDAI+  +KLLSEPFKIF+FDF KRP+S  ETE
Sbjct  207   EACDGIRLVPTGFEDVLAVKPQQYAFHCDAIANEVKLLSEPFKIFEFDFSKRPESRGETE  266

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L IKAT  G   A+ISWW+LQLDREGT+FYST P+WI+ P ++          WCDHWKQ
Sbjct  267   LSIKATNDGRVQAVISWWILQLDREGTIFYSTAPRWINLPVNISHGD------WCDHWKQ  320

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G+ V+KDE V LHAVHTDI++SY +K+     +  QY L+ +D +L L PER
Sbjct  321   CVWFVPGEGMYVKKDEAVCLHAVHTDISISYSIKSPVSRNKSMQYDLTGRDFKLILPPER  380

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IAIYGD  WR +M KAI+ A++ +  PLCIVADDSIFLT+ + H ++ S+V+S FPGLQD
Sbjct  381   IAIYGDSEWRHTMFKAISKAIQGRVDPLCIVADDSIFLTLLVAHLSKTSHVMSFFPGLQD  440

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG +YL AVA++N++S+D ++ +KK+ + LT+ DTH +KVDLLI EPFYYG+DS+LPWQN
Sbjct  441   KGMEYLHAVASANNFSVDRVEYIKKKKTKLTVHDTHQKKVDLLIGEPFYYGTDSMLPWQN  500

Query  1756  LRFW  1767
             LRFW
Sbjct  501   LRFW  504


 Score =   183 bits (464),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 110/139 (79%), Gaps = 11/139 (8%)
 Frame = +2

Query  137  SRMFQLKLDPLTGNSEWVVIEESD----TPEQTPTPLLATTSYLDMLNDSPRNRAFREAI  304
            S  FQL+++PLTGNSEW+VIEE++    TP+     LLATTSYLDMLND PRN ++R+AI
Sbjct  2    SSQFQLRVNPLTGNSEWIVIEENEPESPTPDTAQNALLATTSYLDMLNDCPRNTSYRQAI  61

Query  305  DKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVL  484
            DKTVT+PC VLDIGAGTGLLSMMAARAMG       S +  MVTACESYLPMVKLM+KVL
Sbjct  62   DKTVTQPCRVLDIGAGTGLLSMMAARAMG-------STTCRMVTACESYLPMVKLMKKVL  114

Query  485  RANGIERGIRIINKRSKIL  541
            R N +E+ I++INKRS  L
Sbjct  115  RLNDMEKQIKLINKRSDEL  133



>ref|XP_002528925.1| protein arginine n-methyltransferase, putative [Ricinus communis]
 gb|EEF33454.1| protein arginine n-methyltransferase, putative [Ricinus communis]
Length=697

 Score =   483 bits (1244),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 230/364 (63%), Positives = 281/364 (77%), Gaps = 9/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+LQHAHD LLV++P TVPYR T +GQLVES  LWK+HDL++NE 
Sbjct  154   VSEILDSELLGEGLIPSLQHAHDMLLVDNPLTVPYRATTYGQLVESTFLWKLHDLYDNEA  213

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KASD I LVP G+DTI+ VK QQ PM+CDAIS+ IKLLSEPFKIF+FDFWKRPDS  ETE
Sbjct  214   KASDNIRLVPTGLDTILRVKLQQNPMNCDAISKEIKLLSEPFKIFEFDFWKRPDSHGETE  273

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             +LIKAT  GT HA+ISWW+LQLD EGT+FYST PKWI  P+++       +  WCDHWKQ
Sbjct  274   VLIKATNDGTVHAVISWWMLQLDCEGTIFYSTAPKWIGSPTNIG------TSNWCDHWKQ  327

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             C WF+P  G+ V K E + LHA HTD N+ Y ++   Q+ EVRQ+  +A D  L L PER
Sbjct  328   CTWFLPGKGIQVGKGEQLLLHATHTDTNVFYNIEI--QDTEVRQHNFTAGDFHLILPPER  385

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             +AIYGD  WR SML A+ NAL++K  PLCIVADDS+F T+AL H ++ ++VISLFPGL++
Sbjct  386   LAIYGDSEWRSSMLTALRNALQEKVQPLCIVADDSLFATLALAHLSKTAHVISLFPGLRE  445

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG QYLQ VA +ND+  D + V    +  LT+QDT+ +KVDLLI EP+YYG+D +LPWQ 
Sbjct  446   KGSQYLQTVADANDFKTDRVNVFLN-NKCLTLQDTNQKKVDLLIGEPYYYGNDGMLPWQY  504

Query  1756  LRFW  1767
             LRFW
Sbjct  505   LRFW  508


 Score =   171 bits (432),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 107/137 (78%), Gaps = 8/137 (6%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTP---LLATTSYLDMLNDSPRNRAFREAIDK  310
            +MFQLKLDPLTG SEW++I E++  E    P   LLATTSYLDMLNDS RNRAFREAIDK
Sbjct  9    QMFQLKLDPLTGKSEWIIITENEEEETFGNPNRNLLATTSYLDMLNDSARNRAFREAIDK  68

Query  311  TVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRA  490
             +TKPCHVLDIGAGTGLLSMMAARAM      S  +S+G VTACESYLPMVK+MRKVL  
Sbjct  69   VITKPCHVLDIGAGTGLLSMMAARAM-----RSGEESRGTVTACESYLPMVKMMRKVLHV  123

Query  491  NGIERGIRIINKRSKIL  541
            NG+ R I + NKRS  L
Sbjct  124  NGMGRTINVFNKRSDEL  140



>ref|XP_009334505.1| PREDICTED: protein arginine N-methyltransferase 1.6 isoform X1 
[Pyrus x bretschneideri]
Length=722

 Score =   484 bits (1245),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 227/364 (62%), Positives = 274/364 (75%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+LQHAHD LLVE+P+TVPY+ T +GQLVES  LWK+HDL  NE 
Sbjct  176   VSEILDSELLGEGLIPSLQHAHDMLLVENPKTVPYKATTYGQLVESTFLWKLHDLHGNEA  235

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KAS+ I LVP G+  I+ VK QQ+  HC+AI   +KLLSEPFKIF+FDFWKRPDS  ETE
Sbjct  236   KASEGIRLVPTGLGDILGVKPQQYAFHCNAIENEVKLLSEPFKIFEFDFWKRPDSCGETE  295

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L +KATK G  HA+ISWW+LQLDREGT+FYST P+WI  P+++          WCDHWKQ
Sbjct  296   LFVKATKDGRVHAVISWWILQLDREGTIFYSTAPRWISLPANISHGD------WCDHWKQ  349

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G+S+ KDE V LHA HT+ ++SY +K Q    E  QY L   + +L L PER
Sbjct  350   CVWFVPGEGMSITKDEEVCLHAAHTETSISYNLKNQFPRNETLQYGLKNGEFKLTLPPER  409

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IAIYGD  WR SM  AI   L+ +  PLCIVADDSIFLT+ + H ++ S+V+S FPGLQ 
Sbjct  410   IAIYGDSEWRHSMFSAITKPLQGRVDPLCIVADDSIFLTLLVAHISKTSHVMSFFPGLQG  469

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG  YLQAVA+SN +SMD ++ + KR + LTM DTH +KVDLLI EPFYYG+D +LPWQN
Sbjct  470   KGIGYLQAVASSNGFSMDRVEFINKRKTKLTMHDTHQKKVDLLIGEPFYYGTDGMLPWQN  529

Query  1756  LRFW  1767
             LRFW
Sbjct  530   LRFW  533


 Score =   202 bits (515),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 125/180 (69%), Gaps = 24/180 (13%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSG--SRMFQLKLDPLTGNSEWVV  193
            MLS   KTL P  PL  T       PR    + R MSS    R FQL+++PLTGNSEW+V
Sbjct  1    MLSRIAKTLFPKLPLHST-------PR----LARPMSSQPTQRAFQLRVNPLTGNSEWIV  49

Query  194  IEESDTPEQT----PTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGL  361
            IEE    EQT       LLATTSYLDMLNDSPRNRAFR AIDKT+T PCHVLDIGAGTGL
Sbjct  50   IEEDGPEEQTFNNPQNALLATTSYLDMLNDSPRNRAFRAAIDKTITAPCHVLDIGAGTGL  109

Query  362  LSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            LSMMAARAMGP           MVTACESYLPMVKLMRKV+R NG+E  I++INKRS  L
Sbjct  110  LSMMAARAMGPTTCR-------MVTACESYLPMVKLMRKVVRLNGMENQIKVINKRSDEL  162



>ref|XP_009334506.1| PREDICTED: protein arginine N-methyltransferase 1.6 isoform X2 
[Pyrus x bretschneideri]
Length=561

 Score =   478 bits (1230),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 225/362 (62%), Positives = 272/362 (75%), Gaps = 6/362 (2%)
 Frame = +1

Query  682   EILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEEKA  861
             EILDSELLGEGLIP+LQHAHD LLVE+P+TVPY+ T +GQLVES  LWK+HDL  NE KA
Sbjct  17    EILDSELLGEGLIPSLQHAHDMLLVENPKTVPYKATTYGQLVESTFLWKLHDLHGNEAKA  76

Query  862   SDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETELL  1041
             S+ I LVP G+  I+ VK QQ+  HC+AI   +KLLSEPFKIF+FDFWKRPDS  ETEL 
Sbjct  77    SEGIRLVPTGLGDILGVKPQQYAFHCNAIENEVKLLSEPFKIFEFDFWKRPDSCGETELF  136

Query  1042  IKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQCV  1221
             +KATK G  HA+ISWW+LQLDREGT+FYST P+WI  P+++          WCDHWKQCV
Sbjct  137   VKATKDGRVHAVISWWILQLDREGTIFYSTAPRWISLPANISHGD------WCDHWKQCV  190

Query  1222  WFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPERIA  1401
             WF+P  G+S+ KDE V LHA HT+ ++SY +K Q    E  QY L   + +L L PERIA
Sbjct  191   WFVPGEGMSITKDEEVCLHAAHTETSISYNLKNQFPRNETLQYGLKNGEFKLTLPPERIA  250

Query  1402  IYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQDKG  1581
             IYGD  WR SM  AI   L+ +  PLCIVADDSIFLT+ + H ++ S+V+S FPGLQ KG
Sbjct  251   IYGDSEWRHSMFSAITKPLQGRVDPLCIVADDSIFLTLLVAHISKTSHVMSFFPGLQGKG  310

Query  1582  EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQNLR  1761
               YLQAVA+SN +SMD ++ + KR + LTM DTH +KVDLLI EPFYYG+D +LPWQNLR
Sbjct  311   IGYLQAVASSNGFSMDRVEFINKRKTKLTMHDTHQKKVDLLIGEPFYYGTDGMLPWQNLR  370

Query  1762  FW  1767
             FW
Sbjct  371   FW  372



>ref|XP_006477200.1| PREDICTED: protein arginine N-methyltransferase 1.6-like [Citrus 
sinensis]
Length=735

 Score =   482 bits (1241),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 226/364 (62%), Positives = 280/364 (77%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P TVPYR T +GQLVES  LWK+HDL+NNE 
Sbjct  188   VSEILDSELLGEGLIPTLQHAHDRLLVENPLTVPYRATTYGQLVESTFLWKLHDLYNNEA  247

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KA D IHLVP GMD+I+ VK QQ+ MHCDAI++ IKLLSEPFKIF+FDFWKRPDS  ETE
Sbjct  248   KALDGIHLVPAGMDSILHVKSQQYAMHCDAITKEIKLLSEPFKIFEFDFWKRPDSHGETE  307

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L IK+T  G  HA++SWW+LQLDREGT+FYST P+WI  P          +  WCDHWKQ
Sbjct  308   LQIKSTDDGRVHAVVSWWVLQLDREGTIFYSTAPRWISLPIH------KSTGNWCDHWKQ  361

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWFIP  G+S+ K E +  HA+HT+ ++SY +K+Q    + RQ+ L+A+D QL L PER
Sbjct  362   CVWFIPGKGMSICKGEELLFHALHTETSVSYELKSQIPITDERQHNLNAKDFQLALPPER  421

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IAIYGD  WR SM+ A+ NAL+ +  PLC+VADDS+FLTI +   ++ ++V+SL PGL D
Sbjct  422   IAIYGDGEWRLSMVMAMRNALQGRVQPLCVVADDSVFLTICVARLSKTAHVLSLLPGLGD  481

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG QYL+ VA  N +S+D +++L+K    LTM DT  +KVDLLI EP+Y+G+D +LPWQN
Sbjct  482   KGAQYLRTVADPNCFSIDRVEILQKGKKCLTMDDTQQKKVDLLIGEPYYFGNDGMLPWQN  541

Query  1756  LRFW  1767
             LRFW
Sbjct  542   LRFW  545


 Score =   217 bits (552),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 133/175 (76%), Gaps = 2/175 (1%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIE  199
            MLSL  K L  +   R T++    +P   + +     S  RMFQLKLDPLTGNSEWVVIE
Sbjct  1    MLSLIPKALTLSLSSR-TTTRLILIPLPLKPVASRPMSTQRMFQLKLDPLTGNSEWVVIE  59

Query  200  ES-DTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMA  376
            E+ D PE +  PLLATTSYLDMLNDS RNRA+R AIDK VTK CHVLDIGAGTGLLSMMA
Sbjct  60   ENEDVPESSQEPLLATTSYLDMLNDSYRNRAYRLAIDKMVTKSCHVLDIGAGTGLLSMMA  119

Query  377  ARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            ARAMG +DS ++ ++KGMVTACESYLPMVKLM+KVL  NG+ R I++INKRS  L
Sbjct  120  ARAMGSSDSTTSLNTKGMVTACESYLPMVKLMKKVLHVNGMGRNIKVINKRSDEL  174



>ref|XP_010264285.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X3 
[Nelumbo nucifera]
Length=693

 Score =   480 bits (1236),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 227/367 (62%), Positives = 281/367 (77%), Gaps = 1/367 (0%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  VSEILDSELLGEGLIPTLQ AHD LL+E+P+TVP R TI+GQLVES  LWK+HDL+N
Sbjct  189   NILVSEILDSELLGEGLIPTLQQAHDELLMENPQTVPSRATIYGQLVESTFLWKLHDLYN  248

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSR  1026
             NE KA D +HLVP  ++ I+ VK QQ+ MHCDAI+E I+LLS+PFK+F+FDF KRP+S  
Sbjct  249   NEAKALDNVHLVPAELERILRVKPQQYAMHCDAIAEEIRLLSDPFKVFEFDFSKRPESHG  308

Query  1027  ETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDH  1206
             +TEL IKAT  G  HAI+SWW+LQLD EGT+FYST P+WI+ P + +D     S  WCDH
Sbjct  309   QTELHIKATSDGRVHAIVSWWVLQLDYEGTIFYSTAPRWINLPFNCEDLQTQ-SHNWCDH  367

Query  1207  WKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLS  1386
             WKQCVWFIP IG+ V KDE V   AVH DI++SY +K     +E        + CQL LS
Sbjct  368   WKQCVWFIPGIGILVSKDEQVDFQAVHNDISISYNLKHGDSKLEQGYPDFHTRGCQLILS  427

Query  1387  PERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPG  1566
             PERIAIYGD+ WR  ML+A+ NAL++K SPLC+VADDS+FLTI L + + +SN+IS+FPG
Sbjct  428   PERIAIYGDREWRYDMLRAVMNALQKKVSPLCVVADDSVFLTILLANLSPSSNIISVFPG  487

Query  1567  LQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLP  1746
             LQ+KG QYLQAVA +N +S++ + VL KR + LT  DT  +KVDLLI EPFYYG++  LP
Sbjct  488   LQEKGAQYLQAVADANGFSINRVNVLGKRPTCLTTDDTDQKKVDLLIGEPFYYGNEGKLP  547

Query  1747  WQNLRFW  1767
             W+NLRFW
Sbjct  548   WENLRFW  554


 Score =   203 bits (516),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 132/177 (75%), Gaps = 4/177 (2%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLR-VTSSHSFSLPRSTRTIVRNMSS--GSRMFQLKLDPLTGNSEWV  190
            M S  C+TL     L  +T  +  S  R     VR+MSS    R+FQL+ +PLTGNSEWV
Sbjct  3    MASSICRTLVSNIVLHPITRLNPSSFGRIKCQPVRSMSSELSQRIFQLRFNPLTGNSEWV  62

Query  191  VIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSM  370
            VIEES+  E +P  LL++TSYLDMLNDSPRNRAF +AI+KTV KPCHVLDIG+GTGLLSM
Sbjct  63   VIEESEE-ENSPKALLSSTSYLDMLNDSPRNRAFCKAIEKTVIKPCHVLDIGSGTGLLSM  121

Query  371  MAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            MAARAM  +D+   + SKG+++ACESYLPMVKLMRKVLR N +E+ IRI +KRS  L
Sbjct  122  MAARAMDSSDAKHYTGSKGILSACESYLPMVKLMRKVLRINNMEKKIRIFHKRSDEL  178



>ref|XP_010264283.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Nelumbo nucifera]
Length=743

 Score =   479 bits (1233),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 227/367 (62%), Positives = 282/367 (77%), Gaps = 1/367 (0%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  VSEILDSELLGEGLIPTLQ AHD LL+E+P+TVP R TI+GQLVES  LWK+HDL+N
Sbjct  189   NILVSEILDSELLGEGLIPTLQQAHDELLMENPQTVPSRATIYGQLVESTFLWKLHDLYN  248

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSR  1026
             NE KA D +HLVP  ++ I+ VK QQ+ MHCDAI+E I+LLS+PFK+F+FDF KRP+S  
Sbjct  249   NEAKALDNVHLVPAELERILRVKPQQYAMHCDAIAEEIRLLSDPFKVFEFDFSKRPESHG  308

Query  1027  ETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDH  1206
             +TEL IKAT  G  HAI+SWW+LQLD EGT+FYST P+WI+ P + +D   + S  WCDH
Sbjct  309   QTELHIKATSDGRVHAIVSWWVLQLDYEGTIFYSTAPRWINLPFNCEDLQ-TQSHNWCDH  367

Query  1207  WKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLS  1386
             WKQCVWFIP IG+ V KDE V   AVH DI++SY +K     +E        + CQL LS
Sbjct  368   WKQCVWFIPGIGILVSKDEQVDFQAVHNDISISYNLKHGDSKLEQGYPDFHTRGCQLILS  427

Query  1387  PERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPG  1566
             PERIAIYGD+ WR  ML+A+ NAL++K SPLC+VADDS+FLTI L + + +SN+IS+FPG
Sbjct  428   PERIAIYGDREWRYDMLRAVMNALQKKVSPLCVVADDSVFLTILLANLSPSSNIISVFPG  487

Query  1567  LQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLP  1746
             LQ+KG QYLQAVA +N +S++ + VL KR + LT  DT  +KVDLLI EPFYYG++  LP
Sbjct  488   LQEKGAQYLQAVADANGFSINRVNVLGKRPTCLTTDDTDQKKVDLLIGEPFYYGNEGKLP  547

Query  1747  WQNLRFW  1767
             W+NLRFW
Sbjct  548   WENLRFW  554


 Score =   203 bits (516),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 132/177 (75%), Gaps = 4/177 (2%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLR-VTSSHSFSLPRSTRTIVRNMSS--GSRMFQLKLDPLTGNSEWV  190
            M S  C+TL     L  +T  +  S  R     VR+MSS    R+FQL+ +PLTGNSEWV
Sbjct  3    MASSICRTLVSNIVLHPITRLNPSSFGRIKCQPVRSMSSELSQRIFQLRFNPLTGNSEWV  62

Query  191  VIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSM  370
            VIEES+  E +P  LL++TSYLDMLNDSPRNRAF +AI+KTV KPCHVLDIG+GTGLLSM
Sbjct  63   VIEESEE-ENSPKALLSSTSYLDMLNDSPRNRAFCKAIEKTVIKPCHVLDIGSGTGLLSM  121

Query  371  MAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            MAARAM  +D+   + SKG+++ACESYLPMVKLMRKVLR N +E+ IRI +KRS  L
Sbjct  122  MAARAMDSSDAKHYTGSKGILSACESYLPMVKLMRKVLRINNMEKKIRIFHKRSDEL  178



>ref|XP_002303351.2| arginine N-methyltransferase family protein [Populus trichocarpa]
 gb|EEE78330.2| arginine N-methyltransferase family protein [Populus trichocarpa]
Length=740

 Score =   479 bits (1232),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 226/364 (62%), Positives = 281/364 (77%), Gaps = 9/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P TVPYR T +GQLVES  LWK+HDL NNEE
Sbjct  197   VSEILDSELLGEGLIPTLQHAHDMLLVDNPLTVPYRATTYGQLVESTFLWKLHDLSNNEE  256

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +ASD I LVP G+DTI+CVK +Q PMHCDAIS+ I LLSEPFKIF+FDFWKRPDS  +++
Sbjct  257   EASDGIRLVPAGLDTILCVKAKQHPMHCDAISKEINLLSEPFKIFEFDFWKRPDSQGDSK  316

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             LLIKAT  G  HA++SWW+LQLD EGT+FYST P+WI        P  + +  WCDHWKQ
Sbjct  317   LLIKATNDGRIHAVVSWWILQLDSEGTIFYSTAPRWI------TSPIATHTGNWCDHWKQ  370

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWFIP  G+ + K E VHLHAVH+D ++SY + TQ+   E+R+    A D  L LSPER
Sbjct  371   CVWFIPGEGIPISKGEEVHLHAVHSDTSVSYNLATQAT--EIRECDSIAGDSHLTLSPER  428

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IAIYGD+ WR  ML A+NN L+ +  PLC+VADDS+FL++ + H ++ SNVI+LFPGL++
Sbjct  429   IAIYGDRKWRSCMLTALNNLLQARVHPLCVVADDSVFLSLLVAHLSKTSNVIALFPGLRE  488

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             +G QYL+AVA +N  + D I+V +K+   LT+ DT  +KVDLLI EP+YYG+D +LPWQN
Sbjct  489   RGVQYLKAVADANGITADRIEVFQKK-KYLTLNDTKQKKVDLLIGEPYYYGNDGMLPWQN  547

Query  1756  LRFW  1767
              RFW
Sbjct  548   FRFW  551


 Score =   202 bits (513),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 121/158 (77%), Gaps = 13/158 (8%)
 Frame = +2

Query  89   SLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWVVIEESDTPEQ-----TPTPLLATT  247
            S P  T+T  R MSS S  R+FQLKLDPLTGNSEWV+IE+ +  E+     +   LLATT
Sbjct  32   STPTPTQT--RPMSSDSTQRVFQLKLDPLTGNSEWVIIEDGNKEEEETFKSSSHALLATT  89

Query  248  SYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKG  427
            SYLDMLND  RNRAFREAIDKT+TKPCHVLDIGAGTGLLSMMAARAMG  D     + KG
Sbjct  90   SYLDMLNDDTRNRAFREAIDKTITKPCHVLDIGAGTGLLSMMAARAMGTCD----DNKKG  145

Query  428  MVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            MVTACESYLPMVKLMRKVL  NG+ + ++I NKRS  L
Sbjct  146  MVTACESYLPMVKLMRKVLNLNGMGKNVKIFNKRSDEL  183



>emb|CDP09960.1| unnamed protein product [Coffea canephora]
Length=743

 Score =   476 bits (1224),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 225/364 (62%), Positives = 280/364 (77%), Gaps = 3/364 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHDNLLVE+P+TVPYR T +GQLVES  L K+HDL NNE 
Sbjct  196   VSEILDSELLGEGLIPTLQHAHDNLLVENPQTVPYRATTYGQLVESPYLRKLHDLINNEA  255

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KA D I+LVP G+ +I+ +K QQF MHCDA+ E  KLLSEPFK+FDF+FWKRP+S+R+TE
Sbjct  256   KALDGIYLVPNGVHSILQIKEQQFAMHCDAMKEEFKLLSEPFKVFDFEFWKRPESNRKTE  315

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + IKAT  GT HAI+SWWLLQLD EGT+FY TGPKWI   S    P +     WCDHWKQ
Sbjct  316   VCIKATNDGTIHAIVSWWLLQLDNEGTIFYCTGPKWISDQSKSFFPGMG---NWCDHWKQ  372

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             C+WF+P  G++V K + V + A HT  ++SY VKT  +  +      S  D Q+FL+PE+
Sbjct  373   CIWFLPEKGMTVCKHQEVFVGARHTKTSISYRVKTSLEKEDGGHCDPSPGDNQIFLTPEQ  432

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IAIYGD NWR SM   I NALKQK SP+CIV DDS+FL IA+   +++++VI+LFPGL++
Sbjct  433   IAIYGDCNWRLSMFNVIKNALKQKVSPMCIVVDDSLFLPIAIASLSKSAHVIALFPGLRE  492

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG  YLQAVA+SN YSMD ++VL+ R+  LTM++TH  KV L + EPFYYG+++VLPW+N
Sbjct  493   KGTHYLQAVASSNFYSMDRLEVLRTRNQQLTMENTHQTKVGLFVGEPFYYGNENVLPWRN  552

Query  1756  LRFW  1767
             LRFW
Sbjct  553   LRFW  556


 Score =   230 bits (586),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 128/145 (88%), Gaps = 3/145 (2%)
 Frame = +2

Query  116  VRNMSSGS--RMFQLKLDPLTGNSEWVVIEESDTPEQ-TPTPLLATTSYLDMLNDSPRNR  286
            VRNMSS S  RMFQLKLDPLTGNSEWVVIEE+ TPE+ T  PLLATTSYLDMLNDS RNR
Sbjct  38   VRNMSSDSAQRMFQLKLDPLTGNSEWVVIEENQTPEEKTKEPLLATTSYLDMLNDSHRNR  97

Query  287  AFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVK  466
            AFR+AIDKT+TKPCHVLDIGAGTGLLSMMAARAMG  DS+++   KG VTACESYLPMVK
Sbjct  98   AFRQAIDKTITKPCHVLDIGAGTGLLSMMAARAMGLDDSSTSYCPKGKVTACESYLPMVK  157

Query  467  LMRKVLRANGIERGIRIINKRSKIL  541
            LMRKVLRANG+++ +R+INKRS  L
Sbjct  158  LMRKVLRANGMDKKVRVINKRSDEL  182



>ref|XP_008369459.1| PREDICTED: protein arginine N-methyltransferase 1.6 [Malus domestica]
Length=722

 Score =   475 bits (1222),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 223/364 (61%), Positives = 270/364 (74%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+LQHAHD LLV++P+TVPY+ T +GQLVES  LWK+HDL  NE 
Sbjct  176   VSEILDSELLGEGLIPSLQHAHDILLVKNPKTVPYKATTYGQLVESTFLWKLHDLHGNEA  235

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KASD I LVP G+  I+ VK QQ+  HC+AI   +KLLSEPFKIF+FDFWKRPDS  ETE
Sbjct  236   KASDGIRLVPTGLGDILGVKPQQYAFHCNAIENEVKLLSEPFKIFEFDFWKRPDSCGETE  295

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L +KATK G  HA+ISWW+LQLD EGT+FYST P+WI  P++           WCDHWKQ
Sbjct  296   LFVKATKDGRVHAVISWWILQLDHEGTIFYSTAPRWISLPANTSHGD------WCDHWKQ  349

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G+S+ KDE V LHA HT+ ++SY +K Q    E  QY L   + +L L PER
Sbjct  350   CVWFVPGEGMSITKDEEVCLHAAHTETSISYNLKNQVPRNETLQYGLKNGEFKLTLPPER  409

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
              AIYGD  WR SM  AI   L+ +  PLCIVADDSIFLT+ + H ++ ++V+S FPGLQ 
Sbjct  410   TAIYGDSEWRHSMFSAITKPLQGRVDPLCIVADDSIFLTLIVAHISKTAHVMSFFPGLQG  469

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG  YLQAVA+SN +SMD ++ + KR + LTM D H +KVDLLI EPFYYG+D +LPWQN
Sbjct  470   KGIGYLQAVASSNGFSMDRVEFINKRKTKLTMHDXHQKKVDLLIGEPFYYGTDGMLPWQN  529

Query  1756  LRFW  1767
             LRFW
Sbjct  530   LRFW  533


 Score =   199 bits (505),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 124/180 (69%), Gaps = 24/180 (13%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSG--SRMFQLKLDPLTGNSEWVV  193
            MLS   KTL P  PL  T       PR    + R MSS    R FQL+++PLTGNSEW+V
Sbjct  1    MLSRIAKTLFPKLPLHST-------PR----LARPMSSQPTQRAFQLRVNPLTGNSEWIV  49

Query  194  IEESDTPEQT----PTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGL  361
            IEE +  EQT       LLATTSYLDMLNDSPRNRAFR AIDKT+T PCHVLDIGAGTGL
Sbjct  50   IEEDEPEEQTFNNPQNGLLATTSYLDMLNDSPRNRAFRXAIDKTITAPCHVLDIGAGTGL  109

Query  362  LSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            LSMMAARAMGP           MV ACESYLPMVKLMRKV+R N +E  I++INKRS  L
Sbjct  110  LSMMAARAMGPTTCR-------MVXACESYLPMVKLMRKVVRLNDMENQIKVINKRSDEL  162



>ref|XP_008437081.1| PREDICTED: protein arginine N-methyltransferase 1.6 [Cucumis 
melo]
Length=738

 Score =   474 bits (1219),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 221/364 (61%), Positives = 278/364 (76%), Gaps = 7/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P TVPYR T++GQLVES  LWK+HDL+NNE 
Sbjct  192   VSEILDSELLGEGLIPTLQHAHDKLLVENPLTVPYRATVYGQLVESTYLWKLHDLYNNEA  251

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KA D IHLVP G D IICVK QQ+ MHCDAI+  +KLLSEPF++F+FDFWKRP+S  E E
Sbjct  252   KACDGIHLVPVG-DPIICVKPQQYAMHCDAIANEVKLLSEPFRVFEFDFWKRPESHAENE  310

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L +KAT  G  HA++SWW LQLDREGT+FYST PKWI  P +V       +  WCDHWKQ
Sbjct  311   LHVKATDSGRIHAVVSWWTLQLDREGTIFYSTAPKWISPPYNVG------AGGWCDHWKQ  364

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWFIP  G+S+ K+E VHL A   D   SY +K+Q    E+ Q+ ++A++ +L L PER
Sbjct  365   CVWFIPGNGVSISKEEKVHLCASRNDTTFSYHLKSQIPGGEILQHGVNAENFKLILPPER  424

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IA+YGD+ WR +ML AI   L+ +A  +C++ADDS+FLT+ +   ++ + V+SLFPG+++
Sbjct  425   IAVYGDREWRLAMLTAIKTELQGRAPSVCVIADDSVFLTLMVACLSKTTLVLSLFPGIRE  484

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG +YLQAV+  N   MD IKV++KR S LT+QDT  +KVDLLI+EPFYYG+D+ LPW N
Sbjct  485   KGTKYLQAVSHVNGICMDSIKVIEKRKSCLTIQDTFEKKVDLLISEPFYYGNDNALPWHN  544

Query  1756  LRFW  1767
             LRFW
Sbjct  545   LRFW  548


 Score =   184 bits (467),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 116/142 (82%), Gaps = 8/142 (6%)
 Frame = +2

Query  119  RNMSSGS--RMFQLKLDPLTGNSEWVVIEESDTPE--QTPTPLLATTSYLDMLNDSPRNR  286
            R MSS S  R+FQL+ DPLTGNSEWVVIEE        +  PLLATTSYLDMLNDS RNR
Sbjct  38   RTMSSESTQRLFQLRFDPLTGNSEWVVIEEEVEGVLENSQKPLLATTSYLDMLNDSTRNR  97

Query  287  AFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVK  466
            AFREAIDKT++KPCHVLDIGAGTGLLSMMAARAM   DS    D KGMVTACESYLPMVK
Sbjct  98   AFREAIDKTLSKPCHVLDIGAGTGLLSMMAARAM---DSVMG-DCKGMVTACESYLPMVK  153

Query  467  LMRKVLRANGIERGIRIINKRS  532
            LMRKVLR NG+ER +++INKRS
Sbjct  154  LMRKVLRLNGMERKVKVINKRS  175



>gb|EYU32841.1| hypothetical protein MIMGU_mgv1a022108mg [Erythranthe guttata]
Length=707

 Score =   472 bits (1214),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 230/367 (63%), Positives = 272/367 (74%), Gaps = 3/367 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             +SEILDSELLGEGLIPTLQHAHDNLLVE+P TVPYR T +GQLVE   L  MHDL N E 
Sbjct  158   ISEILDSELLGEGLIPTLQHAHDNLLVENPLTVPYRATTYGQLVECTYLRDMHDLVNREA  217

Query  856   KASDTIHLVPKGMDTIICVK-HQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRET  1032
             + SD I LVP GM  ++ VK  QQF MHCDA+ E IKLLSEPFK+FDFDFWKRPDSSRET
Sbjct  218   ELSDGIRLVPSGMAGVLGVKKQQQFAMHCDALKEEIKLLSEPFKVFDFDFWKRPDSSRET  277

Query  1033  ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKD--PSLSCSEAWCDH  1206
             EL IK T  GT HAIISWWLLQLD EGT+FYST P WI  P DV++   S   S+ WCDH
Sbjct  278   ELHIKTTNDGTVHAIISWWLLQLDSEGTIFYSTEPNWIRRPDDVRELQSSSDSSDNWCDH  337

Query  1207  WKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLS  1386
             WKQ VWF  ++ L V KDE VHLHA HT+ ++SY  KT ++  +V        D Q+ LS
Sbjct  338   WKQSVWFPQSLDLHVLKDEEVHLHAFHTETSISYDFKTLNEKRQVAHVDACTDDFQIALS  397

Query  1387  PERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPG  1566
             PER A+YGD +WR  ML AI  AL+Q+  PLC+VADDSIFL IA+   +++SNVI LFPG
Sbjct  398   PERNALYGDSSWRRLMLNAIEKALRQRIDPLCLVADDSIFLAIAIARLSKSSNVIPLFPG  457

Query  1567  LQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLP  1746
             L  KG QYL  V A+N ++MD I+ + K+    TMQD+H RK++LL+AEPFYYG+D+ LP
Sbjct  458   LGKKGLQYLHKVCAANSFTMDRIETISKKDLLSTMQDSHQRKINLLVAEPFYYGNDNALP  517

Query  1747  WQNLRFW  1767
             WQNLRFW
Sbjct  518   WQNLRFW  524


 Score =   203 bits (516),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = +2

Query  128  SSGSRMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAID  307
             S  RMFQLK DPLTG SEWVVIEE +  + TP  LLATTSYLDMLND+ RNRA+R AID
Sbjct  6    ESTQRMFQLKTDPLTGKSEWVVIEEDEEEKTTPKALLATTSYLDMLNDTRRNRAYRHAID  65

Query  308  KTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSD-SKGMVTACESYLPMVKLMRKVL  484
              VTKPCHVLDIGAGTGLLSMMAARAMG  D   +S  S G VTACESYLPMVKLMRKVL
Sbjct  66   NAVTKPCHVLDIGAGTGLLSMMAARAMGLTDRKGDSSCSNGKVTACESYLPMVKLMRKVL  125

Query  485  RANGIERGIRIINKRSKIL  541
            R+NG++  IR++NKRS  L
Sbjct  126  RSNGMDGKIRLVNKRSDEL  144



>ref|XP_003525834.2| PREDICTED: protein arginine N-methyltransferase 1.6-like isoform 
X1 [Glycine max]
Length=728

 Score =   471 bits (1212),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 218/364 (60%), Positives = 273/364 (75%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHDNLLVE+  TVPYR T +GQLVES  LW++HDL + E 
Sbjct  182   VSEILDSELLGEGLIPTLQHAHDNLLVENALTVPYRATTYGQLVESTFLWQLHDLHSIEA  241

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
               SD I L P G+D+++ VK QQ+ MHC+ I E IKLLSEPFKIF+FDFWKRP+SS ETE
Sbjct  242   TVSDGIQLTPPGLDSVLSVKRQQYAMHCNPIQEEIKLLSEPFKIFEFDFWKRPESSGETE  301

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L +KAT  G  HA++SWW+LQLDREGT++YST P+WI        P+++    WCDHWKQ
Sbjct  302   LCVKATNDGRIHAVVSWWVLQLDREGTIYYSTAPRWI------SSPTITSPVGWCDHWKQ  355

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G+S+ K E +HLHA HT+ ++SY + TQ    E+  ++    D QL L PER
Sbjct  356   CVWFVPGSGISIFKGEEIHLHATHTETSISYNLDTQVPTSEILNHRCMTGDLQLVLPPER  415

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             +AIYGDK WR SMLKA+ + L+ +  PLC+VADDS+FL + +   + AS+V+SL PGL++
Sbjct  416   VAIYGDKGWRLSMLKAVQSMLQGRDHPLCLVADDSVFLPLLVAQLSEASHVMSLLPGLKE  475

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             +G QYLQA A +N  S +CI+VL+KR   LTM D H +KVDLLIAEPFY G D +LPWQN
Sbjct  476   RGLQYLQAAAHANGLSRNCIEVLEKRVKQLTMHDIHQKKVDLLIAEPFYVGHDGMLPWQN  535

Query  1756  LRFW  1767
             LRFW
Sbjct  536   LRFW  539


 Score =   202 bits (513),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 131/180 (73%), Gaps = 18/180 (10%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGS-RMFQLKLDPLTGNSEWVVI  196
            M+S+F KTL  T   R  S     +     T +R MSS + RMFQLKLDP+TGNSEWVVI
Sbjct  1    MISVFPKTLIAT---RFLSRTRPRIHTPKLTAIRTMSSSTQRMFQLKLDPITGNSEWVVI  57

Query  197  EESDTPEQT-----PTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGL  361
            E++D  +++       PLLATTSYLDMLNDSPRN AFR+AI KT+TKPCHVLDIGAGTGL
Sbjct  58   EDNDDGDESFAHNFHQPLLATTSYLDMLNDSPRNTAFRQAIQKTITKPCHVLDIGAGTGL  117

Query  362  LSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            LSMMAARAMG          +G VTACESYLPMVKLM+KVLR NG+E  +++INKRS  L
Sbjct  118  LSMMAARAMG---------DEGRVTACESYLPMVKLMKKVLRINGMEGRVKVINKRSDEL  168



>ref|XP_004152403.1| PREDICTED: protein arginine N-methyltransferase 1.6-like [Cucumis 
sativus]
 ref|XP_004164280.1| PREDICTED: protein arginine N-methyltransferase 1.6-like [Cucumis 
sativus]
 gb|KGN50251.1| hypothetical protein Csa_5G162000 [Cucumis sativus]
Length=738

 Score =   468 bits (1204),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 220/364 (60%), Positives = 276/364 (76%), Gaps = 7/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P TVPYR TI+GQLVES  LWK+HDL NNE 
Sbjct  192   VSEILDSELLGEGLIPTLQHAHDKLLVENPLTVPYRATIYGQLVESTYLWKLHDLRNNEA  251

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KA D IHLVP G D IICVK QQ+ MHCDAI+  +KLLSEPF++F+FDFWKRP+S  E E
Sbjct  252   KACDGIHLVPVG-DPIICVKPQQYAMHCDAIANEVKLLSEPFRVFEFDFWKRPESHAENE  310

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + +KAT  G  HA++SWW LQLDREGT+FYST PKWI  P +      + +  WCDHWKQ
Sbjct  311   VHVKATDSGRVHAVVSWWTLQLDREGTIFYSTAPKWISPPYN------AGAGDWCDHWKQ  364

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWFIP  G+S+ K+E VHL A H D   SY +K Q    E+ ++ ++A++ +L L PER
Sbjct  365   CVWFIPGNGVSISKEEKVHLCASHNDTTFSYHLKAQIPGGEILKHGVNAENFKLILPPER  424

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IA+YGD+ WR +ML AI  AL+ +A   C++ADDS+FLT+ +   ++ + V+SLFPG+++
Sbjct  425   IAVYGDREWRLAMLTAIKTALQGRAPSACMIADDSVFLTLMVACLSKKTLVLSLFPGIRE  484

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG +YLQAV+  N   MD IKV++KR S LT+ DT  +KVDLLI+EPFYYG+D+ LPW N
Sbjct  485   KGTKYLQAVSRVNGICMDSIKVIEKRKSCLTIHDTFEKKVDLLISEPFYYGNDNALPWHN  544

Query  1756  LRFW  1767
             LRFW
Sbjct  545   LRFW  548


 Score =   207 bits (528),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 117/142 (82%), Gaps = 8/142 (6%)
 Frame = +2

Query  119  RNMSSGS--RMFQLKLDPLTGNSEWVVIEES--DTPEQTPTPLLATTSYLDMLNDSPRNR  286
            R MSS S  R+FQL+ DPLTGNSEWVVIEE     PE +  PLLATTSYLDMLNDS RNR
Sbjct  38   RTMSSESTQRLFQLRFDPLTGNSEWVVIEEEAEGVPENSQKPLLATTSYLDMLNDSTRNR  97

Query  287  AFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVK  466
            AF EAIDKT++KPCHVLDIGAGTGLLSMMAARAM   DS    D KGMVTACESYLPMVK
Sbjct  98   AFCEAIDKTISKPCHVLDIGAGTGLLSMMAARAM---DSVIG-DCKGMVTACESYLPMVK  153

Query  467  LMRKVLRANGIERGIRIINKRS  532
            LMRKVLR NG+ER +++INKRS
Sbjct  154  LMRKVLRLNGMERKVKVINKRS  175



>ref|XP_011031876.1| PREDICTED: protein arginine N-methyltransferase 1.6 [Populus 
euphratica]
Length=743

 Score =   465 bits (1196),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 220/364 (60%), Positives = 278/364 (76%), Gaps = 9/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD L V++P TVPYR T +GQLVES  LWK+HDL NNEE
Sbjct  200   VSEILDSELLGEGLIPTLQHAHDMLRVDNPLTVPYRATTYGQLVESTFLWKLHDLSNNEE  259

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +ASD+I L P G+DTI+ VK +Q PMHCDAIS+ I LLSEPFKIF+FDFWKRPDS R+++
Sbjct  260   EASDSIRLAPAGLDTILHVKAKQHPMHCDAISKEINLLSEPFKIFEFDFWKRPDSQRDSK  319

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             LLIKAT  G  HA++SWW+LQLD EGT+FYST P+WI        P  + +  WCDHWKQ
Sbjct  320   LLIKATNDGRIHAVVSWWILQLDSEGTIFYSTAPRWI------TSPIATHTGNWCDHWKQ  373

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWFIP  G+ + K E VHLHAVH+D ++SY + TQ+   ++R+    A D  L LSPER
Sbjct  374   CVWFIPGEGIPISKGEEVHLHAVHSDTSVSYNLATQAT--DIRECDSIAGDSLLTLSPER  431

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IAIYGD+ WR  M  A+ N L+ +  PLC+VADDS+FL++ + H ++ SNVI+LFPGL++
Sbjct  432   IAIYGDRKWRSCMSTALKNLLQARVHPLCVVADDSVFLSLLVAHLSKTSNVIALFPGLRE  491

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             +G QYL+AVA +N  + D I+V +K+   LT+ DT  +KVDLLI EP+YYG++ +LPWQN
Sbjct  492   RGVQYLKAVADANGITADHIEVFQKK-KYLTLNDTKQKKVDLLIGEPYYYGNNGMLPWQN  550

Query  1756  LRFW  1767
              RFW
Sbjct  551   FRFW  554


 Score =   205 bits (522),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 134/192 (70%), Gaps = 24/192 (13%)
 Frame = +2

Query  20   MLSLFCKTLN-PTFPLRVTS----------SHSFSLPRSTRTIVRNMSSGS--RMFQLKL  160
            M+ L  KTL  P+ PLR ++          +   S P  T T  R MSS S  R+FQLKL
Sbjct  1    MIPLLSKTLTIPSLPLRCSTRLILTPNSLFTRFTSTPAPTET--RPMSSDSTPRVFQLKL  58

Query  161  DPLTGNSEWVVIEESDTPEQ-----TPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKP  325
            DPLTGNSEWV+IE+ +  E+     +   LLATTSYLDMLND  RNRAFREAIDKT+TKP
Sbjct  59   DPLTGNSEWVIIEDGNKEEEETFKSSSNALLATTSYLDMLNDDTRNRAFREAIDKTITKP  118

Query  326  CHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIER  505
            CHVLDIGAGTGLLSMMAARAMG  D +     KGMVTACESYLPMVKLMRKVL  NG+ +
Sbjct  119  CHVLDIGAGTGLLSMMAARAMGTCDDS----KKGMVTACESYLPMVKLMRKVLNLNGMGK  174

Query  506  GIRIINKRSKIL  541
             ++I NKRS  L
Sbjct  175  NVKIFNKRSDEL  186



>ref|XP_006579630.1| PREDICTED: protein arginine N-methyltransferase 1.6-like isoform 
X2 [Glycine max]
Length=726

 Score =   464 bits (1193),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 217/364 (60%), Positives = 271/364 (74%), Gaps = 8/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHDNLLVE+  TVPYR T +GQLVES  LW++HDL + E 
Sbjct  182   VSEILDSELLGEGLIPTLQHAHDNLLVENALTVPYRATTYGQLVESTFLWQLHDLHSIEA  241

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
               SD I L P G+D+++ VK QQ+ MHC+ I E IKLLSEPFKIF+FDFWKRP+SS ETE
Sbjct  242   TVSDGIQLTPPGLDSVLSVKRQQYAMHCNPIQEEIKLLSEPFKIFEFDFWKRPESSGETE  301

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L +KAT  G  HA++SWW+LQLDREGT++YST P+WI        P+++    WCDHWKQ
Sbjct  302   LCVKATNDGRIHAVVSWWVLQLDREGTIYYSTAPRWI------SSPTITSPVGWCDHWKQ  355

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G+S+ K E +HLHA HT+ ++SY + TQ    E+  ++    D QL L PER
Sbjct  356   CVWFVPGSGISIFKGEEIHLHATHTETSISYNLDTQVPTSEILNHRCMTGDLQLVLPPER  415

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             +AIYGDK WR SMLKA+ +    +  PLC+VADDS+FL + +   + AS+V+SL PGL++
Sbjct  416   VAIYGDKGWRLSMLKAVQSM--GRDHPLCLVADDSVFLPLLVAQLSEASHVMSLLPGLKE  473

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             +G QYLQA A +N  S +CI+VL+KR   LTM D H +KVDLLIAEPFY G D +LPWQN
Sbjct  474   RGLQYLQAAAHANGLSRNCIEVLEKRVKQLTMHDIHQKKVDLLIAEPFYVGHDGMLPWQN  533

Query  1756  LRFW  1767
             LRFW
Sbjct  534   LRFW  537


 Score =   202 bits (513),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 131/180 (73%), Gaps = 18/180 (10%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGS-RMFQLKLDPLTGNSEWVVI  196
            M+S+F KTL  T   R  S     +     T +R MSS + RMFQLKLDP+TGNSEWVVI
Sbjct  1    MISVFPKTLIAT---RFLSRTRPRIHTPKLTAIRTMSSSTQRMFQLKLDPITGNSEWVVI  57

Query  197  EESDTPEQT-----PTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGL  361
            E++D  +++       PLLATTSYLDMLNDSPRN AFR+AI KT+TKPCHVLDIGAGTGL
Sbjct  58   EDNDDGDESFAHNFHQPLLATTSYLDMLNDSPRNTAFRQAIQKTITKPCHVLDIGAGTGL  117

Query  362  LSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            LSMMAARAMG          +G VTACESYLPMVKLM+KVLR NG+E  +++INKRS  L
Sbjct  118  LSMMAARAMG---------DEGRVTACESYLPMVKLMKKVLRINGMEGRVKVINKRSDEL  168



>gb|KDP39866.1| hypothetical protein JCGZ_03397 [Jatropha curcas]
Length=712

 Score =   461 bits (1187),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 221/364 (61%), Positives = 273/364 (75%), Gaps = 9/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAH+ LLVE+  +VPYR TI+GQLVES  LWK+HDL+NNE 
Sbjct  199   VSEILDSELLGEGLIPTLQHAHEMLLVENSLSVPYRATIYGQLVESTFLWKLHDLYNNEA  258

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KASD I LVP G+DTI+ VK QQ PMHCDAI++ IKLLSEPFK+F+FDFWKRPDS  E E
Sbjct  259   KASDDIRLVPTGLDTILSVKLQQHPMHCDAIAKEIKLLSEPFKVFEFDFWKRPDSHGEAE  318

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L IK T  G  HAI+SWW LQLD EGT+FYST PKWI  P+ +       +  W DHWKQ
Sbjct  319   LHIKTTDNGRVHAILSWWKLQLDYEGTIFYSTSPKWIGLPTKIS------TGHWHDHWKQ  372

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G++V K +++   A+HTDI  SY + T  Q+ E+RQY   A D QL L PER
Sbjct  373   CVWFLPGKGINVDKGDHLLWRAIHTDIGFSYDIPT--QDTEMRQYNFFAGDFQLVLPPER  430

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             I  YGD  WR SML A+ +AL+ +  PLC+VADDS+FLT+A+   +R +N+ISLFPGL++
Sbjct  431   IGTYGDNKWRSSMLTALRSALQARVQPLCVVADDSLFLTLAVARLSRTANLISLFPGLRE  490

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             +G QYLQ VA +N  + D +KV   +   LT+ DT+ +K+DLLI EP+YYG+D +LPWQN
Sbjct  491   RGAQYLQTVADANGLAPDHVKVFHNKKH-LTLHDTNEKKIDLLIGEPYYYGNDGMLPWQN  549

Query  1756  LRFW  1767
             LRFW
Sbjct  550   LRFW  553


 Score =   198 bits (504),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 132/189 (70%), Gaps = 19/189 (10%)
 Frame = +2

Query  20   MLSLFCKTLNPTFP--LRVTSSHSFSLPRS--------TRTIVRNMSSGSRMFQLKLDPL  169
            MLSL  KTL    P  LR+  S    LPR         T  ++ +  S   +FQLK DPL
Sbjct  1    MLSLVSKTLTKPSPSLLRIVYS---ILPRHLPCTSFIVTPALLMSSESTQCVFQLKHDPL  57

Query  170  TGNSEWVVIEESDTPEQ-----TPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHV  334
            TG+SEWVVI + +  ++     +   LLATTSYLDMLNDSPRNRA+REAIDKT+TKPCHV
Sbjct  58   TGDSEWVVIRKDEEEQEEAFGNSHKNLLATTSYLDMLNDSPRNRAYREAIDKTITKPCHV  117

Query  335  LDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIR  514
            LDIGAGTGLLSMMAARAM   +  S +D+KG+VTACESYLPMVKLMRKVL  NG+ R I 
Sbjct  118  LDIGAGTGLLSMMAARAMASGEQKS-TDTKGVVTACESYLPMVKLMRKVLHINGMGRNIN  176

Query  515  IINKRSKIL  541
            IINKRS  L
Sbjct  177  IINKRSDEL  185



>ref|XP_010110826.1| hypothetical protein L484_011809 [Morus notabilis]
 gb|EXC28305.1| hypothetical protein L484_011809 [Morus notabilis]
Length=738

 Score =   461 bits (1185),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 214/364 (59%), Positives = 270/364 (74%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P T+PY+ T +GQLVES  LW+ HDL NNE 
Sbjct  191   VSEILDSELLGEGLIPTLQHAHDMLLVENPVTIPYKATAYGQLVESTFLWRFHDLHNNEA  250

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +ASD + LVP G + I+ VK QQ+ +HC+AI   I LLSEPFKIF+FDFWKRPDS  E +
Sbjct  251   QASDGLRLVPAGFNNILGVKSQQYALHCNAIENEINLLSEPFKIFEFDFWKRPDSYGENQ  310

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L I+AT  G  HA+ISWW+LQ+DREGT+FYST P+WI  P++  D      + WCDHWKQ
Sbjct  311   LSIRATNNGQVHAVISWWVLQMDREGTLFYSTAPRWISMPTNKSD------DDWCDHWKQ  364

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G+ + KD+ VHL A H +  +SY +KTQSQ      +     D QL LSPER
Sbjct  365   CVWFVPGQGIPLAKDQKVHLSAFHDETRISYNLKTQSQVDHPMMHGFKGGDFQLELSPER  424

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             +AIYGD  WR  +   I NALK +  PLC+VADDS+FLT+ + H ++ S+VISLFPGL+ 
Sbjct  425   VAIYGDGEWRTFISTVIGNALKGRVDPLCVVADDSVFLTLLVAHLSKTSSVISLFPGLRS  484

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG +YL+AVA +N +SMD ++VL+K+ +  +M DTH +KVDLLI EPFY G++ +LPWQ 
Sbjct  485   KGARYLEAVADANGFSMDRVQVLEKKKTLSSMIDTHQKKVDLLIGEPFYSGTEGMLPWQK  544

Query  1756  LRFW  1767
             LRFW
Sbjct  545   LRFW  548


 Score =   175 bits (443),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 122/164 (74%), Gaps = 14/164 (9%)
 Frame = +2

Query  89   SLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWVVIEESDTPE---QTPTPLLATTSY  253
            SLPR    I R MSSGS  R+FQL+ DPLTGNSEWVVIEE +  +   Q  +PLLATTSY
Sbjct  15   SLPRFAAAI-RTMSSGSTQRVFQLRHDPLTGNSEWVVIEEDEDEDEHAQPNSPLLATTSY  73

Query  254  LDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAM--------GPADSAS  409
            LDMLNDSPRNRAFR+AIDK +T P HVLDIGAGTGLLSMMAARAM          +++ S
Sbjct  74   LDMLNDSPRNRAFRQAIDKAITSPSHVLDIGAGTGLLSMMAARAMGSAAASTRDHSNTNS  133

Query  410  NSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            N     MVTACESYLPM+KLM+KVLR N +E+ + +INKRS  L
Sbjct  134  NRQWNAMVTACESYLPMLKLMKKVLRHNAMEKAVHVINKRSDEL  177



>ref|XP_004516821.1| PREDICTED: protein arginine N-methyltransferase 1.6-like isoform 
X2 [Cicer arietinum]
Length=679

 Score =   457 bits (1177),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 216/365 (59%), Positives = 272/365 (75%), Gaps = 7/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHDNLLVE+P TVPYR T +GQLVES  LW++HDL NNE 
Sbjct  174   VSEILDSELLGEGLIPTLQHAHDNLLVENPLTVPYRATTYGQLVESTFLWQLHDLQNNEA  233

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              ASD I L P G ++++ VK QQ+ MHCD + E +K LSEPFKIF+FDFWKRP+S  +TE
Sbjct  234   GASDGIRLAPPGSESLLSVKRQQYAMHCDPMREELKTLSEPFKIFEFDFWKRPESYSKTE  293

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L IKAT  G  HA++SWW+LQLDREGT++YST P+WI        P+++    WCDHWKQ
Sbjct  294   LRIKATDDGRVHAVVSWWVLQLDREGTIYYSTAPRWI------SSPTITSPVDWCDHWKQ  347

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ-DCQLFLSPE  1392
             CVWF+P  G+S  + E + LHA HTD ++SY + TQ    +V  + L+   D QL L PE
Sbjct  348   CVWFVPGGGISTFRGEEICLHATHTDTSISYNLDTQMSTTDVLHHGLTTNGDFQLVLPPE  407

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R+AIYGDKNWR SMLKA+ + L+ +   LC+VADDS+FL + +   + A +VIS FPGL+
Sbjct  408   RVAIYGDKNWRLSMLKALKSVLQGRRHLLCVVADDSVFLPLLVAKLSEAPHVISSFPGLK  467

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             ++G QYLQA A +N+ S DCIK ++K    LTM DT+ ++VDLLIAEPFY+G D +LPWQ
Sbjct  468   ERGFQYLQAAARANNLSPDCIKAVEKGVKQLTMHDTNEKQVDLLIAEPFYFGHDGMLPWQ  527

Query  1753  NLRFW  1767
             NLRFW
Sbjct  528   NLRFW  532


 Score =   212 bits (540),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 130/176 (74%), Gaps = 18/176 (10%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWVV  193
            M SLF K L   + LR T S       ST T +R MSS S  R+FQLKL+PLTGNSEWVV
Sbjct  1    MYSLFTKILTAIYFLRRTHS------PSTLTAIRTMSSASTQRIFQLKLNPLTGNSEWVV  54

Query  194  IEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMM  373
            IEE+D  +    PLLATTSYLDMLNDS RN AFREAIDKTVTKPCHVLDIGAGTGLLSMM
Sbjct  55   IEEND-EQAFHQPLLATTSYLDMLNDSTRNTAFREAIDKTVTKPCHVLDIGAGTGLLSMM  113

Query  374  AARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            A+RAMG          KG VTACESYLPMVKLM+KV+R NG+E  I++INKRS  L
Sbjct  114  ASRAMG---------GKGTVTACESYLPMVKLMKKVMRLNGMEGRIKVINKRSDEL  160



>ref|XP_004516820.1| PREDICTED: protein arginine N-methyltransferase 1.6-like isoform 
X1 [Cicer arietinum]
Length=722

 Score =   458 bits (1178),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 216/365 (59%), Positives = 272/365 (75%), Gaps = 7/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHDNLLVE+P TVPYR T +GQLVES  LW++HDL NNE 
Sbjct  174   VSEILDSELLGEGLIPTLQHAHDNLLVENPLTVPYRATTYGQLVESTFLWQLHDLQNNEA  233

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              ASD I L P G ++++ VK QQ+ MHCD + E +K LSEPFKIF+FDFWKRP+S  +TE
Sbjct  234   GASDGIRLAPPGSESLLSVKRQQYAMHCDPMREELKTLSEPFKIFEFDFWKRPESYSKTE  293

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L IKAT  G  HA++SWW+LQLDREGT++YST P+WI        P+++    WCDHWKQ
Sbjct  294   LRIKATDDGRVHAVVSWWVLQLDREGTIYYSTAPRWI------SSPTITSPVDWCDHWKQ  347

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ-DCQLFLSPE  1392
             CVWF+P  G+S  + E + LHA HTD ++SY + TQ    +V  + L+   D QL L PE
Sbjct  348   CVWFVPGGGISTFRGEEICLHATHTDTSISYNLDTQMSTTDVLHHGLTTNGDFQLVLPPE  407

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R+AIYGDKNWR SMLKA+ + L+ +   LC+VADDS+FL + +   + A +VIS FPGL+
Sbjct  408   RVAIYGDKNWRLSMLKALKSVLQGRRHLLCVVADDSVFLPLLVAKLSEAPHVISSFPGLK  467

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             ++G QYLQA A +N+ S DCIK ++K    LTM DT+ ++VDLLIAEPFY+G D +LPWQ
Sbjct  468   ERGFQYLQAAARANNLSPDCIKAVEKGVKQLTMHDTNEKQVDLLIAEPFYFGHDGMLPWQ  527

Query  1753  NLRFW  1767
             NLRFW
Sbjct  528   NLRFW  532


 Score =   212 bits (540),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 130/176 (74%), Gaps = 18/176 (10%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWVV  193
            M SLF K L   + LR T S       ST T +R MSS S  R+FQLKL+PLTGNSEWVV
Sbjct  1    MYSLFTKILTAIYFLRRTHS------PSTLTAIRTMSSASTQRIFQLKLNPLTGNSEWVV  54

Query  194  IEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMM  373
            IEE+D  +    PLLATTSYLDMLNDS RN AFREAIDKTVTKPCHVLDIGAGTGLLSMM
Sbjct  55   IEEND-EQAFHQPLLATTSYLDMLNDSTRNTAFREAIDKTVTKPCHVLDIGAGTGLLSMM  113

Query  374  AARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            A+RAMG          KG VTACESYLPMVKLM+KV+R NG+E  I++INKRS  L
Sbjct  114  ASRAMG---------GKGTVTACESYLPMVKLMKKVMRLNGMEGRIKVINKRSDEL  160



>gb|KEH31648.1| arginine N-methyltransferase [Medicago truncatula]
Length=614

 Score =   453 bits (1165),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 215/364 (59%), Positives = 267/364 (73%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHDNLLVE+P TVPYR T +GQLVES  LW++HDL +NE 
Sbjct  149   VSEILDSELLGEGLIPTLQHAHDNLLVENPLTVPYRATTYGQLVESTFLWRLHDLHSNEA  208

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              ASD I L P G+++++ VK QQ+ MH D I E +K LSEPFKIF+FDFWKRP+S  ETE
Sbjct  209   GASDGIRLTPPGLESVLSVKRQQYAMHVDPIGEELKPLSEPFKIFEFDFWKRPESYGETE  268

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L I AT  G  HA++SWW+LQLDREGT++YST P+WI      + P+ +    WCDHWKQ
Sbjct  269   LCINATDDGRVHAVVSWWVLQLDREGTIYYSTAPRWI------RSPTTTSPVDWCDHWKQ  322

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G+SV K E +HLHA H D ++SY + TQ    E     L+  D QL L PER
Sbjct  323   CVWFVPGSGISVSKGEEIHLHATHNDTSISYNLDTQVSTNEDLHRGLTTGDFQLVLPPER  382

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
              AIYGDK WR SMLKA+ + L+ +   LC+VADDS+FL + +   + AS+VIS FP L++
Sbjct  383   AAIYGDKGWRLSMLKAVESVLQGRRPSLCLVADDSVFLPLLVAKISEASHVISSFPRLKE  442

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
              G +YLQA A +N+ S + I+V+ K    LTM DT+ +KVDLLIAEPFY+G DS+LPWQN
Sbjct  443   NGLRYLQAAACANNISPNSIEVVGKGVKKLTMHDTNQKKVDLLIAEPFYFGHDSMLPWQN  502

Query  1756  LRFW  1767
             LRFW
Sbjct  503   LRFW  506


 Score =   187 bits (476),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 112/141 (79%), Gaps = 12/141 (9%)
 Frame = +2

Query  128  SSGSRMFQLKLDPLTGNSEWVVIEESDTPEQT---PTPLLATTSYLDMLNDSPRNRAFRE  298
            SS  RMFQLK DPLTGNSEWV+I+E D  EQT     PLLATTSYLDMLNDS RN AFRE
Sbjct  4    SSSQRMFQLKFDPLTGNSEWVIIDEDDDDEQTFQFHQPLLATTSYLDMLNDSTRNTAFRE  63

Query  299  AIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRK  478
            AI+KT+T+PCHVLDIGAGTGLLSMMA+RAMG          KG VTACESYLPMVKLM+K
Sbjct  64   AIEKTITEPCHVLDIGAGTGLLSMMASRAMG---------GKGTVTACESYLPMVKLMKK  114

Query  479  VLRANGIERGIRIINKRSKIL  541
            V+R NG+E  I++INKRS  L
Sbjct  115  VMRINGLEGRIKVINKRSDEL  135



>gb|KHG01433.1| Protein arginine N-methyltransferase 1.6 -like protein [Gossypium 
arboreum]
Length=732

 Score =   456 bits (1173),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 212/364 (58%), Positives = 271/364 (74%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P TVP+R   +GQLVES  LWK+HDL   E 
Sbjct  185   VSEILDSELLGEGLIPTLQHAHDKLLVENPLTVPFRAVTYGQLVESTYLWKLHDLSGIEA  244

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             K SD IHLVP G D+II VK +Q+PMHCDAI E IK LSEPFKIF+FDFWKRP+S+ ET+
Sbjct  245   KVSDGIHLVPTGSDSIIYVKSRQYPMHCDAIREEIKPLSEPFKIFEFDFWKRPESNGETK  304

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + ++    G  HA++SWW+LQLDREG VFYST P+WI+ P+++          WCDHWKQ
Sbjct  305   VQVQVIDDGNIHAVVSWWVLQLDREGMVFYSTAPRWINSPANIG------YRDWCDHWKQ  358

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF    G+SV + E V L A HT+ ++SY +  Q    + RQ+  + +D QL LSPER
Sbjct  359   CVWFFRGKGMSVSRGEEVLLEATHTETSVSYNLNVQVPKTDTRQHDHNIRDFQLLLSPER  418

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IAIYGD  WR S+L A+ NAL+ + +PLC+V DDSIFLT+   + ++ S+V+SLFPGL++
Sbjct  419   IAIYGDSKWRSSVLAAVRNALQGRVNPLCVVVDDSIFLTLLAANLSKTSHVLSLFPGLRE  478

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG QYL+ V  +N +SMD ++V +KR   LT+ DTH +KVD+LI EP+YY ++ +LPWQN
Sbjct  479   KGAQYLENVVKANGFSMDRVEVPEKRKPCLTLHDTHGKKVDMLIGEPYYYANEGMLPWQN  538

Query  1756  LRFW  1767
             LRFW
Sbjct  539   LRFW  542


 Score =   189 bits (480),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 128/180 (71%), Gaps = 15/180 (8%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSF---SLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSE  184
            M SLF KTL P+  L  ++  +    SL      + R MSS S  R+FQLKLDPLTGNSE
Sbjct  1    MNSLFPKTLIPSTSLSSSTRLTLTLNSLRHFKVHLPRLMSSDSSYRLFQLKLDPLTGNSE  60

Query  185  WVVIEESDT-PEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGL  361
            WVVIE++D  P+ +  PLLATTSYLDMLNDS RN+AFR AI++TVTKPCHVLDIGAGTGL
Sbjct  61   WVVIEDNDDLPDCSKEPLLATTSYLDMLNDSCRNKAFRSAIERTVTKPCHVLDIGAGTGL  120

Query  362  LSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            LSMMAARAMG           G VTACESYLPM KLMRKVL  N + + I +INKRS  L
Sbjct  121  LSMMAARAMG---------LNGTVTACESYLPMAKLMRKVLHRNSMGKAISLINKRSDEL  171



>gb|AES90914.2| arginine N-methyltransferase [Medicago truncatula]
Length=697

 Score =   453 bits (1165),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 215/364 (59%), Positives = 267/364 (73%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHDNLLVE+P TVPYR T +GQLVES  LW++HDL +NE 
Sbjct  149   VSEILDSELLGEGLIPTLQHAHDNLLVENPLTVPYRATTYGQLVESTFLWRLHDLHSNEA  208

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              ASD I L P G+++++ VK QQ+ MH D I E +K LSEPFKIF+FDFWKRP+S  ETE
Sbjct  209   GASDGIRLTPPGLESVLSVKRQQYAMHVDPIGEELKPLSEPFKIFEFDFWKRPESYGETE  268

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L I AT  G  HA++SWW+LQLDREGT++YST P+WI      + P+ +    WCDHWKQ
Sbjct  269   LCINATDDGRVHAVVSWWVLQLDREGTIYYSTAPRWI------RSPTTTSPVDWCDHWKQ  322

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G+SV K E +HLHA H D ++SY + TQ    E     L+  D QL L PER
Sbjct  323   CVWFVPGSGISVSKGEEIHLHATHNDTSISYNLDTQVSTNEDLHRGLTTGDFQLVLPPER  382

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
              AIYGDK WR SMLKA+ + L+ +   LC+VADDS+FL + +   + AS+VIS FP L++
Sbjct  383   AAIYGDKGWRLSMLKAVESVLQGRRPSLCLVADDSVFLPLLVAKISEASHVISSFPRLKE  442

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
              G +YLQA A +N+ S + I+V+ K    LTM DT+ +KVDLLIAEPFY+G DS+LPWQN
Sbjct  443   NGLRYLQAAACANNISPNSIEVVGKGVKKLTMHDTNQKKVDLLIAEPFYFGHDSMLPWQN  502

Query  1756  LRFW  1767
             LRFW
Sbjct  503   LRFW  506


 Score =   188 bits (477),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 112/141 (79%), Gaps = 12/141 (9%)
 Frame = +2

Query  128  SSGSRMFQLKLDPLTGNSEWVVIEESDTPEQT---PTPLLATTSYLDMLNDSPRNRAFRE  298
            SS  RMFQLK DPLTGNSEWV+I+E D  EQT     PLLATTSYLDMLNDS RN AFRE
Sbjct  4    SSSQRMFQLKFDPLTGNSEWVIIDEDDDDEQTFQFHQPLLATTSYLDMLNDSTRNTAFRE  63

Query  299  AIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRK  478
            AI+KT+T+PCHVLDIGAGTGLLSMMA+RAMG          KG VTACESYLPMVKLM+K
Sbjct  64   AIEKTITEPCHVLDIGAGTGLLSMMASRAMG---------GKGTVTACESYLPMVKLMKK  114

Query  479  VLRANGIERGIRIINKRSKIL  541
            V+R NG+E  I++INKRS  L
Sbjct  115  VMRINGLEGRIKVINKRSDEL  135



>ref|XP_007039849.1| Arginine N-methyltransferase 1.6 isoform 3 [Theobroma cacao]
 gb|EOY24350.1| Arginine N-methyltransferase 1.6 isoform 3 [Theobroma cacao]
Length=702

 Score =   452 bits (1164),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 214/364 (59%), Positives = 269/364 (74%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P TVPYR   +GQLVES  LWK+HDLF +E 
Sbjct  185   VSEILDSELLGEGLIPTLQHAHDKLLVENPLTVPYRAVTYGQLVESPYLWKLHDLFGSEA  244

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KASD IHLVP G++T+I  K QQ PMHCDAI + IKLLSEPFKIF+FDFWKRPDS  +T+
Sbjct  245   KASDGIHLVPTGLETVIHFKLQQHPMHCDAIRKEIKLLSEPFKIFEFDFWKRPDSHGKTK  304

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + IK T  G  HA++SWW+LQLDREGTVFYST P WI   + +       S  WCDHWKQ
Sbjct  305   VQIKMTDTGCIHAVVSWWILQLDREGTVFYSTAPSWISSAAKIG------SGNWCDHWKQ  358

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+   G+ V + E V L A H + ++SY +       ++R++     D QL +SPER
Sbjct  359   CVWFLQGKGMPVSEGEEVLLEATHEETSVSYNLSVLGSQTDIREHDQRIGDFQLLVSPER  418

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IA YGD  WR S+L A+  AL+ + +PLC+VADDSIFLT+   + ++ S+VISLFPGL+D
Sbjct  419   IATYGDSEWRLSVLAAVRKALQGRVNPLCVVADDSIFLTLLAANLSKTSHVISLFPGLRD  478

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG +Y++ VA +N +SMD ++V +K  + LTM DTH +KVDLLI EP+YY ++ +LPWQN
Sbjct  479   KGAKYVETVAKANAFSMDRVEVPEKWKACLTMLDTHGKKVDLLIGEPYYYANEGMLPWQN  538

Query  1756  LRFW  1767
             LRFW
Sbjct  539   LRFW  542


 Score =   198 bits (503),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 128/177 (72%), Gaps = 15/177 (8%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSF---SLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSE  184
            M +L  KTL P+  LR+++  +    S       + R MSS S  ++FQLKLDPLTGNSE
Sbjct  1    MNALIYKTLIPSISLRLSTRLTLILNSFLHFKAPLPRAMSSYSPQQVFQLKLDPLTGNSE  60

Query  185  WVVIEESDT-PEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGL  361
            WVVI++SD  PE +  PLLA+TSYLDMLNDS RN+AFR AIDKTVTKPCHVLDIGAGTGL
Sbjct  61   WVVIQDSDELPECSKEPLLASTSYLDMLNDSHRNKAFRLAIDKTVTKPCHVLDIGAGTGL  120

Query  362  LSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRS  532
            LSMMAARAMG           G VTACESYLPM KLMRKVL  NGI + I +INKRS
Sbjct  121  LSMMAARAMG---------LNGRVTACESYLPMAKLMRKVLHRNGIGKNINLINKRS  168



>ref|XP_007039847.1| Arginine methyltransferase 7, putative isoform 1 [Theobroma cacao]
 gb|EOY24348.1| Arginine methyltransferase 7, putative isoform 1 [Theobroma cacao]
Length=732

 Score =   453 bits (1165),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 214/364 (59%), Positives = 269/364 (74%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P TVPYR   +GQLVES  LWK+HDLF +E 
Sbjct  185   VSEILDSELLGEGLIPTLQHAHDKLLVENPLTVPYRAVTYGQLVESPYLWKLHDLFGSEA  244

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KASD IHLVP G++T+I  K QQ PMHCDAI + IKLLSEPFKIF+FDFWKRPDS  +T+
Sbjct  245   KASDGIHLVPTGLETVIHFKLQQHPMHCDAIRKEIKLLSEPFKIFEFDFWKRPDSHGKTK  304

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + IK T  G  HA++SWW+LQLDREGTVFYST P WI   + +       S  WCDHWKQ
Sbjct  305   VQIKMTDTGCIHAVVSWWILQLDREGTVFYSTAPSWISSAAKIG------SGNWCDHWKQ  358

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+   G+ V + E V L A H + ++SY +       ++R++     D QL +SPER
Sbjct  359   CVWFLQGKGMPVSEGEEVLLEATHEETSVSYNLSVLGSQTDIREHDQRIGDFQLLVSPER  418

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IA YGD  WR S+L A+  AL+ + +PLC+VADDSIFLT+   + ++ S+VISLFPGL+D
Sbjct  419   IATYGDSEWRLSVLAAVRKALQGRVNPLCVVADDSIFLTLLAANLSKTSHVISLFPGLRD  478

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG +Y++ VA +N +SMD ++V +K  + LTM DTH +KVDLLI EP+YY ++ +LPWQN
Sbjct  479   KGAKYVETVAKANAFSMDRVEVPEKWKACLTMLDTHGKKVDLLIGEPYYYANEGMLPWQN  538

Query  1756  LRFW  1767
             LRFW
Sbjct  539   LRFW  542


 Score =   198 bits (504),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 129/180 (72%), Gaps = 15/180 (8%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSF---SLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSE  184
            M +L  KTL P+  LR+++  +    S       + R MSS S  ++FQLKLDPLTGNSE
Sbjct  1    MNALIYKTLIPSISLRLSTRLTLILNSFLHFKAPLPRAMSSYSPQQVFQLKLDPLTGNSE  60

Query  185  WVVIEESDT-PEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGL  361
            WVVI++SD  PE +  PLLA+TSYLDMLNDS RN+AFR AIDKTVTKPCHVLDIGAGTGL
Sbjct  61   WVVIQDSDELPECSKEPLLASTSYLDMLNDSHRNKAFRLAIDKTVTKPCHVLDIGAGTGL  120

Query  362  LSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            LSMMAARAMG           G VTACESYLPM KLMRKVL  NGI + I +INKRS  L
Sbjct  121  LSMMAARAMG---------LNGRVTACESYLPMAKLMRKVLHRNGIGKNINLINKRSDEL  171



>ref|XP_007039850.1| Arginine methyltransferase 7, putative isoform 4 [Theobroma cacao]
 gb|EOY24351.1| Arginine methyltransferase 7, putative isoform 4 [Theobroma cacao]
Length=707

 Score =   452 bits (1163),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 214/364 (59%), Positives = 269/364 (74%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P TVPYR   +GQLVES  LWK+HDLF +E 
Sbjct  185   VSEILDSELLGEGLIPTLQHAHDKLLVENPLTVPYRAVTYGQLVESPYLWKLHDLFGSEA  244

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KASD IHLVP G++T+I  K QQ PMHCDAI + IKLLSEPFKIF+FDFWKRPDS  +T+
Sbjct  245   KASDGIHLVPTGLETVIHFKLQQHPMHCDAIRKEIKLLSEPFKIFEFDFWKRPDSHGKTK  304

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + IK T  G  HA++SWW+LQLDREGTVFYST P WI   + +       S  WCDHWKQ
Sbjct  305   VQIKMTDTGCIHAVVSWWILQLDREGTVFYSTAPSWISSAAKIG------SGNWCDHWKQ  358

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+   G+ V + E V L A H + ++SY +       ++R++     D QL +SPER
Sbjct  359   CVWFLQGKGMPVSEGEEVLLEATHEETSVSYNLSVLGSQTDIREHDQRIGDFQLLVSPER  418

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IA YGD  WR S+L A+  AL+ + +PLC+VADDSIFLT+   + ++ S+VISLFPGL+D
Sbjct  419   IATYGDSEWRLSVLAAVRKALQGRVNPLCVVADDSIFLTLLAANLSKTSHVISLFPGLRD  478

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG +Y++ VA +N +SMD ++V +K  + LTM DTH +KVDLLI EP+YY ++ +LPWQN
Sbjct  479   KGAKYVETVAKANAFSMDRVEVPEKWKACLTMLDTHGKKVDLLIGEPYYYANEGMLPWQN  538

Query  1756  LRFW  1767
             LRFW
Sbjct  539   LRFW  542


 Score =   198 bits (503),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 129/180 (72%), Gaps = 15/180 (8%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSF---SLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSE  184
            M +L  KTL P+  LR+++  +    S       + R MSS S  ++FQLKLDPLTGNSE
Sbjct  1    MNALIYKTLIPSISLRLSTRLTLILNSFLHFKAPLPRAMSSYSPQQVFQLKLDPLTGNSE  60

Query  185  WVVIEESDT-PEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGL  361
            WVVI++SD  PE +  PLLA+TSYLDMLNDS RN+AFR AIDKTVTKPCHVLDIGAGTGL
Sbjct  61   WVVIQDSDELPECSKEPLLASTSYLDMLNDSHRNKAFRLAIDKTVTKPCHVLDIGAGTGL  120

Query  362  LSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            LSMMAARAMG           G VTACESYLPM KLMRKVL  NGI + I +INKRS  L
Sbjct  121  LSMMAARAMG---------LNGRVTACESYLPMAKLMRKVLHRNGIGKNINLINKRSDEL  171



>ref|XP_007039848.1| Arginine methyltransferase 7, putative isoform 2 [Theobroma cacao]
 gb|EOY24349.1| Arginine methyltransferase 7, putative isoform 2 [Theobroma cacao]
Length=740

 Score =   452 bits (1164),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 214/364 (59%), Positives = 269/364 (74%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P TVPYR   +GQLVES  LWK+HDLF +E 
Sbjct  185   VSEILDSELLGEGLIPTLQHAHDKLLVENPLTVPYRAVTYGQLVESPYLWKLHDLFGSEA  244

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KASD IHLVP G++T+I  K QQ PMHCDAI + IKLLSEPFKIF+FDFWKRPDS  +T+
Sbjct  245   KASDGIHLVPTGLETVIHFKLQQHPMHCDAIRKEIKLLSEPFKIFEFDFWKRPDSHGKTK  304

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + IK T  G  HA++SWW+LQLDREGTVFYST P WI   + +       S  WCDHWKQ
Sbjct  305   VQIKMTDTGCIHAVVSWWILQLDREGTVFYSTAPSWISSAAKIG------SGNWCDHWKQ  358

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+   G+ V + E V L A H + ++SY +       ++R++     D QL +SPER
Sbjct  359   CVWFLQGKGMPVSEGEEVLLEATHEETSVSYNLSVLGSQTDIREHDQRIGDFQLLVSPER  418

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IA YGD  WR S+L A+  AL+ + +PLC+VADDSIFLT+   + ++ S+VISLFPGL+D
Sbjct  419   IATYGDSEWRLSVLAAVRKALQGRVNPLCVVADDSIFLTLLAANLSKTSHVISLFPGLRD  478

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG +Y++ VA +N +SMD ++V +K  + LTM DTH +KVDLLI EP+YY ++ +LPWQN
Sbjct  479   KGAKYVETVAKANAFSMDRVEVPEKWKACLTMLDTHGKKVDLLIGEPYYYANEGMLPWQN  538

Query  1756  LRFW  1767
             LRFW
Sbjct  539   LRFW  542


 Score =   198 bits (503),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 128/177 (72%), Gaps = 15/177 (8%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSF---SLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSE  184
            M +L  KTL P+  LR+++  +    S       + R MSS S  ++FQLKLDPLTGNSE
Sbjct  1    MNALIYKTLIPSISLRLSTRLTLILNSFLHFKAPLPRAMSSYSPQQVFQLKLDPLTGNSE  60

Query  185  WVVIEESDT-PEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGL  361
            WVVI++SD  PE +  PLLA+TSYLDMLNDS RN+AFR AIDKTVTKPCHVLDIGAGTGL
Sbjct  61   WVVIQDSDELPECSKEPLLASTSYLDMLNDSHRNKAFRLAIDKTVTKPCHVLDIGAGTGL  120

Query  362  LSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRS  532
            LSMMAARAMG           G VTACESYLPM KLMRKVL  NGI + I +INKRS
Sbjct  121  LSMMAARAMG---------LNGRVTACESYLPMAKLMRKVLHRNGIGKNINLINKRS  168



>ref|XP_003608717.1| Protein arginine N-methyltransferase [Medicago truncatula]
Length=869

 Score =   455 bits (1170),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 215/364 (59%), Positives = 267/364 (73%), Gaps = 6/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHDNLLVE+P TVPYR T +GQLVES  LW++HDL +NE 
Sbjct  149   VSEILDSELLGEGLIPTLQHAHDNLLVENPLTVPYRATTYGQLVESTFLWRLHDLHSNEA  208

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              ASD I L P G+++++ VK QQ+ MH D I E +K LSEPFKIF+FDFWKRP+S  ETE
Sbjct  209   GASDGIRLTPPGLESVLSVKRQQYAMHVDPIGEELKPLSEPFKIFEFDFWKRPESYGETE  268

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L I AT  G  HA++SWW+LQLDREGT++YST P+WI      + P+ +    WCDHWKQ
Sbjct  269   LCINATDDGRVHAVVSWWVLQLDREGTIYYSTAPRWI------RSPTTTSPVDWCDHWKQ  322

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G+SV K E +HLHA H D ++SY + TQ    E     L+  D QL L PER
Sbjct  323   CVWFVPGSGISVSKGEEIHLHATHNDTSISYNLDTQVSTNEDLHRGLTTGDFQLVLPPER  382

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
              AIYGDK WR SMLKA+ + L+ +   LC+VADDS+FL + +   + AS+VIS FP L++
Sbjct  383   AAIYGDKGWRLSMLKAVESVLQGRRPSLCLVADDSVFLPLLVAKISEASHVISSFPRLKE  442

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
              G +YLQA A +N+ S + I+V+ K    LTM DT+ +KVDLLIAEPFY+G DS+LPWQN
Sbjct  443   NGLRYLQAAACANNISPNSIEVVGKGVKKLTMHDTNQKKVDLLIAEPFYFGHDSMLPWQN  502

Query  1756  LRFW  1767
             LRFW
Sbjct  503   LRFW  506


 Score =   189 bits (479),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 112/141 (79%), Gaps = 12/141 (9%)
 Frame = +2

Query  128  SSGSRMFQLKLDPLTGNSEWVVIEESDTPEQT---PTPLLATTSYLDMLNDSPRNRAFRE  298
            SS  RMFQLK DPLTGNSEWV+I+E D  EQT     PLLATTSYLDMLNDS RN AFRE
Sbjct  4    SSSQRMFQLKFDPLTGNSEWVIIDEDDDDEQTFQFHQPLLATTSYLDMLNDSTRNTAFRE  63

Query  299  AIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRK  478
            AI+KT+T+PCHVLDIGAGTGLLSMMA+RAMG          KG VTACESYLPMVKLM+K
Sbjct  64   AIEKTITEPCHVLDIGAGTGLLSMMASRAMG---------GKGTVTACESYLPMVKLMKK  114

Query  479  VLRANGIERGIRIINKRSKIL  541
            V+R NG+E  I++INKRS  L
Sbjct  115  VMRINGLEGRIKVINKRSDEL  135



>ref|XP_010941140.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Elaeis guineensis]
Length=753

 Score =   450 bits (1158),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 211/365 (58%), Positives = 274/365 (75%), Gaps = 4/365 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQ AH+ LLV++P+TVPYR T +GQLVES  LWK+HDL+N+E 
Sbjct  207   VSEILDSELLGEGLIPTLQQAHEMLLVKNPQTVPYRATTYGQLVESTFLWKLHDLYNSEL  266

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              ASD IHL P G++ II VK QQ+ MHCDAIS+ ++LLSEPFKIF+FDFWKRPDS  ETE
Sbjct  267   NASDGIHLAPAGLERIIHVKQQQYAMHCDAISKELRLLSEPFKIFEFDFWKRPDSHGETE  326

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLS-CSEAWCDHWK  1212
             + +KA   G  HA+ISWW+LQLD EG++FYST P+W+        P+L+   E WCDHWK
Sbjct  327   IWVKAIDDGKVHAVISWWVLQLDYEGSIFYSTAPRWMRSSDTEIVPTLAPGGENWCDHWK  386

Query  1213  QCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             QCVW     G+ V KD++V   AVH D ++SY +K   ++        ++ DC + L PE
Sbjct  387   QCVWLTHGAGMPVLKDKHVLFKAVHNDTSVSYYLKFDDRSA---YNDFNSADCLIALLPE  443

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             RIA+YGDK+WR ++++AI NAL  ++SPLC+VADDS+FLTI     ++ SNVIS FPGLQ
Sbjct  444   RIALYGDKDWRSALIRAIKNALHVRSSPLCVVADDSVFLTILTASLSKTSNVISTFPGLQ  503

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             +KG +YLQAVA +N +S+D I+V+ +R++ LT      RKVDLL+ EP+YYG++ +LPWQ
Sbjct  504   EKGARYLQAVADANGFSIDHIEVIGRRTACLTSDGFRQRKVDLLVGEPYYYGNEGMLPWQ  563

Query  1753  NLRFW  1767
             NLRFW
Sbjct  564   NLRFW  568


 Score =   178 bits (451),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 113/140 (81%), Gaps = 9/140 (6%)
 Frame = +2

Query  137  SRMFQLKLDPLTGNSEWVVIEESDT-----PEQTPTPLLATTSYLDMLNDSPRNRAFREA  301
            +R FQL+++PLTG+SEW+V+EE D       ++TP  LLATTSYLDMLNDSPRNRAFREA
Sbjct  58   TRSFQLQVNPLTGDSEWIVVEEGDEEGGEEQKKTPKSLLATTSYLDMLNDSPRNRAFREA  117

Query  302  IDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            I+KT+T+PCHVLDIGAGTGLLSMMAARAM     A     +G V+ACESYLPM KL+++V
Sbjct  118  IEKTITRPCHVLDIGAGTGLLSMMAARAMAKLGGA----EEGRVSACESYLPMGKLLQRV  173

Query  482  LRANGIERGIRIINKRSKIL  541
            LRANG+E+ +++ +KRS  L
Sbjct  174  LRANGMEKKVKVFHKRSDEL  193



>ref|XP_010941139.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Elaeis guineensis]
Length=754

 Score =   449 bits (1156),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 211/366 (58%), Positives = 274/366 (75%), Gaps = 5/366 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQ AH+ LLV++P+TVPYR T +GQLVES  LWK+HDL+N+E 
Sbjct  207   VSEILDSELLGEGLIPTLQQAHEMLLVKNPQTVPYRATTYGQLVESTFLWKLHDLYNSEL  266

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              ASD IHL P G++ II VK QQ+ MHCDAIS+ ++LLSEPFKIF+FDFWKRPDS  ETE
Sbjct  267   NASDGIHLAPAGLERIIHVKQQQYAMHCDAISKELRLLSEPFKIFEFDFWKRPDSHGETE  326

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLS--CSEAWCDHW  1209
             + +KA   G  HA+ISWW+LQLD EG++FYST P+W+        P+L+    E WCDHW
Sbjct  327   IWVKAIDDGKVHAVISWWVLQLDYEGSIFYSTAPRWMRSSDTEIVPTLAPVGGENWCDHW  386

Query  1210  KQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSP  1389
             KQCVW     G+ V KD++V   AVH D ++SY +K   ++        ++ DC + L P
Sbjct  387   KQCVWLTHGAGMPVLKDKHVLFKAVHNDTSVSYYLKFDDRSA---YNDFNSADCLIALLP  443

Query  1390  ERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGL  1569
             ERIA+YGDK+WR ++++AI NAL  ++SPLC+VADDS+FLTI     ++ SNVIS FPGL
Sbjct  444   ERIALYGDKDWRSALIRAIKNALHVRSSPLCVVADDSVFLTILTASLSKTSNVISTFPGL  503

Query  1570  QDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPW  1749
             Q+KG +YLQAVA +N +S+D I+V+ +R++ LT      RKVDLL+ EP+YYG++ +LPW
Sbjct  504   QEKGARYLQAVADANGFSIDHIEVIGRRTACLTSDGFRQRKVDLLVGEPYYYGNEGMLPW  563

Query  1750  QNLRFW  1767
             QNLRFW
Sbjct  564   QNLRFW  569


 Score =   178 bits (451),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 113/140 (81%), Gaps = 9/140 (6%)
 Frame = +2

Query  137  SRMFQLKLDPLTGNSEWVVIEESDT-----PEQTPTPLLATTSYLDMLNDSPRNRAFREA  301
            +R FQL+++PLTG+SEW+V+EE D       ++TP  LLATTSYLDMLNDSPRNRAFREA
Sbjct  58   TRSFQLQVNPLTGDSEWIVVEEGDEEGGEEQKKTPKSLLATTSYLDMLNDSPRNRAFREA  117

Query  302  IDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            I+KT+T+PCHVLDIGAGTGLLSMMAARAM     A     +G V+ACESYLPM KL+++V
Sbjct  118  IEKTITRPCHVLDIGAGTGLLSMMAARAMAKLGGA----EEGRVSACESYLPMGKLLQRV  173

Query  482  LRANGIERGIRIINKRSKIL  541
            LRANG+E+ +++ +KRS  L
Sbjct  174  LRANGMEKKVKVFHKRSDEL  193



>gb|KCW77779.1| hypothetical protein EUGRSUZ_D02075 [Eucalyptus grandis]
Length=591

 Score =   442 bits (1137),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 208/364 (57%), Positives = 266/364 (73%), Gaps = 9/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P TVPY+  ++GQLVES  LWK+HDL+NNE 
Sbjct  237   VSEILDSELLGEGLIPTLQHAHDMLLVENPVTVPYKAIVYGQLVESTYLWKLHDLYNNEA  296

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D IHLVP G++ II VK QQ PMHCDAI   IKLLSEPF+IF+F+F KRP+S  ET 
Sbjct  297   EILDGIHLVPAGLERIIGVKLQQHPMHCDAIRREIKLLSEPFRIFEFNFGKRPESHGETA  356

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + +KAT  G  +A+ISWW+LQLD EG++ YST PKWI         +LS +  WCDHWKQ
Sbjct  357   VRVKATGSGQVNAVISWWMLQLDDEGSIHYSTAPKWI---------TLSGAGNWCDHWKQ  407

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWFIP  G+ + KDE + L A H D ++SY ++          + +   D  L LSPER
Sbjct  408   CVWFIPGKGVPLAKDEEISLRAAHGDTSISYQLEPDQPKSTGGDHHVKGGDFCLTLSPER  467

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IAIYGD  WR S+L A+   L+++A  +C++ADDSIFL + +   + AS++++LFPGLQD
Sbjct  468   IAIYGDAEWRLSVLNALKTVLQRRAPSVCVIADDSIFLALLVARFSTASHIMALFPGLQD  527

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG  YL+AVA +N +SMD ++ ++K+ +  T  DTH++ VDLLIAEPFYYGSD +LPWQN
Sbjct  528   KGIHYLKAVADANGFSMDRVEFVRKKMANWTGDDTHNKAVDLLIAEPFYYGSDGMLPWQN  587

Query  1756  LRFW  1767
             LRFW
Sbjct  588   LRFW  591


 Score =   206 bits (523),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 120/157 (76%), Gaps = 5/157 (3%)
 Frame = +2

Query  77   SHSFSLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWVVIEE---SDTPEQTPTPLLA  241
            S S S+P S   + R MSSGS  R+FQLKLDPLTGNSEWVVIEE      PE     LLA
Sbjct  64   SASRSVPLSGLALARAMSSGSAQRVFQLKLDPLTGNSEWVVIEEDAGGTAPEGLHQGLLA  123

Query  242  TTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDS  421
            TTSYLDMLNDS RNRAFREAIDK V+ PC VLDIGAGTGLLSMMAARAMG  DS +   +
Sbjct  124  TTSYLDMLNDSRRNRAFREAIDKAVSGPCRVLDIGAGTGLLSMMAARAMGLGDSPTCRSN  183

Query  422  KGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRS  532
             G VTACESYLPMVKLMRKVLRAN + R I ++NKRS
Sbjct  184  NGSVTACESYLPMVKLMRKVLRANDMARSITVLNKRS  220



>ref|XP_006440322.1| hypothetical protein CICLE_v10023597mg [Citrus clementina]
 gb|ESR53562.1| hypothetical protein CICLE_v10023597mg [Citrus clementina]
Length=682

 Score =   442 bits (1138),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 217/364 (60%), Positives = 266/364 (73%), Gaps = 24/364 (7%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P TVP R T +GQLVES  LWK+HDL+NNE 
Sbjct  153   VSEILDSELLGEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTFLWKLHDLYNNEA  212

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KA D IHLVP GMD+I+ VK QQ+ MHCDAI++ IKLLSEPFKIF+FDFWKRPDS  E E
Sbjct  213   KALDDIHLVPAGMDSILHVKSQQYAMHCDAITKEIKLLSEPFKIFEFDFWKRPDSHGEAE  272

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L IK+T  G  HA++SWW+LQLDREGT+FYST P+WI  P          +  WCDHWKQ
Sbjct  273   LQIKSTDDGRVHAVVSWWVLQLDREGTIFYSTAPRWISLPIH------KSTGNWCDHWKQ  326

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWFIP  G+S+ K E +  HA+HT+ ++SY +K+Q    + RQ+ L+A+D QL L PER
Sbjct  327   CVWFIPGKGMSICKGEELLFHALHTETSVSYELKSQIPITDERQHNLNAKDFQLALPPER  386

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IAIYGD  WR SM+ A+ NAL+ +  PLC+VADDS+FLTI +   AR             
Sbjct  387   IAIYGDGEWRLSMVMAMRNALQGRVQPLCVVADDSVFLTICV---ARC------------  431

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
                QYL+ VA  N +S+D +++L+K    LTM DT  +KVDLLI EP+Y+G+D +LPWQN
Sbjct  432   ---QYLRTVADPNCFSIDRVEILQKGKKCLTMDDTQQKKVDLLIGEPYYFGNDGMLPWQN  488

Query  1756  LRFW  1767
             LRFW
Sbjct  489   LRFW  492


 Score =   214 bits (546),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = +2

Query  131  SGSRMFQLKLDPLTGNSEWVVIEES-DTPEQTPTPLLATTSYLDMLNDSPRNRAFREAID  307
            S  RMFQLKLDPLTGNSEWVVIEE+ D PE +  PLLATTSYLDMLNDS RNRA+R AID
Sbjct  2    STQRMFQLKLDPLTGNSEWVVIEENEDVPESSQEPLLATTSYLDMLNDSYRNRAYRLAID  61

Query  308  KTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLR  487
            K VTK CHVLDIGAGTGLLSMMAARAMG +DS ++ ++KGMVTACESYLPMVKLM+KVL 
Sbjct  62   KMVTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTSLNTKGMVTACESYLPMVKLMKKVLH  121

Query  488  ANGIERGIRIINKRSKIL  541
             NG+ R I++INKRS  L
Sbjct  122  VNGMGRNIKVINKRSDEL  139



>ref|XP_010053469.1| PREDICTED: protein arginine N-methyltransferase 7 [Eucalyptus 
grandis]
Length=734

 Score =   440 bits (1132),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/364 (57%), Positives = 266/364 (73%), Gaps = 9/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P TVPY+  ++GQLVES  LWK+HDL+NNE 
Sbjct  192   VSEILDSELLGEGLIPTLQHAHDMLLVENPVTVPYKAIVYGQLVESTYLWKLHDLYNNEA  251

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D IHLVP G++ II VK QQ PMHCDAI   IKLLSEPF+IF+F+F KRP+S  ET 
Sbjct  252   EILDGIHLVPAGLERIIGVKLQQHPMHCDAIRREIKLLSEPFRIFEFNFGKRPESHGETA  311

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + +KAT  G  +A+ISWW+LQLD EG++ YST PKWI         +LS +  WCDHWKQ
Sbjct  312   VRVKATGSGQVNAVISWWMLQLDDEGSIHYSTAPKWI---------TLSGAGNWCDHWKQ  362

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWFIP  G+ + KDE + L A H D ++SY ++          + +   D  L LSPER
Sbjct  363   CVWFIPGKGVPLAKDEEISLRAAHGDTSISYQLEPDQPKSTGGDHHVKGGDFCLTLSPER  422

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IAIYGD  WR S+L A+   L+++A  +C++ADDSIFL + +   + AS++++LFPGLQD
Sbjct  423   IAIYGDAEWRLSVLNALKTVLQRRAPSVCVIADDSIFLALLVARFSTASHIMALFPGLQD  482

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG  YL+AVA +N +SMD ++ ++K+ +  T  DTH++ VDLLIAEPFYYGSD +LPWQN
Sbjct  483   KGIHYLKAVADANGFSMDRVEFVRKKMANWTGDDTHNKAVDLLIAEPFYYGSDGMLPWQN  542

Query  1756  LRFW  1767
             LRFW
Sbjct  543   LRFW  546


 Score =   205 bits (522),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 120/157 (76%), Gaps = 5/157 (3%)
 Frame = +2

Query  77   SHSFSLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWVVIEE---SDTPEQTPTPLLA  241
            S S S+P S   + R MSSGS  R+FQLKLDPLTGNSEWVVIEE      PE     LLA
Sbjct  19   SASRSVPLSGLALARAMSSGSAQRVFQLKLDPLTGNSEWVVIEEDAGGTAPEGLHQGLLA  78

Query  242  TTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDS  421
            TTSYLDMLNDS RNRAFREAIDK V+ PC VLDIGAGTGLLSMMAARAMG  DS +   +
Sbjct  79   TTSYLDMLNDSRRNRAFREAIDKAVSGPCRVLDIGAGTGLLSMMAARAMGLGDSPTCRSN  138

Query  422  KGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRS  532
             G VTACESYLPMVKLMRKVLRAN + R I ++NKRS
Sbjct  139  NGSVTACESYLPMVKLMRKVLRANDMARSITVLNKRS  175



>ref|XP_010695157.1| PREDICTED: protein arginine N-methyltransferase 1.6 [Beta vulgaris 
subsp. vulgaris]
Length=696

 Score =   438 bits (1126),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/364 (56%), Positives = 267/364 (73%), Gaps = 8/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P TVPYR  ++GQL+ES  LWK+HDL+NN+ 
Sbjct  151   VSEILDSELLGEGLIPTLQHAHDELLVQNPLTVPYRAIVYGQLLESSFLWKLHDLYNNDI  210

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              ASD I L+P  +  I+ VK +Q+PMHCD +    KLLSEPFKIF+FDF KRPDS  E +
Sbjct  211   SASDAIRLLPPQLPYILSVKPKQYPMHCDPLQHESKLLSEPFKIFEFDFSKRPDSYGEAD  270

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + IK+T  GT +A+ISWW+LQLD++G ++YST PKWI        P    SE WCDHWKQ
Sbjct  271   IFIKSTAAGTVNAVISWWVLQLDQQGAIYYSTAPKWIK----YLQPG---SETWCDHWKQ  323

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  GLSV +DE +HLHAVH+DI++SY ++  SQ  +  +  +     QL L PE+
Sbjct  324   CVWFVPGKGLSVSRDEEIHLHAVHSDISISYSLRVASQRTK-NENSIRNDGFQLILPPEK  382

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IA Y D +WR S+L A+ NA  +K  PLC VADDSIFL  A+ H  + S ++ LFPGL++
Sbjct  383   IATYSDDSWRHSVLLAVQNAFCRKDYPLCFVADDSIFLATAIAHLCKTSRIMLLFPGLRE  442

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             +G QYLQA+A +N +SM+C+K+L  R   +TM DT  +K+D+L+ EPFY GS++ LPW+N
Sbjct  443   RGFQYLQAIAETNQFSMNCMKLLDHRIDCMTMYDTDGKKIDVLVGEPFYLGSENYLPWRN  502

Query  1756  LRFW  1767
             LRFW
Sbjct  503   LRFW  506


 Score =   183 bits (465),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 110/141 (78%), Gaps = 6/141 (4%)
 Frame = +2

Query  119  RNMSSGSRMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFRE  298
            ++  S S+MFQLKLDPLTGNSEWVV+   D        L ATTSYLDMLNDS RN+A+RE
Sbjct  3    QSHGSSSQMFQLKLDPLTGNSEWVVVGVDDDGAGMEVEL-ATTSYLDMLNDSCRNKAYRE  61

Query  299  AIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRK  478
            AIDKTVT+PC VLDIGAGTGLLSM+AARAM      +NSDSKG V ACESYLPM KLMRK
Sbjct  62   AIDKTVTRPCCVLDIGAGTGLLSMIAARAM-----PTNSDSKGSVFACESYLPMFKLMRK  116

Query  479  VLRANGIERGIRIINKRSKIL  541
            ++R N +++ I+IINKRS  L
Sbjct  117  LVRCNSLDKNIKIINKRSDEL  137



>gb|KCW77777.1| hypothetical protein EUGRSUZ_D02075 [Eucalyptus grandis]
Length=779

 Score =   440 bits (1132),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 208/364 (57%), Positives = 266/364 (73%), Gaps = 9/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P TVPY+  ++GQLVES  LWK+HDL+NNE 
Sbjct  237   VSEILDSELLGEGLIPTLQHAHDMLLVENPVTVPYKAIVYGQLVESTYLWKLHDLYNNEA  296

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D IHLVP G++ II VK QQ PMHCDAI   IKLLSEPF+IF+F+F KRP+S  ET 
Sbjct  297   EILDGIHLVPAGLERIIGVKLQQHPMHCDAIRREIKLLSEPFRIFEFNFGKRPESHGETA  356

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + +KAT  G  +A+ISWW+LQLD EG++ YST PKWI         +LS +  WCDHWKQ
Sbjct  357   VRVKATGSGQVNAVISWWMLQLDDEGSIHYSTAPKWI---------TLSGAGNWCDHWKQ  407

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWFIP  G+ + KDE + L A H D ++SY ++          + +   D  L LSPER
Sbjct  408   CVWFIPGKGVPLAKDEEISLRAAHGDTSISYQLEPDQPKSTGGDHHVKGGDFCLTLSPER  467

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IAIYGD  WR S+L A+   L+++A  +C++ADDSIFL + +   + AS++++LFPGLQD
Sbjct  468   IAIYGDAEWRLSVLNALKTVLQRRAPSVCVIADDSIFLALLVARFSTASHIMALFPGLQD  527

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG  YL+AVA +N +SMD ++ ++K+ +  T  DTH++ VDLLIAEPFYYGSD +LPWQN
Sbjct  528   KGIHYLKAVADANGFSMDRVEFVRKKMANWTGDDTHNKAVDLLIAEPFYYGSDGMLPWQN  587

Query  1756  LRFW  1767
             LRFW
Sbjct  588   LRFW  591


 Score =   205 bits (522),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 120/157 (76%), Gaps = 5/157 (3%)
 Frame = +2

Query  77   SHSFSLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWVVIEE---SDTPEQTPTPLLA  241
            S S S+P S   + R MSSGS  R+FQLKLDPLTGNSEWVVIEE      PE     LLA
Sbjct  64   SASRSVPLSGLALARAMSSGSAQRVFQLKLDPLTGNSEWVVIEEDAGGTAPEGLHQGLLA  123

Query  242  TTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDS  421
            TTSYLDMLNDS RNRAFREAIDK V+ PC VLDIGAGTGLLSMMAARAMG  DS +   +
Sbjct  124  TTSYLDMLNDSRRNRAFREAIDKAVSGPCRVLDIGAGTGLLSMMAARAMGLGDSPTCRSN  183

Query  422  KGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRS  532
             G VTACESYLPMVKLMRKVLRAN + R I ++NKRS
Sbjct  184  NGSVTACESYLPMVKLMRKVLRANDMARSITVLNKRS  220



>gb|KCW77778.1| hypothetical protein EUGRSUZ_D02075 [Eucalyptus grandis]
Length=777

 Score =   440 bits (1132),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 208/364 (57%), Positives = 266/364 (73%), Gaps = 9/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P TVPY+  ++GQLVES  LWK+HDL+NNE 
Sbjct  237   VSEILDSELLGEGLIPTLQHAHDMLLVENPVTVPYKAIVYGQLVESTYLWKLHDLYNNEA  296

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D IHLVP G++ II VK QQ PMHCDAI   IKLLSEPF+IF+F+F KRP+S  ET 
Sbjct  297   EILDGIHLVPAGLERIIGVKLQQHPMHCDAIRREIKLLSEPFRIFEFNFGKRPESHGETA  356

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + +KAT  G  +A+ISWW+LQLD EG++ YST PKWI         +LS +  WCDHWKQ
Sbjct  357   VRVKATGSGQVNAVISWWMLQLDDEGSIHYSTAPKWI---------TLSGAGNWCDHWKQ  407

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWFIP  G+ + KDE + L A H D ++SY ++          + +   D  L LSPER
Sbjct  408   CVWFIPGKGVPLAKDEEISLRAAHGDTSISYQLEPDQPKSTGGDHHVKGGDFCLTLSPER  467

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             IAIYGD  WR S+L A+   L+++A  +C++ADDSIFL + +   + AS++++LFPGLQD
Sbjct  468   IAIYGDAEWRLSVLNALKTVLQRRAPSVCVIADDSIFLALLVARFSTASHIMALFPGLQD  527

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             KG  YL+AVA +N +SMD ++ ++K+ +  T  DTH++ VDLLIAEPFYYGSD +LPWQN
Sbjct  528   KGIHYLKAVADANGFSMDRVEFVRKKMANWTGDDTHNKAVDLLIAEPFYYGSDGMLPWQN  587

Query  1756  LRFW  1767
             LRFW
Sbjct  588   LRFW  591


 Score =   205 bits (522),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 120/157 (76%), Gaps = 5/157 (3%)
 Frame = +2

Query  77   SHSFSLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWVVIEE---SDTPEQTPTPLLA  241
            S S S+P S   + R MSSGS  R+FQLKLDPLTGNSEWVVIEE      PE     LLA
Sbjct  64   SASRSVPLSGLALARAMSSGSAQRVFQLKLDPLTGNSEWVVIEEDAGGTAPEGLHQGLLA  123

Query  242  TTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDS  421
            TTSYLDMLNDS RNRAFREAIDK V+ PC VLDIGAGTGLLSMMAARAMG  DS +   +
Sbjct  124  TTSYLDMLNDSRRNRAFREAIDKAVSGPCRVLDIGAGTGLLSMMAARAMGLGDSPTCRSN  183

Query  422  KGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRS  532
             G VTACESYLPMVKLMRKVLRAN + R I ++NKRS
Sbjct  184  NGSVTACESYLPMVKLMRKVLRANDMARSITVLNKRS  220



>ref|XP_007146021.1| hypothetical protein PHAVU_006G006200g [Phaseolus vulgaris]
 gb|ESW18015.1| hypothetical protein PHAVU_006G006200g [Phaseolus vulgaris]
Length=688

 Score =   437 bits (1123),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 213/364 (59%), Positives = 258/364 (71%), Gaps = 9/364 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHDNLLVE+P TVPYR TI GQLVES  L K HD  NNE 
Sbjct  145   VSEILDSELLGEGLIPTLQHAHDNLLVENPLTVPYRATIHGQLVESTFLRKFHDFHNNEA  204

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
               SD I L P G+ +++ VKHQQ+ MH D I E I LLSEPFKIF+FDFWKRP+S  ETE
Sbjct  205   TVSDGIRLTPPGLGSVLSVKHQQYAMHVDPIQEEITLLSEPFKIFEFDFWKRPESYGETE  264

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L +KAT  G  H +ISWW+LQLD+EGT++YST P+WI        P+++    WCDHWKQ
Sbjct  265   LCVKATNDGRVHVVISWWVLQLDQEGTIYYSTAPRWI------SSPTITSPVGWCDHWKQ  318

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G+S+ K E +HL A HT+ + SY   T+    E+  +K   +D QL L PER
Sbjct  319   CVWFVPGSGISILKGEEIHLLATHTETSFSYNFDTRVPTSEILNHKCMTRDFQLVLPPER  378

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
              AIY DK WR SMLKA+ +  K +   LC+V DDS+ L + +   + AS V+SLFPGL++
Sbjct  379   AAIYADKEWRLSMLKAVQSIGKDRL--LCLVVDDSVVLPLLVAKLSEAS-VMSLFPGLRE  435

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
             +G QYLQAVA +N  S  CI+VL+K    L M D H +KVDLLIAEPFY G D +LPWQN
Sbjct  436   RGLQYLQAVAHANGLSHSCIEVLEKSVQQLNMHDIHQKKVDLLIAEPFYVGHDGMLPWQN  495

Query  1756  LRFW  1767
             LRFW
Sbjct  496   LRFW  499


 Score =   185 bits (469),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 108/139 (78%), Gaps = 11/139 (8%)
 Frame = +2

Query  131  SGSRMFQLKLDPLTGNSEWVVIEESDT--PEQTPTPLLATTSYLDMLNDSPRNRAFREAI  304
            S  R+FQLKL PLTG+SEWVVIE+++    +    P LATTSYLDMLNDS RN AFR+AI
Sbjct  2    STHRVFQLKLHPLTGDSEWVVIEDNEESFAQNFHKPFLATTSYLDMLNDSARNAAFRQAI  61

Query  305  DKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVL  484
             KT+TKPCHVLDIGAGTGLLSM+AARAMG          +G VTACESYLPMVKLM+KVL
Sbjct  62   QKTITKPCHVLDIGAGTGLLSMLAARAMG---------DEGRVTACESYLPMVKLMKKVL  112

Query  485  RANGIERGIRIINKRSKIL  541
            R NG+E  ++IINKRS  L
Sbjct  113  RLNGMEGRVKIINKRSDEL  131



>ref|XP_009386347.1| PREDICTED: protein arginine N-methyltransferase 7 [Musa acuminata 
subsp. malaccensis]
Length=703

 Score =   437 bits (1123),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 204/365 (56%), Positives = 265/365 (73%), Gaps = 4/365 (1%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQ AHD LL ++P+TVPYR T +GQLVES  LWK+HDLF+NE 
Sbjct  158   VSEILDSELLGEGLIPTLQQAHDMLLAKNPQTVPYRATTYGQLVESPFLWKLHDLFSNEI  217

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
               SD IHL P G++ +I +K QQ+ MHC A+S  I+LLSEPFKIF+FDFWK+P+S  E E
Sbjct  218   NLSDGIHLTPAGLERVIGIKKQQYAMHCTAMSREIRLLSEPFKIFEFDFWKKPESHGEIE  277

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSD-VKDPSLSCSEAWCDHWK  1212
             + IKA+  G   A+ISWW+LQLD EG++FYST P+W +CP + + +  +  +E WCDHWK
Sbjct  278   MSIKASGDGNVIAVISWWVLQLDEEGSIFYSTAPRWTNCPDNGMVENCIPGNENWCDHWK  337

Query  1213  QCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             QCVWFI   GL V KD+ V   A + +I +SY +K   Q         +  +C L LSPE
Sbjct  338   QCVWFISGAGLPVSKDKLVLFKAAYDEIKISYHLKCDDQTC---CNNFNFGNCLLELSPE  394

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R+A+YGDK+WR   + A+ N L  +++PLCIVADDS+FLTI +   ++ +N IS FPG+Q
Sbjct  395   RVAVYGDKDWRSGFINAMRNTLNVRSAPLCIVADDSVFLTILISSLSKNANTISSFPGIQ  454

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             +KG QYL+AVA SN +SMD +KV+ KR+S L   +   +KVD L+ EPFYYG++  LPWQ
Sbjct  455   EKGAQYLRAVADSNGFSMDRVKVIGKRASYLFTDNLIQQKVDFLVGEPFYYGNEGALPWQ  514

Query  1753  NLRFW  1767
             NLRFW
Sbjct  515   NLRFW  519


 Score =   165 bits (418),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 104/139 (75%), Gaps = 8/139 (6%)
 Frame = +2

Query  137  SRMFQLKLDPLTGNSEWVVIEE----SDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAI  304
            +R FQL+++PLTG+SEW+V+EE     +  E+T   LLATTSYLDMLNDS RN AFR AI
Sbjct  10   TRAFQLRVNPLTGDSEWIVVEEGGDREELEEKTSENLLATTSYLDMLNDSYRNWAFRAAI  69

Query  305  DKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVL  484
            +K++ KPCHV+DIGAGTGLLSMMAA  M   + AS +     V+ACESYLPM KLMRKVL
Sbjct  70   EKSIKKPCHVVDIGAGTGLLSMMAASTMAKFEEASEAK----VSACESYLPMGKLMRKVL  125

Query  485  RANGIERGIRIINKRSKIL  541
              N +E+ +++ +KRS  L
Sbjct  126  WENQMEKKVKVFHKRSDEL  144



>gb|EYU33534.1| hypothetical protein MIMGU_mgv1a019619mg [Erythranthe guttata]
Length=495

 Score =   429 bits (1102),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 216/367 (59%), Positives = 254/367 (69%), Gaps = 34/367 (9%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             +SEILDSELLGEGLIPTLQHAHDNLLVE+P TVPYR T +GQLVE   L  MHDL N E 
Sbjct  3     ISEILDSELLGEGLIPTLQHAHDNLLVENPLTVPYRATTYGQLVECTYLRDMHDLVNREA  62

Query  856   KASDTIHLVPKGMDTIICVK-HQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRET  1032
             + SD I LVP GM  I+ VK  QQF MHCDA+ E IKLLSEPFK+FDFDFW+RPDSS ET
Sbjct  63    ELSDGIRLVPSGMAGILGVKKQQQFAMHCDALKEEIKLLSEPFKVFDFDFWRRPDSSSET  122

Query  1033  ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKD--PSLSCSEAWCDH  1206
             E+ IK T  GT HAIISWWLLQLD EGT+FYST P WI CP DV++   S + S+ WCDH
Sbjct  123   EMHIKTTNDGTVHAIISWWLLQLDSEGTIFYSTEPNWIRCPDDVRELESSSNSSDNWCDH  182

Query  1207  WKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLS  1386
             WKQ VWF  ++ L V KDE VHLHA+HT+ ++SY  KT ++  +V        D Q+ LS
Sbjct  183   WKQSVWFPQSVDLHVLKDEEVHLHALHTETSISYDFKTLNEKRQVAHVDACTDDFQIVLS  242

Query  1387  PERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPG  1566
             PER A+YGD +WR  ML AI  AL+Q+  PLC+VADDSIFL IA+   +++SNVI LFPG
Sbjct  243   PERNALYGDSSWRFLMLNAIEKALRQRTDPLCLVADDSIFLAIAIARLSKSSNVIPLFPG  302

Query  1567  LQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLP  1746
             L  KG QYL                                K++LL+AEPFYYG+D+ LP
Sbjct  303   LGKKGLQYLH-------------------------------KINLLVAEPFYYGNDNALP  331

Query  1747  WQNLRFW  1767
             WQNLRFW
Sbjct  332   WQNLRFW  338



>ref|XP_010322902.1| PREDICTED: protein arginine N-methyltransferase 1.6 isoform X4 
[Solanum lycopersicum]
Length=735

 Score =   436 bits (1122),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 219/399 (55%), Positives = 269/399 (67%), Gaps = 70/399 (18%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQ------------------  801
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR T++GQ                  
Sbjct  183   VSEILDSELLGEGLIPTLQHAHDQLLVDNPKTVPYRATVYGQVFDHGFIFKYSFADSHWV  242

Query  802   ---------------LVESKDLWKMHDLFNNEEKASDTIHLVPKGMDTIICVKHQQFPMH  936
                            LVES DLWK+HDL+N E++  D I LVP+GMD+ +CVK QQF MH
Sbjct  243   PFGYKAVIFPQLTFQLVESTDLWKLHDLYNTEKEVLDEICLVPEGMDSALCVKRQQFSMH  302

Query  937   CDAISEGIKLLSEPFKIFDFDFWKRPDSSRETELLIKATKGGTAHAIISWWLLQLDREGT  1116
             CDA+ E IKLLSEPFK+FDFDFW+RPDS R T+L ++AT  G  HA+ISWWLLQLD +GT
Sbjct  303   CDALEEDIKLLSEPFKVFDFDFWRRPDSHRVTKLSVQATDTGAVHAVISWWLLQLDEKGT  362

Query  1117  VFYSTGPKWIHCPSDVK--DPSLSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHT  1290
             +FYST PKWI CPS V+  + S+S S+ WCDHWKQCVWFIP  GLS+ KDE V L AVHT
Sbjct  363   IFYSTAPKWISCPSSVEGFNSSISWSQNWCDHWKQCVWFIPKKGLSLLKDEEVSLLAVHT  422

Query  1291  DINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPERIAIYGDKNWRCSMLKAINNALKQKA  1470
             D ++SY +KT SQN+E+ Q                                  + +KQK 
Sbjct  423   DTSISYEMKTLSQNLELEQ----------------------------------SEMKQKT  448

Query  1471  SPLCIVADDSIFLTIALGHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKK  1650
               LC+V DDSIFL +AL H A+ S+V+SLFPGLQ+KG  YLQAVA +N YS D ++V +K
Sbjct  449   PSLCVVVDDSIFLAVALAHLAKGSHVLSLFPGLQEKGALYLQAVATANGYSKDHVEV-QK  507

Query  1651  RSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQNLRFW  1767
              S  LT Q +  +++DLL+ EPFYYG++SVLPWQNLRFW
Sbjct  508   MSELLTSQSSQEKQIDLLVGEPFYYGNNSVLPWQNLRFW  546


 Score =   246 bits (629),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIE  199
            M  LF KTLNP F LR     SF+  RS    VR+MSSGSRMFQLK+DPLTGNSEWVVIE
Sbjct  1    MQCLFPKTLNPQFFLR-----SFNNTRSKAFTVRSMSSGSRMFQLKVDPLTGNSEWVVIE  55

Query  200  ESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAA  379
            E +        LLA TSYLDMLND+ RN+A+REAIDKT+TKPCHVLDIGAGTGLLSMMAA
Sbjct  56   EDEASGDATKQLLANTSYLDMLNDTRRNKAYREAIDKTITKPCHVLDIGAGTGLLSMMAA  115

Query  380  RAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            RAM   DS  +S SKGMVTACESYLPMVKLMRKVL ANG++R IRIINKRS  L
Sbjct  116  RAMDLGDSVESSGSKGMVTACESYLPMVKLMRKVLHANGMQRKIRIINKRSDEL  169



>ref|XP_004964287.1| PREDICTED: protein arginine N-methyltransferase 7-like isoform 
X2 [Setaria italica]
Length=722

 Score =   422 bits (1084),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 203/365 (56%), Positives = 262/365 (72%), Gaps = 6/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR   +G LVES  LWKMHDL ++E 
Sbjct  180   VSEILDSELLGEGLIPTLQHAHDELLVKNPKTVPYRAMTYGVLVESTFLWKMHDLHSSEA  239

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A D + L P G + I+ VK QQ  M CDA+++ I+LLSEPFK+F+FDFWKRPDS RET+
Sbjct  240   NAEDGVWLTPSGTENILSVKPQQHAMQCDALADEIRLLSEPFKVFEFDFWKRPDSHRETK  299

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS-LSCSEAWCDHWK  1212
             + IKAT  G AHAIISWW+LQLD  G+VFYST P+W+   S V  P  ++  + WCDHWK
Sbjct  300   IEIKATADGHAHAIISWWVLQLDSAGSVFYSTAPRWVRQLSGVDLPQCVNGMKDWCDHWK  359

Query  1213  QCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             QCVWFI   G    KD+ + L A H + ++SY +     NM       S ++  L L PE
Sbjct  360   QCVWFIQGTGAPAMKDQTLSLRASHDETSISYHL-----NMNDEVSSRSPKNDHLTLLPE  414

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             RIA+YGDK WR +++ A+ NA+  ++SP CIVADDS+ L + +     +S VI++FPGL+
Sbjct  415   RIALYGDKAWRSALIGAVRNAMSGRSSPTCIVADDSVLLALIVSSLLPSSTVITMFPGLR  474

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             DKG  YL+AVA +N+ SMD IKV+ K++S+LT  D  H KV+L++ EPFY GS+ +LPWQ
Sbjct  475   DKGFNYLRAVADANNLSMDRIKVIGKKASSLTTNDLKHEKVNLVVGEPFYLGSEGMLPWQ  534

Query  1753  NLRFW  1767
             NLRFW
Sbjct  535   NLRFW  539


 Score =   156 bits (395),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 105/139 (76%), Gaps = 8/139 (6%)
 Frame = +2

Query  137  SRMFQLKLDPLTGNSEWVVIEESDTPEQTPT---PLLATTSYLDMLNDSPRNRAFREAID  307
            ++ FQL+L+PLTG+SEW+V++E++     P+    LLA TSYLDMLND+ RNRA+R AI+
Sbjct  32   TQAFQLRLNPLTGDSEWLVVDEAEAEAPAPSHHKQLLAATSYLDMLNDAARNRAYRHAIE  91

Query  308  KTVTKPC-HVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVL  484
             TVT P   VLDIGAGTGLLSMMAARA+    +A   + +G V+ACE+YLPM KL R+VL
Sbjct  92   ATVTDPTSRVLDIGAGTGLLSMMAARAL----AAVGGEGRGSVSACEAYLPMGKLTRRVL  147

Query  485  RANGIERGIRIINKRSKIL  541
            RANG+E  +++ +KRS  L
Sbjct  148  RANGMENKVKVFHKRSDEL  166



>ref|XP_004964286.1| PREDICTED: protein arginine N-methyltransferase 7-like isoform 
X1 [Setaria italica]
Length=729

 Score =   421 bits (1083),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 203/365 (56%), Positives = 262/365 (72%), Gaps = 6/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR   +G LVES  LWKMHDL ++E 
Sbjct  180   VSEILDSELLGEGLIPTLQHAHDELLVKNPKTVPYRAMTYGVLVESTFLWKMHDLHSSEA  239

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A D + L P G + I+ VK QQ  M CDA+++ I+LLSEPFK+F+FDFWKRPDS RET+
Sbjct  240   NAEDGVWLTPSGTENILSVKPQQHAMQCDALADEIRLLSEPFKVFEFDFWKRPDSHRETK  299

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS-LSCSEAWCDHWK  1212
             + IKAT  G AHAIISWW+LQLD  G+VFYST P+W+   S V  P  ++  + WCDHWK
Sbjct  300   IEIKATADGHAHAIISWWVLQLDSAGSVFYSTAPRWVRQLSGVDLPQCVNGMKDWCDHWK  359

Query  1213  QCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             QCVWFI   G    KD+ + L A H + ++SY +     NM       S ++  L L PE
Sbjct  360   QCVWFIQGTGAPAMKDQTLSLRASHDETSISYHL-----NMNDEVSSRSPKNDHLTLLPE  414

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             RIA+YGDK WR +++ A+ NA+  ++SP CIVADDS+ L + +     +S VI++FPGL+
Sbjct  415   RIALYGDKAWRSALIGAVRNAMSGRSSPTCIVADDSVLLALIVSSLLPSSTVITMFPGLR  474

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             DKG  YL+AVA +N+ SMD IKV+ K++S+LT  D  H KV+L++ EPFY GS+ +LPWQ
Sbjct  475   DKGFNYLRAVADANNLSMDRIKVIGKKASSLTTNDLKHEKVNLVVGEPFYLGSEGMLPWQ  534

Query  1753  NLRFW  1767
             NLRFW
Sbjct  535   NLRFW  539


 Score =   156 bits (395),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 105/139 (76%), Gaps = 8/139 (6%)
 Frame = +2

Query  137  SRMFQLKLDPLTGNSEWVVIEESDTPEQTPT---PLLATTSYLDMLNDSPRNRAFREAID  307
            ++ FQL+L+PLTG+SEW+V++E++     P+    LLA TSYLDMLND+ RNRA+R AI+
Sbjct  32   TQAFQLRLNPLTGDSEWLVVDEAEAEAPAPSHHKQLLAATSYLDMLNDAARNRAYRHAIE  91

Query  308  KTVTKPC-HVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVL  484
             TVT P   VLDIGAGTGLLSMMAARA+    +A   + +G V+ACE+YLPM KL R+VL
Sbjct  92   ATVTDPTSRVLDIGAGTGLLSMMAARAL----AAVGGEGRGSVSACEAYLPMGKLTRRVL  147

Query  485  RANGIERGIRIINKRSKIL  541
            RANG+E  +++ +KRS  L
Sbjct  148  RANGMENKVKVFHKRSDEL  166



>ref|XP_002436330.1| hypothetical protein SORBIDRAFT_10g000540 [Sorghum bicolor]
 gb|EER87697.1| hypothetical protein SORBIDRAFT_10g000540 [Sorghum bicolor]
Length=731

 Score =   419 bits (1077),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 196/365 (54%), Positives = 260/365 (71%), Gaps = 7/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR T +G LVES  LWKMHDL +NE 
Sbjct  189   VSEILDSELLGEGLIPTLQHAHDMLLVKNPKTVPYRATTYGVLVESVSLWKMHDLHSNEA  248

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A D + L P G   ++ VK QQ  M CDA+++ I+LLSEPFK+F+FDF KRPDS RET+
Sbjct  249   NAEDGVWLTPSGTQNVLSVKSQQHAMQCDALADEIRLLSEPFKVFEFDFSKRPDSRRETK  308

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLS-CSEAWCDHWK  1212
             + IKAT  G AHAI+SWW+LQLD   ++FYST P+W+   S V  P  +  ++ WCDHWK
Sbjct  309   IEIKATADGHAHAIVSWWVLQLDSAESIFYSTAPRWVRQSSSVDLPQYANGTKDWCDHWK  368

Query  1213  QCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             QCVWFI   G   +KD+ + L A H   ++SY +    +         S +   L L PE
Sbjct  369   QCVWFIQGTGAPAKKDQALSLSASHNQTSISYQLNMNGEGSR------SPKSNHLTLLPE  422

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             ++A+YGDK WR +++  I N++ +++SP CIVADDS+FL + +     +S V ++FP L+
Sbjct  423   KVALYGDKGWRSALISVIRNSMSERSSPTCIVADDSVFLALVVSSLLPSSKVFTMFPSLR  482

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             DKG  YLQAVA +N+ SMD IKV+ K++S+LTM D +H KV+L++ EPFY+GS+ +LPWQ
Sbjct  483   DKGFNYLQAVADANNLSMDQIKVIGKKASSLTMNDLNHEKVNLIVGEPFYHGSEGMLPWQ  542

Query  1753  NLRFW  1767
             NLRFW
Sbjct  543   NLRFW  547


 Score =   152 bits (383),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 107/145 (74%), Gaps = 10/145 (7%)
 Frame = +2

Query  128  SSG-SRMFQLKLDPLTGNSEWVVIEESDTPEQTPT-----PLLATTSYLDMLNDSPRNRA  289
            SSG +R FQL+L+PLTG+SEW+V++E++   + P       LLA TSYLDMLND+ RNRA
Sbjct  34   SSGPARAFQLRLNPLTGDSEWLVVDEAEAEAEAPAPTHHKQLLAATSYLDMLNDASRNRA  93

Query  290  FREAIDKTVTKPC-HVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVK  466
            +R AID TVT P   VLDIGAGTGLLSMMAARA+     A   + +G V+ACESYLPM K
Sbjct  94   YRLAIDATVTDPTSRVLDIGAGTGLLSMMAARALA---VAGGEEGRGSVSACESYLPMGK  150

Query  467  LMRKVLRANGIERGIRIINKRSKIL  541
            L R+VLRANG+E  +++ +KRS  L
Sbjct  151  LTRRVLRANGMENKVKVFHKRSDEL  175



>ref|NP_001141412.1| uncharacterized protein LOC100273522 [Zea mays]
 gb|ACF86337.1| unknown [Zea mays]
Length=701

 Score =   417 bits (1072),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 196/365 (54%), Positives = 260/365 (71%), Gaps = 7/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR T +G LVES  LWKMHDL +NE 
Sbjct  159   VSEILDSELLGEGLIPTLQHAHDMLLVKNPKTVPYRATTYGVLVESTSLWKMHDLHSNEA  218

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A D + L+P G   ++ VK QQ  M CDA+++ I+LLSEPFK+F+FDF +RPDS RET+
Sbjct  219   NAEDGVRLIPSGTQIVLSVKSQQHAMQCDALADEIRLLSEPFKVFEFDFSERPDSHRETK  278

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLS-CSEAWCDHWK  1212
             + IKAT  G AHAI+SWW+LQLD  G+VFYST P+W+   S V  P  +  ++ WCDHWK
Sbjct  279   IEIKATADGHAHAIVSWWVLQLDSSGSVFYSTAPRWVRQSSGVDLPQYANGTKDWCDHWK  338

Query  1213  QCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             QCVWFI   G   +KD+ + L A H   ++SY +    +         S +   L L PE
Sbjct  339   QCVWFIQGTGAPAKKDQTLSLSASHNQTSISYQLNINDEGSR------SPKSNHLTLLPE  392

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R+A+YGDK WR +++  I N   +++SP+CIVADDS+FL + +     +S V+++FP L+
Sbjct  393   RVALYGDKVWRSALISVIRNYTSERSSPICIVADDSVFLALIVSFLLPSSKVLAMFPCLR  452

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             D G  YLQAVA +N+ SMD IKV+ K++S+LT  D +H KV++L+ EPFY+GS+ +LPWQ
Sbjct  453   DSGLNYLQAVADANNLSMDRIKVIGKKASSLTTNDLNHEKVNMLVGEPFYHGSEGMLPWQ  512

Query  1753  NLRFW  1767
             NLRFW
Sbjct  513   NLRFW  517


 Score =   134 bits (338),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 106/147 (72%), Gaps = 13/147 (9%)
 Frame = +2

Query  128  SSG-SRMFQLKLDPLTGNSEWVVIEESDTPEQT----PT---PLLATTSYLDMLNDSPRN  283
            SSG +R FQL+L+PLTG+SEW+V++E++T  +     PT    LLA TSYLDMLND+ RN
Sbjct  3    SSGPARAFQLRLNPLTGDSEWLVVDEAETEAEVAAPAPTHHKQLLAATSYLDMLNDASRN  62

Query  284  RAFREAIDKTVTKPC-HVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPM  460
            RA+R AID TVT P   VLDIGAGTGLLSMMAARA+  A           V+ACESYLPM
Sbjct  63   RAYRLAIDATVTDPTSRVLDIGAGTGLLSMMAARALAAAGGEGRGS----VSACESYLPM  118

Query  461  VKLMRKVLRANGIERGIRIINKRSKIL  541
             KL R+VLRANG+E  +++ +KRS  L
Sbjct  119  GKLTRRVLRANGMENKVKVFHKRSDEL  145



>gb|AFW86217.1| hypothetical protein ZEAMMB73_654010 [Zea mays]
Length=728

 Score =   417 bits (1071),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 196/365 (54%), Positives = 260/365 (71%), Gaps = 7/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR T +G LVES  LWKMHDL +NE 
Sbjct  186   VSEILDSELLGEGLIPTLQHAHDMLLVKNPKTVPYRATTYGVLVESTSLWKMHDLHSNEA  245

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A D + L+P G   ++ VK QQ  M CDA+++ I+LLSEPFK+F+FDF +RPDS RET+
Sbjct  246   NAEDGVRLIPSGTQIVLSVKSQQHAMQCDALADEIRLLSEPFKVFEFDFSERPDSHRETK  305

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLS-CSEAWCDHWK  1212
             + IKAT  G AHAI+SWW+LQLD  G+VFYST P+W+   S V  P  +  ++ WCDHWK
Sbjct  306   IEIKATADGHAHAIVSWWVLQLDSSGSVFYSTAPRWVRQSSGVDLPQYANGTKDWCDHWK  365

Query  1213  QCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             QCVWFI   G   +KD+ + L A H   ++SY +    +         S +   L L PE
Sbjct  366   QCVWFIQGTGAPAKKDQTLSLSASHNQTSISYQLNINDEGSR------SPKSNHLTLLPE  419

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R+A+YGDK WR +++  I N   +++SP+CIVADDS+FL + +     +S V+++FP L+
Sbjct  420   RVALYGDKVWRSALISVIRNYTSERSSPICIVADDSVFLALIVSFLLPSSKVLAMFPCLR  479

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             D G  YLQAVA +N+ SMD IKV+ K++S+LT  D +H KV++L+ EPFY+GS+ +LPWQ
Sbjct  480   DSGLNYLQAVADANNLSMDRIKVIGKKASSLTTNDLNHEKVNMLVGEPFYHGSEGMLPWQ  539

Query  1753  NLRFW  1767
             NLRFW
Sbjct  540   NLRFW  544


 Score =   134 bits (337),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 106/147 (72%), Gaps = 13/147 (9%)
 Frame = +2

Query  128  SSG-SRMFQLKLDPLTGNSEWVVIEESDTPEQT----PT---PLLATTSYLDMLNDSPRN  283
            SSG +R FQL+L+PLTG+SEW+V++E++T  +     PT    LLA TSYLDMLND+ RN
Sbjct  30   SSGPARAFQLRLNPLTGDSEWLVVDEAETEAEVAAPAPTHHKQLLAATSYLDMLNDASRN  89

Query  284  RAFREAIDKTVTKPC-HVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPM  460
            RA+R AID TVT P   VLDIGAGTGLLSMMAARA+  A           V+ACESYLPM
Sbjct  90   RAYRLAIDATVTDPTSRVLDIGAGTGLLSMMAARALAAAGGEGRGS----VSACESYLPM  145

Query  461  VKLMRKVLRANGIERGIRIINKRSKIL  541
             KL R+VLRANG+E  +++ +KRS  L
Sbjct  146  GKLTRRVLRANGMENKVKVFHKRSDEL  172



>ref|XP_008658259.1| PREDICTED: uncharacterized protein LOC100273522 isoform X1 [Zea 
mays]
Length=730

 Score =   417 bits (1071),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 196/365 (54%), Positives = 260/365 (71%), Gaps = 7/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR T +G LVES  LWKMHDL +NE 
Sbjct  188   VSEILDSELLGEGLIPTLQHAHDMLLVKNPKTVPYRATTYGVLVESTSLWKMHDLHSNEA  247

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A D + L+P G   ++ VK QQ  M CDA+++ I+LLSEPFK+F+FDF +RPDS RET+
Sbjct  248   NAEDGVRLIPSGTQIVLSVKSQQHAMQCDALADEIRLLSEPFKVFEFDFSERPDSHRETK  307

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLS-CSEAWCDHWK  1212
             + IKAT  G AHAI+SWW+LQLD  G+VFYST P+W+   S V  P  +  ++ WCDHWK
Sbjct  308   IEIKATADGHAHAIVSWWVLQLDSSGSVFYSTAPRWVRQSSGVDLPQYANGTKDWCDHWK  367

Query  1213  QCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             QCVWFI   G   +KD+ + L A H   ++SY +    +         S +   L L PE
Sbjct  368   QCVWFIQGTGAPAKKDQTLSLSASHNQTSISYQLNINDEGSR------SPKSNHLTLLPE  421

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R+A+YGDK WR +++  I N   +++SP+CIVADDS+FL + +     +S V+++FP L+
Sbjct  422   RVALYGDKVWRSALISVIRNYTSERSSPICIVADDSVFLALIVSFLLPSSKVLAMFPCLR  481

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             D G  YLQAVA +N+ SMD IKV+ K++S+LT  D +H KV++L+ EPFY+GS+ +LPWQ
Sbjct  482   DSGLNYLQAVADANNLSMDRIKVIGKKASSLTTNDLNHEKVNMLVGEPFYHGSEGMLPWQ  541

Query  1753  NLRFW  1767
             NLRFW
Sbjct  542   NLRFW  546


 Score =   132 bits (333),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 104/149 (70%), Gaps = 15/149 (10%)
 Frame = +2

Query  128  SSG-SRMFQLKLDPLTGNSEWVVIEESDTPEQTPT---------PLLATTSYLDMLNDSP  277
            SSG +R FQL+L+PLTG+SEW+V++E++T  +             LLA TSYLDMLND+ 
Sbjct  30   SSGPARAFQLRLNPLTGDSEWLVVDEAETEAEVAAPAPAPTHHKQLLAATSYLDMLNDAS  89

Query  278  RNRAFREAIDKTVTKPC-HVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYL  454
            RNRA+R AID TVT P   VLDIGAGTGLLSMMAARA+  A           V+ACESYL
Sbjct  90   RNRAYRLAIDATVTDPTSRVLDIGAGTGLLSMMAARALAAAGGEGRGS----VSACESYL  145

Query  455  PMVKLMRKVLRANGIERGIRIINKRSKIL  541
            PM KL R+VLRANG+E  +++ +KRS  L
Sbjct  146  PMGKLTRRVLRANGMENKVKVFHKRSDEL  174



>ref|XP_008658261.1| PREDICTED: uncharacterized protein LOC100273522 isoform X3 [Zea 
mays]
Length=732

 Score =   417 bits (1071),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 196/365 (54%), Positives = 260/365 (71%), Gaps = 7/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR T +G LVES  LWKMHDL +NE 
Sbjct  188   VSEILDSELLGEGLIPTLQHAHDMLLVKNPKTVPYRATTYGVLVESTSLWKMHDLHSNEA  247

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A D + L+P G   ++ VK QQ  M CDA+++ I+LLSEPFK+F+FDF +RPDS RET+
Sbjct  248   NAEDGVRLIPSGTQIVLSVKSQQHAMQCDALADEIRLLSEPFKVFEFDFSERPDSHRETK  307

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLS-CSEAWCDHWK  1212
             + IKAT  G AHAI+SWW+LQLD  G+VFYST P+W+   S V  P  +  ++ WCDHWK
Sbjct  308   IEIKATADGHAHAIVSWWVLQLDSSGSVFYSTAPRWVRQSSGVDLPQYANGTKDWCDHWK  367

Query  1213  QCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             QCVWFI   G   +KD+ + L A H   ++SY +    +         S +   L L PE
Sbjct  368   QCVWFIQGTGAPAKKDQTLSLSASHNQTSISYQLNINDEGSR------SPKSNHLTLLPE  421

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R+A+YGDK WR +++  I N   +++SP+CIVADDS+FL + +     +S V+++FP L+
Sbjct  422   RVALYGDKVWRSALISVIRNYTSERSSPICIVADDSVFLALIVSFLLPSSKVLAMFPCLR  481

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             D G  YLQAVA +N+ SMD IKV+ K++S+LT  D +H KV++L+ EPFY+GS+ +LPWQ
Sbjct  482   DSGLNYLQAVADANNLSMDRIKVIGKKASSLTTNDLNHEKVNMLVGEPFYHGSEGMLPWQ  541

Query  1753  NLRFW  1767
             NLRFW
Sbjct  542   NLRFW  546


 Score =   132 bits (333),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 104/149 (70%), Gaps = 15/149 (10%)
 Frame = +2

Query  128  SSG-SRMFQLKLDPLTGNSEWVVIEESDTPEQTPT---------PLLATTSYLDMLNDSP  277
            SSG +R FQL+L+PLTG+SEW+V++E++T  +             LLA TSYLDMLND+ 
Sbjct  30   SSGPARAFQLRLNPLTGDSEWLVVDEAETEAEVAAPAPAPTHHKQLLAATSYLDMLNDAS  89

Query  278  RNRAFREAIDKTVTKPC-HVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYL  454
            RNRA+R AID TVT P   VLDIGAGTGLLSMMAARA+  A           V+ACESYL
Sbjct  90   RNRAYRLAIDATVTDPTSRVLDIGAGTGLLSMMAARALAAAGGEGRGS----VSACESYL  145

Query  455  PMVKLMRKVLRANGIERGIRIINKRSKIL  541
            PM KL R+VLRANG+E  +++ +KRS  L
Sbjct  146  PMGKLTRRVLRANGMENKVKVFHKRSDEL  174



>ref|XP_008658260.1| PREDICTED: uncharacterized protein LOC100273522 isoform X2 [Zea 
mays]
Length=730

 Score =   416 bits (1070),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 196/365 (54%), Positives = 260/365 (71%), Gaps = 7/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR T +G LVES  LWKMHDL +NE 
Sbjct  186   VSEILDSELLGEGLIPTLQHAHDMLLVKNPKTVPYRATTYGVLVESTSLWKMHDLHSNEA  245

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A D + L+P G   ++ VK QQ  M CDA+++ I+LLSEPFK+F+FDF +RPDS RET+
Sbjct  246   NAEDGVRLIPSGTQIVLSVKSQQHAMQCDALADEIRLLSEPFKVFEFDFSERPDSHRETK  305

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLS-CSEAWCDHWK  1212
             + IKAT  G AHAI+SWW+LQLD  G+VFYST P+W+   S V  P  +  ++ WCDHWK
Sbjct  306   IEIKATADGHAHAIVSWWVLQLDSSGSVFYSTAPRWVRQSSGVDLPQYANGTKDWCDHWK  365

Query  1213  QCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             QCVWFI   G   +KD+ + L A H   ++SY +    +         S +   L L PE
Sbjct  366   QCVWFIQGTGAPAKKDQTLSLSASHNQTSISYQLNINDEGSR------SPKSNHLTLLPE  419

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R+A+YGDK WR +++  I N   +++SP+CIVADDS+FL + +     +S V+++FP L+
Sbjct  420   RVALYGDKVWRSALISVIRNYTSERSSPICIVADDSVFLALIVSFLLPSSKVLAMFPCLR  479

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             D G  YLQAVA +N+ SMD IKV+ K++S+LT  D +H KV++L+ EPFY+GS+ +LPWQ
Sbjct  480   DSGLNYLQAVADANNLSMDRIKVIGKKASSLTTNDLNHEKVNMLVGEPFYHGSEGMLPWQ  539

Query  1753  NLRFW  1767
             NLRFW
Sbjct  540   NLRFW  544


 Score =   134 bits (337),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 106/147 (72%), Gaps = 13/147 (9%)
 Frame = +2

Query  128  SSG-SRMFQLKLDPLTGNSEWVVIEESDTPEQT----PT---PLLATTSYLDMLNDSPRN  283
            SSG +R FQL+L+PLTG+SEW+V++E++T  +     PT    LLA TSYLDMLND+ RN
Sbjct  30   SSGPARAFQLRLNPLTGDSEWLVVDEAETEAEVAAPAPTHHKQLLAATSYLDMLNDASRN  89

Query  284  RAFREAIDKTVTKPC-HVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPM  460
            RA+R AID TVT P   VLDIGAGTGLLSMMAARA+  A           V+ACESYLPM
Sbjct  90   RAYRLAIDATVTDPTSRVLDIGAGTGLLSMMAARALAAAGGEGRGS----VSACESYLPM  145

Query  461  VKLMRKVLRANGIERGIRIINKRSKIL  541
             KL R+VLRANG+E  +++ +KRS  L
Sbjct  146  GKLTRRVLRANGMENKVKVFHKRSDEL  172



>ref|XP_006656546.1| PREDICTED: protein arginine N-methyltransferase 7-like [Oryza 
brachyantha]
Length=678

 Score =   409 bits (1050),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 197/370 (53%), Positives = 256/370 (69%), Gaps = 19/370 (5%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQ AHD LL  +P+ VPYR T +GQLVES  LWK+HDL NNE 
Sbjct  135   VSEILDSELLGEGLIPTLQQAHDMLLTTNPKIVPYRATTYGQLVESTFLWKLHDLHNNEA  194

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A+D + L P GM+ I+ VK Q+  M CDA+ + I+LLSEPFK+F+FDFWKRPDS RET 
Sbjct  195   NAADGVWLTPGGMERIVSVKLQKHAMQCDALEDEIRLLSEPFKVFEFDFWKRPDSHRETN  254

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPS------DVKDPSLSCSEAW  1197
             + I+ T+ G  HAIISWW+LQLD  G++FYST P+W    S      D+KD        W
Sbjct  255   IKIRTTQDGHVHAIISWWVLQLDSAGSIFYSTAPRWARQSSTEDVQHDMKD--------W  306

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQL  1377
             CDHWK CVWF    G+   +D+ + L A H   ++SY +     N++        Q   L
Sbjct  307   CDHWKHCVWFTQGKGIPATEDQVLSLRARHNQTSISYQL-----NIDDEACDRGFQGDHL  361

Query  1378  FLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISL  1557
              L PERIA+YGDK+WR +++  I NAL  K SP C+VADDS+FL + +   +  S VI++
Sbjct  362   TLLPERIALYGDKDWRSALINTIRNALTVKCSPTCVVADDSLFLALLISSISPTSKVIAM  421

Query  1558  FPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDS  1737
             +PGL+DKG  YL+AVA +N+ S+D I+V+ KR+S+L+  D  H+KV+LL+ EPFYYGS+ 
Sbjct  422   YPGLRDKGATYLRAVADANNISIDKIQVIGKRASSLSADDLKHKKVNLLVGEPFYYGSEG  481

Query  1738  VLPWQNLRFW  1767
             +LPWQNLRFW
Sbjct  482   MLPWQNLRFW  491


 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 74/125 (59%), Gaps = 35/125 (28%)
 Frame = +2

Query  260  MLNDSPRNRAFREAIDKTVTKP-CHVLDIG------------------------------  346
            MLND+ RNRA+R AID  VT P   VLDIG                              
Sbjct  1    MLNDTARNRAYRRAIDAAVTDPFSRVLDIGWVTLPVSNSLSHVLMTAKILQWATTFVGTG  60

Query  347  AGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINK  526
            AGTGLLSMMAARA+    +A+  +++G V+ACESYLPM KLMRKVLRANG+E  +++ +K
Sbjct  61   AGTGLLSMMAARAL----AAAGGETRGSVSACESYLPMGKLMRKVLRANGMENRVKVFHK  116

Query  527  RSKIL  541
            RS  L
Sbjct  117  RSDEL  121



>ref|XP_010264284.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Nelumbo nucifera]
Length=701

 Score =   409 bits (1050),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 192/322 (60%), Positives = 242/322 (75%), Gaps = 1/322 (0%)
 Frame = +1

Query  802   LVESKDLWKMHDLFNNEEKASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPF  981
             LVES  LWK+HDL+NNE KA D +HLVP  ++ I+ VK QQ+ MHCDAI+E I+LLS+PF
Sbjct  192   LVESTFLWKLHDLYNNEAKALDNVHLVPAELERILRVKPQQYAMHCDAIAEEIRLLSDPF  251

Query  982   KIFDFDFWKRPDSSRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSD  1161
             K+F+FDF KRP+S  +TEL IKAT  G  HAI+SWW+LQLD EGT+FYST P+WI+ P +
Sbjct  252   KVFEFDFSKRPESHGQTELHIKATSDGRVHAIVSWWVLQLDYEGTIFYSTAPRWINLPFN  311

Query  1162  VKDPSLSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEV  1341
              +D     S  WCDHWKQCVWFIP IG+ V KDE V   AVH DI++SY +K     +E 
Sbjct  312   CEDLQTQ-SHNWCDHWKQCVWFIPGIGILVSKDEQVDFQAVHNDISISYNLKHGDSKLEQ  370

Query  1342  RQYKLSAQDCQLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
                    + CQL LSPERIAIYGD+ WR  ML+A+ NAL++K SPLC+VADDS+FLTI L
Sbjct  371   GYPDFHTRGCQLILSPERIAIYGDREWRYDMLRAVMNALQKKVSPLCVVADDSVFLTILL  430

Query  1522  GHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDL  1701
              + + +SN+IS+FPGLQ+KG QYLQAVA +N +S++ + VL KR + LT  DT  +KVDL
Sbjct  431   ANLSPSSNIISVFPGLQEKGAQYLQAVADANGFSINRVNVLGKRPTCLTTDDTDQKKVDL  490

Query  1702  LIAEPFYYGSDSVLPWQNLRFW  1767
             LI EPFYYG++  LPW+NLRFW
Sbjct  491   LIGEPFYYGNEGKLPWENLRFW  512


 Score =   202 bits (515),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 132/177 (75%), Gaps = 4/177 (2%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLR-VTSSHSFSLPRSTRTIVRNMSS--GSRMFQLKLDPLTGNSEWV  190
            M S  C+TL     L  +T  +  S  R     VR+MSS    R+FQL+ +PLTGNSEWV
Sbjct  3    MASSICRTLVSNIVLHPITRLNPSSFGRIKCQPVRSMSSELSQRIFQLRFNPLTGNSEWV  62

Query  191  VIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSM  370
            VIEES+  E +P  LL++TSYLDMLNDSPRNRAF +AI+KTV KPCHVLDIG+GTGLLSM
Sbjct  63   VIEESEE-ENSPKALLSSTSYLDMLNDSPRNRAFCKAIEKTVIKPCHVLDIGSGTGLLSM  121

Query  371  MAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            MAARAM  +D+   + SKG+++ACESYLPMVKLMRKVLR N +E+ IRI +KRS  L
Sbjct  122  MAARAMDSSDAKHYTGSKGILSACESYLPMVKLMRKVLRINNMEKKIRIFHKRSDEL  178



>gb|EEE64946.1| hypothetical protein OsJ_19828 [Oryza sativa Japonica Group]
Length=690

 Score =   407 bits (1046),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 259/370 (70%), Gaps = 19/370 (5%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQ A+D LL ++P+ VPYR T +GQLVES  LWK+HDL NNE 
Sbjct  178   VSEILDSELLGEGLIPTLQQAYDMLLAKNPKIVPYRATTYGQLVESTFLWKLHDLHNNEA  237

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A+D + L P  M+ I+ VK QQ  M CDA+ + I+LLSEPFK+F+FDFWKRPDS RE  
Sbjct  238   NAADGVWLTPGEMERIVSVKPQQHAMQCDALEDEIRLLSEPFKVFEFDFWKRPDSHREAN  297

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPS------DVKDPSLSCSEAW  1197
             + I+ T+ G  HAIISWW+LQLD  G++FYST P+W    S      D+KD        W
Sbjct  298   IKIRTTRDGYVHAIISWWVLQLDSAGSIFYSTAPRWARQSSSEGPQRDMKD--------W  349

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQL  1377
             CDHWKQCVWF+   G+   +D+ + L A H   ++SY +     N+       S++   L
Sbjct  350   CDHWKQCVWFMQGKGIPATEDQVLSLRARHNQTSISYQL-----NINDEACDRSSKGDHL  404

Query  1378  FLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISL  1557
              L PERIA+YGDK+WR +++  I NAL  K+SP C+VADDS+FL + +   +  S VI++
Sbjct  405   TLLPERIALYGDKDWRSALINTIKNALTVKSSPTCVVADDSMFLALLISSMSPTSKVIAM  464

Query  1558  FPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDS  1737
             +PGL+DKG  YL++VA +N++S+D I+V+ KR+S++T  D  H+KV+LL+ EPFY GS+ 
Sbjct  465   YPGLRDKGAAYLRSVADANNFSIDQIQVIGKRASSITADDLKHKKVNLLVGEPFYLGSEG  524

Query  1738  VLPWQNLRFW  1767
             +LPWQNLRFW
Sbjct  525   MLPWQNLRFW  534


 Score =   162 bits (409),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 111/154 (72%), Gaps = 10/154 (6%)
 Frame = +2

Query  95   PRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIEESDTPEQTPTP----LLATTSYLDM  262
            P + R + R M+S  R FQL+L+PLTG+SEW+V+EE +  +  PTP    LLATTSYLDM
Sbjct  16   PSALRILRRRMAS--RAFQLRLNPLTGDSEWLVVEEEEEEDHHPTPPPKQLLATTSYLDM  73

Query  263  LNDSPRNRAFREAIDKTVTKP-CHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTA  439
            LNDS RNRA+R AI+  VT P   VLDIGAGTGLLSMMAARA+      +     G V+A
Sbjct  74   LNDSARNRAYRRAIEAAVTDPSSRVLDIGAGTGLLSMMAARALAAVGGETRG---GSVSA  130

Query  440  CESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            CESYLPM KLMR+VLRANG+E  +++ +KRS  L
Sbjct  131  CESYLPMGKLMRRVLRANGMENRVKVFHKRSDEL  164



>gb|EEC79835.1| hypothetical protein OsI_21299 [Oryza sativa Indica Group]
Length=690

 Score =   407 bits (1045),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 259/370 (70%), Gaps = 19/370 (5%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQ A+D LL ++P+ VPYR T +GQLVES  LWK+HDL NNE 
Sbjct  178   VSEILDSELLGEGLIPTLQQAYDMLLAKNPKIVPYRATTYGQLVESTFLWKLHDLHNNEA  237

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A+D + L P  M+ I+ VK QQ  M CDA+ + I+LLSEPFK+F+FDFWKRPDS RE  
Sbjct  238   NAADGVWLTPGEMERIVSVKPQQHAMQCDALEDEIRLLSEPFKVFEFDFWKRPDSHREAN  297

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPS------DVKDPSLSCSEAW  1197
             + I+ T+ G  HAIISWW+LQLD  G++FYST P+W    S      D+KD        W
Sbjct  298   IKIQTTRDGYVHAIISWWVLQLDSAGSIFYSTAPRWARQSSSEGPQRDMKD--------W  349

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQL  1377
             CDHWKQCVWF+   G+   +D+ + L A H   ++SY +     N+       S++   L
Sbjct  350   CDHWKQCVWFMQGKGIPATEDQVLSLRARHNQTSISYQL-----NINDEACDRSSKGDHL  404

Query  1378  FLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISL  1557
              L PERIA+YGDK+WR +++  I NAL  K+SP C+VADDS+FL + +   +  S VI++
Sbjct  405   TLLPERIALYGDKDWRSALINTIKNALTVKSSPTCVVADDSMFLALLISSMSPTSKVIAM  464

Query  1558  FPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDS  1737
             +PGL+DKG  YL++VA +N++S+D I+V+ KR+S++T  D  H+KV+LL+ EPFY GS+ 
Sbjct  465   YPGLRDKGAAYLRSVADANNFSIDQIQVIGKRASSITADDLKHKKVNLLVGEPFYLGSEG  524

Query  1738  VLPWQNLRFW  1767
             +LPWQNLRFW
Sbjct  525   MLPWQNLRFW  534


 Score =   162 bits (409),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 111/154 (72%), Gaps = 10/154 (6%)
 Frame = +2

Query  95   PRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIEESDTPEQTPTP----LLATTSYLDM  262
            P + R + R M+S  R FQL+L+PLTG+SEW+V+EE +  +  PTP    LLATTSYLDM
Sbjct  16   PSALRILRRRMAS--RAFQLRLNPLTGDSEWLVVEEEEEEDHHPTPPPKQLLATTSYLDM  73

Query  263  LNDSPRNRAFREAIDKTVTKP-CHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTA  439
            LNDS RNRA+R AI+  VT P   VLDIGAGTGLLSMMAARA+      +     G V+A
Sbjct  74   LNDSARNRAYRRAIEAAVTDPSSRVLDIGAGTGLLSMMAARALAAVGGETRG---GSVSA  130

Query  440  CESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            CESYLPM KLMR+VLRANG+E  +++ +KRS  L
Sbjct  131  CESYLPMGKLMRRVLRANGMENRVKVFHKRSDEL  164



>ref|NP_001056556.1| Os06g0105500 [Oryza sativa Japonica Group]
 sp|Q5VS72.1|ANM7_ORYSJ RecName: Full=Protein arginine N-methyltransferase 7 [Oryza sativa 
Japonica Group]
 dbj|BAD67703.1| putative protein arginine N-methyltransferase 7 [Oryza sativa 
Japonica Group]
 dbj|BAF18470.1| Os06g0105500 [Oryza sativa Japonica Group]
Length=720

 Score =   407 bits (1046),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 259/370 (70%), Gaps = 19/370 (5%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQ A+D LL ++P+ VPYR T +GQLVES  LWK+HDL NNE 
Sbjct  178   VSEILDSELLGEGLIPTLQQAYDMLLAKNPKIVPYRATTYGQLVESTFLWKLHDLHNNEA  237

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A+D + L P  M+ I+ VK QQ  M CDA+ + I+LLSEPFK+F+FDFWKRPDS RE  
Sbjct  238   NAADGVWLTPGEMERIVSVKPQQHAMQCDALEDEIRLLSEPFKVFEFDFWKRPDSHREAN  297

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPS------DVKDPSLSCSEAW  1197
             + I+ T+ G  HAIISWW+LQLD  G++FYST P+W    S      D+KD        W
Sbjct  298   IKIRTTRDGYVHAIISWWVLQLDSAGSIFYSTAPRWARQSSSEGPQRDMKD--------W  349

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQL  1377
             CDHWKQCVWF+   G+   +D+ + L A H   ++SY +     N+       S++   L
Sbjct  350   CDHWKQCVWFMQGKGIPATEDQVLSLRARHNQTSISYQL-----NINDEACDRSSKGDHL  404

Query  1378  FLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISL  1557
              L PERIA+YGDK+WR +++  I NAL  K+SP C+VADDS+FL + +   +  S VI++
Sbjct  405   TLLPERIALYGDKDWRSALINTIKNALTVKSSPTCVVADDSMFLALLISSMSPTSKVIAM  464

Query  1558  FPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDS  1737
             +PGL+DKG  YL++VA +N++S+D I+V+ KR+S++T  D  H+KV+LL+ EPFY GS+ 
Sbjct  465   YPGLRDKGAAYLRSVADANNFSIDQIQVIGKRASSITADDLKHKKVNLLVGEPFYLGSEG  524

Query  1738  VLPWQNLRFW  1767
             +LPWQNLRFW
Sbjct  525   MLPWQNLRFW  534


 Score =   162 bits (409),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 111/154 (72%), Gaps = 10/154 (6%)
 Frame = +2

Query  95   PRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIEESDTPEQTPTP----LLATTSYLDM  262
            P + R + R M+S  R FQL+L+PLTG+SEW+V+EE +  +  PTP    LLATTSYLDM
Sbjct  16   PSALRILRRRMAS--RAFQLRLNPLTGDSEWLVVEEEEEEDHHPTPPPKQLLATTSYLDM  73

Query  263  LNDSPRNRAFREAIDKTVTKP-CHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTA  439
            LNDS RNRA+R AI+  VT P   VLDIGAGTGLLSMMAARA+      +     G V+A
Sbjct  74   LNDSARNRAYRRAIEAAVTDPSSRVLDIGAGTGLLSMMAARALAAVGGETRG---GSVSA  130

Query  440  CESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            CESYLPM KLMR+VLRANG+E  +++ +KRS  L
Sbjct  131  CESYLPMGKLMRRVLRANGMENRVKVFHKRSDEL  164



>sp|A2Y8B9.3|ANM7_ORYSI RecName: Full=Protein arginine N-methyltransferase 7 [Oryza sativa 
Indica Group]
Length=720

 Score =   406 bits (1044),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/370 (52%), Positives = 259/370 (70%), Gaps = 19/370 (5%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQ A+D LL ++P+ VPYR T +GQLVES  LWK+HDL NNE 
Sbjct  178   VSEILDSELLGEGLIPTLQQAYDMLLAKNPKIVPYRATTYGQLVESTFLWKLHDLHNNEA  237

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A+D + L P  M+ I+ VK QQ  M CDA+ + I+LLSEPFK+F+FDFWKRPDS RE  
Sbjct  238   NAADGVWLTPGEMERIVSVKPQQHAMQCDALEDEIRLLSEPFKVFEFDFWKRPDSHREAN  297

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPS------DVKDPSLSCSEAW  1197
             + I+ T+ G  HAIISWW+LQLD  G++FYST P+W    S      D+KD        W
Sbjct  298   IKIQTTRDGYVHAIISWWVLQLDSAGSIFYSTAPRWARQSSSEGPQRDMKD--------W  349

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQL  1377
             CDHWKQCVWF+   G+   +D+ + L A H   ++SY +     N+       S++   L
Sbjct  350   CDHWKQCVWFMQGKGIPATEDQVLSLRARHNQTSISYQL-----NINDEACDRSSKGDHL  404

Query  1378  FLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISL  1557
              L PERIA+YGDK+WR +++  I NAL  K+SP C+VADDS+FL + +   +  S VI++
Sbjct  405   TLLPERIALYGDKDWRSALINTIKNALTVKSSPTCVVADDSMFLALLISSMSPTSKVIAM  464

Query  1558  FPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDS  1737
             +PGL+DKG  YL++VA +N++S+D I+V+ KR+S++T  D  H+KV+LL+ EPFY GS+ 
Sbjct  465   YPGLRDKGAAYLRSVADANNFSIDQIQVIGKRASSITADDLKHKKVNLLVGEPFYLGSEG  524

Query  1738  VLPWQNLRFW  1767
             +LPWQNLRFW
Sbjct  525   MLPWQNLRFW  534


 Score =   162 bits (409),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 111/154 (72%), Gaps = 10/154 (6%)
 Frame = +2

Query  95   PRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIEESDTPEQTPTP----LLATTSYLDM  262
            P + R + R M+S  R FQL+L+PLTG+SEW+V+EE +  +  PTP    LLATTSYLDM
Sbjct  16   PSALRILRRRMAS--RAFQLRLNPLTGDSEWLVVEEEEEEDHHPTPPPKQLLATTSYLDM  73

Query  263  LNDSPRNRAFREAIDKTVTKP-CHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTA  439
            LNDS RNRA+R AI+  VT P   VLDIGAGTGLLSMMAARA+      +     G V+A
Sbjct  74   LNDSARNRAYRRAIEAAVTDPSSRVLDIGAGTGLLSMMAARALAAVGGETRG---GSVSA  130

Query  440  CESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            CESYLPM KLMR+VLRANG+E  +++ +KRS  L
Sbjct  131  CESYLPMGKLMRRVLRANGMENRVKVFHKRSDEL  164



>ref|XP_003561238.1| PREDICTED: protein arginine N-methyltransferase 7 [Brachypodium 
distachyon]
Length=720

 Score =   405 bits (1041),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/370 (54%), Positives = 259/370 (70%), Gaps = 18/370 (5%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQ AHD LLV++P+TVPYR T +GQLVES  LWKMHDL NNE 
Sbjct  180   VSEILDSELLGEGLIPTLQQAHDELLVKNPKTVPYRATTYGQLVESTFLWKMHDLHNNEA  239

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A+D I L P G + ++ VK QQ  M CDA+ + I+LLSEPFK+F+FDFW+RP S+RET+
Sbjct  240   NAADGIWLTPDGTERVVSVKPQQHAMQCDALEDEIRLLSEPFKVFEFDFWERPKSNRETK  299

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIH------CPSDVKDPSLSCSEAW  1197
             + IK T  G  HAIISWW+LQLD  G++FYST P+W+        P D KD        W
Sbjct  300   ISIKTTGDGCVHAIISWWVLQLDSAGSIFYSTAPRWVRQSSIEDLPQDTKD--------W  351

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQL  1377
             CDHWK CVWF    G  V KD+ + L A H   ++SY    +  N     +  + +   L
Sbjct  352   CDHWKHCVWFTQGRGAPVMKDQILSLRASHNLTSISY----ELLNTTDEAWSGNLKGDHL  407

Query  1378  FLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISL  1557
              LSPERIA+YGD+ WR +++  + NAL  ++   CIVADDSIFLT+ +   + +S VI++
Sbjct  408   TLSPERIALYGDRYWRSALITVVKNALSDRSLSTCIVADDSIFLTLLVSSLSPSSKVIAM  467

Query  1558  FPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDS  1737
             FPGL++KG  Y+QAVA +N+ SMD I+V+ K++++LT+ D   +KV+LL+ EPFYYGS+ 
Sbjct  468   FPGLREKGATYIQAVADANNLSMDQIQVIGKKAASLTLDDLKQKKVNLLVGEPFYYGSEG  527

Query  1738  VLPWQNLRFW  1767
             +LPWQNLRFW
Sbjct  528   MLPWQNLRFW  537


 Score =   145 bits (365),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 109/150 (73%), Gaps = 9/150 (6%)
 Frame = +2

Query  107  RTIVRNMSSGSRMFQLKLDPLTGNSEWVVIEESDTPEQTPT----PLLATTSYLDMLNDS  274
            R  + + S+ SR FQL+L+PLTG+SEW+V++E++   + P      LLATTSYLDMLND+
Sbjct  21   RRCMASSSAPSRAFQLRLNPLTGDSEWLVVDEAEADGEAPATSQRKLLATTSYLDMLNDA  80

Query  275  PRNRAFREAIDKTVTKPC-HVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESY  451
             RNRA+R AID  VT P   VLDIGAGTGLLSMM+ARA+         + KG V+ACESY
Sbjct  81   ARNRAYRRAIDAAVTDPSSRVLDIGAGTGLLSMMSARAL----ENVGGEGKGSVSACESY  136

Query  452  LPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            LPM KL RKVLRANG+E+ ++I +KRS  L
Sbjct  137  LPMGKLTRKVLRANGMEKKVKIFHKRSDEL  166



>ref|XP_010434803.1| PREDICTED: LOW QUALITY PROTEIN: protein arginine N-methyltransferase 
1.6-like [Camelina sativa]
Length=717

 Score =   404 bits (1038),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 199/365 (55%), Positives = 256/365 (70%), Gaps = 9/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+LQHAHD LLV++P+TVPYR T + QLVES+ L  MH+L NNE 
Sbjct  175   VSEILDSELLGEGLIPSLQHAHDMLLVDNPKTVPYRATTYCQLVESEFLCNMHNLRNNEA  234

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             K SD + LVP G++++  +K QQ+ MH DAI + IKLLS+P K+F+FDFWKRP+S+ E +
Sbjct  235   KISDGVRLVPPGLESLFGIKSQQYSMHVDAIEKDIKLLSDPVKVFEFDFWKRPESNGELD  294

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + I+AT  G+ HAIISWW+LQLD EGT+FYST P+WI        P +   E WCDHWKQ
Sbjct  295   VHIEATTAGSVHAIISWWVLQLDSEGTIFYSTAPRWID-----SSPEIGVRE-WCDHWKQ  348

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             CVWF P  G+S+ K E V+LHA HT  N+ Y + KTQS   E+    LS  D  L LSPE
Sbjct  349   CVWFTPGAGVSLSKGEKVNLHAAHTCTNILYNLKKTQSLTHEMTHSPLSTGDLHLTLSPE  408

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R+AIYGD  +R SM +A  NAL+  ++P C+V DDS+ L +   H +  S VISL PGLQ
Sbjct  409   RVAIYGDSRYRQSMFEATRNALQGNSNPQCLVIDDSLLLPLMALHASNRSRVISLSPGLQ  468

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             +   +Y +AVA SN +S D  +  ++  S L   + +  K+DLLI EP++YG +S LPWQ
Sbjct  469   ENAARYFEAVADSNGFSKDRFEYFREVKSKLA--EAYPSKIDLLIGEPYFYGLESGLPWQ  526

Query  1753  NLRFW  1767
             NLRFW
Sbjct  527   NLRFW  531


 Score =   190 bits (483),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 114/147 (78%), Gaps = 11/147 (7%)
 Frame = +2

Query  98   RSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLND  271
            RS+    R MSS S  R+FQL+ DPLTG SEWVVIE++D P  +   LLATTSYLDMLND
Sbjct  21   RSSVFSARTMSSQSSQRVFQLRQDPLTGESEWVVIEDNDQPGTSSDGLLATTSYLDMLND  80

Query  272  SPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESY  451
            + RNRA+R AI++TVT+PCHVLDIGAGTGLLSMMAARAMG          +G+VTACESY
Sbjct  81   TRRNRAYRLAIERTVTQPCHVLDIGAGTGLLSMMAARAMG---------EEGIVTACESY  131

Query  452  LPMVKLMRKVLRANGIERGIRIINKRS  532
            LPMVKLMRKVL  NG+ + I +INKRS
Sbjct  132  LPMVKLMRKVLHKNGMTKNINLINKRS  158



>ref|XP_010440130.1| PREDICTED: protein arginine N-methyltransferase 1.6-like isoform 
X2 [Camelina sativa]
Length=585

 Score =   398 bits (1022),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 196/365 (54%), Positives = 252/365 (69%), Gaps = 9/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+LQHAHD LLV++P+ VPYR T + QLVES+ L  MH+L NNE 
Sbjct  182   VSEILDSELLGEGLIPSLQHAHDMLLVDNPKAVPYRATTYCQLVESEFLCNMHNLRNNEA  241

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             K SD + LVP G++++  +K QQ+ MH DAI   IKLLS+P KIF+FDFWKRP+S+ E +
Sbjct  242   KVSDGVRLVPPGLESLFGIKSQQYSMHVDAIENDIKLLSDPVKIFEFDFWKRPESNGELD  301

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + I+AT  G+ HAIISWW+LQLD EGT+FYST P+WI        P +   E WCDHWKQ
Sbjct  302   VHIEATTAGSVHAIISWWVLQLDSEGTIFYSTAPRWID-----SSPEIGVRE-WCDHWKQ  355

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             CVWF P  G+S+ K E V+LHA HT  N+ Y + KTQS   E+    LS  D  L L PE
Sbjct  356   CVWFTPGAGVSLSKGEKVNLHAAHTCTNILYNLKKTQSLTHEMTHSPLSTGDVHLTLPPE  415

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R+AIYGD  +R SM +A  NAL+  ++P C+V DDS+ L +   H +  S VISL PGLQ
Sbjct  416   RVAIYGDSRYRQSMFEATRNALQGNSNPQCLVIDDSLLLPLMALHASNRSRVISLSPGLQ  475

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             +   +Y +A+A SN +S D  +  ++  S L   + +  K+DLLI EP++ G +S LPWQ
Sbjct  476   ENAARYFEAIADSNGFSKDRFEYFREVKSNLA--EAYPSKIDLLIGEPYFCGLESGLPWQ  533

Query  1753  NLRFW  1767
             NLRFW
Sbjct  534   NLRFW  538


 Score =   200 bits (508),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 121/161 (75%), Gaps = 11/161 (7%)
 Frame = +2

Query  56   FPLRVTSSHSFSLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWVVIEESDTPEQTPT  229
             P R    HS +  RS+  I R MSS S  R+FQL+ DPLTG+SEWVVIE++D P  +  
Sbjct  14   IPFRSFRRHSLTRLRSSVFIARTMSSQSSQRVFQLRQDPLTGDSEWVVIEDNDQPGTSSD  73

Query  230  PLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSAS  409
             LL+TTSYLDMLND+ RNRA+R AI+KT+T+PCHVLDIGAGTGLLSMMAARAMG      
Sbjct  74   GLLSTTSYLDMLNDTRRNRAYRLAIEKTITQPCHVLDIGAGTGLLSMMAARAMG------  127

Query  410  NSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRS  532
                +GMVTACESYLPMVKLMRKVL  NG+ + I +INKRS
Sbjct  128  ---EEGMVTACESYLPMVKLMRKVLHKNGMTKNINLINKRS  165



>dbj|BAK05792.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=729

 Score =   402 bits (1033),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 199/373 (53%), Positives = 257/373 (69%), Gaps = 21/373 (6%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQ AHD+LLV++P+TVPYR T +GQLVES  LWKMHDL +NE 
Sbjct  186   VSEILDSELLGEGLIPTLQQAHDSLLVKNPKTVPYRATTYGQLVESPFLWKMHDLHSNEA  245

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A+D + L P GM+ I+ VK QQ  M CD +   I+LLSEPFK+F+FDF +RP+S RE +
Sbjct  246   NAADGVWLTPDGMENIVSVKLQQHAMQCDPLQGEIRLLSEPFKVFEFDFSERPESQRENK  305

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWI---------HCPSDVKDPSLSCS  1188
             + IK T  G  HAIISWW+LQLD +G++FYST P+W+          C  D+KD      
Sbjct  306   ITIKTTGDGCVHAIISWWVLQLDSDGSIFYSTAPRWVRQSSITDLPQCADDMKD------  359

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQD  1368
               WCDHWK CVWF    G SV KD+ + L A H   ++SY    Q  N        S + 
Sbjct  360   --WCDHWKHCVWFTQGRGASVMKDQTLSLRASHNLTSISY----QQLNANDEACNGSLKG  413

Query  1369  CQLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNV  1548
               L L PERIA+YGD+ WR +++ AI NAL  ++   CIVADDSIFL + +   + +S V
Sbjct  414   DHLTLLPERIALYGDRYWRSALITAIKNALGDRSLQTCIVADDSIFLALLVSSLSPSSKV  473

Query  1549  ISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYG  1728
             I++FPGL+D G  YLQAVA +N++S+D I+V+ KR+++L+  D  H+KVDLL+ EPFY G
Sbjct  474   IAMFPGLRDTGATYLQAVAKANNFSIDQIQVIGKRAASLSTDDLEHKKVDLLVGEPFYCG  533

Query  1729  SDSVLPWQNLRFW  1767
             S+ +LPWQNLRFW
Sbjct  534   SEGMLPWQNLRFW  546


 Score =   140 bits (354),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 104/142 (73%), Gaps = 11/142 (8%)
 Frame = +2

Query  137  SRMFQLKLDPLTGNSEWVVIEESD------TPEQTPTPLLATTSYLDMLNDSPRNRAFRE  298
            SR FQL+L+PLTG+SEW+V++E++       P QT   LLA TSYLDMLND+ RNRA+R 
Sbjct  35   SRAFQLRLNPLTGDSEWLVVDEAEGEDAGAAPPQTQRQLLAATSYLDMLNDAARNRAYRR  94

Query  299  AIDKTVTKP-CHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMR  475
            AI+  VT P   VLDIGAGTGLLSMM+ARA+G    A   + +G V+ACESYLPM KL R
Sbjct  95   AIEAAVTDPSSRVLDIGAGTGLLSMMSARALG----AVGGECRGSVSACESYLPMGKLTR  150

Query  476  KVLRANGIERGIRIINKRSKIL  541
            K LRANG++  +++ +KRS  L
Sbjct  151  KALRANGMDNKVKLFHKRSDEL  172



>gb|KFK26525.1| hypothetical protein AALP_AA8G260400 [Arabis alpina]
Length=720

 Score =   399 bits (1025),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 210/410 (51%), Positives = 272/410 (66%), Gaps = 19/410 (5%)
 Frame = +1

Query  550   LMKPVDEKSSIVKPCNISL**KFNYQF---QDFLWIHHILNFNNTVSEILDSELLGEGLI  720
             LM+ V  K+ + K  NI+L  K + +    +D     H+L     VSEILDSELLGEGLI
Sbjct  140   LMRKVLHKNGMAK--NINLINKRSDELKVGEDLASQAHVL-----VSEILDSELLGEGLI  192

Query  721   PTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEEKASDTIHLVPKGMDT  900
             P+LQHAHD LLV++P+TVPYR T + QLVES  L  MHDL NNE K  D + LVP G+++
Sbjct  193   PSLQHAHDMLLVDNPKTVPYRATTYCQLVESTFLCNMHDLQNNEAKKPDGVCLVPPGLES  252

Query  901   IICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETELLIKATKGGTAHAII  1080
             +  +K +Q+ MH DAI + IKLLSEP KIF+FDFWKRP+S  E  + I+A   G  HAII
Sbjct  253   LFGIKSEQYAMHVDAIEKEIKLLSEPIKIFEFDFWKRPESDGEIGVDIEAITEGRIHAII  312

Query  1081  SWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQCVWFIPNIGLSVQKD  1260
             SWW+LQLD EGT+FYST P+WI   SD      +    WCDHWKQCVW+ P  G+S+ K 
Sbjct  313   SWWVLQLDSEGTIFYSTAPRWIDSNSD------TGFRDWCDHWKQCVWYTPGAGVSISKG  366

Query  1261  EYVHLHAVHTDINLSYVVK-TQSQNMEVRQYKLSAQDCQLFLSPERIAIYGDKNWRCSML  1437
             E +HLHA HT  N+ Y +K TQS   E+ Q  LS  D  L L PER+A+YGD  +R SM+
Sbjct  367   EKIHLHATHTCTNILYNLKTTQSLTREMTQSPLSTGDLHLTLPPERVAVYGDSIYRQSMI  426

Query  1438  KAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQDKGEQYLQAVAASND  1617
             +A   A++ K+ P C+V DDS+ L +   H +  S VISL PGLQ+   +YL+A+A SN 
Sbjct  427   EATRKAVQGKSHPHCLVIDDSLLLPLMALHISNTSRVISLSPGLQENAARYLEAIADSNG  486

Query  1618  YSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQNLRFW  1767
             YS D  K  ++  + LT  + +  ++DLLI EP+YYG +S LPWQNLRFW
Sbjct  487   YSKDRFKYFREGKAKLT--EAYPNEIDLLIGEPYYYGLESGLPWQNLRFW  534


 Score =   199 bits (506),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 118/163 (72%), Gaps = 9/163 (6%)
 Frame = +2

Query  59   PLRVTSSHSFSLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWVVIEESDTPEQTPTP  232
            P      HS +  R      R MSS S  R+FQL+ DPLTGNSEW+VIEE+D      T 
Sbjct  9    PFHFFRCHSVT-TRLRSVAARTMSSQSSQRVFQLRQDPLTGNSEWIVIEENDQTGVPETG  67

Query  233  LLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASN  412
            LLA TSYLDMLNDS RNRAFR AI+KT+T+PCHVLDIGAGTGLLSMMAARAMG       
Sbjct  68   LLARTSYLDMLNDSCRNRAFRLAIEKTITEPCHVLDIGAGTGLLSMMAARAMG------E  121

Query  413  SDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
             DSKGMVTACESYLPMVKLMRKVL  NG+ + I +INKRS  L
Sbjct  122  EDSKGMVTACESYLPMVKLMRKVLHKNGMAKNINLINKRSDEL  164



>ref|XP_010440129.1| PREDICTED: protein arginine N-methyltransferase 1.6-like isoform 
X1 [Camelina sativa]
Length=724

 Score =   396 bits (1018),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 196/365 (54%), Positives = 252/365 (69%), Gaps = 9/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+LQHAHD LLV++P+ VPYR T + QLVES+ L  MH+L NNE 
Sbjct  182   VSEILDSELLGEGLIPSLQHAHDMLLVDNPKAVPYRATTYCQLVESEFLCNMHNLRNNEA  241

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             K SD + LVP G++++  +K QQ+ MH DAI   IKLLS+P KIF+FDFWKRP+S+ E +
Sbjct  242   KVSDGVRLVPPGLESLFGIKSQQYSMHVDAIENDIKLLSDPVKIFEFDFWKRPESNGELD  301

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + I+AT  G+ HAIISWW+LQLD EGT+FYST P+WI        P +   E WCDHWKQ
Sbjct  302   VHIEATTAGSVHAIISWWVLQLDSEGTIFYSTAPRWID-----SSPEIGVRE-WCDHWKQ  355

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             CVWF P  G+S+ K E V+LHA HT  N+ Y + KTQS   E+    LS  D  L L PE
Sbjct  356   CVWFTPGAGVSLSKGEKVNLHAAHTCTNILYNLKKTQSLTHEMTHSPLSTGDVHLTLPPE  415

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R+AIYGD  +R SM +A  NAL+  ++P C+V DDS+ L +   H +  S VISL PGLQ
Sbjct  416   RVAIYGDSRYRQSMFEATRNALQGNSNPQCLVIDDSLLLPLMALHASNRSRVISLSPGLQ  475

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             +   +Y +A+A SN +S D  +  ++  S L   + +  K+DLLI EP++ G +S LPWQ
Sbjct  476   ENAARYFEAIADSNGFSKDRFEYFREVKSNLA--EAYPSKIDLLIGEPYFCGLESGLPWQ  533

Query  1753  NLRFW  1767
             NLRFW
Sbjct  534   NLRFW  538


 Score =   199 bits (507),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 121/161 (75%), Gaps = 11/161 (7%)
 Frame = +2

Query  56   FPLRVTSSHSFSLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWVVIEESDTPEQTPT  229
             P R    HS +  RS+  I R MSS S  R+FQL+ DPLTG+SEWVVIE++D P  +  
Sbjct  14   IPFRSFRRHSLTRLRSSVFIARTMSSQSSQRVFQLRQDPLTGDSEWVVIEDNDQPGTSSD  73

Query  230  PLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSAS  409
             LL+TTSYLDMLND+ RNRA+R AI+KT+T+PCHVLDIGAGTGLLSMMAARAMG      
Sbjct  74   GLLSTTSYLDMLNDTRRNRAYRLAIEKTITQPCHVLDIGAGTGLLSMMAARAMG------  127

Query  410  NSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRS  532
                +GMVTACESYLPMVKLMRKVL  NG+ + I +INKRS
Sbjct  128  ---EEGMVTACESYLPMVKLMRKVLHKNGMTKNINLINKRS  165



>ref|XP_010542205.1| PREDICTED: protein arginine N-methyltransferase 1.6 [Tarenaya 
hassleriana]
Length=705

 Score =   395 bits (1014),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 200/367 (54%), Positives = 250/367 (68%), Gaps = 7/367 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P+TVPYR + F QLVES  L  MHDL N+E 
Sbjct  158   VSEILDSELLGEGLIPTLQHAHDMLLVDNPKTVPYRASTFCQLVESTFLCNMHDLCNSEA  217

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             K SD +HLVP G++ ++  K QQ+ MH +A+ + +KLLSEP KIF+FDFWKRP S  E E
Sbjct  218   KTSDGVHLVPTGLENLLRPKSQQYAMHVNAMEKEVKLLSEPIKIFEFDFWKRPASHGELE  277

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEA--WCDHW  1209
             + +KA   G  HAIISWW+LQLD EGT+FYST P+W+   +D    +LS      WCDHW
Sbjct  278   VHVKAISEGRIHAIISWWVLQLDSEGTIFYSTAPRWVDSNTDTGGSNLSMESVRDWCDHW  337

Query  1210  KQCVWFIPNIGLSVQKDEYVHLHAVHTDIN-LSYVVKTQSQNMEVRQYKLSAQDCQLFLS  1386
             KQCVWF P  G+SV K E V L A HT  N L Y+ KTQ  + E+     +A+D QL L 
Sbjct  338   KQCVWFTPGAGVSVSKGEKVVLQAAHTCTNILYYLKKTQRLSNEIPCSTSNARDLQLTLP  397

Query  1387  PERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPG  1566
             PERIA+YGD  +R SM +A+  AL+ KA PLC+  DDS+FL +   H    S+VISL PG
Sbjct  398   PERIAVYGDNEFRLSMFEAMIKALQGKAHPLCLAVDDSLFLPLTALHICGNSHVISLSPG  457

Query  1567  LQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLP  1746
              ++   +YL+AVA SN +S D  + + K      +  TH  KVDLL+ EP+Y   + VLP
Sbjct  458   FKENVVRYLEAVADSNGFSKDRFEYVTKAK----LTQTHENKVDLLVGEPYYSALEGVLP  513

Query  1747  WQNLRFW  1767
             WQNLRFW
Sbjct  514   WQNLRFW  520


 Score =   183 bits (464),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 107/143 (75%), Gaps = 3/143 (2%)
 Frame = +2

Query  122  NMSSGSRMFQLKLDPLTGNSEWVVIEESDT---PEQTPTPLLATTSYLDMLNDSPRNRAF  292
            N  S  R+FQLK DPL+  SEWVVIE++D    P+ +   LL TTSYLDMLNDSPRNRAF
Sbjct  2    NSESIQRVFQLKHDPLSCTSEWVVIEDNDDAELPDTSTDGLLDTTSYLDMLNDSPRNRAF  61

Query  293  REAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLM  472
            R AI+KT+T+PCHVLDIGAGTGLLSMMAAR M         DS  MVTACESYLPMVKLM
Sbjct  62   RLAIEKTITRPCHVLDIGAGTGLLSMMAARRMTTLGEEYPVDSNCMVTACESYLPMVKLM  121

Query  473  RKVLRANGIERGIRIINKRSKIL  541
            RKV+  NG+ + I IINKRS  L
Sbjct  122  RKVVHMNGMGKDINIINKRSDEL  144



>ref|XP_002870146.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46405.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=729

 Score =   394 bits (1013),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 195/365 (53%), Positives = 247/365 (68%), Gaps = 9/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+LQHAHD LLV++P+TVPYR T + QLVES  L  MHDL NNE 
Sbjct  186   VSEILDSELLGEGLIPSLQHAHDMLLVDNPKTVPYRATTYCQLVESTFLCNMHDLRNNEA  245

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             K  D   LVP G++++  +K QQ+ MH DAI + IKLLSEP KIF+FDFWKRP+S+ E +
Sbjct  246   KTYDGFRLVPPGLESLFGIKSQQYSMHVDAIEKDIKLLSEPVKIFEFDFWKRPESNGELD  305

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + I+A   G+ HAIISWW+LQLD EGT+FYST P+WI   S++          WCDHWKQ
Sbjct  306   VHIEAITAGSVHAIISWWVLQLDSEGTIFYSTAPRWIDSNSEIG------VRDWCDHWKQ  359

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             CVWF P  G+S+ K E VHLHA HT  N+ Y + KTQS   E+  + LS  D  L LSPE
Sbjct  360   CVWFTPGAGVSISKGEKVHLHAAHTCTNILYNLKKTQSLTHEMTYFPLSTGDLHLTLSPE  419

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R+AIYGD  +R S+ +A   AL+ K+ P C+V DDS+ L +   H +  S V+SL PGLQ
Sbjct  420   RVAIYGDSIYRQSLFEATRKALQGKSYPQCLVIDDSLLLPLVALHISNRSRVLSLSPGLQ  479

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             +   +Y + +A SN +S D  +    R     +   +  K+DLLI EP+Y G +S LPWQ
Sbjct  480   ENAARYFEVIADSNGFSKDRFEYF--REGKANLAKAYPSKIDLLIGEPYYSGLESGLPWQ  537

Query  1753  NLRFW  1767
             NLRFW
Sbjct  538   NLRFW  542


 Score =   199 bits (507),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 129/177 (73%), Gaps = 8/177 (5%)
 Frame = +2

Query  20   MLSLFCKTLNPTF-PLRVTSSHSFSLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWV  190
            M SLF   L  TF   R    HS +  RS+    R MSS S  R+FQL+ DPLTGNSEW+
Sbjct  1    MSSLFSLLLPKTFISFRC---HSVTRLRSS-VAARTMSSQSSQRVFQLRQDPLTGNSEWI  56

Query  191  VIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSM  370
            VIE++D P  +   LLATTSYLDMLNDS RNRA+R AI+KT+T+PCHVLDIGAGTGLLSM
Sbjct  57   VIEDNDQPGTSTDGLLATTSYLDMLNDSRRNRAYRLAIEKTITEPCHVLDIGAGTGLLSM  116

Query  371  MAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            MA RAM   +  S  DSKGMVTACESYLPMVKLMRKVL  NG+ + I +INKRS  L
Sbjct  117  MAVRAMRGREEESG-DSKGMVTACESYLPMVKLMRKVLHKNGMTKNINLINKRSDEL  172



>ref|XP_010449758.1| PREDICTED: protein arginine N-methyltransferase 1.6-like [Camelina 
sativa]
Length=724

 Score =   392 bits (1008),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/365 (53%), Positives = 252/365 (69%), Gaps = 9/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+LQHAHD LLV++P+TVPYR T + QLVES+ L  MH+L NNE 
Sbjct  182   VSEILDSELLGEGLIPSLQHAHDMLLVDNPKTVPYRATTYCQLVESEFLCNMHNLRNNEA  241

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
               SD + LVP G +++  +K QQ+ MH DAI + IKLLS+P K+F+FDFWKRP+S+ E +
Sbjct  242   TVSDGVRLVPAGSESLFGIKSQQYSMHVDAIEKDIKLLSDPVKVFEFDFWKRPESNGELD  301

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + I+AT  G+ +AIISWW+LQLD EGT+FYST P+WI        P +   E WCDHWKQ
Sbjct  302   VHIEATTAGSVNAIISWWVLQLDSEGTIFYSTAPRWID-----SSPEIGVRE-WCDHWKQ  355

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             CVWF P  G+S+ K E V+LHA HT  N+ Y + KTQS   E+    LS  D  L L PE
Sbjct  356   CVWFTPGAGVSLSKGEKVNLHAAHTCTNILYNLKKTQSLTHEMTHSPLSTGDIHLTLPPE  415

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R+AIYGD  +R SM +A  NAL+  ++P C+V DDS+ L +   H +  S VISL PGLQ
Sbjct  416   RVAIYGDSRYRQSMFEATRNALQGNSNPQCLVIDDSLLLPLMALHASNRSRVISLSPGLQ  475

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             +   +Y +A+A SN +S D  +  ++  S L   + +  K+DLLI EP++ G +S LPWQ
Sbjct  476   ENAARYFEAIADSNGFSKDRFEYFREVKSKLA--EAYPSKIDLLIGEPYFCGLESGLPWQ  533

Query  1753  NLRFW  1767
             NLRFW
Sbjct  534   NLRFW  538


 Score =   192 bits (488),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 123/177 (69%), Gaps = 14/177 (8%)
 Frame = +2

Query  17   SMLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWV  190
            S+ SL  KT  P    R    HS +   S     R MSS S  R FQL+ DPLTGNSEWV
Sbjct  4    SLSSLHPKTFIPFISFR---RHSLTRLGSFVVAARTMSSQSSQRAFQLRQDPLTGNSEWV  60

Query  191  VIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSM  370
            VIE++D P  +   LL+TTSYLDMLND+ RNRA+R AI+KT+T+PCHVLDIGAG GLLSM
Sbjct  61   VIEDNDQPGTSTDGLLSTTSYLDMLNDTRRNRAYRLAIEKTITQPCHVLDIGAGAGLLSM  120

Query  371  MAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            MAARAMG          +G+VTACESYLPMVKLMRKVL  NG+ + I +INKRS  L
Sbjct  121  MAARAMG---------EEGIVTACESYLPMVKLMRKVLHKNGMTKNINLINKRSDEL  168



>ref|NP_567508.1| protein arginine N-methyltransferase 7 [Arabidopsis thaliana]
 sp|Q944R7.2|ANM16_ARATH RecName: Full=Protein arginine N-methyltransferase 1.6; Short=AtPRMT16; 
Short=AtPRMT7 [Arabidopsis thaliana]
 gb|AEE83772.1| protein arginine N-methyltransferase 7 [Arabidopsis thaliana]
Length=724

 Score =   389 bits (1000),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 193/365 (53%), Positives = 247/365 (68%), Gaps = 9/365 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+LQHAHD LLV++P+TVPYR T + QLVES  L  + DL NNE 
Sbjct  181   VSEILDSELLGEGLIPSLQHAHDMLLVDNPKTVPYRATTYCQLVESTFLCNLQDLRNNEA  240

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             K SD + LVP G++++  +K QQ+ MH DAI + IKLLSEP KIF+FDFWKRP+S+ E +
Sbjct  241   KTSDGVRLVPPGLESLFGIKSQQYSMHVDAIEKEIKLLSEPVKIFEFDFWKRPESNGELD  300

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + I+A   G+ HAIISWW+LQLD EGT+FYST P+WI   S++          WCDHWKQ
Sbjct  301   VHIEAKTTGSVHAIISWWVLQLDSEGTIFYSTAPRWIDSNSEIG------VRDWCDHWKQ  354

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             CVWF P  G+S+ K E VHLHA HT  N+ Y + KTQS   E   + LS  D  L L PE
Sbjct  355   CVWFTPGTGVSISKGEKVHLHASHTCTNILYNLKKTQSLTHERTHFPLSTGDLHLTLPPE  414

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R+AIYGD  +R S+ +A   AL+ K+ P C+V DDS+ L +   H +  S V+SL PGLQ
Sbjct  415   RVAIYGDSIYRQSLFEATRKALQGKSYPQCLVIDDSLLLPLMALHISNRSRVLSLSPGLQ  474

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             +   +Y +A+A SN +S D  +    R     +   +  K+DLLI EP+Y G ++ LPWQ
Sbjct  475   ENAARYFEAIADSNGFSKDRFEYF--RDGKTNLAKAYPGKIDLLIGEPYYSGLENGLPWQ  532

Query  1753  NLRFW  1767
             NLRFW
Sbjct  533   NLRFW  537


 Score =   196 bits (499),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 122/161 (76%), Gaps = 10/161 (6%)
 Frame = +2

Query  68   VTSSHSFSLPRSTRTI-VRNMSSGS--RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLL  238
            ++S H  S+ R  R++  R MSS S  R+FQL+ DPLTGNSEW+VIE++D P  +   LL
Sbjct  13   ISSFHCHSVTRLRRSVTARTMSSQSSQRVFQLRQDPLTGNSEWIVIEDNDQPGTSTDGLL  72

Query  239  ATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSD  418
            ATTSYLDMLNDS RN A+R AI+KT+T+PCHVLDIGAGTGLLSMMA RAM         D
Sbjct  73   ATTSYLDMLNDSRRNIAYRLAIEKTITEPCHVLDIGAGTGLLSMMAVRAM-------RGD  125

Query  419  SKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            SKGMVTACESYLPMVKLMRKV+  NG+ + I +INKRS  L
Sbjct  126  SKGMVTACESYLPMVKLMRKVMHKNGMTKNINLINKRSDEL  166



>ref|XP_009145712.1| PREDICTED: protein arginine N-methyltransferase 1.6 [Brassica 
rapa]
Length=723

 Score =   384 bits (986),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 189/364 (52%), Positives = 247/364 (68%), Gaps = 11/364 (3%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+LQHAHD LLV++ +TVPYR T + QLVES  L  MHDL +NE 
Sbjct  185   VSEILDSELLGEGLIPSLQHAHDMLLVDNSKTVPYRATTYCQLVESTFLCNMHDLQSNEA  244

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             + SD + LVP  ++++  +K QQ+ MH DAI + IKLLSEP K+F+FDFWKRP+S+ E +
Sbjct  245   RMSDGVRLVPPVLESLFGIKSQQYSMHVDAIEKEIKLLSEPIKVFEFDFWKRPESNGELD  304

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + I+A   G+ HAIISWW+LQLD EGT+FYST P+WI   S++       +  WCDHWKQ
Sbjct  305   VHIEAITEGSVHAIISWWVLQLDSEGTIFYSTAPRWIESNSEIG------ARDWCDHWKQ  358

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF P  G+S+ K E VHLHA HT  N+ Y +K   +  E+     S  + QL   PER
Sbjct  359   CVWFTPGAGVSISKGEKVHLHAAHTCTNILYNLK---KAHEITHSSFSTGELQLTFPPER  415

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             +AIYGD  +R S+ +A  NA +  +   C+V DDSI L +   H +  S VISL PGLQ+
Sbjct  416   VAIYGDSVYRQSIFEATRNAFQGLSDAQCLVIDDSILLPLMALHISNGSRVISLSPGLQE  475

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
                +YL+A+A SN +S D  K  ++  + L   + +  K+DLLI EP+YYG +S LPWQN
Sbjct  476   NAARYLEAIADSNGFSKDRFKYFREGKAKL--MEAYPSKIDLLIGEPYYYGLESGLPWQN  533

Query  1756  LRFW  1767
             LRFW
Sbjct  534   LRFW  537


 Score =   181 bits (458),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 119/176 (68%), Gaps = 12/176 (7%)
 Frame = +2

Query  23   LSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIEE  202
            LSL  KT  P    R       S   + RT+     S  R+FQL+ DPLTG SEW++I+E
Sbjct  5    LSLLPKTFIPFLSFRCPPLTRLSSVVAARTMTSQ--SSQRVFQLRQDPLTGTSEWIIIDE  62

Query  203  SD---TPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMM  373
            +D    P  +   LLATTSYLDMLND+ RNRA+R AI+KT+T+PCHVLDIGAGTGLLSMM
Sbjct  63   NDEAGAPVTSTDGLLATTSYLDMLNDTRRNRAYRLAIEKTITEPCHVLDIGAGTGLLSMM  122

Query  374  AARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            AARAMG  + +        VTACESYLPMVKLMRKV+  NG+ + I +INKRS  L
Sbjct  123  AARAMGDKEESC-------VTACESYLPMVKLMRKVMHKNGMTKNINLINKRSDEL  171



>emb|CDY40533.1| BnaC01g19790D [Brassica napus]
Length=724

 Score =   384 bits (985),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 197/407 (48%), Positives = 265/407 (65%), Gaps = 17/407 (4%)
 Frame = +1

Query  550   LMKPVDEKSSIVKPCNISL**KFNYQFQDFLWIHHILNFNNT-VSEILDSELLGEGLIPT  726
             LM+ V  K+ + K  N+     FN +  +      I +  +  VSEILDSELLGEGLIP+
Sbjct  148   LMRKVLHKNGMTKNINL-----FNKRSDELEVGSDIASRADVLVSEILDSELLGEGLIPS  202

Query  727   LQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEEKASDTIHLVPKGMDTII  906
             LQHAHD LLV++P+TVPYR T + QLVES  L  MHDL +NE + SD + L P G++++ 
Sbjct  203   LQHAHDMLLVDNPKTVPYRATTYCQLVESTFLCNMHDLQSNEARISDGVRLAPPGLESLF  262

Query  907   CVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETELLIKATKGGTAHAIISW  1086
              +K QQ+ MH DAI + IKLLSEP K+F+FDFWKRP+S+ E ++ I+A   G+ HAIISW
Sbjct  263   GIKSQQYSMHIDAIEKEIKLLSEPVKVFEFDFWKRPESNGELDVHIEAINEGSVHAIISW  322

Query  1087  WLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQCVWFIPNIGLSVQKDEY  1266
             W+LQLD EGT+FYST P+WI   S++       +  WCDHWKQCVWF P  G+S+ K E 
Sbjct  323   WVLQLDSEGTIFYSTAPRWIESNSEIS------ARDWCDHWKQCVWFTPGAGVSISKGEK  376

Query  1267  VHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPERIAIYGDKNWRCSMLKAI  1446
              HL A HT  N+ Y +K   +  E+     S  +  L L PER+AIYGD  +R ++ +A 
Sbjct  377   FHLQAAHTCTNILYNLK---KAHEMTHSSFSTGELLLTLPPERVAIYGDSIYRQTIFEAT  433

Query  1447  NNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQDKGEQYLQAVAASNDYSM  1626
              NAL+ K+   C+V DDS+ L +   H +  S VISL PGLQ+   +YL+A+A SN +S 
Sbjct  434   RNALQGKSDAQCLVIDDSLLLPLTALHISNGSRVISLSPGLQENAARYLEAIADSNGFSE  493

Query  1627  DCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQNLRFW  1767
             D  +  ++  + LT  +    K+DLLI EP+YYG +S LPWQNLRFW
Sbjct  494   DRFEYFREGKAKLT--EAFPSKIDLLIGEPYYYGLESGLPWQNLRFW  538


 Score =   179 bits (453),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 115/162 (71%), Gaps = 16/162 (10%)
 Frame = +2

Query  83   SFSLPRSTR----TIVRNMSSGS--RMFQLKLDPLTGNSEWVVIEESD---TPEQTPTPL  235
            SF  P  TR       R M+S S  R+FQL+ DPLTG SEW+VI+E+D    P  +   L
Sbjct  18   SFRWPPPTRLSSVVTARTMTSQSNQRVFQLRQDPLTGTSEWIVIDENDEAGAPVTSTDGL  77

Query  236  LATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNS  415
            LATTSYLDMLND+ RNRA+R AI+KT+T+PCHVLDIGAGTGLLSMMAARAMG  + +   
Sbjct  78   LATTSYLDMLNDTRRNRAYRLAIEKTITEPCHVLDIGAGTGLLSMMAARAMGDKEESC--  135

Query  416  DSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
                 VTACESYLPMVKLMRKVL  NG+ + I + NKRS  L
Sbjct  136  -----VTACESYLPMVKLMRKVLHKNGMTKNINLFNKRSDEL  172



>emb|CDY60190.1| BnaA01g35410D [Brassica napus]
Length=723

 Score =   384 bits (985),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 189/364 (52%), Positives = 247/364 (68%), Gaps = 11/364 (3%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+LQHAHD LLV++ +TVPYR T + QLVES  L  MHDL +NE 
Sbjct  185   VSEILDSELLGEGLIPSLQHAHDMLLVDNSKTVPYRATTYCQLVESTFLCNMHDLQSNEA  244

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             + SD + LVP  ++++  +K QQ+ MH DAI + IKLLSEP K+F+FDFWKRP+S+ E +
Sbjct  245   RMSDGVRLVPPVLESLFGIKSQQYSMHVDAIEKEIKLLSEPIKVFEFDFWKRPESNGELD  304

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + I+A   G+ HAIISWW+LQLD EGT+FYST P+WI   S++       +  WCDHWKQ
Sbjct  305   VHIEAITEGSVHAIISWWVLQLDSEGTIFYSTAPRWIESNSEIG------ARDWCDHWKQ  358

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF P  G+S+ K E VHLHA HT  N+ Y +K   +  E+     S  + QL   PER
Sbjct  359   CVWFTPGAGVSISKGEKVHLHAAHTCTNILYNLK---KAHEITHSSFSTGELQLTFPPER  415

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQD  1575
             +AIYGD  +R S+ +A  NA +  +   C+V DDSI L +   H +  S VISL PGLQ+
Sbjct  416   VAIYGDSVYRQSIFEATRNAFQGLSDAQCLVIDDSILLPLMALHISNGSRVISLSPGLQE  475

Query  1576  KGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQN  1755
                +YL+A+A SN +S D  K  ++  + L   + +  K+DLLI EP+YYG +S LPWQN
Sbjct  476   NAARYLEAIADSNGFSKDRFKYFREGKAKL--MEAYPSKIDLLIGEPYYYGLESGLPWQN  533

Query  1756  LRFW  1767
             LRFW
Sbjct  534   LRFW  537


 Score =   184 bits (468),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 120/176 (68%), Gaps = 12/176 (7%)
 Frame = +2

Query  23   LSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIEE  202
            LSL  KT  P  P R       S   + RT+     S  R+FQL+ DPLTG SEW+VI+E
Sbjct  5    LSLLPKTFIPLLPFRCPPLTRLSSVVAARTMTSQ--SNQRVFQLRQDPLTGTSEWIVIDE  62

Query  203  SD---TPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMM  373
            +D    P  +   LLATTSYLDMLND+ RNRA+R AI+KT+T+PCHVLDIGAGTGLLSMM
Sbjct  63   NDEAGAPVTSTDGLLATTSYLDMLNDTRRNRAYRLAIEKTITEPCHVLDIGAGTGLLSMM  122

Query  374  AARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            AARAMG  + +        VTACESYLPMVKLMRKV+  NG+ + I +INKRS  L
Sbjct  123  AARAMGDKEESC-------VTACESYLPMVKLMRKVMHKNGMTKNINLINKRSDEL  171



>ref|XP_006414329.1| hypothetical protein EUTSA_v10024535mg [Eutrema salsugineum]
 gb|ESQ55782.1| hypothetical protein EUTSA_v10024535mg [Eutrema salsugineum]
Length=720

 Score =   378 bits (971),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 192/365 (53%), Positives = 249/365 (68%), Gaps = 19/365 (5%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIP+LQHAHD LLV++P+TVPYR T + QLVES  L  MHDL NN+ 
Sbjct  188   VSEILDSELLGEGLIPSLQHAHDMLLVDNPKTVPYRATTYCQLVESTFLCNMHDLENNDG  247

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
                        G++++I +K QQ+ MH DAI + IKLLSEP KIF+F+FWKRP+S+ E E
Sbjct  248   P----------GLESLIGIKSQQYGMHVDAIEKEIKLLSEPVKIFEFEFWKRPESNGELE  297

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             + I+A   G+ HAIISWW+LQLD EGT+FYST P+WI   S++          WCDHWKQ
Sbjct  298   VHIEAITEGSIHAIISWWVLQLDSEGTIFYSTAPRWIDSNSEIG------LRDWCDHWKQ  351

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             CVWF P  G+S+ + E VHLHA HT  N+ Y + KTQS   E+ Q  LS  D  L L PE
Sbjct  352   CVWFTPGAGVSISEGEKVHLHAAHTCTNILYNLKKTQSVTHEMTQSPLSTGDLHLTLPPE  411

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             RIAIYGD  +R  ML+A  NAL+ K+   C+V DDS+ L +   H +  S V+SL PGL+
Sbjct  412   RIAIYGDSTYRQFMLEATRNALQGKSHTQCLVIDDSLLLPLMTLHISNRSRVLSLSPGLK  471

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
             + G +YL+A+A +N +S D  +  ++  + L   + +  ++DLLI EP+YYG +S LPWQ
Sbjct  472   EDGARYLEAIADANGFSKDRFEYFREGKAKLA--EAYPGEIDLLIGEPYYYGLESGLPWQ  529

Query  1753  NLRFW  1767
             NLRFW
Sbjct  530   NLRFW  534


 Score =   202 bits (513),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 122/167 (73%), Gaps = 5/167 (3%)
 Frame = +2

Query  50   PTFPLRVTSSHSFSLPRSTRTIVRNMSSGSRMFQLKLDPLTGNSEWVVIEESD---TPEQ  220
            P  P      HS +  RS  T   +  S  R+FQL+ DPLTGNSEW+VIEE+D    PE 
Sbjct  10   PFVPFLSFRCHSVTRLRSVATRTMSSQSSQRVFQLRQDPLTGNSEWIVIEENDQTGAPET  69

Query  221  TPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPAD  400
            +P  LLATTSYLDMLNDS RNRAFR AI+KT+T+PCHVLDIGAGTGLLSMMAARAM   +
Sbjct  70   SPDGLLATTSYLDMLNDSYRNRAFRLAIEKTITEPCHVLDIGAGTGLLSMMAARAMRIEE  129

Query  401  SASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            S     SKG+VTACESYLPMVKLMRKVL  NG+ + I +INKRS  L
Sbjct  130  SGDV--SKGIVTACESYLPMVKLMRKVLHKNGMTKNINLINKRSDEL  174



>gb|EPS70481.1| hypothetical protein M569_04274, partial [Genlisea aurea]
Length=694

 Score =   377 bits (968),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 191/369 (52%), Positives = 248/369 (67%), Gaps = 15/369 (4%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLV++P TVPYR T F QLVE K LW+++DL   + 
Sbjct  157   VSEILDSELLGEGLIPTLQHAHDKLLVKNPRTVPYRATTFAQLVECKYLWEVNDLVQRDT  216

Query  856   KASDTIHLVPKGMDTIICVK-HQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRET  1032
             +ASD + L P GM   I +K  QQ  +HC+A+ + IKLLS PF++F+FDFW+RPDSSRET
Sbjct  217   EASDGVRLTPTGMPARIGIKRRQQHALHCNALKDEIKLLSAPFEVFEFDFWRRPDSSRET  276

Query  1033  ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSC----SEAWC  1200
             +L +K    GT HAIISWWLL LD EGT+ Y TGP W+H  SDV++   S        WC
Sbjct  277   KLHVKIINDGTVHAIISWWLLHLDAEGTI-YCTGPAWLHSLSDVEESKSSLHGHGHGQWC  335

Query  1201  DHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLF  1380
             DHWKQ VWF P+ G+ V+KD+ V L A HT+  +SY  +  S     +  ++     Q+ 
Sbjct  336   DHWKQTVWFAPDSGVPVRKDDRVLLLATHTETAISYEFENSSTESTDQDNEI-----QIA  390

Query  1381  LSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLF  1560
             L+PER A+YGD  WR  M+ A    L  +A+PLC+VADDSIFL I + H ++  ++I LF
Sbjct  391   LTPERSALYGDSGWRSLMINATKKILHDRANPLCLVADDSIFLAICISHFSKNPSLIPLF  450

Query  1561  PGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSV  1740
             PGL  KG  YLQ V   N   +D  K  +++   L++Q + H+K+DLL+AEPFY  +   
Sbjct  451   PGLGKKGVHYLQTV--DNTLRIDFPK--RQKDLLLSLQGSDHKKIDLLVAEPFYDANSDA  506

Query  1741  LPWQNLRFW  1767
             LPW+NLRFW
Sbjct  507   LPWKNLRFW  515


 Score =   177 bits (450),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 105/143 (73%), Gaps = 10/143 (7%)
 Frame = +2

Query  128  SSGSRMFQLKLDPLTGNSEWVVIEESDTPE----QTPTPLLATTSYLDMLNDSPRNRAFR  295
             +G RMFQL  DPLTGNSEW+V+E  +  +      P  LLATTSYLDMLND+ RN AFR
Sbjct  6    EAGGRMFQLWTDPLTGNSEWIVVEGGEDYDGDDINHPKLLLATTSYLDMLNDTCRNNAFR  65

Query  296  EAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKG-MVTACESYLPMVKLM  472
             AI+ TVT PC VLDIGAGTGLLSMMAARAMG       SDSK  MVTACESYLPM KLM
Sbjct  66   RAIENTVTGPCRVLDIGAGTGLLSMMAARAMGHL-----SDSKEVMVTACESYLPMFKLM  120

Query  473  RKVLRANGIERGIRIINKRSKIL  541
            R VLRAN  +R I+IINKRS  L
Sbjct  121  RSVLRANCFDRKIKIINKRSDEL  143



>ref|XP_008794808.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Phoenix dactylifera]
Length=761

 Score =   376 bits (966),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 177/329 (54%), Positives = 236/329 (72%), Gaps = 7/329 (2%)
 Frame = +1

Query  790   IFGQLVESKDLWKMHDLFNNEEKASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLL  969
             +  QLVES  LWK+HDL+++E  ASD IHL P G++ II VK QQ+ MHCDAIS+ I+LL
Sbjct  252   LMSQLVESTFLWKLHDLYSSELDASDGIHLAPAGLERIIHVKQQQYAMHCDAISQEIRLL  311

Query  970   SEPFKIFDFDFWKRPDSSRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIH  1149
             SEPFKIF+FDFWKRPDS  ETE+ +KA   G  HA+ISWW+LQLD EG++FYST P+W+ 
Sbjct  312   SEPFKIFEFDFWKRPDSHGETEIWVKAIDDGKVHAVISWWVLQLDYEGSIFYSTAPRWMR  371

Query  1150  CPSDVKDPSLSC--SEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQ  1323
                    P+ +    E WC+HWKQCVW     G+ V KD++V   AVH D ++SY +K  
Sbjct  372   SSDTEIVPTHASVGGENWCNHWKQCVWLTHGTGMPVSKDKHVLFKAVHDDTSVSYCLKFD  431

Query  1324  SQNMEVRQYK-LSAQDCQLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDS  1500
              Q    R Y   ++ +C + L PERIA+YGDK+WR ++++A+ NAL  ++SPLC+VADDS
Sbjct  432   EQ----RAYNDFNSANCLITLLPERIALYGDKDWRLALIRAVKNALCVRSSPLCVVADDS  487

Query  1501  IFLTIALGHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDT  1680
             +FLTI     ++ SNVIS FPGLQ KG +YLQAVA +N +S+D I+V+ +R++ L     
Sbjct  488   VFLTILTASLSKTSNVISTFPGLQAKGARYLQAVADANGFSIDHIEVIGRRTACLISDGF  547

Query  1681  HHRKVDLLIAEPFYYGSDSVLPWQNLRFW  1767
               RKVDLL+ EP+YYG++ +LPWQNLRFW
Sbjct  548   RQRKVDLLVGEPYYYGNEGMLPWQNLRFW  576


 Score =   177 bits (448),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 109/140 (78%), Gaps = 9/140 (6%)
 Frame = +2

Query  137  SRMFQLKLDPLTGNSEWVVIEESDTP-----EQTPTPLLATTSYLDMLNDSPRNRAFREA  301
            +R FQL+++PLTG SEW+V+EE +       ++TP  LLATTSYLDMLNDSPRNRAFREA
Sbjct  59   TRSFQLRVNPLTGESEWIVVEEGEEEGEEEEKKTPKSLLATTSYLDMLNDSPRNRAFREA  118

Query  302  IDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            I+KT+TKPCHVLDIGAGTGLLSMMAARAM     A        V+ACESYLPM KL+R+V
Sbjct  119  IEKTITKPCHVLDIGAGTGLLSMMAARAMAKLGGAEEE----RVSACESYLPMGKLLRRV  174

Query  482  LRANGIERGIRIINKRSKIL  541
            LRANG+E  +++ +KRS  L
Sbjct  175  LRANGMEEKVKVFHKRSDEL  194



>gb|EYU32837.1| hypothetical protein MIMGU_mgv1a024512mg [Erythranthe guttata]
Length=650

 Score =   372 bits (956),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/302 (61%), Positives = 216/302 (72%), Gaps = 12/302 (4%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             +SEILDSELLGEGLIPTLQHAHDNLLVE+P TVPYR T +GQLV    L  MHDL N E 
Sbjct  184   ISEILDSELLGEGLIPTLQHAHDNLLVENPLTVPYRATTYGQLVGCTYLRDMHDLVNREA  243

Query  856   KASDTIHLVPKGMDTIICVK-HQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRET  1032
             + SD I LVP GM  I+ VK  QQF MHCDA+ E IKLLSEPFK+FDFDFW+RPDSS ET
Sbjct  244   ELSDGIRLVPSGMAGILGVKKQQQFAMHCDALKEEIKLLSEPFKVFDFDFWRRPDSSSET  303

Query  1033  ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWK  1212
             E+ IK T  GT +AIISWWLLQLD EGT+FYST P WI C           S+ WCDHWK
Sbjct  304   EMHIKTTNDGTVYAIISWWLLQLDSEGTIFYSTEPNWIRC-----------SDNWCDHWK  352

Query  1213  QCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPE  1392
             Q VWF  ++ L V KD  VHLHA+HT+ ++SY  KT ++  +V        D Q+ LSPE
Sbjct  353   QSVWFPQSVDLHVLKDGEVHLHALHTETSISYDFKTLNKKQQVAHVDACTDDFQIVLSPE  412

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPGLQ  1572
             R A+YGD +WR  ML AI  AL+Q+  PLC+VADDSIFL IA+   +++SNVI LFPGL 
Sbjct  413   RNALYGDSSWRFLMLNAIEKALRQRTDPLCLVADDSIFLAIAIARLSKSSNVIPLFPGLG  472

Query  1573  DK  1578
              K
Sbjct  473   KK  474


 Score =   210 bits (534),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 127/179 (71%), Gaps = 14/179 (8%)
 Frame = +2

Query  20   MLSLFCKTLNPTFPLRVTSSHSFSLPRSTRTIVRNMSSG----SRMFQLKLDPLTGNSEW  187
            MLS   K L  TFP R         P +  T VR MSS      RMFQLK DPLTG SEW
Sbjct  1    MLSGILKPLLFTFPRR---------PAAAVTTVRTMSSSGESTQRMFQLKTDPLTGKSEW  51

Query  188  VVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLS  367
            VVIEE +  + TP  LLATTSYLDMLND+ RNRA+R AID  VTKPCHVLDIGAGTGLLS
Sbjct  52   VVIEEDEEEKTTPKALLATTSYLDMLNDTRRNRAYRHAIDNAVTKPCHVLDIGAGTGLLS  111

Query  368  MMAARAMGPADSASNSD-SKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            MMAARAMG  D   +S  S G VTACESYLPMVKLMRKVLR+NG++  IR++NKRS  L
Sbjct  112  MMAARAMGLTDRKCDSSCSNGKVTACESYLPMVKLMRKVLRSNGMDGKIRLLNKRSDEL  170



>gb|KDO61457.1| hypothetical protein CISIN_1g0442451mg, partial [Citrus sinensis]
Length=400

 Score =   347 bits (890),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 166/260 (64%), Positives = 198/260 (76%), Gaps = 12/260 (5%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHD LLVE+P TVP R T +GQLVES  LWK+HDL+NNE 
Sbjct  153   VSEILDSELLGEGLIPTLQHAHDRLLVENPLTVPCRVTTYGQLVESTFLWKLHDLYNNEA  212

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             KA D IHLVP GMD+I+ VK QQ+ MHCDAI++ IKLLSEPFKIF+FDFWKRPDS  E E
Sbjct  213   KALDDIHLVPAGMDSILHVKSQQYAMHCDAITKEIKLLSEPFKIFEFDFWKRPDSHGEAE  272

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L IK+T  G  HA++SWW+LQLDREGT+FYST P+WI   +            WCDHWKQ
Sbjct  273   LQIKSTDDGRVHAVVSWWVLQLDREGTIFYSTAPRWISTGN------------WCDHWKQ  320

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWFIP  G+S+ K E +  HA+HT+ ++SY +K+Q    + RQ+ L+A+D QL L PER
Sbjct  321   CVWFIPGKGMSICKGEELLFHALHTETSVSYELKSQIPITDERQHNLNAKDFQLALPPER  380

Query  1396  IAIYGDKNWRCSMLKAINNA  1455
             IAIYGD  WR SM+ A+ NA
Sbjct  381   IAIYGDGEWRLSMVMAMRNA  400


 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = +2

Query  131  SGSRMFQLKLDPLTGNSEWVVIEES-DTPEQTPTPLLATTSYLDMLNDSPRNRAFREAID  307
            S  RMFQLKLDPLTGNSEWVVIEE+ D PE +  PLLATTSYLDMLNDS RNRA+R AID
Sbjct  2    STQRMFQLKLDPLTGNSEWVVIEENEDVPESSQEPLLATTSYLDMLNDSYRNRAYRLAID  61

Query  308  KTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLR  487
            K VTK CHVLDIGAGTGLLSMMAARAMG +DS ++ ++KGMVTACESYLPMVKLM+KVL 
Sbjct  62   KMVTKSCHVLDIGAGTGLLSMMAARAMGSSDSTTSLNTKGMVTACESYLPMVKLMKKVLH  121

Query  488  ANGIERGIRIINKRSKIL  541
             NG+ R I++INKRS  L
Sbjct  122  VNGMGRNIKVINKRSDEL  139



>gb|KHN04362.1| Protein arginine N-methyltransferase 1.6 [Glycine soja]
Length=617

 Score =   341 bits (875),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/261 (60%), Positives = 195/261 (75%), Gaps = 6/261 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQHAHDNLLVE+  TVPYR T +GQLVES  LW++HDL + E 
Sbjct  150   VSEILDSELLGEGLIPTLQHAHDNLLVENALTVPYRATTYGQLVESTFLWQLHDLHSIEA  209

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
               SD I L P G+D+++ VK QQ+ MHC+ I E IKLLSEPFKIF+FDFWKRP+SS ETE
Sbjct  210   TVSDGIQLTPPGLDSVLSVKRQQYAMHCNPIQEEIKLLSEPFKIFEFDFWKRPESSGETE  269

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
             L +KAT  G  HA++SWW+LQLDREGT++YST P+WI        P+++    WCDHWKQ
Sbjct  270   LCVKATNDGRIHAVVSWWVLQLDREGTIYYSTAPRWI------SSPTITSPVGWCDHWKQ  323

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G+S+ K E +HLHA HT+ ++SY + TQ    E+  ++    D QL L PER
Sbjct  324   CVWFVPGSGISIFKGEEIHLHATHTETSISYNLDTQVPTSEILNHRCMTGDLQLVLPPER  383

Query  1396  IAIYGDKNWRCSMLKAINNAL  1458
             +AIYGDK WR SMLKA+ + +
Sbjct  384   VAIYGDKGWRLSMLKAVQSMV  404


 Score =   197 bits (502),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 114/143 (80%), Gaps = 14/143 (10%)
 Frame = +2

Query  128  SSGSRMFQLKLDPLTGNSEWVVIEESDTPEQT-----PTPLLATTSYLDMLNDSPRNRAF  292
            SS  RMFQLKLDP+TGNSEWVVIE++D  +++       PLLATTSYLDMLNDSPRN AF
Sbjct  3    SSTQRMFQLKLDPITGNSEWVVIEDNDDGDESFAHNFHQPLLATTSYLDMLNDSPRNTAF  62

Query  293  REAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLM  472
            R+AI KT+TKPCHVLDIGAGTGLLSMMAARAMG          +G VTACESYLPMVKLM
Sbjct  63   RQAIQKTITKPCHVLDIGAGTGLLSMMAARAMG---------DEGRVTACESYLPMVKLM  113

Query  473  RKVLRANGIERGIRIINKRSKIL  541
            +KVLR NG+E  +++INKRS  L
Sbjct  114  KKVLRINGMEGRVKVINKRSDEL  136


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = +1

Query  1633  IKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQNLRFW  1767
             + +   +   L+M       VDLLIAEPFY G D +LPWQNLRFW
Sbjct  384   VAIYGDKGWRLSMLKAVQSMVDLLIAEPFYVGHDGMLPWQNLRFW  428



>gb|EMS53458.1| hypothetical protein TRIUR3_03298 [Triticum urartu]
Length=576

 Score =   331 bits (848),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/379 (46%), Positives = 237/379 (63%), Gaps = 34/379 (9%)
 Frame = +1

Query  661   NFNNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDL  840
             ++ + VSEILDSELLGEGLIPTLQ AHD+LLV++P+TVPYR T +GQLVES  LWKMHDL
Sbjct  38    SYVSQVSEILDSELLGEGLIPTLQQAHDSLLVKNPKTVPYRATTYGQLVESPFLWKMHDL  97

Query  841   FNNEEKASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDS  1020
              +NE  A+D + L P GM+ I+ VK QQ  M CD + + I+L +               +
Sbjct  98    HSNEANAADGVWLTPDGMENIVSVKLQQHAMKCDPLEDEIRLRASV------------KT  145

Query  1021  SRETELLIKATKGGTAHAIIS-WWLLQLDREGTVFYSTGPKWI---------HCPSDVKD  1170
                 + L+ A      H   S WW+LQLD  G++FYST PKW+          C  D KD
Sbjct  146   RSRLKQLVMAVFMLLFHGKYSIWWVLQLDSAGSIFYSTAPKWVRQSSIKDLPQCADDTKD  205

Query  1171  PSLSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQY  1350
                     WCDHWK CVWF   +G  V KD+ + L A H   ++SY  +  + N E    
Sbjct  206   --------WCDHWKHCVWFTQGMGTPVMKDQTLSLRASHNLTSISY--QLLNPNDEACNG  255

Query  1351  KLSAQDCQLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHH  1530
              L A +  L L PERIA+YGD  WR +++ AI N L  ++   C VADDSIFL + +   
Sbjct  256   SLKADN--LTLLPERIALYGDIYWRSALITAIKNVLSDRSPQTCFVADDSIFLALLVSSL  313

Query  1531  ARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIA  1710
             + +S VI++FPGL+D G  YLQAVA +N++SMD I+V+ KR+++++  D  H+K++LL+ 
Sbjct  314   SPSSKVIAMFPGLRDTGATYLQAVAKANNFSMDQIQVIGKRAASISTDDLEHKKINLLVG  373

Query  1711  EPFYYGSDSVLPWQNLRFW  1767
             EPFY GS+ +LPWQNLRFW
Sbjct  374   EPFYCGSEGMLPWQNLRFW  392



>gb|EMT27966.1| hypothetical protein F775_10263 [Aegilops tauschii]
Length=646

 Score =   302 bits (773),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 169/367 (46%), Positives = 225/367 (61%), Gaps = 12/367 (3%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             VSEILDSELLGEGLIPTLQ AHD+LLV++P+TVPYR T +GQLVES  LWKMHDL +NE 
Sbjct  105   VSEILDSELLGEGLIPTLQQAHDSLLVKNPKTVPYRATTYGQLVESPFLWKMHDLHSNEA  164

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
              A+D + L P GM+ I+ VK QQ  M CD + + I+L+    +    +         E  
Sbjct  165   NAADGVWLTPDGMENIVSVKLQQHAMQCDPLEDEIRLVGASVRFCWVNLLLHSSQMGEA-  223

Query  1036  LLIKATKGGTAHAIISWWLL---QLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDH  1206
               IK     T    +S       Q     T        W +  SDV   + + ++ WCDH
Sbjct  224   --IKYQGSTTMRRCVSRMFRIVSQCTFTVTYLCLNVSAWCYA-SDVNSIAAN-TKDWCDH  279

Query  1207  WKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLS  1386
             WK CVWF    G  V KD+ + L A H   ++SY  +  + N E     L A    L L 
Sbjct  280   WKHCVWFTQGRGAPVMKDQTLSLRASHNLTSISY--QLLNPNDEACNGNLKAD--HLTLL  335

Query  1387  PERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFPG  1566
             PERIA+YGD  WR +++ AI NAL  ++   CIVADDSIFL + +   + +S VI++FPG
Sbjct  336   PERIALYGDIYWRSALITAIKNALSDRSPQTCIVADDSIFLALLVSSLSPSSKVIAMFPG  395

Query  1567  LQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLP  1746
             L+DKG  YLQAVA +N++SMD I+V+ KR+++L+  D  H+K++LL+ EPFY GS+ +LP
Sbjct  396   LRDKGATYLQAVAKANNFSMDQIQVIGKRAASLSTDDLEHKKINLLVGEPFYCGSEGMLP  455

Query  1747  WQNLRFW  1767
             WQNLRFW
Sbjct  456   WQNLRFW  462


 Score = 92.0 bits (227),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 5/95 (5%)
 Frame = +2

Query  260  MLNDSPRNRAFREAIDKTVTKP-CHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVT  436
            MLND+ RNRA+R AID  V+ P   VLDIGAGTGLLSMM+ARA+     A   + +G V+
Sbjct  1    MLNDAARNRAYRRAIDAAVSDPSARVLDIGAGTGLLSMMSARAL----EAVGGEGRGSVS  56

Query  437  ACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            ACESYLPM KL R+VLRANG+E  +++ +KRS  L
Sbjct  57   ACESYLPMGKLTRRVLRANGMENKVKLFHKRSDEL  91



>ref|XP_008794807.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Phoenix dactylifera]
Length=447

 Score =   269 bits (688),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 128/257 (50%), Positives = 176/257 (68%), Gaps = 7/257 (3%)
 Frame = +1

Query  1006  KRPDSSRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSC  1185
             KR D   ETE+ +KA   G  HA+ISWW+LQLD EG++FYST P+W+        P+ + 
Sbjct  10    KRYDCHGETEIWVKAIDDGKVHAVISWWVLQLDYEGSIFYSTAPRWMRSSDTEIVPTHAS  69

Query  1186  --SEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYK-L  1356
                E WC+HWKQCVW     G+ V KD++V   AVH D ++SY +K   Q    R Y   
Sbjct  70    VGGENWCNHWKQCVWLTHGTGMPVSKDKHVLFKAVHDDTSVSYCLKFDEQ----RAYNDF  125

Query  1357  SAQDCQLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
             ++ +C + L PERIA+YGDK+WR ++++A+ NAL  ++SPLC+VADDS+FLTI     ++
Sbjct  126   NSANCLITLLPERIALYGDKDWRLALIRAVKNALCVRSSPLCVVADDSVFLTILTASLSK  185

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
              SNVIS FPGLQ KG +YLQAVA +N +S+D I+V+ +R++ L       RKVDLL+ EP
Sbjct  186   TSNVISTFPGLQAKGARYLQAVADANGFSIDHIEVIGRRTACLISDGFRQRKVDLLVGEP  245

Query  1717  FYYGSDSVLPWQNLRFW  1767
             +YYG++ +LPWQNLRFW
Sbjct  246   YYYGNEGMLPWQNLRFW  262



>ref|XP_001784898.1| protein arginine N-methyltransferase [Physcomitrella patens]
 gb|EDQ50287.1| protein arginine N-methyltransferase [Physcomitrella patens]
Length=714

 Score =   272 bits (696),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 145/370 (39%), Positives = 219/370 (59%), Gaps = 11/370 (3%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             +SEILDSELLGEGLIP+L+HAH NLL ++   VP+  T++ QLVE + LWK HDL   E 
Sbjct  144   ISEILDSELLGEGLIPSLRHAHQNLLTKNARCVPHTATVYAQLVECEHLWKCHDLPGVES  203

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D + L  +  +     + +   MH D ++  ++LLSEPF++F F+  K PD S + +
Sbjct  204   QLVDGVVLASRDYNQF---RGRAAAMHVDPLASEMQLLSEPFEVFTFELSKAPDESGQRQ  260

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPS-DVKDPSLSCSEAWCDHWK  1212
               +  T  G AHA++SWW+LQLD EG +FYST P WI  PS +VK  ++  +E WC+HWK
Sbjct  261   HSVLITNSGRAHALVSWWVLQLDIEGEIFYSTAPNWIKNPSANVKAETIPQTE-WCEHWK  319

Query  1213  QCVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQYKLSAQDCQLF---  1380
             Q VW +P  GL +     V + A H  +++SY V       M          DC +    
Sbjct  320   QMVWILPGKGLMLYSGNEVVVTASHDAVSVSYNVTDPVGSYMHKDVVPKDNVDCPVLFEA  379

Query  1381  -LSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISL  1557
              +SP+RI I G + WR S+  A+  AL+   + LC+V DDS+ +T+          V+++
Sbjct  380   SMSPDRIGILGHEPWRRSVKSAVEIALRCLKTSLCVVVDDSLLVTMMAASVRANVQVVAM  439

Query  1558  FPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDS  1737
             FPG    G++Y+  ++ +   ++  IKV+ K ++ L+++    RK+DLL+AEP+Y     
Sbjct  440   FPG-SAVGQEYVDDISRTLGQNVANIKVMNKIATPLSLEVLGVRKIDLLMAEPYYTSCSR  498

Query  1738  VLPWQNLRFW  1767
             +LPW+ LRFW
Sbjct  499   MLPWRLLRFW  508


 Score =   142 bits (358),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 89/128 (70%), Gaps = 2/128 (2%)
 Frame = +2

Query  149  QLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPC  328
            Q  L+ LTG  EW+V+ + D   +  +  L  T++LDMLND+PRNRA+R AI K V    
Sbjct  2    QQSLNKLTGQVEWIVVRQDDPEAEEVSEALTMTTFLDMLNDAPRNRAYRLAIQKAVKGAH  61

Query  329  HVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERG  508
            HVLDIGAGTGLLSMMA R+M   +    S+  G +TACES+LPM KL RKVLRAN +  G
Sbjct  62   HVLDIGAGTGLLSMMAWRSM--CEEGRISEEMGSITACESFLPMFKLARKVLRANKVGAG  119

Query  509  IRIINKRS  532
            +R+I+KRS
Sbjct  120  VRLIHKRS  127



>ref|XP_002988698.1| hypothetical protein SELMODRAFT_427394 [Selaginella moellendorffii]
 gb|EFJ10209.1| hypothetical protein SELMODRAFT_427394 [Selaginella moellendorffii]
Length=619

 Score =   262 bits (670),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 144/366 (39%), Positives = 205/366 (56%), Gaps = 32/366 (9%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             V EILDSELLGEG+IP+L+HAH++LL  +  TVPYR T++ QLVES  LW++HDL   E+
Sbjct  136   VCEILDSELLGEGIIPSLRHAHEHLLRPNAATVPYRATVYAQLVESDFLWRLHDLQGVED  195

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D +   P   D     KH+Q   H D I  G+KLLSEPF+ F  DF++ PD   E  
Sbjct  196   RLQDGLAFAPN--DFYSYFKHRQHAFHVDEIP-GMKLLSEPFEAFVLDFYRAPDVRGEFN  252

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
               +     GTAHAI+SWW+LQLD++G V YST P+WI   S+           WCDHWKQ
Sbjct  253   QAVHVNFSGTAHAIVSWWVLQLDKDGLVCYSTAPRWIRGASE-----------WCDHWKQ  301

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQ-SQNMEVRQYKLSAQDCQLFLSPE  1392
             CVWF+P  G+SV++   + +   H + ++ Y +      N     ++LS Q C++     
Sbjct  302   CVWFLPGQGVSVEEQSELRVVVSHDEASVRYDINGGVCCNSSASGFELSLQRCRML----  357

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTI-ALGHHARASNVISLFPGL  1569
                  GD + R  +  AI  AL ++    C++ DD +   + AL     + +V  LFPG 
Sbjct  358   -----GDGSRRSIIQSAIQKALGERELGNCLIRDDGLMSAVCALSTPHGSCHVAGLFPGC  412

Query  1570  QDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPW  1749
             +  G +YL++VA+        +  + K    LT  D    KVD+L+ EP+Y   +  LPW
Sbjct  413   RRDGLKYLESVASK-------LSTIHKDVKHLTGDDFKGHKVDVLLGEPYYATYEHALPW  465

Query  1750  QNLRFW  1767
             + LRFW
Sbjct  466   KQLRFW  471


 Score =   118 bits (295),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 83/130 (64%), Gaps = 11/130 (8%)
 Frame = +2

Query  143  MFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTK  322
            M Q +++ LTG SEW+++ +         PL A +SYLDMLND  RNRAF  AI K + +
Sbjct  1    MLQQRVNALTGESEWILVGDGGDGGDASDPL-AESSYLDMLNDRARNRAFSSAIAK-LGR  58

Query  323  PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIE  502
              HVLDIGAGTGLLS+MA RAM         + +  VTACES+LPM KL RKV R NG  
Sbjct  59   HGHVLDIGAGTGLLSLMAWRAM---------EEQCQVTACESFLPMYKLARKVCRDNGTM  109

Query  503  RGIRIINKRS  532
              I++++ RS
Sbjct  110  GAIKLLHMRS  119



>ref|XP_002986285.1| hypothetical protein SELMODRAFT_425255 [Selaginella moellendorffii]
 gb|EFJ12494.1| hypothetical protein SELMODRAFT_425255 [Selaginella moellendorffii]
Length=614

 Score =   261 bits (666),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 143/366 (39%), Positives = 206/366 (56%), Gaps = 32/366 (9%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             V EILDSELLGEG+IP+L++AH++LL  +  TVPYR T++ QLVES  LW++HDL   E+
Sbjct  136   VCEILDSELLGEGIIPSLRNAHEHLLRPNAATVPYRATVYAQLVESDFLWRLHDLQGVED  195

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D +   P   D     KH+Q   H D I  G+KLLSEPF+ F  DF++ PD   E  
Sbjct  196   QLQDGLAFAPN--DFYSYFKHRQHAFHVDEIP-GMKLLSEPFEAFVLDFYRAPDVRGEFN  252

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
               +     GTAHAI+SWW+LQLD++G V YST P+WI   S+           WCDHWKQ
Sbjct  253   QAVHVNFSGTAHAIVSWWVLQLDKDGLVCYSTAPRWIRGASE-----------WCDHWKQ  301

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQ-SQNMEVRQYKLSAQDCQLFLSPE  1392
             CVWF+P  G+SV++   + +   H + ++ Y +      N     ++LS Q C++     
Sbjct  302   CVWFLPGQGVSVEEQSELRVVVSHDEASVRYDINGGVCCNSSASGFELSLQRCRML----  357

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTI-ALGHHARASNVISLFPGL  1569
                  GD + R  +  AI  AL ++    C++ DD +   + AL     + +V  LFPG 
Sbjct  358   -----GDGSRRSIIQSAIQKALGERELGNCLIRDDGLMSAVCALSTAHGSCHVAGLFPGC  412

Query  1570  QDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPW  1749
             +  G +YL++VA+        + ++ K    LT  D    KVD+L+ EP+Y   +  LPW
Sbjct  413   RRDGLKYLESVASK-------LSIIHKDGKHLTGDDFKGHKVDVLLGEPYYATYEHALPW  465

Query  1750  QNLRFW  1767
             + LRFW
Sbjct  466   KQLRFW  471


 Score =   116 bits (291),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 81/127 (64%), Gaps = 11/127 (9%)
 Frame = +2

Query  143  MFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTK  322
            M Q +++ LTG SEW+++ +         PL A +SYLDMLND  RNRAF  AI K V +
Sbjct  1    MLQQRVNALTGESEWILVGDGGDGGDASDPL-AESSYLDMLNDRARNRAFSSAIAK-VGR  58

Query  323  PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIE  502
              HVLDIGAGTGLLS+MA RAM         + +  VTACES+LPM KL RKV R NG  
Sbjct  59   HGHVLDIGAGTGLLSLMAWRAM---------EEQCQVTACESFLPMYKLARKVCRDNGTM  109

Query  503  RGIRIIN  523
              I++++
Sbjct  110  GAIKLLH  116



>ref|XP_002986287.1| hypothetical protein SELMODRAFT_425258 [Selaginella moellendorffii]
 gb|EFJ12496.1| hypothetical protein SELMODRAFT_425258 [Selaginella moellendorffii]
Length=540

 Score =   258 bits (660),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 142/366 (39%), Positives = 205/366 (56%), Gaps = 32/366 (9%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             V EILDSELLGEG+IP+ +HAH++LL  +  TVPYR T++ QLVES  LW++HDL   E+
Sbjct  57    VCEILDSELLGEGIIPSPRHAHEHLLRPNAATVPYRATVYAQLVESDFLWRLHDLQGVED  116

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D +   P   D     KH+Q   H D I  G+KLLSEPF+ F  DF++ PD   E  
Sbjct  117   QLQDGLAFAPN--DFYSYFKHRQHAFHVDEIP-GMKLLSEPFEAFVLDFYRAPDVRGEFN  173

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
               +     GTAHAI+SWW+LQLD++G V YST P+WI   S+           WCDHWKQ
Sbjct  174   QAVHVNFSGTAHAIVSWWVLQLDKDGLVCYSTAPRWIRGASE-----------WCDHWKQ  222

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQ-SQNMEVRQYKLSAQDCQLFLSPE  1392
             CVWF+P  G+SV++   + +   H + ++ Y +      N     ++LS Q C++     
Sbjct  223   CVWFLPGQGVSVEEQSELRVVVSHDEASVRYDINGGVCCNSSASGFELSLQRCRML----  278

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTI-ALGHHARASNVISLFPGL  1569
                  GD + R  +  AI  AL ++    C++ DD +   + AL     + +V  LFPG 
Sbjct  279   -----GDGSRRSIIQSAIQKALGEREFGNCLIRDDGLMSAVCALSTAHGSCHVAGLFPGC  333

Query  1570  QDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPW  1749
             +  G +YL++VA+        + ++ K    LT  D    KVD+L+ +P+Y   +  LPW
Sbjct  334   RRDGLKYLESVASK-------LSIIHKDVKHLTGDDFKGHKVDVLLGDPYYATYEHALPW  386

Query  1750  QNLRFW  1767
             + LRFW
Sbjct  387   KQLRFW  392



>ref|XP_002988702.1| hypothetical protein SELMODRAFT_447442 [Selaginella moellendorffii]
 gb|EFJ10213.1| hypothetical protein SELMODRAFT_447442 [Selaginella moellendorffii]
Length=606

 Score =   259 bits (663),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 143/366 (39%), Positives = 204/366 (56%), Gaps = 32/366 (9%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             V EILDSELLGEG+IP+L+HAH++LL  +  TVPYR T++ QLVES  LW++HDL   E+
Sbjct  136   VCEILDSELLGEGIIPSLRHAHEHLLRPNAATVPYRATVYAQLVESDFLWRLHDLQGVED  195

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D +   P   D     KH+Q     D I  G+KLLSEPF+ F  DF++ PD   E  
Sbjct  196   RLQDGLAFAPN--DFYSYFKHRQHAFRVDEIP-GMKLLSEPFEAFVLDFYRAPDVRGEFN  252

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
               +     GTAHAI+SWW+LQLD++G V YST P+WI   S+           WCDHWKQ
Sbjct  253   QAVHVNFSGTAHAIVSWWVLQLDKDGLVCYSTAPRWIRGASE-----------WCDHWKQ  301

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQ-SQNMEVRQYKLSAQDCQLFLSPE  1392
             CVWF+P  G+SV++   + +   H + ++ Y +      N     ++LS Q C++     
Sbjct  302   CVWFLPGQGVSVEEQSELRVVVSHDEASVRYDINGGVCCNSSASGFELSLQRCRML----  357

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTI-ALGHHARASNVISLFPGL  1569
                  GD + R  +  AI  AL ++    C++ DD +   + AL     + +V  LFPG 
Sbjct  358   -----GDGSRRSIIQSAIQKALGERELGNCLIRDDGLMSAVCALSTPHGSCHVAGLFPGC  412

Query  1570  QDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPW  1749
             +  G +YL++VA+        +  + K    LT  D    KVD+L+ EP+Y   +  LPW
Sbjct  413   RRDGLKYLESVASK-------LSTIHKDVKHLTGDDFKGHKVDVLLGEPYYATYEHALPW  465

Query  1750  QNLRFW  1767
             + LRFW
Sbjct  466   KQLRFW  471


 Score =   115 bits (287),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 81/127 (64%), Gaps = 11/127 (9%)
 Frame = +2

Query  143  MFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTK  322
            M Q +++ LTG SEW+++ +         PL A +SYLDMLND  RNRAF  AI K + +
Sbjct  1    MLQQRVNALTGESEWILVGDGGDGGDASDPL-AESSYLDMLNDRARNRAFSSAIAK-LGR  58

Query  323  PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIE  502
              HVLDIGAGTGLLS+MA RAM         + +  VTACES+LPM KL RKV R NG  
Sbjct  59   HGHVLDIGAGTGLLSLMAWRAM---------EEQCQVTACESFLPMYKLARKVCRDNGTM  109

Query  503  RGIRIIN  523
              I++++
Sbjct  110  GAIKLLH  116



>ref|XP_002990150.1| hypothetical protein SELMODRAFT_185054 [Selaginella moellendorffii]
 gb|EFJ08710.1| hypothetical protein SELMODRAFT_185054 [Selaginella moellendorffii]
Length=654

 Score =   259 bits (663),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 142/366 (39%), Positives = 204/366 (56%), Gaps = 32/366 (9%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             V EILDSELLGEG+IP+L+HAH++LL  +  TVPYR T++ QLVE   LW+ HDL   E 
Sbjct  137   VCEILDSELLGEGIIPSLRHAHEHLLQPNAATVPYRATVYAQLVECDFLWRFHDLQGVEA  196

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D +   P+  D     KH+Q   H D I  GIKLLSEPF+ F  DF++ PD   +  
Sbjct  197   QLQDGMAFAPE--DFYSYFKHRQHAFHVDEIP-GIKLLSEPFEAFTLDFYRAPDVCGQFT  253

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
               +     GTAHAI+SWW+LQLD++G + YST P+W+   SD           WCDHWKQ
Sbjct  254   RAVHVNMSGTAHAIVSWWVLQLDKDGLICYSTAPRWVKGASD-----------WCDHWKQ  302

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQ-NMEVRQYKLSAQDCQLFLSPE  1392
             CVWF+P  G+SV++   + +   H + ++ Y +    + N     +KLS Q C++     
Sbjct  303   CVWFLPGQGISVEQHSELCVVVSHDETSVRYDINGGGRCNSFTSGFKLSPQRCRML----  358

Query  1393  RIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTI-ALGHHARASNVISLFPGL  1569
                  GD + R  +   I  AL ++    C++ DD +   + AL     + +V  LFPG 
Sbjct  359   -----GDGSRRSIIRSVIQKALGEREVGNCLILDDGLMSAVCALSTVHGSCHVAGLFPGC  413

Query  1570  QDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPW  1749
             +  G +YL +VA+        + ++ K    LT  D    +VD+L+AEP+Y   +  LPW
Sbjct  414   RRDGLKYLASVASK-------LSIIHKDVKHLTRDDFKGHEVDVLLAEPYYATYEHALPW  466

Query  1750  QNLRFW  1767
             + LRFW
Sbjct  467   KQLRFW  472


 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 83/130 (64%), Gaps = 10/130 (8%)
 Frame = +2

Query  143  MFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTK  322
            M Q +++ LTG SEW+++ + D  +   +  LA + YLDMLND  RN AF  AI K + +
Sbjct  1    MLQQRVNALTGESEWILVSDGDDGDGDASDALAESMYLDMLNDRARNTAFSSAIAK-LGR  59

Query  323  PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIE  502
              HVLDIGAGTGLLSMMA RAM         + +  VTACES+LPM KL RKV R NG  
Sbjct  60   HGHVLDIGAGTGLLSMMAWRAM---------EKQCQVTACESFLPMYKLARKVCRDNGTM  110

Query  503  RGIRIINKRS  532
              I++++ RS
Sbjct  111  GAIKLLHMRS  120



>ref|XP_002986371.1| hypothetical protein SELMODRAFT_425264 [Selaginella moellendorffii]
 gb|EFJ12580.1| hypothetical protein SELMODRAFT_425264 [Selaginella moellendorffii]
Length=1374

 Score =   266 bits (680),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 143/365 (39%), Positives = 206/365 (56%), Gaps = 31/365 (8%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             V EILDSELLGEG+IP+L++AH++LL  +  TVPYR T++ QLVES  LW++HDL   E+
Sbjct  94    VCEILDSELLGEGIIPSLRNAHEHLLRPNAATVPYRATVYAQLVESDFLWRLHDLQGVED  153

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D +   P   D     KH+Q   H D I  G+KLLSEPF+ F  DF++ PD   E  
Sbjct  154   QLQDGLAFAPN--DFYSYFKHRQHAFHVDEIP-GMKLLSEPFEAFVLDFYRAPDVRGEFN  210

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDHWKQ  1215
               +     GTAHAI+SWW+LQLD++G V YST P+WI   S+           WCDHWKQ
Sbjct  211   QAVHVNFSGTAHAIVSWWVLQLDKDGLVCYSTAPRWIRGASE-----------WCDHWKQ  259

Query  1216  CVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQDCQLFLSPER  1395
             CVWF+P  G+SV++   + +   H + ++ Y +     N     ++LS Q C++      
Sbjct  260   CVWFLPGQGVSVEEQSELRVVVSHDEASVRYDINGVRCNSSASGFELSLQRCRML-----  314

Query  1396  IAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTI-ALGHHARASNVISLFPGLQ  1572
                 GD + R  +  AI  AL ++    C++ DD +   + AL     + +V  LFPG +
Sbjct  315   ----GDGSRRSIIQSAIQKALGERELGNCLIRDDGLMSAVCALSTAHGSCHVAGLFPGCR  370

Query  1573  DKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQ  1752
               G +YL++VA+        + ++ K    LT  D    KVD+L+ EP+Y   +  LPW+
Sbjct  371   RDGLKYLESVASK-------LSIIHKDGKHLTGDDFKGHKVDVLLGEPYYATYEHALPWK  423

Query  1753  NLRFW  1767
              LRFW
Sbjct  424   QLRFW  428


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 47/76 (62%), Gaps = 10/76 (13%)
 Frame = +2

Query  296  EAIDKTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMR  475
            EA +  ++ P  VLD  AGTGLLS+MA RAM         + +  VTACES+LPM KL R
Sbjct  9    EAREILLSFPELVLD-SAGTGLLSLMAWRAM---------EEQCQVTACESFLPMYKLAR  58

Query  476  KVLRANGIERGIRIIN  523
            KV R NG    I++++
Sbjct  59   KVCRDNGTMGAIKLLH  74



>gb|AAL11573.1|AF424579_1 AT4g16570/dl4310w [Arabidopsis thaliana]
 gb|AAN18172.1| At4g16570/dl4310w [Arabidopsis thaliana]
Length=457

 Score =   232 bits (592),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 117/248 (47%), Positives = 154/248 (62%), Gaps = 9/248 (4%)
 Frame = +1

Query  1027  ETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAWCDH  1206
             E+ + I+A   G+ HAIISWW+LQLD EGT+FYST P+WI   S++          WCDH
Sbjct  31    ESLMHIEAKTTGSVHAIISWWVLQLDSEGTIFYSTAPRWIDSNSEIG------VRDWCDH  84

Query  1207  WKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQYKLSAQDCQLFL  1383
             WKQCVWF P  G+S+ K E VHLHA HT  N+ Y + KTQS   E   + LS  D  L L
Sbjct  85    WKQCVWFTPGTGVSISKGEKVHLHASHTCTNILYNLKKTQSLTHERTHFPLSTGDLHLTL  144

Query  1384  SPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVISLFP  1563
              PER+AIYGD  +R S+ +A   AL+ K+ P C+V DDS+ L +   H +  S V+SL P
Sbjct  145   PPERVAIYGDSIYRQSLFEATRKALQGKSYPQCLVIDDSLLLPLMALHISNRSRVLSLSP  204

Query  1564  GLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDSVL  1743
             GLQ+   +Y +A+A SN +S D  +    R     +   +  K+DLLI EP+Y G ++ L
Sbjct  205   GLQENAARYFEAIADSNGFSKDRFEYF--RDGKTNLAKAYPGKIDLLIGEPYYSGLENGL  262

Query  1744  PWQNLRFW  1767
             PWQNLRFW
Sbjct  263   PWQNLRFW  270



>ref|XP_002870148.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46407.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 129/177 (73%), Gaps = 8/177 (5%)
 Frame = +2

Query  20   MLSLFCKTLNPTF-PLRVTSSHSFSLPRSTRTIVRNMSSGS--RMFQLKLDPLTGNSEWV  190
            M SLF   L  TF   R    HS +  RS+    R MSS S  R+FQL+ DPLTGNSEW+
Sbjct  1    MSSLFSLLLPKTFISFRC---HSVTRLRSS-VAARTMSSQSSQRVFQLRQDPLTGNSEWI  56

Query  191  VIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIGAGTGLLSM  370
            VIE++D P  +   LLATTSYLDMLNDS RNRA+R AI+KT+T+PCHVLDIGAGTGLLSM
Sbjct  57   VIEDNDQPGTSTDGLLATTSYLDMLNDSRRNRAYRLAIEKTITEPCHVLDIGAGTGLLSM  116

Query  371  MAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            MA RAM   +  S  DSKGMVTACESYLPMVKLMRKVL  NG+ + I +INKRS  L
Sbjct  117  MAVRAMRGEEEESG-DSKGMVTACESYLPMVKLMRKVLHKNGMTKNINLINKRSDEL  172



>gb|AFW86216.1| hypothetical protein ZEAMMB73_654010 [Zea mays]
Length=374

 Score =   197 bits (502),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 130/194 (67%), Gaps = 6/194 (3%)
 Frame = +1

Query  1186  SEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ  1365
             ++ WCDHWKQCVWFI   G   +KD+ + L A H   ++SY +    +         S +
Sbjct  3     TKDWCDHWKQCVWFIQGTGAPAKKDQTLSLSASHNQTSISYQLNINDEGSR------SPK  56

Query  1366  DCQLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASN  1545
                L L PER+A+YGDK WR +++  I N   +++SP+CIVADDS+FL + +     +S 
Sbjct  57    SNHLTLLPERVALYGDKVWRSALISVIRNYTSERSSPICIVADDSVFLALIVSFLLPSSK  116

Query  1546  VISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYY  1725
             V+++FP L+D G  YLQAVA +N+ SMD IKV+ K++S+LT  D +H KV++L+ EPFY+
Sbjct  117   VLAMFPCLRDSGLNYLQAVADANNLSMDRIKVIGKKASSLTTNDLNHEKVNMLVGEPFYH  176

Query  1726  GSDSVLPWQNLRFW  1767
             GS+ +LPWQNLRFW
Sbjct  177   GSEGMLPWQNLRFW  190



>gb|ACN27197.1| unknown [Zea mays]
Length=376

 Score =   197 bits (502),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 130/194 (67%), Gaps = 6/194 (3%)
 Frame = +1

Query  1186  SEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ  1365
             ++ WCDHWKQCVWFI   G   +KD+ + L A H   ++SY +    +         S +
Sbjct  3     TKDWCDHWKQCVWFIQGTGAPAKKDQTLSLSASHNQTSISYQLNINDEGSR------SPK  56

Query  1366  DCQLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASN  1545
                L L PER+A+YGDK WR +++  I N   +++SP+CIVADDS+FL + +     +S 
Sbjct  57    SNHLTLLPERVALYGDKVWRSALISVIRNYTSERSSPICIVADDSVFLALIVSFLLPSSK  116

Query  1546  VISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYY  1725
             V+++FP L+D G  YLQAVA +N+ SMD IKV+ K++S+LT  D +H KV++L+ EPFY+
Sbjct  117   VLAMFPCLRDSGLNYLQAVADANNLSMDRIKVIGKKASSLTTNDLNHEKVNMLVGEPFYH  176

Query  1726  GSDSVLPWQNLRFW  1767
             GS+ +LPWQNLRFW
Sbjct  177   GSEGMLPWQNLRFW  190



>emb|CAB10433.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78699.1| hypothetical protein [Arabidopsis thaliana]
Length=487

 Score =   186 bits (472),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 122/179 (68%), Gaps = 28/179 (16%)
 Frame = +2

Query  68   VTSSHSFSLPRSTRTI-VRNMSSGS--RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLL  238
            ++S H  S+ R  R++  R MSS S  R+FQL+ DPLTGNSEW+VIE++D P  +   LL
Sbjct  13   ISSFHCHSVTRLRRSVTARTMSSQSSQRVFQLRQDPLTGNSEWIVIEDNDQPGTSTDGLL  72

Query  239  ATTSYLDMLNDSPRNRAFREAIDKTVTKPCHVLDIG------------------AGTGLL  364
            ATTSYLDMLNDS RN A+R AI+KT+T+PCHVLDIG                  AGTGLL
Sbjct  73   ATTSYLDMLNDSRRNIAYRLAIEKTITEPCHVLDIGFVFSLNFDKGECGICVYSAGTGLL  132

Query  365  SMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRSKIL  541
            SMMA RAM         DSKGMVTACESYLPMVKLMRKV+  NG+ + I +INKRS  L
Sbjct  133  SMMAVRAM-------RGDSKGMVTACESYLPMVKLMRKVMHKNGMTKNINLINKRSDEL  184


 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 81/152 (53%), Gaps = 44/152 (29%)
 Frame = +1

Query  715   LIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEEKASDTIHLVPKGM  894
             LIP+LQHAHD LLV++P+TVPYR T + QLVES  L  + DL NNE K SD + LVP G+
Sbjct  205   LIPSLQHAHDMLLVDNPKTVPYRATTYCQLVESTFLCNLQDLRNNEAKTSDGVRLVPPGL  264

Query  895   DTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETELLIKATKGGTAHA  1074
             +++  +K QQ+ MH DAI + IKLL                                   
Sbjct  265   ESLFGIKSQQYSMHVDAIEKEIKLL-----------------------------------  289

Query  1075  IISWWLLQLDREGTVFYSTGPKWIHCPSDVKD  1170
                      D EGT+FYST P+WI   S++++
Sbjct  290   ---------DSEGTIFYSTAPRWIDSNSEIEE  312



>ref|XP_002988700.1| hypothetical protein SELMODRAFT_427398 [Selaginella moellendorffii]
 gb|EFJ10211.1| hypothetical protein SELMODRAFT_427398 [Selaginella moellendorffii]
Length=584

 Score =   166 bits (420),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 115/372 (31%), Positives = 170/372 (46%), Gaps = 79/372 (21%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             V EILDSELLGEG+IP+L+HAH++LL  +  TVPYR T++ QLVES  LW++HDL   E+
Sbjct  136   VCEILDSELLGEGIIPSLRHAHEHLLRPNAATVPYRATVYAQLVESDFLWRLHDLQGVED  195

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D +   P   D     KH+Q   H D I  G+KLLSEPF+ F  DF++ PD   E  
Sbjct  196   RLQDGLAFAPN--DFYSYFKHRQHAFHVDEIP-GMKLLSEPFEAFVLDFYRAPDVRGEFN  252

Query  1036  LLIKATKGGTAHAIIS------WWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAW  1197
               +     GTAHAI+S      W+  QL   G+   +                       
Sbjct  253   QAVHVNFSGTAHAIVSCLTKMAWFATQLLLVGSEGQAR----------------------  290

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAV--HTDINLSYVVKTQSQNMEVRQYKLSAQDC  1371
                           G+++  +E   L  V  H + ++ Y +     N     ++LS Q C
Sbjct  291   --------------GVTIGNNEQSELRVVVSHDETSVRYDINGVRCNSSASGFELSLQRC  336

Query  1372  QLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNVI  1551
             ++          GD + R  +  AI  AL ++    C++ DD +   +            
Sbjct  337   RML---------GDGSRRSIIQSAIQIALGERELGNCLILDDGLMSAVC-----------  376

Query  1552  SLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGS  1731
                   +  G +YL++VA+        +  + K    LT  D    KVD+L+ EP+Y   
Sbjct  377   -----CRRDGLKYLESVASK-------LSTIHKDVKHLTGDDFKGHKVDVLLGEPYYATY  424

Query  1732  DSVLPWQNLRFW  1767
             +  LPW+ LRFW
Sbjct  425   EHALPWKQLRFW  436


 Score =   115 bits (288),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 81/127 (64%), Gaps = 11/127 (9%)
 Frame = +2

Query  143  MFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTK  322
            M Q +++ LTG SEW+++ +         PL A +SYLDMLND  RNRAF  AI K + +
Sbjct  1    MLQQRVNALTGESEWILVGDGGDGGDASDPL-AESSYLDMLNDRARNRAFSSAIAK-LGR  58

Query  323  PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIE  502
              HVLDIGAGTGLLS+MA RAM         + +  VTACES+LPM KL RKV R NG  
Sbjct  59   HGHVLDIGAGTGLLSLMAWRAM---------EEQCQVTACESFLPMYKLARKVCRDNGTM  109

Query  503  RGIRIIN  523
              I++++
Sbjct  110  GAIKLLH  116



>ref|XP_005504811.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Columba livia]
Length=688

 Score =   163 bits (412),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 112/381 (29%), Positives = 183/381 (48%), Gaps = 39/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VRVEAEDGEKIIVSPSEVEKCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  253   -SKPVRSASTCYRVQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN    V + E ++L A   + ++ Y ++   +       ++
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEQLYLTACRDEYSVWYKLQKAREEENKADVRV  361

Query  1357  SAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
              +  C+    L  +  R     D+N  C  +K++   L  KA  +C+   D   L + L 
Sbjct  362   ESPVCRCQAHLLWNRPRFGQLNDQNRTCQYVKSLMKVL--KADSVCLCVSDGSLLPV-LA  418

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             HH  A  V +L           +Q    +ND   D IK+++ R   LT      +K+ +L
Sbjct  419   HHLGAQQVFTLENSAVSCS--VMQKFFKANDLE-DKIKIIEARPELLTPSHFKDQKISVL  475

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  + S+LPW NL FW
Sbjct  476   VGEPFF--TTSLLPWHNLYFW  494


 Score = 72.4 bits (176),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 67/137 (49%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EWV  +E+    Q     +A + Y DML+D  RN  + E I   V+
Sbjct  2    KTFCGRANPTTGAMEWVEEDENYDYHQE----IARSRYADMLHDKDRNTKYYEGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA        A+ +D      A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAA--------AAGAD---FCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_010219995.1| PREDICTED: protein arginine N-methyltransferase 7, partial [Tinamus 
guttatus]
Length=668

 Score =   162 bits (409),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 112/381 (29%), Positives = 187/381 (49%), Gaps = 39/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH +L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  119   NILVTELFDTELIGEGALPTYEHAHKHLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  178

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  179   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  232

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S ++   
Sbjct  233   -SKPVRSASTCYRVQLETIKSGKAQIVLSWWDIDMDPSGKINCTMAPYWVKPTSTLQ---  288

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y ++   +        +
Sbjct  289   ------WRDHWMQCVYFLPN-EEPVFQGENVYLTAYRDEYSVWYKLQKAREEENKADVHV  341

Query  1357  SAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
              +  C+    L  +  R     D+N  C  +K++   LK  +  LCI +D S+   +A  
Sbjct  342   ESPVCRCQAHLLWNRPRFGELNDQNRTCQYIKSLVKVLKTDSVCLCI-SDGSLLPVLA--  398

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             H+  A  V ++      +    +     +ND   D IK+L+ R  +LT  D   +K+ +L
Sbjct  399   HYLGAKQVFTVENSAVSRS--VMGKFLKANDLE-DKIKILEARPESLTSSDLEDKKISVL  455

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  + S+LPW NL FW
Sbjct  456   LGEPFF--TTSLLPWHNLYFW  474


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 50/105 (48%), Gaps = 17/105 (16%)
 Frame = +2

Query  236  LATTSYLDMLNDSPRNRAFREAIDKTVTK------PCHVLDIGAGTGLLSMMAARAMGPA  397
            +A + Y DML+D  RN  + + I   V++         VLDIG GTGLLSMMAA A    
Sbjct  10   IARSRYADMLHDKDRNVKYYQGIRAAVSRVKERGEKAIVLDIGTGTGLLSMMAASA----  65

Query  398  DSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRS  532
                         A E + PM     K++  NG    I++INK S
Sbjct  66   -------GADFCYAVEVFKPMANAAVKIVEKNGFSDKIKVINKHS  103



>ref|XP_008965527.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X13 
[Pan paniscus]
Length=567

 Score =   160 bits (405),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 117/377 (31%), Positives = 183/377 (49%), Gaps = 31/377 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     V +   ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQ-EEPVMQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  LC+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDSVCLCV--SDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW  1767
             F+  + S+LPW NL FW
Sbjct  480   FF--TTSLLPWHNLYFW  494


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRVAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_009429398.1| PREDICTED: protein arginine N-methyltransferase 7 [Pan troglodytes]
Length=714

 Score =   162 bits (409),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 117/377 (31%), Positives = 183/377 (49%), Gaps = 31/377 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   MD   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPMDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     V +   ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQ-EEPVMQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW  1767
             F+  + S+LPW NL FW
Sbjct  480   FF--TTSLLPWHNLYFW  494


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRVAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_006258220.1| PREDICTED: protein arginine N-methyltransferase 7 [Alligator 
mississippiensis]
Length=690

 Score =   161 bits (408),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 114/381 (30%), Positives = 188/381 (49%), Gaps = 38/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHKYLVQEGCEAVPHRATVYAQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P +         +LS+   +F  DF
Sbjct  199   VHIQAEDDKKIIVSPSEMENCPGVSSVYDIQLNQVPWN------DFTILSDVVTVFSVDF  252

Query  1003  WKRPDS-SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPS-DVKDPS  1176
              K+  S S    +++K  K G A  I SWW + +D  GT+  +  P W    S D++   
Sbjct  253   SKQVSSASAYHRVVLKPVKSGMAQVIFSWWDIDMDPSGTIKCTMAPYWAQPTSLDIQ---  309

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN    +Q  E V+L A   + ++ Y ++      +     +
Sbjct  310   ------WRDHWMQCVYFLPNEKPLLQ-GEIVYLTACRDEYSVWYKLQKARDKEDKTDAHV  362

Query  1357  SAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
             ++  C+    L  +  R     D+N     +KA+   LK  +  LCI +D S+   +A  
Sbjct  363   ASPVCRCQAHLLWNRPRFGELNDQNRTNEYIKALKKVLKTDSVCLCI-SDGSLLPVLA--  419

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             H+  A  V +L           ++ +  +N    D IK+++KR   LT  D  ++KV ++
Sbjct  420   HYLGAQQVFTLENSAV--SHSVMEKIFKANHLE-DKIKIIEKRPELLTPSDLENKKVSVV  476

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             I EPF+  + S+LPW NL FW
Sbjct  477   IGEPFF--TTSLLPWHNLYFW  495


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 62/137 (45%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG  EW+  +E     Q     +A + Y DML+D  RN  + + I   V 
Sbjct  2    KIFCGRANPTTGAMEWLEEDEDYDYHQE----IARSRYADMLHDKDRNVKYYQGISAAVR  57

Query  320  KPCH------VLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKERGERAIVLDIGTGTGLLSMMAVSA-----------GADFCYAVEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSEKIKVINKHS  123



>ref|XP_008965526.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X12 
[Pan paniscus]
Length=627

 Score =   160 bits (406),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 119/389 (31%), Positives = 188/389 (48%), Gaps = 32/389 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     V +   ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQ-EEPVMQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW*MICHTHACLYF  1803
             F+  + S+LPW NL FW    ++  CL F
Sbjct  480   FF--TTSLLPWHNLYFW-CAGNSKMCLLF  505


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRVAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_008965525.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X11 
[Pan paniscus]
Length=656

 Score =   161 bits (407),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 119/389 (31%), Positives = 188/389 (48%), Gaps = 32/389 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     V +   ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQ-EEPVMQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW*MICHTHACLYF  1803
             F+  + S+LPW NL FW    ++  CL F
Sbjct  480   FF--TTSLLPWHNLYFW-CAGNSKMCLLF  505


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRVAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>gb|EAW83232.1| protein arginine methyltransferase 7, isoform CRA_e [Homo sapiens]
Length=567

 Score =   160 bits (404),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 118/377 (31%), Positives = 182/377 (48%), Gaps = 31/377 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES  +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESGRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDVESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     VQ    ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQEEPVVQGSA-LYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  LC+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDSVCLCV--SDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW  1767
             F+  + S+LPW NL FW
Sbjct  480   FF--TTSLLPWHNLYFW  494


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_008965522.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X9 
[Pan paniscus]
Length=685

 Score =   161 bits (407),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 119/389 (31%), Positives = 188/389 (48%), Gaps = 32/389 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  60    NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  119

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  120   IHVQTSLGEQVIVPPVDLESCPGA---PSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  176

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  177   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  228

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     V +   ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  229   MQWRDHWMQCVYFLPQ-EEPVMQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  286

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  287   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  343

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  344   VEQVFTV--ESSAASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  400

Query  1717  FYYGSDSVLPWQNLRFW*MICHTHACLYF  1803
             F+  + S+LPW NL FW    ++  CL F
Sbjct  401   FF--TTSLLPWHNLYFW-CAGNSKMCLLF  426



>ref|XP_010193298.1| PREDICTED: protein arginine N-methyltransferase 7, partial [Mesitornis 
unicolor]
Length=526

 Score =   159 bits (402),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 114/381 (30%), Positives = 184/381 (48%), Gaps = 38/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTVLSDVVTMFSVDF  252

Query  1003  WKRPDS-SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSL  1179
              K   S S     L++  K G A  ++SWW + +D  G +  +  P W+   S ++    
Sbjct  253   SKPVRSASTSYRALLEPVKSGKAQIVLSWWDIDMDPAGMINCTMAPYWVKSASALQ----  308

Query  1180  SCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYKL  1356
                  W DHW QCV+F+PN    VQ  E V+L A   + ++ Y + K + +       ++
Sbjct  309   -----WRDHWMQCVYFLPNEEPVVQ-GEQVYLTACRDEYSVWYKLHKARGEEENKADVRV  362

Query  1357  SAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
              +  C+    L  +  R     D+N  C   +A+   LK  +  LCI +D S+   +A  
Sbjct  363   ESPVCRCQAHLLWNRPRFGQLNDQNRTCQYTEALMKVLKGDSVCLCI-SDGSLLPVLA--  419

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             H+  A  V +L           +Q    +N+   D IK+++ R   LT      +K+ +L
Sbjct  420   HYLGAKQVFTLENSAVSCS--VMQKFFKANNLE-DKIKIIEARPELLTSSHLEDKKISVL  476

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  + S+LPW NL FW
Sbjct  477   VGEPFF--TTSLLPWHNLYFW  495


 Score = 69.3 bits (168),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 63/137 (46%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EWV  +E     Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWVEEDEDYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKARGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFCDKIKVINKHS  123



>ref|XP_008965523.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X10 
[Pan paniscus]
Length=664

 Score =   160 bits (406),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 119/389 (31%), Positives = 188/389 (48%), Gaps = 32/389 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     V +   ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQ-EEPVMQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW*MICHTHACLYF  1803
             F+  + S+LPW NL FW    ++  CL F
Sbjct  480   FF--TTSLLPWHNLYFW-CAGNSKMCLLF  505


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRVAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_003936376.2| PREDICTED: protein arginine N-methyltransferase 7 [Saimiri boliviensis 
boliviensis]
Length=700

 Score =   161 bits (407),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 124/381 (33%), Positives = 187/381 (49%), Gaps = 39/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  142   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  201

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD----AISEG-IKLLSEPFKIFDFDFWKR  1011
                + S    ++   MD   C      P  CD     +S     +LS+   IF  DF K+
Sbjct  202   IRVQTSLGEQVIVPPMDLERC---PGAPSVCDIQLNQVSPAEFTVLSDVLPIFSVDFSKQ  258

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +  P W H      DP 
Sbjct  259   VSSSAACHSRQFEPL----ASGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE  309

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQY  1350
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S   N  VR+ 
Sbjct  310   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCIWYSLQRTSPGNNERVREM  365

Query  1351  KLSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
             +    DCQ  L  +  R     D++     ++A+   LK  +  LC V+D S+   +A  
Sbjct  366   R-PVCDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDSVCLC-VSDGSLMSMLA--  421

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             HH  A  V ++         + ++ +  +N    D I +++KR   LT +D   RKV LL
Sbjct  422   HHLGAEQVFTIESSA--ASHKLMRKIFKANHLE-DKINIIEKRPELLTNEDLKGRKVSLL  478

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  + S+LPW NL FW
Sbjct  479   LGEPFF--TTSLLPWHNLYFW  497


 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EWV  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  5    KIFCSRANPTTGSVEWVEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRAAVS  60

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  61   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  109

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  110  VEENGFSDKIKVINKHS  126



>ref|XP_008965521.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X8 
[Pan paniscus]
Length=687

 Score =   160 bits (406),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 119/389 (31%), Positives = 188/389 (48%), Gaps = 32/389 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     V +   ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQ-EEPVMQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW*MICHTHACLYF  1803
             F+  + S+LPW NL FW    ++  CL F
Sbjct  480   FF--TTSLLPWHNLYFW-CAGNSKMCLLF  505


 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRVAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_007992049.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X4 
[Chlorocebus sabaeus]
 ref|XP_007992050.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X4 
[Chlorocebus sabaeus]
Length=565

 Score =   159 bits (402),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 118/380 (31%), Positives = 183/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L  E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  6     NILVTELFDTELIGEGALPSYEHAHRHLAEENCEAVPHRATVYAQLVESRRMWSWNKLFP  65

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  66    IHVQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  122

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  123   VSSSAACHSRQFEPL----TSGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  173

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  174   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDFCVWYSLQRTSPEKNERVHQM  229

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++     ++A++  LK  +  +C+   D   L++ L H
Sbjct  230   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTVLKPDS--VCLCVSDGSLLSV-LAH  286

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+
Sbjct  287   HLGVEQVFTV--ESSAASHKLLRKIFKANHLE-DKINIIEKRPELLTSEDLKGRKVSLLL  343

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  344   GEPFF--TTSLLPWHNLYFW  361



>dbj|BAB14215.1| unnamed protein product [Homo sapiens]
Length=613

 Score =   160 bits (404),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 117/377 (31%), Positives = 182/377 (48%), Gaps = 31/377 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES  +W  + LF 
Sbjct  60    NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESGRMWSWNKLFP  119

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  120   IHVQTSLGEQVIVPPVDVESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  176

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  177   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  228

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     VQ    ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  229   MQWRDHWMQCVYFLPQEEPVVQGSA-LYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  286

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  287   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  343

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  344   VEQVFTV--ESSAASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  400

Query  1717  FYYGSDSVLPWQNLRFW  1767
             F+  + S+LPW NL FW
Sbjct  401   FF--TTSLLPWHNLYFW  415



>ref|XP_009195014.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X3 
[Papio anubis]
Length=664

 Score =   160 bits (405),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 119/380 (31%), Positives = 184/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  102   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATIYAQLVESRRMWSWNKLFP  161

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  162   IHLQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  218

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  219   VSSSAACHSRQFEPLT----SGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  269

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  270   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPEKNERVHQM  325

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++     ++A++  LK  +  +C+   D   L++ L H
Sbjct  326   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTVLKPDS--VCLCVSDGSLLSV-LAH  382

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+
Sbjct  383   HLGVEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTSEDLKSRKVSLLL  439

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  440   GEPFF--TTSLLPWHNLYFW  457



>ref|XP_005256049.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X5 
[Homo sapiens]
 ref|XP_005256050.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X6 
[Homo sapiens]
 ref|XP_006721261.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X10 
[Homo sapiens]
 gb|EAW83226.1| protein arginine methyltransferase 7, isoform CRA_b [Homo sapiens]
 gb|EAW83227.1| protein arginine methyltransferase 7, isoform CRA_b [Homo sapiens]
 gb|EAW83229.1| protein arginine methyltransferase 7, isoform CRA_b [Homo sapiens]
Length=613

 Score =   160 bits (404),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 117/377 (31%), Positives = 182/377 (48%), Gaps = 31/377 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES  +W  + LF 
Sbjct  60    NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESGRMWSWNKLFP  119

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  120   IHVQTSLGEQVIVPPVDVESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  176

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  177   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  228

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     VQ    ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  229   MQWRDHWMQCVYFLPQEEPVVQGSA-LYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  286

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  287   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  343

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  344   VEQVFTV--ESSAASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  400

Query  1717  FYYGSDSVLPWQNLRFW  1767
             F+  + S+LPW NL FW
Sbjct  401   FF--TTSLLPWHNLYFW  415



>dbj|BAG53431.1| unnamed protein product [Homo sapiens]
Length=567

 Score =   159 bits (402),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 118/377 (31%), Positives = 182/377 (48%), Gaps = 31/377 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES  +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESGRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDVEGC---PGAPSVCDIQLNQVSPADFTVLSDVLLMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     VQ    ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQEEPVVQGSA-LYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  LC+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDSVCLCV--SDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW  1767
             F+  + S+LPW NL FW
Sbjct  480   FF--TTSLLPWHNLYFW  494


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_008965519.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X6 
[Pan paniscus]
Length=693

 Score =   160 bits (405),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 119/389 (31%), Positives = 188/389 (48%), Gaps = 32/389 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     V +   ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQ-EEPVMQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW*MICHTHACLYF  1803
             F+  + S+LPW NL FW    ++  CL F
Sbjct  480   FF--TTSLLPWHNLYFW-CAGNSKMCLLF  505


 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRVAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|NP_001171753.1| protein arginine N-methyltransferase 7 isoform 2 [Homo sapiens]
 dbj|BAG65391.1| unnamed protein product [Homo sapiens]
Length=642

 Score =   160 bits (404),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 117/377 (31%), Positives = 182/377 (48%), Gaps = 31/377 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES  +W  + LF 
Sbjct  89    NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESGRMWSWNKLFP  148

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  149   IHVQTSLGEQVIVPPVDVESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  205

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  206   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  257

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     VQ    ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  258   MQWRDHWMQCVYFLPQEEPVVQGSA-LYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  315

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  316   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  372

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  373   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  429

Query  1717  FYYGSDSVLPWQNLRFW  1767
             F+  + S+LPW NL FW
Sbjct  430   FF--TTSLLPWHNLYFW  444



>ref|XP_006019120.1| PREDICTED: protein arginine N-methyltransferase 7 [Alligator 
sinensis]
Length=690

 Score =   160 bits (405),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 113/381 (30%), Positives = 188/381 (49%), Gaps = 38/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHKYLVQEGCEAVPHRATVYAQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P +         +LS+   +F  DF
Sbjct  199   VHIQAEDDKKIIVSPSEMENCPGVSSVYDIQLNQMPWN------DFTILSDVVTMFSVDF  252

Query  1003  WKRPDS-SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPS-DVKDPS  1176
              K+  S S    ++++  K G A  I SWW + +D  GT+  +  P W    S D++   
Sbjct  253   SKQVSSASAYHRVVLQPVKSGMAQVIFSWWDIDMDPSGTIKCTMAPYWAQPTSLDIQ---  309

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN    +Q  E V+L A   + ++ Y ++      +     +
Sbjct  310   ------WRDHWMQCVYFLPNEKPLLQ-GEIVYLTACRDEYSVWYKLQKARDKEDKTDAHV  362

Query  1357  SAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
             ++  C+    L  +  R     D+N     +KA+   LK  +  LCI +D S+   +A  
Sbjct  363   ASPVCRCQAHLLWNRPRFGELNDQNRTNEYIKALKKVLKTDSVCLCI-SDGSLLPVLA--  419

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             H+  A  V +L           ++ +  +N    D IK+++KR   LT  D  ++KV ++
Sbjct  420   HYLGAQQVFTLENSA--VSHSVMEKIFKANHLE-DKIKIIEKRPELLTPSDLENKKVSVV  476

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             I EPF+  + S+LPW NL FW
Sbjct  477   IGEPFF--TTSLLPWHNLHFW  495


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 62/137 (45%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG  EW+  +E     Q     +A + Y DML+D  RN  + + I   V 
Sbjct  2    KIFCGRANPTTGAMEWLEEDEDYDYHQE----IARSRYADMLHDKDRNVKYYQGISAAVR  57

Query  320  KPCH------VLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKERGERAIVLDIGTGTGLLSMMAVSA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSEKIKVINKHS  123



>ref|XP_008965517.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X4 
[Pan paniscus]
Length=727

 Score =   160 bits (406),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 119/389 (31%), Positives = 188/389 (48%), Gaps = 32/389 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     V +   ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQ-EEPVMQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW*MICHTHACLYF  1803
             F+  + S+LPW NL FW    ++  CL F
Sbjct  480   FF--TTSLLPWHNLYFW-CAGNSKMCLLF  505


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRVAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>gb|EAW83231.1| protein arginine methyltransferase 7, isoform CRA_d [Homo sapiens]
Length=655

 Score =   160 bits (404),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 117/377 (31%), Positives = 182/377 (48%), Gaps = 31/377 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES  +W  + LF 
Sbjct  102   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESGRMWSWNKLFP  161

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  162   IHVQTSLGEQVIVPPVDVESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  218

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  219   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  270

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     VQ    ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  271   MQWRDHWMQCVYFLPQEEPVVQGSA-LYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  328

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  329   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  385

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  386   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  442

Query  1717  FYYGSDSVLPWQNLRFW  1767
             F+  + S+LPW NL FW
Sbjct  443   FF--TTSLLPWHNLYFW  457



>ref|XP_008965520.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X7 
[Pan paniscus]
Length=692

 Score =   160 bits (405),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 116/377 (31%), Positives = 183/377 (49%), Gaps = 31/377 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     V +   ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQ-EEPVMQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW  1767
             F+  + S+LPW NL FW
Sbjct  480   FF--TTSLLPWHNLYFW  494


 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRVAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_008965516.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X3 
[Pan paniscus]
Length=727

 Score =   160 bits (406),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 119/389 (31%), Positives = 188/389 (48%), Gaps = 32/389 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     V +   ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQ-EEPVMQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW*MICHTHACLYF  1803
             F+  + S+LPW NL FW    ++  CL F
Sbjct  480   FF--TTSLLPWHNLYFW-CAGNSKMCLLF  505


 Score = 70.5 bits (171),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRVAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_007992045.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X3 
[Chlorocebus sabaeus]
Length=619

 Score =   159 bits (402),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 118/380 (31%), Positives = 183/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L  E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  60    NILVTELFDTELIGEGALPSYEHAHRHLAEENCEAVPHRATVYAQLVESRRMWSWNKLFP  119

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  120   IHVQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  176

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  177   VSSSAACHSRQFEPL----TSGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  227

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  228   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDFCVWYSLQRTSPEKNERVHQM  283

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++     ++A++  LK  +  +C+   D   L++ L H
Sbjct  284   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTVLKPDS--VCLCVSDGSLLSV-LAH  340

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+
Sbjct  341   HLGVEQVFTV--ESSAASHKLLRKIFKANHLE-DKINIIEKRPELLTSEDLKGRKVSLLL  397

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  398   GEPFF--TTSLLPWHNLYFW  415



>ref|XP_009897442.1| PREDICTED: LOW QUALITY PROTEIN: protein arginine N-methyltransferase 
7 [Picoides pubescens]
Length=697

 Score =   160 bits (405),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 115/382 (30%), Positives = 190/382 (50%), Gaps = 40/382 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH  L+ E  E VP++ T++ QLVESK +W  + LF 
Sbjct  142   NILVTELFDTELIGEGALPSYEHAHKYLVQEGCEAVPHKATVYVQLVESKRMWSWNKLFP  201

Query  847   NEEKASDTIHLV---PK-----GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++   P+     G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  202   VHVEAEDGEKIIVSPPEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  255

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P SS  T   + ++  K G A  ++SWW + +DR G +  +  P W+   S ++   
Sbjct  256   -SKPVSSASTCYRVHLEPVKSGKAQIVLSWWDIDMDRSGKINCTMAPYWVKSTSALQ---  311

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVR-QYK  1353
                   W DHW QCV+F+PN    + + E V L A   + +L Y ++   +  E R   +
Sbjct  312   ------WRDHWMQCVYFLPN-EEPILQGEKVCLTACRDEYSLWYKLQKAREEEESRADVR  364

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +KA+   LK  +  LCI +D S+   +A 
Sbjct  365   VDSPVCRCQAHLLWNRPRFGELNDRNRTQQYIKALTKVLKTDSVCLCI-SDGSLLPMLA-  422

Query  1522  GHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDL  1701
              HH  A  V ++           +Q    +N+   D IK+L+ R  +LT      +K+ +
Sbjct  423   -HHLGAKQVFTVENSAVSCS--VMQKFFKANNLE-DKIKILEARPESLTSSHLEDQKISV  478

Query  1702  LIAEPFYYGSDSVLPWQNLRFW  1767
             L+ EPF+  + S+LPW NL FW
Sbjct  479   LVGEPFF--TTSLLPWHNLYFW  498


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 66/138 (48%), Gaps = 20/138 (14%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNTKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTAC-ESYLPMVKLMRK  478
            +         VLDIG GTGLLSMMA          S  +   + + C + + PM     K
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMA---------CSXGEHFSLRSCCLQVFKPMANAAVK  108

Query  479  VLRANGIERGIRIINKRS  532
            ++  NG    I++INK S
Sbjct  109  IVEKNGFGDRIKVINKHS  126



>ref|XP_007992044.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Chlorocebus sabaeus]
Length=648

 Score =   159 bits (403),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 118/380 (31%), Positives = 183/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L  E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  89    NILVTELFDTELIGEGALPSYEHAHRHLAEENCEAVPHRATVYAQLVESRRMWSWNKLFP  148

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  149   IHVQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  205

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  206   VSSSAACHSRQFEPLT----SGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  256

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  257   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDFCVWYSLQRTSPEKNERVHQM  312

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++     ++A++  LK  +  +C+   D   L++ L H
Sbjct  313   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTVLKPDS--VCLCVSDGSLLSV-LAH  369

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+
Sbjct  370   HLGVEQVFTV--ESSAASHKLLRKIFKANHLE-DKINIIEKRPELLTSEDLKGRKVSLLL  426

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  427   GEPFF--TTSLLPWHNLYFW  444



>ref|NP_061896.1| protein arginine N-methyltransferase 7 isoform 1 [Homo sapiens]
 ref|NP_001276947.1| protein arginine N-methyltransferase 7 isoform 1 [Homo sapiens]
 ref|XP_005256045.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Homo sapiens]
 ref|XP_005256046.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Homo sapiens]
 ref|XP_006721259.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X8 
[Homo sapiens]
 sp|Q9NVM4.1|ANM7_HUMAN RecName: Full=Protein arginine N-methyltransferase 7; AltName: 
Full=Histone-arginine N-methyltransferase PRMT7; AltName: 
Full=[Myelin basic protein]-arginine N-methyltransferase PRMT7 
[Homo sapiens]
 dbj|BAA91726.1| unnamed protein product [Homo sapiens]
 gb|AAH00146.1| Protein arginine methyltransferase 7 [Homo sapiens]
 gb|EAW83224.1| protein arginine methyltransferase 7, isoform CRA_a [Homo sapiens]
 gb|EAW83225.1| protein arginine methyltransferase 7, isoform CRA_a [Homo sapiens]
 gb|EAW83230.1| protein arginine methyltransferase 7, isoform CRA_a [Homo sapiens]
Length=692

 Score =   160 bits (404),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 117/377 (31%), Positives = 182/377 (48%), Gaps = 31/377 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES  +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESGRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDVESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     VQ    ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQEEPVVQGSA-LYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW  1767
             F+  + S+LPW NL FW
Sbjct  480   FF--TTSLLPWHNLYFW  494


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_008965510.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Pan paniscus]
 ref|XP_008965511.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Pan paniscus]
 ref|XP_008965512.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Pan paniscus]
 ref|XP_008965513.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Pan paniscus]
 ref|XP_008965514.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Pan paniscus]
Length=764

 Score =   160 bits (406),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 119/389 (31%), Positives = 188/389 (48%), Gaps = 32/389 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     V +   ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQ-EEPVMQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTV--ESSAASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW*MICHTHACLYF  1803
             F+  + S+LPW NL FW    ++  CL F
Sbjct  480   FF--TTSLLPWHNLYFW-CAGNSKMCLLF  505


 Score = 70.5 bits (171),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRVAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_007429235.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Python bivittatus]
Length=552

 Score =   158 bits (399),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 117/382 (31%), Positives = 186/382 (49%), Gaps = 40/382 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRYLVQEGCEAVPHRATVYAQLVESKRMWSWNKLFP  198

Query  847   NEEKASD---TIHLVPK-----GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D    I   P+     G  ++  ++  Q P+H D ++     LSE   +F  DF
Sbjct  199   IPIQAEDDEKAIVFPPEMDSCPGAPSVYDIQLNQVPLH-DFVA-----LSEVVTMFSIDF  252

Query  1003  WKRPDSSRETELLIK--ATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P S       +K   TK G A  ++SWW + ++  G++  +  P W+  P +     
Sbjct  253   -SKPVSRASASYTVKLEPTKSGKAQVVLSWWEIDMNPSGSIKCTLAPYWVQSPYE-----  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN  L V + + V L A   D ++ Y ++ +S+N + +  + 
Sbjct  307   ---DSPWRDHWMQCVYFLPNEEL-VSQGQSVDLTAFRDDYSVWYNLR-KSRNEDSKTSEH  361

Query  1357  SAQ---DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +    CQ  L  +  R     D N     L+A+    K  +  +C+   D   L + L
Sbjct  362   TERPVCRCQAHLLWNRPRFGELNDWNRTSHYLQALKKVFKPNS--VCLSISDGSLLPV-L  418

Query  1522  GHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDL  1701
              H   A  V +L           +Q +  +N    D I +++K   +L   D   RK+ L
Sbjct  419   AHRLGAEKVFTL--ESSSLSHSLMQKIFTANHLE-DKITIIEKHPESLISSDFEDRKISL  475

Query  1702  LIAEPFYYGSDSVLPWQNLRFW  1767
             LI EPF+  S S+LPW NL FW
Sbjct  476   LIGEPFF--STSLLPWHNLYFW  495


 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 63/137 (46%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG  EW+  +E+    Q     +A + Y DMLND  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGAMEWLEEDENYDYHQE----IARSCYADMLNDKDRNVKYFQGIHAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                   E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAVTA-----------GADFCYGIEVFKPMADTAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I+IINK S
Sbjct  107  VEKNGFSDKIKIINKHS  123



>ref|XP_008965515.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Pan paniscus]
Length=763

 Score =   160 bits (405),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 116/377 (31%), Positives = 183/377 (49%), Gaps = 31/377 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     V +   ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQ-EEPVMQGSALYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW  1767
             F+  + S+LPW NL FW
Sbjct  480   FF--TTSLLPWHNLYFW  494


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRVAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_005592409.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X4 
[Macaca fascicularis]
Length=567

 Score =   158 bits (399),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 119/380 (31%), Positives = 184/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATIYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHLQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  256   VSSSAACHSRQFEPL----TSGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  307   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQRTSTEKNERVHQM  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++     ++A++  LK  +  LC+   D   L++ L H
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTVLKPDSVCLCV--SDGSLLSV-LAH  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+
Sbjct  420   HLGVEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTSEDLKSRKVSLLL  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW +L FW
Sbjct  477   GEPFF--TTSLLPWHSLYFW  494


 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I +INK S
Sbjct  107  VEKNGFSDKILVINKHS  123



>ref|XP_002992539.1| hypothetical protein SELMODRAFT_430728 [Selaginella moellendorffii]
 gb|EFJ06477.1| hypothetical protein SELMODRAFT_430728 [Selaginella moellendorffii]
Length=655

 Score =   159 bits (402),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 102/157 (65%), Gaps = 3/157 (2%)
 Frame = +1

Query  676   VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
             V EILDSELLGEG+IP+L+HAH +LL  +  TVPYR T++ QLVE   LW+ HDL   E 
Sbjct  135   VCEILDSELLGEGIIPSLRHAHKHLLQPNAATVPYRATVYAQLVECDFLWRFHDLQGVEA  194

Query  856   KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFWKRPDSSRETE  1035
             +  D +   P+  D     KH+Q   H D I  GIKLLSEPF+ F  DF++ PD   +  
Sbjct  195   QLQDGMAFSPE--DFYSYFKHRQHAFHVDEIP-GIKLLSEPFEAFTLDFYRAPDVCGQFT  251

Query  1036  LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWI  1146
               +     GTAHAI+SWW+LQLD++G + YST P+W+
Sbjct  252   RAVHVNMSGTAHAIVSWWVLQLDKDGLICYSTAPRWV  288


 Score =   109 bits (273),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 83/130 (64%), Gaps = 12/130 (9%)
 Frame = +2

Query  143  MFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVTK  322
            M Q +++ LTG SEW+++ + D  + +    LA + YLDMLND  RN AF  AI K + +
Sbjct  1    MLQQRVNALTGESEWILVSDGDDGDASDA--LAESLYLDMLNDRARNTAFSSAIAK-LGR  57

Query  323  PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVLRANGIE  502
              HVLDIGAG+GLLSMMA RAM         + +  VTACES+LPM KL RKV R NG  
Sbjct  58   HGHVLDIGAGSGLLSMMAWRAM---------EKQCQVTACESFLPMYKLARKVCRDNGTM  108

Query  503  RGIRIINKRS  532
              I++++ RS
Sbjct  109  GAIKLLHMRS  118


 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 69/130 (53%), Gaps = 8/130 (6%)
 Frame = +1

Query  1381  LSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTI-ALGHHARASNVISL  1557
             LSP+R  + GD + R  +  AI  AL ++    C++ DD +   + AL     + +V  L
Sbjct  314   LSPQRCCMLGDGSRRSIIRSAIQKALGEREVGNCLILDDGLMSAVCALSTVHGSCHVAGL  373

Query  1558  FPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYGSDS  1737
             FPG +  G +YL +VA+        + ++ K    LT  D    KVD+L+AEP+Y   + 
Sbjct  374   FPGCRRDGLKYLASVASK-------LSIIHKDVKHLTRDDFKGHKVDVLLAEPYYATYEH  426

Query  1738  VLPWQNLRFW  1767
              LPW+ LRFW
Sbjct  427   ALPWKQLRFW  436



>ref|XP_010353347.1| PREDICTED: protein arginine N-methyltransferase 7 [Rhinopithecus 
roxellana]
Length=701

 Score =   159 bits (403),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 118/380 (31%), Positives = 184/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IRVQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  256   VSSSAACHSRQFEPLT----SGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  307   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPEKNERVHQM  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++     ++A++  LK  +  +C+   D   L++ L H
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTVLKPDS--VCLCVSDGSLLSV-LAH  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+
Sbjct  420   HLGVEQVFTVESSA--ASHKLLRKIFKANHLE-DKINLIEKRPELLTSEDLKDRKVSLLL  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  477   GEPFF--TTSLLPWHNLYFW  494


 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     ++
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMAAAAAEI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I +INK S
Sbjct  107  VEKNGFRDKIMVINKHS  123



>gb|EHH60505.1| hypothetical protein EGM_11877 [Macaca fascicularis]
Length=567

 Score =   158 bits (399),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 119/380 (31%), Positives = 184/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATIYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHLQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  256   VSSSAACYSRQFEPL----TSGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  307   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPEKNERVHQM  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++     ++A++  LK  +  LC+   D   L++ L H
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTVLKPDSVCLCV--SDGSLLSV-LAH  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+
Sbjct  420   HLGVEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTSEDLKSRKVSLLL  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW +L FW
Sbjct  477   GEPFF--TTSLLPWHSLYFW  494


 Score = 68.9 bits (167),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I +INK S
Sbjct  107  VEKNGFSDKILVINKHS  123



>gb|EHH31787.1| hypothetical protein EGK_12925 [Macaca mulatta]
Length=567

 Score =   157 bits (398),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 119/380 (31%), Positives = 184/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATIYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHLQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  256   VSSSAACHSRQFEPL----TSGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  307   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPEKNERVHQM  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++     ++A++  LK  +  LC+   D   L++ L H
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTVLKPDSVCLCV--SDGSLLSV-LAH  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+
Sbjct  420   HLGVEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTSEDLKSRKVSLLL  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW +L FW
Sbjct  477   GEPFF--TTSLLPWHSLYFW  494


 Score = 68.9 bits (167),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I +INK S
Sbjct  107  VEKNGFSDKILVINKHS  123



>ref|XP_007992043.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Chlorocebus sabaeus]
Length=698

 Score =   159 bits (402),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 118/380 (31%), Positives = 183/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L  E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLAEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  256   VSSSAACHSRQFEPLT----SGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  307   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDFCVWYSLQRTSPEKNERVHQM  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++     ++A++  LK  +  +C+   D   L++ L H
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTVLKPDS--VCLCVSDGSLLSV-LAH  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+
Sbjct  420   HLGVEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTSEDLKGRKVSLLL  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  477   GEPFF--TTSLLPWHNLYFW  494


 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAGKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I +INK S
Sbjct  107  VEKNGFSDKIMVINKHS  123



>ref|XP_005025773.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Anas platyrhynchos]
 gb|EOA96924.1| Protein arginine N-methyltransferase 7, partial [Anas platyrhynchos]
Length=688

 Score =   159 bits (401),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 115/385 (30%), Positives = 189/385 (49%), Gaps = 47/385 (12%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   +V          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VRVEAEDGEKIVVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN    + + E V+L A   + ++ Y  K Q    E  +  +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPILQGEKVYLTACRDEYSVWY--KLQKARGEDNKADV  359

Query  1357  SAQD----CQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIA  1518
               +     CQ  L  +  R     D+N     +K++ N L+  +  LCI +D S+   +A
Sbjct  360   CVESPICRCQAHLLWNRPRFGELNDQNRTRQYIKSLMNVLRTDSVCLCI-SDGSLLPVLA  418

Query  1519  LGHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRK  1692
               H+  A  V ++      +   E++ +A     ++  D IK+L+ R  +LT      +K
Sbjct  419   --HYLGAKQVFTVENSAVSRSVMEKFFKA-----NHLEDKIKILEARPESLTSSHLEDKK  471

Query  1693  VDLLIAEPFYYGSDSVLPWQNLRFW  1767
             + +L+ EPF+  + S+LPW NL FW
Sbjct  472   ISVLVGEPFF--TTSLLPWHNLYFW  494


 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_001099129.2| PREDICTED: protein arginine N-methyltransferase 7 isoform 1 [Macaca 
mulatta]
Length=651

 Score =   158 bits (399),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 118/380 (31%), Positives = 184/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  89    NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATIYAQLVESRRMWSWNKLFP  148

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  149   IHLQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  205

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  206   VSSSAACHSRQFEPLT----SGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  256

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  257   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPEKNERVHQM  312

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++     ++A++  LK  +  +C+   D   L++ L H
Sbjct  313   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTVLKPDS--VCLCVSDGSLLSV-LAH  369

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+
Sbjct  370   HLGVEQVFTV--ESSAASHKLLRKIFKANHLE-DKINIIEKRPELLTSEDLKSRKVSLLL  426

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW +L FW
Sbjct  427   GEPFF--TTSLLPWHSLYFW  444



>dbj|BAG51772.1| unnamed protein product [Homo sapiens]
Length=692

 Score =   158 bits (400),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 116/377 (31%), Positives = 181/377 (48%), Gaps = 31/377 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES  +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESGRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGEQVIVPPVDVESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
                S        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSGSAACHSRRFEPLTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     VQ    ++L A H D  + Y ++  S  +N  VRQ +   
Sbjct  308   MQWRDHWMQCVYFLPQEEPVVQGSA-LYLVAHHDDYCVWYSLQRTSPEKNERVRQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
                V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EP
Sbjct  423   VEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW  1767
             F+  + S+LPW NL FW
Sbjct  480   FF--TTSLLPWHNLYFW  494


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_007429234.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Python bivittatus]
Length=690

 Score =   158 bits (400),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 117/382 (31%), Positives = 186/382 (49%), Gaps = 40/382 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRYLVQEGCEAVPHRATVYAQLVESKRMWSWNKLFP  198

Query  847   NEEKASD---TIHLVPK-----GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D    I   P+     G  ++  ++  Q P+H D ++     LSE   +F  DF
Sbjct  199   IPIQAEDDEKAIVFPPEMDSCPGAPSVYDIQLNQVPLH-DFVA-----LSEVVTMFSIDF  252

Query  1003  WKRPDSSRETELLIK--ATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P S       +K   TK G A  ++SWW + ++  G++  +  P W+  P +     
Sbjct  253   -SKPVSRASASYTVKLEPTKSGKAQVVLSWWEIDMNPSGSIKCTLAPYWVQSPYE-----  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN  L V + + V L A   D ++ Y ++ +S+N + +  + 
Sbjct  307   ---DSPWRDHWMQCVYFLPNEEL-VSQGQSVDLTAFRDDYSVWYNLR-KSRNEDSKTSEH  361

Query  1357  SAQD---CQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +    CQ  L  +  R     D N     L+A+    K  +  +C+   D   L + L
Sbjct  362   TERPVCRCQAHLLWNRPRFGELNDWNRTSHYLQALKKVFKPNS--VCLSISDGSLLPV-L  418

Query  1522  GHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDL  1701
              H   A  V +L           +Q +  +N    D I +++K   +L   D   RK+ L
Sbjct  419   AHRLGAEKVFTL--ESSSLSHSLMQKIFTANHLE-DKITIIEKHPESLISSDFEDRKISL  475

Query  1702  LIAEPFYYGSDSVLPWQNLRFW  1767
             LI EPF+  S S+LPW NL FW
Sbjct  476   LIGEPFF--STSLLPWHNLYFW  495


 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 63/137 (46%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG  EW+  +E+    Q     +A + Y DMLND  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGAMEWLEEDENYDYHQE----IARSCYADMLNDKDRNVKYFQGIHAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                   E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAVTA-----------GADFCYGIEVFKPMADTAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I+IINK S
Sbjct  107  VEKNGFSDKIKIINKHS  123



>ref|XP_009884748.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X3 
[Charadrius vociferus]
Length=637

 Score =   157 bits (398),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 113/382 (30%), Positives = 185/382 (48%), Gaps = 42/382 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  89    NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  148

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  149   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SRDFTILSDVVTMFSVDF  202

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  203   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSTSAFQ---  258

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y + K   +N      +
Sbjct  259   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSVWYTLQKASPENKAAISVE  311

Query  1354  LSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                  CQ  L  +  R     D+N     +K++   LK  +  LCI +D S+   +A  H
Sbjct  312   SPVCRCQAHLLWNRPRFGQLNDQNRTSQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA--H  368

Query  1528  HARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDL  1701
             +  A  V +L      +   E++ +A     ++  D IK+++ R   LT      +K+ +
Sbjct  369   YLGAKQVFTLENSSVSRSVMEKFFKA-----NHLEDKIKIIEARPELLTSSHLEDKKISV  423

Query  1702  LIAEPFYYGSDSVLPWQNLRFW  1767
             L+ EPF+  + S+LPW NL FW
Sbjct  424   LVGEPFF--TTSLLPWHNLYFW  443



>ref|XP_003262970.1| PREDICTED: LOW QUALITY PROTEIN: protein arginine N-methyltransferase 
7 [Nomascus leucogenys]
Length=692

 Score =   158 bits (399),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 121/381 (32%), Positives = 188/381 (49%), Gaps = 39/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELXDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IRVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +  P W H  SD ++  
Sbjct  256   VSSSAACHSRQFEPLT----SGQAQVVLSWWDIEMDPEGKIKCTMAPFWAH--SDAEE--  307

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQY  1350
                   W DHW QCV+F+P     VQ    ++L A H D  + Y ++     +N  VRQ 
Sbjct  308   ----MQWRDHWMQCVYFLPQEEPVVQGSA-LYLVAHHDDYCVWYSLQRTGPEKNERVRQM  362

Query  1351  KLSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
             +    DCQ  L  +  R     D++     ++A+   LK  +  LC V+D S+   +A  
Sbjct  363   R-PVCDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDSVCLC-VSDGSLLSMLA--  418

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             HH     V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL
Sbjct  419   HHLGVEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLKGRKVSLL  475

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  + S+LPW NL FW
Sbjct  476   LGEPFF--TTSLLPWHNLYFW  494


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIWAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKNRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_005592408.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X3 
[Macaca fascicularis]
Length=701

 Score =   158 bits (399),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 118/380 (31%), Positives = 184/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATIYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHLQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  256   VSSSAACHSRQFEPLT----SGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  307   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQRTSTEKNERVHQM  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++     ++A++  LK  +  +C+   D   L++ L H
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTVLKPDS--VCLCVSDGSLLSV-LAH  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+
Sbjct  420   HLGVEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTSEDLKSRKVSLLL  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW +L FW
Sbjct  477   GEPFF--TTSLLPWHSLYFW  494


 Score = 68.9 bits (167),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I +INK S
Sbjct  107  VEKNGFSDKILVINKHS  123



>ref|XP_008255735.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Oryctolagus cuniculus]
Length=577

 Score =   156 bits (395),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 118/381 (31%), Positives = 180/381 (47%), Gaps = 39/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  H LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRATVYAQLVESRRMWSWHKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                  S    ++    +   C      P  CD            +LS    +F  DF K+
Sbjct  199   IRVHTSLGEQVIVPPAELERC---PGAPSVCDIQLNQVSPADFTVLSRVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +  P W H      DP 
Sbjct  256   VSSSAACHSRQFEPL----ASGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQY  1350
                   W DHW QCV+F+P     V +   + L A H D  + Y ++  S  +N  V Q 
Sbjct  307   ---GLQWRDHWMQCVYFLPQ-EEPVTQGSALCLVAHHDDYCVWYSLQRTSPEKNGRVPQM  362

Query  1351  KLSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
             +    DCQ  L  +  R     D N     ++A+   L   +  +C+   D   L++ L 
Sbjct  363   R-PVCDCQAHLLWTRPRFGEINDANRTEQYVQALGTVLTPDS--ICLCVSDGSLLSV-LA  418

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             HH  A  V ++         + ++ +  +N    D I +++KR   LT +D   RKV LL
Sbjct  419   HHLGAQQVFTIESSA--ASHKLMKKIFKANHLE-DKINIIEKRPEMLTSEDLQGRKVSLL  475

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  + S+LPW NL FW
Sbjct  476   VGEPFF--TTSLLPWHNLYFW  494


 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAVEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I+IINK S
Sbjct  107  VEKNGFSDKIKIINKHS  123



>ref|XP_009862795.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Apaloderma vittatum]
Length=639

 Score =   157 bits (397),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 113/384 (29%), Positives = 185/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  89    NILVTELFDTELIGEGALPTYEHAHKFLVEEGCEAVPHRATVYAQLVESKRMWSWNKLFP  148

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                 A D    +          G+ ++  ++  Q P+          +LSE   +F  DF
Sbjct  149   VHVGAEDGAKTIVSPSEMENCPGVPSVCDIQLNQMPL------SDFTVLSEVVTMFSVDF  202

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   SD +   
Sbjct  203   -SKPVRSASTCYSVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSSSDFQ---  258

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E VHL A   + +L Y + K + +       +
Sbjct  259   ------WRDHWMQCVYFLPN-EEPVLRGESVHLTACRDEYSLWYKLQKARGEEENKADVR  311

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   L+  +  LCI +D S+   +A 
Sbjct  312   VESPVCRCQAHLLWNRPRFGQLNDQNRTHRYIKSLMKVLETDSVCLCI-SDGSLLPMLA-  369

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K+
Sbjct  370   -HYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLEDKIKIIETRPELLTASHLEDKKI  423

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  424   SVLLGEPFF--TTSLLPWHNLYFW  445



>ref|XP_001099228.1| PREDICTED: protein arginine N-methyltransferase 7 isoform 2 [Macaca 
mulatta]
Length=701

 Score =   158 bits (399),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 118/380 (31%), Positives = 184/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATIYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHLQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  256   VSSSAACHSRQFEPLT----SGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  307   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPEKNERVHQM  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++     ++A++  LK  +  +C+   D   L++ L H
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTVLKPDS--VCLCVSDGSLLSV-LAH  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+
Sbjct  420   HLGVEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTSEDLKSRKVSLLL  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW +L FW
Sbjct  477   GEPFF--TTSLLPWHSLYFW  494


 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I +INK S
Sbjct  107  VEKNGFSDKILVINKHS  123



>ref|XP_009249137.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X4 
[Pongo abelii]
 ref|XP_009249138.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X4 
[Pongo abelii]
 ref|XP_009249139.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X4 
[Pongo abelii]
Length=615

 Score =   157 bits (396),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 114/376 (30%), Positives = 180/376 (48%), Gaps = 29/376 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  60    NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  119

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  120   IRVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  176

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  177   VSSSAACHSRQFEPWTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  228

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ-  1365
               W DHW QCV+F+P     VQ    + L A H D  + Y ++  S     R +++    
Sbjct  229   MQWRDHWMQCVYFLPQEEPVVQGSA-LFLVAHHDDYCVWYSLQRTSPEKNERVHQMRPVC  287

Query  1366  DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARA  1539
             DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH   
Sbjct  288   DCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLGV  344

Query  1540  SNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPF  1719
               V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EPF
Sbjct  345   EQVFTV--ESSAASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEPF  401

Query  1720  YYGSDSVLPWQNLRFW  1767
             +  + S+LPW NL FW
Sbjct  402   F--TTSLLPWHNLYFW  415



>ref|XP_009884740.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Charadrius vociferus]
Length=687

 Score =   157 bits (398),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 113/382 (30%), Positives = 185/382 (48%), Gaps = 42/382 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SRDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y + K   +N      +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSVWYTLQKASPENKAAISVE  361

Query  1354  LSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                  CQ  L  +  R     D+N     +K++   LK  +  LCI +D S+   +A  H
Sbjct  362   SPVCRCQAHLLWNRPRFGQLNDQNRTSQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA--H  418

Query  1528  HARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDL  1701
             +  A  V +L      +   E++ +A     ++  D IK+++ R   LT      +K+ +
Sbjct  419   YLGAKQVFTLENSSVSRSVMEKFFKA-----NHLEDKIKIIEARPELLTSSHLEDKKISV  473

Query  1702  LIAEPFYYGSDSVLPWQNLRFW  1767
             L+ EPF+  + S+LPW NL FW
Sbjct  474   LVGEPFF--TTSLLPWHNLYFW  493


 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>gb|KFP74008.1| Protein arginine N-methyltransferase 7, partial [Apaloderma vittatum]
Length=688

 Score =   157 bits (398),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 113/384 (29%), Positives = 185/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKFLVEEGCEAVPHRATVYAQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                 A D    +          G+ ++  ++  Q P+          +LSE   +F  DF
Sbjct  199   VHVGAEDGAKTIVSPSEMENCPGVPSVCDIQLNQMPL------SDFTVLSEVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   SD +   
Sbjct  253   -SKPVRSASTCYSVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSSSDFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E VHL A   + +L Y + K + +       +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLRGESVHLTACRDEYSLWYKLQKARGEEENKADVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   L+  +  LCI +D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGQLNDQNRTHRYIKSLMKVLETDSVCLCI-SDGSLLPMLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K+
Sbjct  420   -HYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLEDKIKIIETRPELLTASHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLLGEPFF--TTSLLPWHNLYFW  495


 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNTKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_009862794.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Apaloderma vittatum]
Length=689

 Score =   157 bits (398),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 113/384 (29%), Positives = 185/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKFLVEEGCEAVPHRATVYAQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                 A D    +          G+ ++  ++  Q P+          +LSE   +F  DF
Sbjct  199   VHVGAEDGAKTIVSPSEMENCPGVPSVCDIQLNQMPL------SDFTVLSEVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   SD +   
Sbjct  253   -SKPVRSASTCYSVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSSSDFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E VHL A   + +L Y + K + +       +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLRGESVHLTACRDEYSLWYKLQKARGEEENKADVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   L+  +  LCI +D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGQLNDQNRTHRYIKSLMKVLETDSVCLCI-SDGSLLPMLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K+
Sbjct  420   -HYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLEDKIKIIETRPELLTASHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLLGEPFF--TTSLLPWHNLYFW  495


 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNTKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_010126413.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Chlamydotis macqueenii]
Length=638

 Score =   157 bits (396),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 120/382 (31%), Positives = 184/382 (48%), Gaps = 41/382 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  89    NILVTELFDTELIGEGALPTYEHAHKYLVEEGCEAVPHRATVYVQLVESKRMWSWNKLFP  148

Query  847   NEEKASD--TIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFW  1005
                +A D   I L P  M+    V     P  CD       S    +LS+   +F  DF 
Sbjct  149   VRVEAGDGEKIILSPSDMENCPGV-----PSVCDIQLNQMPSSDFTILSDVVTMFSVDF-  202

Query  1006  KRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSL  1179
              +P SS  T   + ++  K G A  ++SWW + +D  G +  +  P W    SD +    
Sbjct  203   SKPVSSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPAGMINCTMAPYWAKSTSDFQ----  258

Query  1180  SCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLS  1359
                  W DHW QCV+F+PN    V + E V+L A     ++ Y ++   +        + 
Sbjct  259   -----WRDHWMQCVYFLPN-EEPVLQGETVYLTACRDAYSVWYKLQKAREGENKAGVHVE  312

Query  1360  AQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
             +  C+    L  +  R     D+N     +K++   L+  +  LCI +D S+   +A  H
Sbjct  313   SPVCRCQAHLLWNRPRFGQLNDQNRTHQYIKSLMKVLQTDSVCLCI-SDGSLLPVLA--H  369

Query  1528  HARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDL  1701
             +  A  V +L          E++L+A    ND   D IK+++ R   LT      +K+ +
Sbjct  370   YLGAKQVFTLENSAVSCSVMEKFLKA----NDLE-DKIKIIEARPELLTSSHLEDKKISV  424

Query  1702  LIAEPFYYGSDSVLPWQNLRFW  1767
             LI EPF+  + S+LPW NL FW
Sbjct  425   LIGEPFF--TTSLLPWHNLYFW  444



>ref|XP_002826617.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X3 
[Pongo abelii]
Length=644

 Score =   157 bits (396),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 114/376 (30%), Positives = 180/376 (48%), Gaps = 29/376 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  89    NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  148

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  149   IRVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  205

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  206   VSSSAACHSRQFEPWTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  257

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ-  1365
               W DHW QCV+F+P     VQ    + L A H D  + Y ++  S     R +++    
Sbjct  258   MQWRDHWMQCVYFLPQEEPVVQGSA-LFLVAHHDDYCVWYSLQRTSPEKNERVHQMRPVC  316

Query  1366  DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARA  1539
             DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH   
Sbjct  317   DCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLGV  373

Query  1540  SNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPF  1719
               V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EPF
Sbjct  374   EQVFTV--ESSAASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEPF  430

Query  1720  YYGSDSVLPWQNLRFW  1767
             +  + S+LPW NL FW
Sbjct  431   F--TTSLLPWHNLYFW  444



>ref|XP_009939264.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Opisthocomus hoazin]
Length=639

 Score =   157 bits (396),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 117/379 (31%), Positives = 183/379 (48%), Gaps = 34/379 (9%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W    LF 
Sbjct  89    NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWSKLFP  148

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                +A D   ++    D   C      P  CD       S    +LS+   +F  DF  R
Sbjct  149   VHVEAEDGEKIIVSPSDMENC---PGVPSVCDIQLNQVPSSDFTILSDVVTMFSVDF-SR  204

Query  1012  PDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSC  1185
             P SS  T   + ++  K G A  ++SWW + +D  G +  +  P W+         +L+C
Sbjct  205   PVSSAATSYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWV-------KSTLAC  257

Query  1186  SEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYKLSA  1362
                W DHW QCV+F+PN   SV + E V+L A   + ++ Y + K + +       ++ +
Sbjct  258   Q--WRDHWMQCVYFLPN-EESVLQGEKVYLTACRDEYSVWYKLQKARGEEENKADVRVES  314

Query  1363  QDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHH  1530
               C+    L  +  R     D+N     +K++   LK  +  LCI +D S+   +A  H+
Sbjct  315   PVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKTDSVCLCI-SDGSLLPLLA--HY  371

Query  1531  ARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIA  1710
               A  V +L           +Q    +N    D IK+++ R   LT      +K+ +L+ 
Sbjct  372   LGAKQVFTLENSTVSCS--VMQKFFKANHLE-DKIKIIEARPELLTSSHLEDKKISVLVG  428

Query  1711  EPFYYGSDSVLPWQNLRFW  1767
             EPF+  + S+LPW NL FW
Sbjct  429   EPFF--TTSLLPWHNLYFW  445



>ref|XP_009884732.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Charadrius vociferus]
Length=689

 Score =   157 bits (397),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 113/385 (29%), Positives = 190/385 (49%), Gaps = 46/385 (12%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SRDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y ++ +++  E  +  +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSVWYTLQ-KARGEEENKAAI  360

Query  1357  SAQD----CQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIA  1518
             S +     CQ  L  +  R     D+N     +K++   LK  +  LCI +D S+   +A
Sbjct  361   SVESPVCRCQAHLLWNRPRFGQLNDQNRTSQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA  419

Query  1519  LGHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRK  1692
               H+  A  V +L      +   E++ +A     ++  D IK+++ R   LT      +K
Sbjct  420   --HYLGAKQVFTLENSSVSRSVMEKFFKA-----NHLEDKIKIIEARPELLTSSHLEDKK  472

Query  1693  VDLLIAEPFYYGSDSVLPWQNLRFW  1767
             + +L+ EPF+  + S+LPW NL FW
Sbjct  473   ISVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_010126412.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Chlamydotis macqueenii]
Length=688

 Score =   157 bits (397),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 120/382 (31%), Positives = 184/382 (48%), Gaps = 41/382 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVEEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASD--TIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFW  1005
                +A D   I L P  M+    V     P  CD       S    +LS+   +F  DF 
Sbjct  199   VRVEAGDGEKIILSPSDMENCPGV-----PSVCDIQLNQMPSSDFTILSDVVTMFSVDF-  252

Query  1006  KRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSL  1179
              +P SS  T   + ++  K G A  ++SWW + +D  G +  +  P W    SD +    
Sbjct  253   SKPVSSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPAGMINCTMAPYWAKSTSDFQ----  308

Query  1180  SCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLS  1359
                  W DHW QCV+F+PN    V + E V+L A     ++ Y ++   +        + 
Sbjct  309   -----WRDHWMQCVYFLPN-EEPVLQGETVYLTACRDAYSVWYKLQKAREGENKAGVHVE  362

Query  1360  AQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
             +  C+    L  +  R     D+N     +K++   L+  +  LCI +D S+   +A  H
Sbjct  363   SPVCRCQAHLLWNRPRFGQLNDQNRTHQYIKSLMKVLQTDSVCLCI-SDGSLLPVLA--H  419

Query  1528  HARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDL  1701
             +  A  V +L          E++L+A    ND   D IK+++ R   LT      +K+ +
Sbjct  420   YLGAKQVFTLENSAVSCSVMEKFLKA----NDLE-DKIKIIEARPELLTSSHLEDKKISV  474

Query  1702  LIAEPFYYGSDSVLPWQNLRFW  1767
             LI EPF+  + S+LPW NL FW
Sbjct  475   LIGEPFF--TTSLLPWHNLYFW  494


 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAIEWLEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>gb|KGL82134.1| Protein arginine N-methyltransferase 7, partial [Tinamus guttatus]
Length=652

 Score =   157 bits (396),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 115/382 (30%), Positives = 188/382 (49%), Gaps = 56/382 (15%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH +L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  119   NILVTELFDTELIGEGALPTYEHAHKHLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  178

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  179   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  232

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S ++   
Sbjct  233   -SKPVRSASTCYRVQLETIKSGKAQIVLSWWDIDMDPSGKINCTMAPYWVKPTSTLQ---  288

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y ++   +        +
Sbjct  289   ------WRDHWMQCVYFLPN-EEPVFQGENVYLTAYRDEYSVWYKLQKAREEENKADVHV  341

Query  1357  SAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
              +  C+    L  +  R     D+N  C  +K++   LK  +  LCI +D S+   +A  
Sbjct  342   ESPVCRCQAHLLWNRPRFGELNDQNRTCQYIKSLVKVLKTDSVCLCI-SDGSLLPVLA--  398

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV-DL  1701
             H+  A              +Q+L+A    ND   D IK+L+ R  +LT  D   +KV ++
Sbjct  399   HYLGA--------------KQFLKA----NDLE-DKIKILEARPESLTSSDLEDKKVCNI  439

Query  1702  LIAEPFYYGSDSVLPWQNLRFW  1767
             L+ EPF+  + S+LPW NL FW
Sbjct  440   LLGEPFF--TTSLLPWHNLYFW  459


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 50/105 (48%), Gaps = 17/105 (16%)
 Frame = +2

Query  236  LATTSYLDMLNDSPRNRAFREAIDKTVTK------PCHVLDIGAGTGLLSMMAARAMGPA  397
            +A + Y DML+D  RN  + + I   V++         VLDIG GTGLLSMMAA A    
Sbjct  10   IARSRYADMLHDKDRNVKYYQGIRAAVSRVKERGEKAIVLDIGTGTGLLSMMAASA----  65

Query  398  DSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRS  532
                         A E + PM     K++  NG    I++INK S
Sbjct  66   -------GADFCYAVEVFKPMANAAVKIVEKNGFSDKIKVINKHS  103



>ref|XP_008984356.1| PREDICTED: protein arginine N-methyltransferase 7 [Callithrix 
jacchus]
 ref|XP_008984357.1| PREDICTED: protein arginine N-methyltransferase 7 [Callithrix 
jacchus]
 ref|XP_008984358.1| PREDICTED: protein arginine N-methyltransferase 7 [Callithrix 
jacchus]
 ref|XP_002761222.3| PREDICTED: protein arginine N-methyltransferase 7 [Callithrix 
jacchus]
Length=699

 Score =   157 bits (397),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 123/380 (32%), Positives = 183/380 (48%), Gaps = 38/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  142   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATIYAQLVESRRMWSWNKLFP  201

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD----AISEG-IKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD     +S     +LS+   IF  DF K+
Sbjct  202   IRVQTSLGEQVIIPPVDLERC---PGAPSVCDIQLNQVSPAEFTVLSDVLPIFSVDFSKQ  258

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +  P W H      DP 
Sbjct  259   VSSSAACHSRQFEPL----ASGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE  309

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+P     VQ      L A H D  + Y + +T  +N  V + +
Sbjct  310   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCIWYSLQRTSPENERVLEMR  365

Query  1354  LSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++     ++A+   LK  +  LC V+D S  L   L H
Sbjct  366   -PVCDCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDSVCLC-VSDGS--LMSMLAH  421

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H  A  V ++           L       ++  D I +++KR   LT +D   RK+ LL+
Sbjct  422   HLGAEQVFTI---ESSAASHKLMRKIFKVNHLEDKINIIEKRPELLTNEDLQGRKISLLL  478

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  479   GEPFF--TTSLLPWHNLYFW  496


 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 66/137 (48%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EWV  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  5    KIFCSRANPTTGSVEWVEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRAAVS  60

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA RA                 A E + PM     K+
Sbjct  61   RVKDRGQKALVLDIGTGTGLLSMMAVRA-----------GADFCYAIEVFKPMADAAVKI  109

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  110  VEENGFSDKIKVINKHS  126



>ref|XP_009939263.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Opisthocomus hoazin]
Length=689

 Score =   157 bits (396),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 117/379 (31%), Positives = 183/379 (48%), Gaps = 34/379 (9%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W    LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWSKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                +A D   ++    D   C      P  CD       S    +LS+   +F  DF  R
Sbjct  199   VHVEAEDGEKIIVSPSDMENC---PGVPSVCDIQLNQVPSSDFTILSDVVTMFSVDF-SR  254

Query  1012  PDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSC  1185
             P SS  T   + ++  K G A  ++SWW + +D  G +  +  P W+         +L+C
Sbjct  255   PVSSAATSYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWV-------KSTLAC  307

Query  1186  SEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYKLSA  1362
                W DHW QCV+F+PN   SV + E V+L A   + ++ Y + K + +       ++ +
Sbjct  308   Q--WRDHWMQCVYFLPN-EESVLQGEKVYLTACRDEYSVWYKLQKARGEEENKADVRVES  364

Query  1363  QDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHH  1530
               C+    L  +  R     D+N     +K++   LK  +  LCI +D S+   +A  H+
Sbjct  365   PVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKTDSVCLCI-SDGSLLPLLA--HY  421

Query  1531  ARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIA  1710
               A  V +L           +Q    +N    D IK+++ R   LT      +K+ +L+ 
Sbjct  422   LGAKQVFTLENSTVSCS--VMQKFFKANHLE-DKIKIIEARPELLTSSHLEDKKISVLVG  478

Query  1711  EPFYYGSDSVLPWQNLRFW  1767
             EPF+  + S+LPW NL FW
Sbjct  479   EPFF--TTSLLPWHNLYFW  495


 Score = 72.4 bits (176),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EWV  +ES    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGVMEWVEEDESYDYHQE----IARSRYADMLHDKDRNTKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RIKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFHDKIKVINKHS  123



>ref|XP_008112156.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Anolis carolinensis]
Length=590

 Score =   155 bits (393),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 112/380 (29%), Positives = 183/380 (48%), Gaps = 38/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  41    NILITELFDTELIGEGALPSYEHAHRCLVQEGCEAVPHRATVYAQLVESKRMWSWNKLFP  100

Query  847   ---NEEKASDTIHLVPK-----GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                  E     I   P+     G  ++  ++  Q P+  D ++     LSE   +F  DF
Sbjct  101   IHVQAEGGKKVIVSPPEMENCPGAPSVYDIQLNQVPL-SDFVA-----LSEVVTMFSVDF  154

Query  1003  WKRPDSSRETELL-IKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSL  1179
              K+   +     + ++  + G A  ++SWW + +D  G++  +  P W+   S+      
Sbjct  155   SKQVSRAPACHTMQLEPIESGKAQVVLSWWDIDMDPAGSIKCTMAPYWVQLASE------  208

Query  1180  SCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLS  1359
                  W DHW QCV+F+P+    +Q  + V+L A H D ++ Y  K Q    E     + 
Sbjct  209   --DIPWRDHWMQCVYFLPHEDPIIQ-GQSVNLTAFHDDYSVWY--KLQKGRAEEGDAAVE  263

Query  1360  AQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
             +  C+    +  +  R     D+N     L+A+   LK  +  +C+   D   L + L H
Sbjct  264   SPVCRCQAHMLWNRPRFGELNDQNRTALYLQALQKVLKPNS--ICLSVSDGSLLPV-LAH  320

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H  A  V +L           +Q +  +N    + IK+++K   +LT  D   +KV +LI
Sbjct  321   HLGAEEVFTL--ETSSVSHSLMQKIFKANHLE-NKIKIIEKNPESLTSSDLGDKKVSVLI  377

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  S S+LPW NL FW
Sbjct  378   GEPFF--STSLLPWHNLYFW  395



>ref|XP_009249136.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Pongo abelii]
Length=664

 Score =   156 bits (395),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 114/376 (30%), Positives = 180/376 (48%), Gaps = 29/376 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IRVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRQFEPWTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ-  1365
               W DHW QCV+F+P     VQ    + L A H D  + Y ++  S     R +++    
Sbjct  308   MQWRDHWMQCVYFLPQEEPVVQGSA-LFLVAHHDDYCVWYSLQRTSPEKNERVHQMRPVC  366

Query  1366  DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARA  1539
             DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH   
Sbjct  367   DCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLGV  423

Query  1540  SNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPF  1719
               V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EPF
Sbjct  424   EQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEPF  480

Query  1720  YYGSDSVLPWQNLRFW  1767
             +  + S+LPW NL FW
Sbjct  481   F--TTSLLPWHNLYFW  494


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDFHQE----IARSSYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_009972231.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Tyto alba]
Length=639

 Score =   156 bits (394),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 113/384 (29%), Positives = 186/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QL ESK +W  + LF 
Sbjct  89    NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLAESKRMWSWNKLFP  148

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  149   VRVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVLTMFSVDF  202

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   L ++  K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  203   -SKPVRSASTYYRLQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKSTSAFQ---  258

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN  L +Q  E V+L A   +  L Y + K + +       +
Sbjct  259   ------WRDHWMQCVYFLPNEELVLQ-GEKVYLTACRDEYALWYKLQKARGEEENKSDVR  311

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  LCI +D S+   +A 
Sbjct  312   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA-  369

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          +++ +A     ++  D IK+++ R   LT      +K+
Sbjct  370   -HYLGAKQVFTLENSAVSCSVMKKFFKA-----NHLEDKIKIIEARPELLTPSHVEDKKI  423

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  424   SVLVGEPFF--TTSLLPWHNLYFW  445



>ref|XP_009249129.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Pongo abelii]
 ref|XP_009249130.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Pongo abelii]
 ref|XP_009249131.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Pongo abelii]
 ref|XP_009249132.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Pongo abelii]
 ref|XP_009249133.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Pongo abelii]
 ref|XP_009249134.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Pongo abelii]
 ref|XP_009249135.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Pongo abelii]
Length=694

 Score =   157 bits (396),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 114/376 (30%), Positives = 180/376 (48%), Gaps = 29/376 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IRVQTSLGEQVIVPPVDLESC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDSSRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHSRQFEPWTSGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---E  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ-  1365
               W DHW QCV+F+P     VQ    + L A H D  + Y ++  S     R +++    
Sbjct  308   MQWRDHWMQCVYFLPQEEPVVQGSA-LFLVAHHDDYCVWYSLQRTSPEKNERVHQMRPVC  366

Query  1366  DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARA  1539
             DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L HH   
Sbjct  367   DCQAHLLWNRPRFGEINDQDRTDRYVQALRTVLKPDS--VCLCVSDGSLLSV-LAHHLGV  423

Query  1540  SNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPF  1719
               V ++         + L+ +  +N    D I +++KR   LT +D   RKV LL+ EPF
Sbjct  424   EQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIEKRPELLTNEDLQGRKVSLLLGEPF  480

Query  1720  YYGSDSVLPWQNLRFW  1767
             +  + S+LPW NL FW
Sbjct  481   F--TTSLLPWHNLYFW  494


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDFHQE----IARSSYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_008832222.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X3 
[Nannospalax galili]
Length=613

 Score =   155 bits (393),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 115/380 (30%), Positives = 183/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  60    NILITELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRATVYAQLVESRRMWSWNKLFP  119

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                K S    ++   ++   C      P  CD       S    +LSE   +F  DF K+
Sbjct  120   VHVKTSLGEQVIVPPLELEKC---PGAPSVCDIQLNQVSSADFSVLSEVLPMFSVDFSKQ  176

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +  P W    SD K+  
Sbjct  177   VSSSAACHSRQFEPL----ASGQAQVVLSWWDIEMDPEGKIRCTMAPFWAQ--SDPKE--  228

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P    +V +     L A H D  + Y +++ S +   R +++
Sbjct  229   ----LQWRDHWMQCVYFLPQ-EETVVRGSACCLVAHHDDYCVWYSLQSTSPDENGRVHQM  283

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++      +A+   +   +  +C+   D   L++ L H
Sbjct  284   RPVCDCQAHLLWNRPRFGEINDQDRTDQYAQALRTVMTPGS--ICLCVSDGSLLSV-LAH  340

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H  A  V ++           L     + ++  D I ++KKR   LT  D   +KV LL+
Sbjct  341   HLGAEQVFTI---ESSAASHKLMKRIFNANHLEDKINIIKKRPELLTSADLEGKKVSLLV  397

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  398   GEPFF--TTSLLPWHNLYFW  415



>ref|XP_008832229.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X4 
[Nannospalax galili]
Length=559

 Score =   155 bits (392),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 115/380 (30%), Positives = 183/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                K S    ++   ++   C      P  CD       S    +LSE   +F  DF K+
Sbjct  199   VHVKTSLGEQVIVPPLELEKC---PGAPSVCDIQLNQVSSADFSVLSEVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +  P W    SD K+  
Sbjct  256   VSSSAACHSRQFEPL----ASGQAQVVLSWWDIEMDPEGKIRCTMAPFWAQ--SDPKELQ  309

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P    +V +     L A H D  + Y +++ S +   R +++
Sbjct  310   ------WRDHWMQCVYFLPQ-EETVVRGSACCLVAHHDDYCVWYSLQSTSPDENGRVHQM  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++      +A+   +   +  +C+   D   L++ L H
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDQDRTDQYAQALRTVMTPGS--ICLCVSDGSLLSV-LAH  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H  A  V ++           L     + ++  D I ++KKR   LT  D   +KV LL+
Sbjct  420   HLGAEQVFTI---ESSAASHKLMKRIFNANHLEDKINIIKKRPELLTSADLEGKKVSLLV  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  477   GEPFF--TTSLLPWHNLYFW  494


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 66/137 (48%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM +   K+
Sbjct  58   RVKDRGHKALVLDIGTGTGLLSMMALTA-----------GADFCYAIEVFKPMAEAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_010174684.1| PREDICTED: protein arginine N-methyltransferase 7 [Caprimulgus 
carolinensis]
Length=689

 Score =   156 bits (395),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 114/384 (30%), Positives = 188/384 (49%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                KA D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVKAEDGEKMIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
              K P  S  T   + ++  K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  253   GK-PVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E ++L A   + +L Y + K + +       +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKLYLTACRDEYSLWYNLQKARGEEENKADVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  LCI +D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMRVLKTDSVCLCI-SDGSLLPMLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     ++  D IK+++ R  +LT      +K+
Sbjct  420   -HYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLEDKIKIIEARPESLTSPHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EWV  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGEMEWVEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>gb|KFZ51183.1| Protein arginine N-methyltransferase 7, partial [Caprimulgus 
carolinensis]
Length=687

 Score =   156 bits (395),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 114/384 (30%), Positives = 188/384 (49%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                KA D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVKAEDGEKMIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
              K P  S  T   + ++  K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  253   GK-PVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E ++L A   + +L Y + K + +       +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKLYLTACRDEYSLWYNLQKARGEEENKADVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  LCI +D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMRVLKTDSVCLCI-SDGSLLPMLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     ++  D IK+++ R  +LT      +K+
Sbjct  420   -HYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLEDKIKIIEARPESLTSPHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EWV  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGEMEWVEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_002711658.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Oryctolagus cuniculus]
Length=692

 Score =   156 bits (395),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 118/381 (31%), Positives = 180/381 (47%), Gaps = 39/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  H LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRATVYAQLVESRRMWSWHKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                  S    ++    +   C      P  CD            +LS    +F  DF K+
Sbjct  199   IRVHTSLGEQVIVPPAELERC---PGAPSVCDIQLNQVSPADFTVLSRVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +  P W H      DP 
Sbjct  256   VSSSAACHSRQFEPL----ASGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQY  1350
                   W DHW QCV+F+P     V +   + L A H D  + Y ++  S  +N  V Q 
Sbjct  307   ---GLQWRDHWMQCVYFLPQ-EEPVTQGSALCLVAHHDDYCVWYSLQRTSPEKNGRVPQM  362

Query  1351  KLSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
             +    DCQ  L  +  R     D N     ++A+   L   +  +C+   D   L++ L 
Sbjct  363   R-PVCDCQAHLLWTRPRFGEINDANRTEQYVQALGTVLTPDS--ICLCVSDGSLLSV-LA  418

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             HH  A  V ++         + ++ +  +N    D I +++KR   LT +D   RKV LL
Sbjct  419   HHLGAQQVFTIESSA--ASHKLMKKIFKANHLE-DKINIIEKRPEMLTSEDLQGRKVSLL  475

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  + S+LPW NL FW
Sbjct  476   VGEPFF--TTSLLPWHNLYFW  494


 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAVEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I+IINK S
Sbjct  107  VEKNGFSDKIKIINKHS  123



>ref|XP_004273243.1| PREDICTED: protein arginine N-methyltransferase 7 isoform 2 [Orcinus 
orca]
Length=645

 Score =   156 bits (394),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 114/373 (31%), Positives = 178/373 (48%), Gaps = 23/373 (6%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ ++ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  89    NILITELFDTELIGEGALPSYEHAHRHLVQKNCEAVPHRATIYAQLVESRRMWSWNKLFP  148

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQ-FPMHCDAISE-GIKLLSEPFKIFDFDFWKRPDS  1020
                + S    ++   ++   C      + +  + +S     +LS    +F  DF K+  S
Sbjct  149   IRVQTSLGEQVIVPPLELERCPGAPSVYDIQLNQVSPTDFTVLSNVLPMFSVDFSKQVSS  208

Query  1021  SRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAW  1197
             S  +     +    G A  ++SWW +++D EG +  +T P W H      DP       W
Sbjct  209   STASHSRQFEPLASGQAQVVLSWWDIEMDPEGKIKCTTAPFWAH-----SDPE---ELQW  260

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ-DCQ  1374
              DHW QCV+F+P     VQ      L A H D  + Y ++  S   + R +      DCQ
Sbjct  261   RDHWMQCVYFLPEEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPEKDGRAHPARPVCDCQ  319

Query  1375  --LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNV  1548
               L  +  R     D+N     ++A+   LK  +  LCI   D   L+I L HH  A  V
Sbjct  320   AHLLWNRPRFGEINDQNRTDQYIQALRTVLKPDSVCLCI--SDGSLLSI-LAHHLGAEQV  376

Query  1549  ISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYG  1728
              ++           L       ++  D I +++KR   LT  D   +KV LL+ EPF+  
Sbjct  377   FTI---ENSAASHRLMKKIFKANHLEDKINIIEKRPELLTPADLEGKKVSLLLGEPFF--  431

Query  1729  SDSVLPWQNLRFW  1767
             + S+LPW NL FW
Sbjct  432   TTSLLPWHNLYFW  444



>ref|XP_009972230.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Tyto alba]
Length=689

 Score =   156 bits (395),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 113/384 (29%), Positives = 186/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QL ESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLAESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VRVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVLTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   L ++  K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRLQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN  L +Q  E V+L A   +  L Y + K + +       +
Sbjct  309   ------WRDHWMQCVYFLPNEELVLQ-GEKVYLTACRDEYALWYKLQKARGEEENKSDVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  LCI +D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          +++ +A     ++  D IK+++ R   LT      +K+
Sbjct  420   -HYLGAKQVFTLENSAVSCSVMKKFFKA-----NHLEDKIKIIEARPELLTPSHVEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 62/137 (45%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            R F  + +P TG  EW+  +E     Q     +A + Y DML+D  RN  + + I   V 
Sbjct  2    RTFCGRANPTTGAMEWLEEDEDYDYHQE----IARSRYADMLHDKDRNTKYYQGIRAAVN  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_008832215.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Nannospalax galili]
Length=643

 Score =   155 bits (392),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 115/380 (30%), Positives = 183/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                K S    ++   ++   C      P  CD       S    +LSE   +F  DF K+
Sbjct  199   VHVKTSLGEQVIVPPLELEKC---PGAPSVCDIQLNQVSSADFSVLSEVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +  P W    SD K+  
Sbjct  256   VSSSAACHSRQFEPL----ASGQAQVVLSWWDIEMDPEGKIRCTMAPFWAQ--SDPKE--  307

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P    +V +     L A H D  + Y +++ S +   R +++
Sbjct  308   ----LQWRDHWMQCVYFLPQ-EETVVRGSACCLVAHHDDYCVWYSLQSTSPDENGRVHQM  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++      +A+   +   +  +C+   D   L++ L H
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDQDRTDQYAQALRTVMTPGS--ICLCVSDGSLLSV-LAH  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H  A  V ++           L     + ++  D I ++KKR   LT  D   +KV LL+
Sbjct  420   HLGAEQVFTI---ESSAASHKLMKRIFNANHLEDKINIIKKRPELLTSADLEGKKVSLLV  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  477   GEPFF--TTSLLPWHNLYFW  494


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 66/137 (48%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM +   K+
Sbjct  58   RVKDRGHKALVLDIGTGTGLLSMMALTA-----------GADFCYAIEVFKPMAEAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_010205492.1| PREDICTED: protein arginine N-methyltransferase 7, partial [Colius 
striatus]
Length=657

 Score =   155 bits (393),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 115/384 (30%), Positives = 186/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  107   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  166

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                KA D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  167   VHVKAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  220

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  221   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKSTSAFQ---  276

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN   SV + E V L A   + +L Y + K + +       +
Sbjct  277   ------WRDHWMQCVYFLPN-EESVLQGEKVDLTACRDEYSLWYKLQKARGEEESKADVR  329

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  LCI +D S+   +A 
Sbjct  330   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA-  387

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     +   D IK+++ R   LT      +K+
Sbjct  388   -HYLGAKQVFTLENSSVSCSVMEKFFRA-----NKLEDKIKIIEARPELLTPSHLEDKKI  441

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  442   SVLVGEPFF--TTSLLPWHNLYFW  463


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 46/100 (46%), Gaps = 17/100 (17%)
 Frame = +2

Query  251  YLDMLNDSPRNRAFREAIDKTVTK------PCHVLDIGAGTGLLSMMAARAMGPADSASN  412
            Y DML+D  RN  + + I   V +         VLDIG GTGLLSMMAA A         
Sbjct  3    YADMLHDKDRNTKYYQGIRAAVCRVKERGEKAIVLDIGTGTGLLSMMAASA---------  53

Query  413  SDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRS  532
                    A E + PM     K++  NG    I++INK S
Sbjct  54   --GADFCYAIEVFKPMANAAVKIVEKNGFHDKIKVINKHS  91



>ref|XP_004273242.1| PREDICTED: protein arginine N-methyltransferase 7 isoform 1 [Orcinus 
orca]
Length=695

 Score =   156 bits (394),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 114/373 (31%), Positives = 178/373 (48%), Gaps = 23/373 (6%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ ++ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQKNCEAVPHRATIYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQ-FPMHCDAISE-GIKLLSEPFKIFDFDFWKRPDS  1020
                + S    ++   ++   C      + +  + +S     +LS    +F  DF K+  S
Sbjct  199   IRVQTSLGEQVIVPPLELERCPGAPSVYDIQLNQVSPTDFTVLSNVLPMFSVDFSKQVSS  258

Query  1021  SRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAW  1197
             S  +     +    G A  ++SWW +++D EG +  +T P W H      DP       W
Sbjct  259   STASHSRQFEPLASGQAQVVLSWWDIEMDPEGKIKCTTAPFWAH-----SDPE---ELQW  310

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ-DCQ  1374
              DHW QCV+F+P     VQ      L A H D  + Y ++  S   + R +      DCQ
Sbjct  311   RDHWMQCVYFLPEEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPEKDGRAHPARPVCDCQ  369

Query  1375  --LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNV  1548
               L  +  R     D+N     ++A+   LK  +  LCI   D   L+I L HH  A  V
Sbjct  370   AHLLWNRPRFGEINDQNRTDQYIQALRTVLKPDSVCLCI--SDGSLLSI-LAHHLGAEQV  426

Query  1549  ISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYG  1728
              ++           L       ++  D I +++KR   LT  D   +KV LL+ EPF+  
Sbjct  427   FTI---ENSAASHRLMKKIFKANHLEDKINIIEKRPELLTPADLEGKKVSLLLGEPFF--  481

Query  1729  SDSVLPWQNLRFW  1767
             + S+LPW NL FW
Sbjct  482   TTSLLPWHNLYFW  494


 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDKGQTALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I+IINK S
Sbjct  107  VEKNGFSDKIKIINKHS  123



>ref|XP_003223006.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Anolis carolinensis]
Length=688

 Score =   155 bits (393),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 112/380 (29%), Positives = 183/380 (48%), Gaps = 38/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRCLVQEGCEAVPHRATVYAQLVESKRMWSWNKLFP  198

Query  847   ---NEEKASDTIHLVPK-----GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                  E     I   P+     G  ++  ++  Q P+  D ++     LSE   +F  DF
Sbjct  199   IHVQAEGGKKVIVSPPEMENCPGAPSVYDIQLNQVPL-SDFVA-----LSEVVTMFSVDF  252

Query  1003  WKRPDSSRETELL-IKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSL  1179
              K+   +     + ++  + G A  ++SWW + +D  G++  +  P W+   S+      
Sbjct  253   SKQVSRAPACHTMQLEPIESGKAQVVLSWWDIDMDPAGSIKCTMAPYWVQLASE------  306

Query  1180  SCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLS  1359
                  W DHW QCV+F+P+    +Q  + V+L A H D ++ Y  K Q    E     + 
Sbjct  307   --DIPWRDHWMQCVYFLPHEDPIIQ-GQSVNLTAFHDDYSVWY--KLQKGRAEEGDAAVE  361

Query  1360  AQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
             +  C+    +  +  R     D+N     L+A+   LK  +  +C+   D   L + L H
Sbjct  362   SPVCRCQAHMLWNRPRFGELNDQNRTALYLQALQKVLKPNS--ICLSVSDGSLLPV-LAH  418

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H  A  V +L           +Q +  +N    + IK+++K   +LT  D   +KV +LI
Sbjct  419   HLGAEEVFTL--ETSSVSHSLMQKIFKANHLE-NKIKIIEKNPESLTSSDLGDKKVSVLI  475

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  S S+LPW NL FW
Sbjct  476   GEPFF--STSLLPWHNLYFW  493


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 63/137 (46%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG  EW+   E     Q     +A + Y DMLND  RN  + + I   V 
Sbjct  2    KVFCGRANPTTGAVEWMEEGEDYDYHQE----IARSCYADMLNDKDRNEKYYQGIRSAVR  57

Query  320  KPCH------VLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM +  RK+
Sbjct  58   RVKERGQRAIVLDIGTGTGLLSMMAVTA-----------GADFCYAVEVFKPMAETARKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I+IINK S
Sbjct  107  VEKNGFSNKIKIINKHS  123



>gb|KGL86637.1| Protein arginine N-methyltransferase 7, partial [Charadrius vociferus]
Length=688

 Score =   155 bits (393),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 113/383 (30%), Positives = 186/383 (49%), Gaps = 42/383 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SRDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y ++ +++  E  +  +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSVWYTLQ-KARGEEENKAAI  360

Query  1357  SAQD----CQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIA  1518
             S +     CQ  L  +  R     D+N     +K++   LK  +  LCI +D S+   +A
Sbjct  361   SVESPVCRCQAHLLWNRPRFGQLNDQNRTSQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA  419

Query  1519  LGHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVD  1698
               H+  A  V   F  L      +    A   ++  D IK+++ R   LT      +K+ 
Sbjct  420   --HYLGAKQVQCFFLSLVYYFFFFKFFKA---NHLEDKIKIIEARPELLTSSHLEDKKIS  474

Query  1699  LLIAEPFYYGSDSVLPWQNLRFW  1767
             +L+ EPF+  + S+LPW NL FW
Sbjct  475   VLVGEPFF--TTSLLPWHNLYFW  495


 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_008832205.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Nannospalax galili]
Length=692

 Score =   155 bits (393),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 115/380 (30%), Positives = 183/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                K S    ++   ++   C      P  CD       S    +LSE   +F  DF K+
Sbjct  199   VHVKTSLGEQVIVPPLELEKC---PGAPSVCDIQLNQVSSADFSVLSEVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +  P W    SD K+  
Sbjct  256   VSSSAACHSRQFEPL----ASGQAQVVLSWWDIEMDPEGKIRCTMAPFWAQ--SDPKELQ  309

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P    +V +     L A H D  + Y +++ S +   R +++
Sbjct  310   ------WRDHWMQCVYFLPQ-EETVVRGSACCLVAHHDDYCVWYSLQSTSPDENGRVHQM  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D++      +A+   +   +  +C+   D   L++ L H
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDQDRTDQYAQALRTVMTPGS--ICLCVSDGSLLSV-LAH  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H  A  V ++           L     + ++  D I ++KKR   LT  D   +KV LL+
Sbjct  420   HLGAEQVFTI---ESSAASHKLMKRIFNANHLEDKINIIKKRPELLTSADLEGKKVSLLV  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  477   GEPFF--TTSLLPWHNLYFW  494


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 66/137 (48%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM +   K+
Sbjct  58   RVKDRGHKALVLDIGTGTGLLSMMALTA-----------GADFCYAIEVFKPMAEAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_010017137.1| PREDICTED: protein arginine N-methyltransferase 7 [Nestor notabilis]
Length=696

 Score =   155 bits (392),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 110/383 (29%), Positives = 183/383 (48%), Gaps = 43/383 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWAWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTVLSDVITMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKPTSSFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN    V + E ++L A   + +L Y ++   +       ++
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKLYLTASRDEYSLWYKLQKAREEENKADVRV  361

Query  1357  SAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
              +  C+    L  +  R     DKN     +K++   L  KA  +C+   D   L + L 
Sbjct  362   ESPVCRCQAHLLWNRPRFGQLNDKNRTHQYVKSLMKVL--KADSVCLCVSDGSLLPV-LA  418

Query  1525  HHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVD  1698
             H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K+ 
Sbjct  419   HYLGAKQVFTLENSAVSSSVMEKFFKA-----NHLEDKIKIIEARPELLTSSHLEDKKIS  473

Query  1699  LLIAEPFYYGSDSVLPWQNLRFW  1767
             +L+ EPF+  + S+LPW NL FW
Sbjct  474   VLVGEPFF--TTSLLPWHNLYFW  494


 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNEKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFCDKIKVINKHS  123



>ref|XP_007113368.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Physeter catodon]
 ref|XP_007113369.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X3 
[Physeter catodon]
Length=695

 Score =   155 bits (392),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 111/373 (30%), Positives = 178/373 (48%), Gaps = 23/373 (6%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQ-FPMHCDAISE-GIKLLSEPFKIFDFDFWKRPDS  1020
                + S    ++   ++   C      + +  + +S     +LS+   +F  DF K+  S
Sbjct  199   VRVQTSLGEQVIVPPLELERCPGAPSVYDIQLNQVSPTDFTVLSDVLPMFSVDFSKQVSS  258

Query  1021  SRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAW  1197
             S  +     +    G A  ++SWW +++D EG +  +  P W H      DP       W
Sbjct  259   STASHSRQFEPLASGQAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---ELQW  310

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ-DCQ  1374
              DHW QCV+F+P     VQ      L A H D  + Y ++  S   + R +      DCQ
Sbjct  311   RDHWMQCVYFLPEEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPEKDGRAHPARPVCDCQ  369

Query  1375  --LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNV  1548
               L  +  R     D+N     ++A+   LK  +  +C+   D   L+I L HH  A  V
Sbjct  370   AHLLWNRPRFGEINDQNRTDQYVQALRTVLKPDS--VCLCVSDGSLLSI-LAHHLGAEQV  426

Query  1549  ISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYG  1728
              ++           L       ++  D I +++KR   LT  D   +KV LL+ EPF+  
Sbjct  427   FTI---ENSAASHRLMKKIFKANHLEDKINIIEKRPELLTPADLEGKKVSLLLGEPFF--  481

Query  1729  SDSVLPWQNLRFW  1767
             + S+LPW NL FW
Sbjct  482   TTSLLPWHNLYFW  494


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDKGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I+IINK S
Sbjct  107  VEKNGFSDKIKIINKHS  123



>ref|XP_003758489.1| PREDICTED: protein arginine N-methyltransferase 7 [Sarcophilus 
harrisii]
Length=689

 Score =   155 bits (391),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 112/380 (29%), Positives = 184/380 (48%), Gaps = 36/380 (9%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH NL+ E+ E VP++ T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHKNLVEENCEAVPHKATVYAQLVESRRMWSWNKLFP  198

Query  847   --NEEKASDTIHLVPKGMD------TIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                + + +  + + P  M+      ++  ++  Q P+          +LS+   +F  DF
Sbjct  199   LLVQTETAQKLIVAPAEMESCPGAPSVYDIQLNQMPL------SDFTVLSDVLTMFSVDF  252

Query  1003  WKRPDSSRETELL-IKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSL  1179
              K+ +SS     +  +  + G A  ++SWW + +D +G +  S  P W+H  SD K+   
Sbjct  253   SKQVNSSPTHHTMQFEPRESGRAQVVLSWWDIDMDPDGKIKCSMAPYWVH--SDPKNIQ-  309

Query  1180  SCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTD----INLSYVVKTQSQNMEVRQ  1347
                  W DHW QCV+F+PN    VQ  E ++L A   D     NL      +S+N    +
Sbjct  310   -----WRDHWMQCVYFLPNEEPVVQ-GESLYLTAHRDDYCVWYNLHKTRNEKSKNNFHEE  363

Query  1348  YKLSAQDCQLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
               +      L  +  R     D       ++A+   L  KA  +C+   D   L I L H
Sbjct  364   RPVCECQAHLLWNRPRFGELNDHKRTEQYIQALKKVL--KADSICLCISDGSLLPI-LAH  420

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
                A  V +L         + ++ +  +N    D I +++KR   LT  D   RK+ +L+
Sbjct  421   CVGAEQVFTLENSA--VSHRLMKKIFKANGLE-DTITIIEKRPELLTSADLGDRKISVLL  477

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  478   GEPFF--TTSLLPWHNLYFW  495


 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V 
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRAAVK  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +      P  VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKERGQPAIVLDIGTGTGLLSMMAVSA-----------GADFCYAVEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I+IINK S
Sbjct  107  VEKNGFSDKIKIINKHS  123



>ref|XP_010053472.1| PREDICTED: protein arginine N-methyltransferase 7-like [Eucalyptus 
grandis]
Length=122

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 0/97 (0%)
 Frame = +1

Query  676  VSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFNNEE  855
            VSEILDSELLGEGLIPTLQHAHD L +E+P TVPY+  ++GQLVES  LWK+HDL+NNE 
Sbjct  3    VSEILDSELLGEGLIPTLQHAHDMLFLENPVTVPYKAIVYGQLVESTYLWKLHDLYNNEA  62

Query  856  KASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKL  966
            +  D IHLVP G++ II VK QQ PMHCDAI   IKL
Sbjct  63   EILDGIHLVPAGLERIIGVKLQQHPMHCDAIRREIKL  99



>ref|XP_009467501.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Nipponia nippon]
Length=639

 Score =   154 bits (389),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 111/384 (29%), Positives = 185/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  89    NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  148

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  149   VHVEAEDGEKVIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  202

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  203   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKSTSAFQ---  258

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E V+L A   + +L Y + K + +       +
Sbjct  259   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSLWYKLQKARGEEENKADVR  311

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  +C+   D   L + L
Sbjct  312   VESPVCRCQAHLLWNRPRFGELNDRNRTRQYIKSLMKVLKTDS--VCLSISDGSLLPV-L  368

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K+
Sbjct  369   AHYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLEDKIKIIEARPELLTSSHLEDKKI  423

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  424   SVLVGEPFF--TTSLLPWHNLYFW  445



>ref|XP_004313874.1| PREDICTED: protein arginine N-methyltransferase 7, partial [Tursiops 
truncatus]
Length=602

 Score =   154 bits (388),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 114/374 (30%), Positives = 180/374 (48%), Gaps = 24/374 (6%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ ++ E VP+R T++ QLVES+ +W  + LF 
Sbjct  45    NILITELFDTELIGEGALPSYEHAHRHLVQKNCEAVPHRATVYAQLVESRRMWSWNKLFP  104

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQ-FPMHCDAISE-GIKLLSEPFKIFDFDFWKRPDS  1020
                + S    ++   ++   C      + +  + +S     +LS    +F  DF K+  S
Sbjct  105   IRVQTSLGEQVIVPPLELERCPGAPSVYDIQLNQVSPTDFTVLSNVLPMFSVDFSKQVSS  164

Query  1021  SRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAW  1197
             S  +     +    G A  ++SWW +++D EG +  +T P W H      DP       W
Sbjct  165   STASHSRQFEPLASGQAQVVLSWWDIEMDPEGKIKCTTAPFWAH-----SDPE---ELQW  216

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYKLSAQ-DC  1371
              DHW QCV+F+P     VQ      L A H D  + Y + +T+S   + R +      DC
Sbjct  217   RDHWMQCVYFLPEEEPVVQGSALC-LVAHHDDYCVWYSLQRTRSPKKDGRAHPARPVCDC  275

Query  1372  Q--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASN  1545
             Q  L  +  R     D+N     ++A+   LK  +  LCI   D   L+I L HH  A  
Sbjct  276   QAHLLWNRPRFGEINDQNRTDQYVQALRTVLKPDSVCLCI--SDGSLLSI-LAHHLGAEQ  332

Query  1546  VISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYY  1725
             V ++           L       ++  D I +++KR   LT  D   +KV LL+ EPF+ 
Sbjct  333   VFTI---ENSAASHRLMKKIFKANHLEDKINIIEKRPELLTPADLEGKKVSLLLGEPFF-  388

Query  1726  GSDSVLPWQNLRFW  1767
              + S+LPW NL FW
Sbjct  389   -TTSLLPWHNLYFW  401



>ref|XP_009641538.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Egretta garzetta]
Length=639

 Score =   154 bits (388),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 111/384 (29%), Positives = 188/384 (49%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  89    NILVTELFDTELIGEGALPTYEHAHRYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  148

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  149   VHVEAEDGEKIIVSPSEVEDCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  202

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  203   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSSSAFQ---  258

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y + K + +  +    +
Sbjct  259   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSVWYKLQKARGEEEDKADVR  311

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  LCI +D S+   +A 
Sbjct  312   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA-  369

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L      +   E++ +A     ++  D IK+++ R   LT      +K+
Sbjct  370   -HYLGAKQVFTLENSAVSRSVMEKFFKA-----NHLEDKIKIIEARPELLTSSHLGDKKI  423

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  424   SVLVGEPFF--TTSLLPWHNLYFW  445



>gb|KFQ53514.1| Protein arginine N-methyltransferase 7, partial [Nestor notabilis]
Length=687

 Score =   154 bits (390),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 111/381 (29%), Positives = 182/381 (48%), Gaps = 45/381 (12%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWAWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTVLSDVITMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKPTSSFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN    V + E ++L A   + +L Y ++   +       ++
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKLYLTASRDEYSLWYKLQKAREEENKADVRV  361

Query  1357  SAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
              +  C+    L  +  R     DKN     +K++   L  KA  +C+   D   L + L 
Sbjct  362   ESPVCRCQAHLLWNRPRFGQLNDKNRTHQYVKSLMKVL--KADSVCLCVSDGSLLPV-LA  418

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             H+  A  V  L   L     Q+ +A     ++  D IK+++ R   LT      +K+ +L
Sbjct  419   HYLGAKQVQYLLMLLL----QFFKA-----NHLEDKIKIIEARPELLTSSHLEDKKISVL  469

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  + S+LPW NL FW
Sbjct  470   VGEPFF--TTSLLPWHNLYFW  488


 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNEKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFCDKIKVINKHS  123



>ref|XP_006010765.1| PREDICTED: protein arginine N-methyltransferase 7 [Latimeria 
chalumnae]
Length=689

 Score =   154 bits (390),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 107/383 (28%), Positives = 185/383 (48%), Gaps = 40/383 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLF-  843
             N  V+E+ D+EL+GEG +P+ +HAH +L+    E +P+R T++ QLVES  +W  + L  
Sbjct  133   NILVTELFDTELIGEGALPSYEHAHKHLVQVGCEAIPHRATMYAQLVESSRMWSWNKLLP  192

Query  844   ---NNEEKASDTIHLVP------KGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDF  996
                 ++  + +T+ + P       G  ++  ++  Q P +        K LS    +F  
Sbjct  193   VHIQSDTGSRETVIVPPPDIETCAGAPSVYDIQLNQVPQN------DFKCLSNILTLFSM  246

Query  997   DFWKRPDSSRETELLIK--ATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKD  1170
             DF  RP SS     +++  A   GTA  ++SWW + +D +G +  +  P W   P+    
Sbjct  247   DF-SRPVSSAPVSHVVRFPALSSGTAQVVLSWWDIDMDPQGNIKCTMAPYWAR-PTPKNI  304

Query  1171  PSLSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKT----QSQNME  1338
             P       W DHW QCV+F+P   + + + E V L A H D  + + ++     Q +   
Sbjct  305   P-------WRDHWMQCVYFLPK-AVPLTEGESVRLTAHHDDYCMWFSLQANRGVQCEGDA  356

Query  1339  VRQYKLSAQDCQLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIA  1518
               +  L      L  +  R     D +   + ++A+   LK  +  +C+   D   L + 
Sbjct  357   SVERPLCTCQAHLLWNRPRFGELNDGHRTNNYVQALREVLKPDS--VCLSVSDGSLLPL-  413

Query  1519  LGHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVD  1698
             L HH  A  V +L   +    ++ ++ +  +N    + +KVL++R   L  +D  +R+V 
Sbjct  414   LAHHLGAQQVFTL--EISGMSKRLMEGILVANQL-FEKVKVLERRPEQLMSEDLENRQVS  470

Query  1699  LLIAEPFYYGSDSVLPWQNLRFW  1767
             +LI EPF+  + S+LPW NL FW
Sbjct  471   VLIGEPFF--TTSLLPWHNLYFW  491


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 46/88 (52%), Gaps = 10/88 (11%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  +WV  +ES    Q     +A +SY DML+D  RN  +   I   V 
Sbjct  2    KTFCGRANPTTGAMDWVEEDESYDYHQE----IARSSYADMLHDKDRNEKYYCGICAAVR  57

Query  320  K------PCHVLDIGAGTGLLSMMAARA  385
            +         VLDIG GTGLLSMMA +A
Sbjct  58   RVKERGQKAVVLDIGTGTGLLSMMAVKA  85



>ref|XP_009641537.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Egretta garzetta]
Length=689

 Score =   154 bits (389),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 111/384 (29%), Positives = 188/384 (49%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHRYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEVEDCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSSSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y + K + +  +    +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSVWYKLQKARGEEEDKADVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  LCI +D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L      +   E++ +A     ++  D IK+++ R   LT      +K+
Sbjct  420   -HYLGAKQVFTLENSAVSRSVMEKFFKA-----NHLEDKIKIIEARPELLTSSHLGDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG+ EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGSMEWIEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFCDKIKVINKHS  123



>ref|XP_009195013.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Papio anubis]
Length=673

 Score =   154 bits (388),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 120/400 (30%), Positives = 181/400 (45%), Gaps = 55/400 (14%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  102   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATIYAQLVESRRMWSWNKLFP  161

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  162   IHLQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  218

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  219   VSSSAACHSRQFEPLT----SGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  269

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  270   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPEKNERVHQM  325

Query  1357  SAQ-DCQ--LFLSPERIAIYGDK--------------------NWRCSMLKAINNALKQK  1467
                 DCQ  L  +  R     D+                    NWR    +   +    K
Sbjct  326   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTLTSRNLLANWRKPCAEGARSPQVLK  385

Query  1468  ASPLCIVADDSIFLTIALGHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLK  1647
                +C+   D   L++ L HH     V ++         + L+ +  +N    D I +++
Sbjct  386   PDSVCLCVSDGSLLSV-LAHHLGVEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIE  441

Query  1648  KRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQNLRFW  1767
             KR   LT +D   RKV LL+ EPF+  + S+LPW NL FW
Sbjct  442   KRPELLTSEDLKSRKVSLLLGEPFF--TTSLLPWHNLYFW  479



>ref|XP_009467500.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Nipponia nippon]
Length=689

 Score =   154 bits (389),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 111/384 (29%), Positives = 185/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKVIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E V+L A   + +L Y + K + +       +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSLWYKLQKARGEEENKADVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  +C+   D   L + L
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDRNRTRQYIKSLMKVLKTDS--VCLSISDGSLLPV-L  418

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K+
Sbjct  419   AHYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLEDKIKIIEARPELLTSSHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_010281742.1| PREDICTED: protein arginine N-methyltransferase 7 [Phaethon lepturus]
Length=694

 Score =   154 bits (389),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 110/384 (29%), Positives = 185/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                KA +   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVKAENREKIIASPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQVVLSWWDIDMDPSGMINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+P     V + E V+L A   + ++ Y + K + +       +
Sbjct  309   ------WRDHWMQCVYFLPR-EEPVLQGEKVYLTACRDEYSVWYKLQKARGEEENKADVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N  C  ++++   LK  +  LCI +D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTCQYIQSLMKVLKTDSVCLCI-SDGSLLPVLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     +   D IK+++ R   LT      +K+
Sbjct  420   -HYLGAKQVFTLENSAVSCSVMEKFFKA-----NNLQDKIKIIEARPELLTSSHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_009195012.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Papio anubis]
Length=686

 Score =   154 bits (388),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 120/400 (30%), Positives = 181/400 (45%), Gaps = 55/400 (14%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  102   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATIYAQLVESRRMWSWNKLFP  161

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  162   IHLQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  218

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  219   VSSSAACHSRQFEPLT----SGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  269

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  270   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPEKNERVHQM  325

Query  1357  SAQ-DCQ--LFLSPERIAIYGDK--------------------NWRCSMLKAINNALKQK  1467
                 DCQ  L  +  R     D+                    NWR    +   +    K
Sbjct  326   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTLTSRNLLANWRKPCAEGARSPQVLK  385

Query  1468  ASPLCIVADDSIFLTIALGHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLK  1647
                +C+   D   L++ L HH     V ++         + L+ +  +N    D I +++
Sbjct  386   PDSVCLCVSDGSLLSV-LAHHLGVEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIE  441

Query  1648  KRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQNLRFW  1767
             KR   LT +D   RKV LL+ EPF+  + S+LPW NL FW
Sbjct  442   KRPELLTSEDLKSRKVSLLLGEPFF--TTSLLPWHNLYFW  479



>ref|XP_005608413.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Equus caballus]
Length=608

 Score =   153 bits (386),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 113/373 (30%), Positives = 182/373 (49%), Gaps = 23/373 (6%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRATIYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQ-FPMHCDAIS-EGIKLLSEPFKIFDFDFWKRPDS  1020
                + S    ++    +   C      + +  + +S     +LS    +F  DF K+  S
Sbjct  199   IRVQTSHGEQVIVPPSEVEQCPGAPSVYDIQLNQVSPTDFTVLSNVLPMFSVDFSKQVSS  258

Query  1021  SRETELL-IKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAW  1197
             S    +   +    G A  ++SWW +++D EG +  +  P W H  SD K+        W
Sbjct  259   SAACHIRQFEPLASGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH--SDPKELQ------W  310

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYKLSAQDCQ  1374
              DHW QCV+F+P     +Q    V L A H D  + Y + +T  +  E         DCQ
Sbjct  311   RDHWMQCVYFLPQEEPVIQGSA-VFLVAHHDDYCVWYSLQRTSPEKNESIHPGRPVCDCQ  369

Query  1375  --LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNV  1548
               L  +  R     D++     ++A+   LK  +  LC V+D S+   +A  HH  A  V
Sbjct  370   AHLLWNRPRFGEINDQDRTDQYIQALRTVLKSDSVCLC-VSDGSLLSMLA--HHLGAEQV  426

Query  1549  ISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYG  1728
              ++         + ++ +  +N    D I +++KR   LT  D   +KV LL+ EPF+  
Sbjct  427   FTIESSA--ASHRLMKKIFKANHLE-DKINIIEKRPELLTSADLEGKKVSLLLGEPFF--  481

Query  1729  SDSVLPWQNLRFW  1767
             + S+LPW NL FW
Sbjct  482   TTSLLPWHNLFFW  494


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            R+F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    RIFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIQAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_003209740.1| PREDICTED: protein arginine N-methyltransferase 7 [Meleagris 
gallopavo]
Length=689

 Score =   154 bits (388),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 112/384 (29%), Positives = 189/384 (49%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   IHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTVLSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T  ++ ++  K G A  ++SWW + +D  GT+  +  P W+   S V+   
Sbjct  253   -SKPVRSASTCYKVQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKPTSAVQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV---KTQSQNMEVRQ  1347
                   W DHW QCV+F+P     V + + VHL A   + ++ Y +   + + +N    +
Sbjct  309   ------WRDHWMQCVYFLPK-EEQVLQGQKVHLTACRDEYSVWYTLQKAREEDENKADAR  361

Query  1348  YKLSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
              +     CQ  L  +  R     D+N     +K++ + LK  +  LCI +D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMHVLKTDSVCLCI-SDGSLLPVLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          +++ +A     ++  D IK+++ R   LT      +K+
Sbjct  420   -HYLGAEQVFTLENSTVSCSVMKKFFKA-----NHLEDKIKIVEARPELLTSSHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG+ EWV  +E     Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGSLEWVEEDEDYDYHQE----IARSRYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKGRGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFHDKIKVINKHS  123



>gb|KFP19614.1| Protein arginine N-methyltransferase 7, partial [Egretta garzetta]
Length=688

 Score =   154 bits (388),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 112/382 (29%), Positives = 186/382 (49%), Gaps = 40/382 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHRYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEVEDCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSSSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y + K + +  +    +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSVWYKLQKARGEEEDKADVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  LCI +D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA-  419

Query  1522  GHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDL  1701
              H+  A  V   F  LQ +   Y  +     ++  D IK+++ R   LT      +K+ +
Sbjct  420   -HYLGAKQVQCFF--LQ-RVPLYFPSPFFKANHLEDKIKIIEARPELLTSSHLGDKKISV  475

Query  1702  LIAEPFYYGSDSVLPWQNLRFW  1767
             L+ EPF+  + S+LPW NL FW
Sbjct  476   LVGEPFF--TTSLLPWHNLYFW  495


 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG+ EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGSMEWIEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFCDKIKVINKHS  123



>ref|XP_009571084.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Fulmarus glacialis]
Length=639

 Score =   153 bits (387),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 112/384 (29%), Positives = 185/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  89    NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  148

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  149   IHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQLP------SSDFTILSDVVTMFSVDF  202

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  203   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSTSAFQ---  258

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E VHL A   + ++ Y + K + +       +
Sbjct  259   ------WRDHWMQCVYFLPN-EEPVLQGEKVHLTACRDEYSVWYKLQKARGEEENKADVR  311

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  LCI +D S+   +A 
Sbjct  312   VDSPVCRCHAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA-  369

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     +   D IK+++ R   LT      +K+
Sbjct  370   -HYLGAKQVFTLENSAVSCSVMEKFFKA-----NRLEDKIKIIEARPELLTSSHLEDKKI  423

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  424   SVLVGEPFF--TTSLLPWHNLYFW  445



>ref|XP_008065522.1| PREDICTED: protein arginine N-methyltransferase 7 [Tarsius syrichta]
Length=692

 Score =   154 bits (388),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 119/381 (31%), Positives = 183/381 (48%), Gaps = 39/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRATIYAQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   VHIQTSFGEQVIVPPLDLERC---PGAPSVCDIQLNQMSPADFTILSDVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +  P W      + DP 
Sbjct  256   VSSSAACHSRQFEPL----ASGQAQVVLSWWDIEMDPEGKIKCTMAPFWA-----LSDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQY  1350
                   W DHW QCV+F+P     VQ      L A H D  + Y +   S  +N +V Q 
Sbjct  307   ---GLQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCIWYSLHKTSPEKNEKVCQM  362

Query  1351  KLSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
             +    DCQ  L  +  R     D++     ++A+   LK  +  +C+   D   L++ L 
Sbjct  363   R-PVCDCQAHLLWNRPRFGEINDQDRTDQYIRALRTVLKPDS--ICLCVSDGSLLSV-LA  418

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             HH  A  V ++         + ++ +  +N    D I +++KR   LT  D   +KV LL
Sbjct  419   HHLGAEQVFTIESSA--ASHKLMKKIFKANHLE-DKINIIEKRPELLTDADLEDKKVSLL  475

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  + S+LPW NL FW
Sbjct  476   LGEPFF--TTSLLPWHNLYFW  494


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCSRTNPTTGSMEWLEEDEDYDYHQE----IARSSYADMLHDKDRNIKYYQGIQAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAVEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_005152296.1| PREDICTED: LOW QUALITY PROTEIN: protein arginine N-methyltransferase 
7 [Melopsittacus undulatus]
Length=692

 Score =   153 bits (387),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 114/388 (29%), Positives = 183/388 (47%), Gaps = 49/388 (13%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWAWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SNDFTVLSDVLTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKPTSTFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPN---------IGLSVQKDEYVHLHAVHTDINLSYVVKTQSQ  1329
                   W DHW QCV+F+PN         + L   +DEY   + +  D    Y    +  
Sbjct  309   ------WRDHWMQCVYFLPNEEPVLQGEKLYLIASRDEYSLWYKLQKD-RXQYTSVKKGT  361

Query  1330  NMEVRQYKLSAQDCQLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFL  1509
              + V       Q   L+  P R     DKN     +K++   LK  +  LCI +D S+  
Sbjct  362   EVLVESPVCRCQAHLLWNRP-RFGQLNDKNRTLQYIKSLMKVLKTDSVCLCI-SDGSLLP  419

Query  1510  TIALGHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTH  1683
              +A  H+  A  V +L          E++ +A     ++  D IK+++ R   LT  +  
Sbjct  420   VLA--HYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLDDKIKIIEARPELLTSSNLE  472

Query  1684  HRKVDLLIAEPFYYGSDSVLPWQNLRFW  1767
             ++KV +L+ EPF+  + S+LPW NL FW
Sbjct  473   NKKVSVLVGEPFF--TTSLLPWHNLYFW  498


 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 63/137 (46%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V 
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNEKYYQGIRAAVN  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>gb|KFQ74234.1| Protein arginine N-methyltransferase 7 [Phoenicopterus ruber 
ruber]
Length=604

 Score =   152 bits (384),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 114/382 (30%), Positives = 185/382 (48%), Gaps = 41/382 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VRVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV---KTQSQNMEVRQ  1347
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y +   + + +N    +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSVWYKLQKARGEEENKADAR  361

Query  1348  YKLSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
              +     CQ  L  +  R     D+N     +K++   LK  +  LC V+D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTHQYIKSLMKVLKTDSVCLC-VSDGSLLPVLA-  419

Query  1522  GHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDL  1701
              H+  A  V   F  LQ     + Q   A  ++  D IK+++ R   LT      +K+ +
Sbjct  420   -HYLGAKQVQYFF--LQYATFFFFQFFKA--NHLEDKIKIIEARPELLTSSHLEDKKISV  474

Query  1702  LIAEPFYYGSDSVLPWQNLRFW  1767
             L+ EPF+  + S+LPW NL FW
Sbjct  475   LVGEPFF--TTSLLPWHNLYFW  494


 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNTKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKARGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFRPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_007198238.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X4 
[Balaenoptera acutorostrata scammoni]
Length=695

 Score =   153 bits (387),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 112/373 (30%), Positives = 178/373 (48%), Gaps = 23/373 (6%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQ-FPMHCDAIS-EGIKLLSEPFKIFDFDFWKRPDS  1020
                + S    ++   ++   C      + +  + +S     +LS+   +F  DF K+  S
Sbjct  199   IRVQTSLGEQVIVPPLELERCPGAPSVYDIQLNQVSLTDFTVLSDVLPMFSVDFSKQVSS  258

Query  1021  SRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAW  1197
             S  +     +    G A  ++SWW +++D EG +  +  P W H      DP       W
Sbjct  259   SAASHSRQFEPLASGQAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---ELQW  310

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ-DCQ  1374
              DHW QCV+F+P     VQ      L A H D  + Y ++  S   + R +      DCQ
Sbjct  311   RDHWMQCVYFLPEEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPEKDGRAHPARPVCDCQ  369

Query  1375  --LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNV  1548
               L  +  R     D+N     ++A+   LK     LC V+D S+   +A  HH  A  V
Sbjct  370   AHLLWNRPRFGEINDQNRTDQYVQALKTVLKPDGVCLC-VSDGSLLSMLA--HHLGAEQV  426

Query  1549  ISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYG  1728
              ++           L       ++  D I +++KR   LT  D   +KV LL+ EPF+  
Sbjct  427   FTI---ENSAASHRLMKKIFKANHLEDKINIIEKRPELLTPADLEGKKVSLLLGEPFF--  481

Query  1729  SDSVLPWQNLRFW  1767
             + S+LPW NL FW
Sbjct  482   TTSLLPWHNLYFW  494


 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDKGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEIFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I+IINK S
Sbjct  107  VEKNGFSDKIKIINKHS  123



>gb|KFR01626.1| Protein arginine N-methyltransferase 7, partial [Nipponia nippon]
Length=686

 Score =   153 bits (386),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 112/388 (29%), Positives = 183/388 (47%), Gaps = 54/388 (14%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKVIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E V+L A   + +L Y + K + +       +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSLWYKLQKARGEEENKADVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  +C+   D   L + L
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDRNRTRQYIKSLMKVLKTDS--VCLSISDGSLLPV-L  418

Query  1522  GHHARASNVISLFPGLQDKGEQYLQAVAASN------DYSMDCIKVLKKRSSALTMQDTH  1683
              H+  A  V           + YLQ  A         ++  D IK+++ R   LT     
Sbjct  419   AHYLGAKQV-----------KYYLQYAAFFFFQFFKANHLEDKIKIIEARPELLTSSHLE  467

Query  1684  HRKVDLLIAEPFYYGSDSVLPWQNLRFW  1767
              +K+ +L+ EPF+  + S+LPW NL FW
Sbjct  468   DKKISVLVGEPFF--TTSLLPWHNLYFW  493


 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_007198235.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Balaenoptera acutorostrata scammoni]
Length=729

 Score =   154 bits (388),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 112/373 (30%), Positives = 178/373 (48%), Gaps = 23/373 (6%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R T++ QLVES+ +W  + LF 
Sbjct  173   NILITELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRATVYAQLVESRRMWSWNKLFP  232

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQ-FPMHCDAIS-EGIKLLSEPFKIFDFDFWKRPDS  1020
                + S    ++   ++   C      + +  + +S     +LS+   +F  DF K+  S
Sbjct  233   IRVQTSLGEQVIVPPLELERCPGAPSVYDIQLNQVSLTDFTVLSDVLPMFSVDFSKQVSS  292

Query  1021  SRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAW  1197
             S  +     +    G A  ++SWW +++D EG +  +  P W H      DP       W
Sbjct  293   SAASHSRQFEPLASGQAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---ELQW  344

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ-DCQ  1374
              DHW QCV+F+P     VQ      L A H D  + Y ++  S   + R +      DCQ
Sbjct  345   RDHWMQCVYFLPEEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPEKDGRAHPARPVCDCQ  403

Query  1375  --LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNV  1548
               L  +  R     D+N     ++A+   LK     LC V+D S+   +A  HH  A  V
Sbjct  404   AHLLWNRPRFGEINDQNRTDQYVQALKTVLKPDGVCLC-VSDGSLLSMLA--HHLGAEQV  460

Query  1549  ISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYG  1728
              ++           L       ++  D I +++KR   LT  D   +KV LL+ EPF+  
Sbjct  461   FTI---ENSAASHRLMKKIFKANHLEDKINIIEKRPELLTPADLEGKKVSLLLGEPFF--  515

Query  1729  SDSVLPWQNLRFW  1767
             + S+LPW NL FW
Sbjct  516   TTSLLPWHNLYFW  528


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  36   KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  91

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  92   RVKDKGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEIFKPMADAAVKI  140

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I+IINK S
Sbjct  141  VEKNGFSDKIKIINKHS  157



>ref|XP_009571083.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Fulmarus glacialis]
Length=689

 Score =   153 bits (386),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 112/384 (29%), Positives = 185/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   IHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQLP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E VHL A   + ++ Y + K + +       +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVHLTACRDEYSVWYKLQKARGEEENKADVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  LCI +D S+   +A 
Sbjct  362   VDSPVCRCHAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     +   D IK+++ R   LT      +K+
Sbjct  420   -HYLGAKQVFTLENSAVSCSVMEKFFKA-----NRLEDKIKIIEARPELLTSSHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_005444644.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Falco cherrug]
Length=639

 Score =   152 bits (385),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 111/384 (29%), Positives = 186/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVES  +W  + LF 
Sbjct  89    NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYAQLVESTRMWSWNKLFP  148

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P+          +LS+   +F  DF
Sbjct  149   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMPL------SDFTILSDVVTMFSVDF  202

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  203   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKSTSAFQ---  258

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV---KTQSQNMEVRQ  1347
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y++   + +  N    +
Sbjct  259   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTASRDEYSVWYMLQKARGEEDNKADDR  311

Query  1348  YKLSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
              +     CQ  L  +  R     D+N     +K++   LK  +  LC V+D S+   +A 
Sbjct  312   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKSDSVCLC-VSDGSLLPMLA-  369

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K+
Sbjct  370   -HYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLEDKIKIIEARPELLTSAHLEDKKI  423

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  424   SVLVGEPFF--TTSLLPWHNLYFW  445



>ref|XP_007902874.1| PREDICTED: protein arginine N-methyltransferase 7 [Callorhinchus 
milii]
Length=675

 Score =   153 bits (386),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 114/378 (30%), Positives = 186/378 (49%), Gaps = 32/378 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH  L+ E  E VP+R T++ QLVESK +W  + L  
Sbjct  125   NILVTELFDTELIGEGALPSYEHAHRYLVQEGCEAVPHRATVYAQLVESKQMWAWNKLLP  184

Query  847   NEEK--ASDTIHLVPKGMDTIICVKHQQ-FPMHCDAISEG-IKLLSEPFKIFDFDFWKRP  1014
                +    D   +VP   D   C      + +    +S    K L+   ++F  +F K  
Sbjct  185   VPVRLGCGDVREVVPPP-DMQACAGCPTVYDIQLSQVSRSHFKALTHVTEMFRVEFSKAV  243

Query  1015  DS-SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIH-CPSDVKDPSLSCS  1188
              S S +  + + AT  G A  ++SWW + +D EG++  +  P W H  P +++       
Sbjct  244   SSASAQHTVQVPATASGQAQVVLSWWDMDMDPEGSIKCTMAPHWAHPSPDNIQ-------  296

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVR---QYKLS  1359
               W DHW QCV+F+     +VQK + +HL A H D  + Y ++  S   E     Q    
Sbjct  297   --WRDHWMQCVYFLATES-TVQKGDRLHLTATHDDYCVWYKLQDSSDKQETEGWAQQPYC  353

Query  1360  AQDCQLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIF--LTIALGHHA  1533
             +    L  + +R     D+    + ++A+   +K  +  L I +D S+    T  LG   
Sbjct  354   SCQAHLMCNRQRFGQLNDQMRNEAYIEALKTVVKPHSVCLSI-SDGSLLSVFTCLLG---  409

Query  1534  RASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAE  1713
              A+ V SL      K  Q ++ + A+N  +   + + +KR   LT +D  +++V +LI E
Sbjct  410   -AAQVFSLESSALSK--QVMEKILAANRLAGK-VTISEKRPEQLTSKDLANQQVSVLIGE  465

Query  1714  PFYYGSDSVLPWQNLRFW  1767
             PF+  + S+LPW NL FW
Sbjct  466   PFF--TTSLLPWHNLYFW  481


 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 52/105 (50%), Gaps = 17/105 (16%)
 Frame = +2

Query  236  LATTSYLDMLNDSPRNRAFREAIDKTVTK------PCHVLDIGAGTGLLSMMAARAMGPA  397
            +A +SY DML+D+ RN  +   I   V +         VLDIG GTGLLSMMA  A    
Sbjct  16   IARSSYADMLHDTDRNEKYYSGIRAAVRRVKDRGQEAIVLDIGTGTGLLSMMAMSA----  71

Query  398  DSASNSDSKGMVTACESYLPMVKLMRKVLRANGIERGIRIINKRS  532
                         A E + PM  + RK++  NG  + I+IINK S
Sbjct  72   -------GADYCYAIEVFKPMADVARKIVEKNGFAKKIKIINKHS  109



>ref|XP_008516459.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Equus przewalskii]
 ref|XP_008516460.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Equus przewalskii]
Length=695

 Score =   153 bits (386),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 113/373 (30%), Positives = 182/373 (49%), Gaps = 23/373 (6%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRATIYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQ-FPMHCDAIS-EGIKLLSEPFKIFDFDFWKRPDS  1020
                + S    ++    +   C      + +  + +S     +LS    +F  DF K+  S
Sbjct  199   IRVQTSHGEQVIVPPSEVEQCPGAPSVYDIQLNQVSPTDFTVLSNVLPMFSVDFSKQVSS  258

Query  1021  SRETELL-IKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAW  1197
             S    +   +    G A  ++SWW +++D EG +  +  P W H  SD K+        W
Sbjct  259   SAACHIRQFEPLASGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH--SDPKELQ------W  310

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYKLSAQDCQ  1374
              DHW QCV+F+P     +Q    V L A H D  + Y + +T  +  E         DCQ
Sbjct  311   RDHWMQCVYFLPQEEPVIQGSA-VFLVAHHDDYCVWYSLQRTSPEKNESIHPGRPVCDCQ  369

Query  1375  --LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNV  1548
               L  +  R     D++     ++A+   LK  +  LC V+D S+   +A  HH  A  V
Sbjct  370   AHLLWNRPRFGEINDQDRTDQYIQALRTVLKSDSVCLC-VSDGSLLSMLA--HHLGAEQV  426

Query  1549  ISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYG  1728
              ++         + ++ +  +N    D I +++KR   LT  D   +KV LL+ EPF+  
Sbjct  427   FTIESSA--ASHRLMKKIFKANHLE-DKINIIEKRPELLTSADLEGKKVSLLLGEPFF--  481

Query  1729  SDSVLPWQNLRFW  1767
             + S+LPW NL FW
Sbjct  482   TTSLLPWHNLFFW  494


 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            R+F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    RIFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIQAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_005233549.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Falco peregrinus]
Length=639

 Score =   152 bits (384),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 111/384 (29%), Positives = 186/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVES  +W  + LF 
Sbjct  89    NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYAQLVESTRMWSWNKLFP  148

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P+          +LS+   +F  DF
Sbjct  149   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMPL------SDFTILSDVVTMFSVDF  202

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  203   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKSTSAFQ---  258

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV---KTQSQNMEVRQ  1347
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y++   + +  N    +
Sbjct  259   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTASRDEYSVWYMLQKARGEEDNKADDR  311

Query  1348  YKLSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
              +     CQ  L  +  R     D+N     +K++   LK  +  LC V+D S+   +A 
Sbjct  312   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKSDSVCLC-VSDGSLLPMLA-  369

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K+
Sbjct  370   -HYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLEDKIKIIEARPELLTSAHLEDKKI  423

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  424   SVLVGEPFF--TTSLLPWHNLYFW  445



>ref|XP_004690271.1| PREDICTED: protein arginine N-methyltransferase 7 [Condylura 
cristata]
Length=697

 Score =   153 bits (386),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 117/378 (31%), Positives = 188/378 (50%), Gaps = 33/378 (9%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRATIYAQLVESRKMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQ-FPMHCDAISE-GIKLLSEPFKIFDFDFWKRPDS  1020
                + S    ++   ++   C      + +  + +S     +LS+   +F  DF K+  S
Sbjct  199   IHVQTSCGEQVIVPPLELERCPGAPSVYDIQLNQVSPTDFTVLSDVLPMFSVDFSKQVSS  258

Query  1021  -----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSC  1185
                  SR+ E L      G A  ++SWW +++D EG +  +  P W H      DP    
Sbjct  259   LAACHSRKFEPL----ASGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPG---  306

Query  1186  SEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLS  1359
                W DHW QCV+F+P     VQ      L A H D  + Y +++ S  +N +V   +  
Sbjct  307   ELQWRDHWMQCVYFLPEEEAVVQGSALC-LLAHHDDYCIWYSLQSTSPQKNGKVPSVR-P  364

Query  1360  AQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHA  1533
               DCQ  L  +  R     D++     ++A+   LK  ++ LC V+D S+   +A  HH 
Sbjct  365   VCDCQAHLLWNRPRFGEINDQDRTDQYVQALRTVLKPDSACLC-VSDGSLLPMLA--HHL  421

Query  1534  RASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAE  1713
              A  V ++         + ++ +  +N    D I V++KR   LT  D   +KV LL+ E
Sbjct  422   GAGQVFTVESSA--ASHRLMKKIFKANHLE-DKINVIEKRPELLTSADLEGKKVSLLLGE  478

Query  1714  PFYYGSDSVLPWQNLRFW  1767
             PF+  + S+LPW NL FW
Sbjct  479   PFF--TTSLLPWHNLYFW  494


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEENGFSDKIKVINKHS  123



>ref|XP_001496929.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Equus caballus]
Length=695

 Score =   153 bits (386),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 113/373 (30%), Positives = 182/373 (49%), Gaps = 23/373 (6%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRATIYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQ-FPMHCDAIS-EGIKLLSEPFKIFDFDFWKRPDS  1020
                + S    ++    +   C      + +  + +S     +LS    +F  DF K+  S
Sbjct  199   IRVQTSHGEQVIVPPSEVEQCPGAPSVYDIQLNQVSPTDFTVLSNVLPMFSVDFSKQVSS  258

Query  1021  SRETELL-IKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAW  1197
             S    +   +    G A  ++SWW +++D EG +  +  P W H  SD K+        W
Sbjct  259   SAACHIRQFEPLASGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH--SDPKELQ------W  310

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYKLSAQDCQ  1374
              DHW QCV+F+P     +Q    V L A H D  + Y + +T  +  E         DCQ
Sbjct  311   RDHWMQCVYFLPQEEPVIQGSA-VFLVAHHDDYCVWYSLQRTSPEKNESIHPGRPVCDCQ  369

Query  1375  --LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNV  1548
               L  +  R     D++     ++A+   LK  +  LC V+D S+   +A  HH  A  V
Sbjct  370   AHLLWNRPRFGEINDQDRTDQYIQALRTVLKSDSVCLC-VSDGSLLSMLA--HHLGAEQV  426

Query  1549  ISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYG  1728
              ++         + ++ +  +N    D I +++KR   LT  D   +KV LL+ EPF+  
Sbjct  427   FTIESSA--ASHRLMKKIFKANHLE-DKINIIEKRPELLTSADLEGKKVSLLLGEPFF--  481

Query  1729  SDSVLPWQNLRFW  1767
             + S+LPW NL FW
Sbjct  482   TTSLLPWHNLFFW  494


 Score = 73.6 bits (179),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            R+F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    RIFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIQAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_004015141.1| PREDICTED: protein arginine N-methyltransferase 7 isoform 2 [Ovis 
aries]
Length=645

 Score =   152 bits (384),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 114/381 (30%), Positives = 181/381 (48%), Gaps = 39/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+  + E VP+R T++ QLVES+ +W  + LF 
Sbjct  89    NILITELFDTELIGEGALPSYEHAHRHLVQANCEAVPHRATVYAQLVESRRMWSWNKLFP  148

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   ++   C      P  CD            +LS+   +F  DF K+
Sbjct  149   IRVQTSRGERVIIPPLELERC---PGAPSVCDIQLNQVSPADFTILSDVLPMFSVDFSKQ  205

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHC-PSDVKDP  1173
               S     SR+ E L+     G A  ++SWW +++D EG +  +  P W H  P +++  
Sbjct  206   VSSSAACHSRQFEPLV----SGRAQVVLSWWDIEMDPEGKIKCTMAPFWAHSNPEELQ--  259

Query  1174  SLSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYK  1353
                    W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R + 
Sbjct  260   -------WRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQKTSPEKNERVHP  311

Query  1354  LSAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
             +    DCQ  L  +  R     D+N     ++A+   LK  +  LC V+D S+   +A  
Sbjct  312   VRPVCDCQAHLLWNRPRFGEINDRNRTEQYIQALRTVLKPDSVCLC-VSDGSLLSMLA--  368

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             +H  A  V ++           L       ++  D I +++KR   LT  D   +KV LL
Sbjct  369   YHLGAEQVFTV---ENSAASHRLMKKIFRANHLEDKINIIEKRPELLTPADLEGKKVSLL  425

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  + S+LPW NL FW
Sbjct  426   LGEPFF--TTSLLPWHNLYFW  444



>ref|XP_005233548.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Falco peregrinus]
Length=689

 Score =   152 bits (385),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 111/384 (29%), Positives = 186/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVES  +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYAQLVESTRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P+          +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMPL------SDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV---KTQSQNMEVRQ  1347
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y++   + +  N    +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTASRDEYSVWYMLQKARGEEDNKADDR  361

Query  1348  YKLSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
              +     CQ  L  +  R     D+N     +K++   LK  +  LC V+D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKSDSVCLC-VSDGSLLPMLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K+
Sbjct  420   -HYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLEDKIKIIEARPELLTSAHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 63/137 (46%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EWV  +E     Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWVEEDEDYDYHQE----IARSRYADMLHDKDRNAKYFQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKEKGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_005444643.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Falco cherrug]
Length=689

 Score =   152 bits (385),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 111/384 (29%), Positives = 186/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVES  +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYAQLVESTRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P+          +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMPL------SDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV---KTQSQNMEVRQ  1347
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y++   + +  N    +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTASRDEYSVWYMLQKARGEEDNKADDR  361

Query  1348  YKLSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
              +     CQ  L  +  R     D+N     +K++   LK  +  LC V+D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKSDSVCLC-VSDGSLLPMLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K+
Sbjct  420   -HYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLEDKIKIIEARPELLTSAHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 63/137 (46%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EWV  +E     Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWVEEDEDYDYHQE----IARSRYADMLHDKDRNAKYFQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKEKGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>gb|EJW83377.1| protein arginine N-methyltransferase 7 [Wuchereria bancrofti]
Length=643

 Score =   114 bits (284),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 104/382 (27%), Positives = 173/382 (45%), Gaps = 52/382 (14%)
 Frame = +1

Query  646   IHHILNFNNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLW  825
             I  I   N  V+E+ D+EL+GEG + T + AH  L+      VP    +    V+S  L 
Sbjct  119   ISSIEKGNVIVAEVFDTELIGEGALRTFKEAHQKLVKPGCRVVPSSARVLVVPVQSDFLM  178

Query  826   KMHDLFNNEEKASDTIHLVPKGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDFW  1005
             + H L +   K  +     P G   I  +   + P       E I++L+EPF  F FDF 
Sbjct  179   RFHQLPSRHFKVPEISKRCP-GAGAIHDIHVSEVP------EEEIRVLAEPFVAFSFDF-  230

Query  1006  KRPDSSRETELLIK---ATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
             +   S    E +++   A   GT  A++ WW L +D  G    ST PKW           
Sbjct  231   EDGCSINYNETVVRTFNAELDGTFEALLMWWELDMDGTGQNILSTAPKW-----------  279

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
              +  E W DHW Q V+++    + V+KDE V LH  H + +  + V    QN E   ++ 
Sbjct  280   WNKKENWRDHWVQGVYYLAQ-SVQVRKDEAVPLHCCHDEFSFWFAV---PQN-EFDAFEP  334

Query  1357  SAQDCQLFLSPERIAIYGDKNWRCSMLK---AINNALKQKASPLCI-VADDSIFLTIALG  1524
             +   C+  ++  R AI+     R + L    A ++ LK+  +   + V DD   +++ L 
Sbjct  335   NFCRCKTHVACSRNAIH-----RLNELDDDVAFDHFLKENFTEKSVAVLDDGSLMSLLLS  389

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAAS-NDYSMDCIKVLKKRSSALTMQDTHHRKVDL  1701
              +A+   +I       +  + +L  + A   +  +  I++    +S        ++++D+
Sbjct  390   KYAKTVQII-------EPNDHFLAVILAYIEENEIRNIRIYDDCAS------VPYQEIDV  436

Query  1702  LIAEPFYYGSDSVLPWQNLRFW  1767
             +++EPFY    S LPW NL FW
Sbjct  437   VVSEPFYLS--SFLPWDNLCFW  456


 Score = 65.9 bits (159),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 66/136 (49%), Gaps = 31/136 (23%)
 Frame = +2

Query  143  MFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAF----REAID-  307
            MF   +DP+TG   W V +E     Q     +A + + DM++D  RN+ +    +  ID 
Sbjct  1    MFLETIDPITGRQTWKVADEDYDVAQE----IARSGFGDMIHDFERNQKYELGLKSVIDQ  56

Query  308  -KTVTKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKVL  484
             K   +  HVLDIGAGTGLLSMMA RA   ADS         VTA E   P         
Sbjct  57   LKKRNERVHVLDIGAGTGLLSMMAMRA--GADS---------VTALEIDRP---------  96

Query  485  RANGIERGIRIINKRS  532
              NG E  IR+I  RS
Sbjct  97   -KNGYEGQIRLIASRS  111



>ref|XP_007477291.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Monodelphis domestica]
 ref|XP_007477292.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X3 
[Monodelphis domestica]
Length=689

 Score =   152 bits (384),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 116/380 (31%), Positives = 186/380 (49%), Gaps = 36/380 (9%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLF-  843
             N  V+E+ D+EL+GEG +P+ +HAH NL+ E+ E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHKNLVEENCEAVPHRATVYAQLVESKRMWSWNKLFP  198

Query  844   -NNEEKASDTIHLVPKGMD------TIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
              + +  + + I + P  M+      ++  ++  Q P      S    +LS    +F  DF
Sbjct  199   IHIQTDSVEKIIVAPSEMENCPGAPSVYDIQLNQMP------SGDFTVLSNVLTMFSVDF  252

Query  1003  WKRPDSSRETELL-IKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSL  1179
              K+  SS     +  +    G A  ++SWW + +D +G +  S  P W+H  SD K+   
Sbjct  253   SKQVYSSPAYHTMQFEPLVSGRAQVVLSWWDIDMDPDGKIKCSMAPYWVH--SDPKNIQ-  309

Query  1180  SCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQY-K  1353
                  W DHW QCV+F+PN    VQ  E ++L A   D  + Y + KT+++  +   Y +
Sbjct  310   -----WRDHWMQCVYFLPNEEPVVQ-GESLYLTAHRDDYCVWYHLHKTRNEKSKSNFYGE  363

Query  1354  LSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 +CQ  L  +  R     D+      ++A+   LK  +  LCI +D S+   +    
Sbjct  364   RPICECQAHLLWNRPRFGELNDQTRTEQYIQALKKVLKADSVCLCI-SDGSLLPIL----  418

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
              A    V  +F          L       ++  D I +++KR   LT  D   RK+ +L+
Sbjct  419   -AHCVGVEQVFTMENSAVSHRLMKKIFKVNHLEDKINIIEKRPELLTSADLGDRKISVLL  477

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  478   GEPFF--TTSLLPWHNLYFW  495


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V 
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRAAVK  57

Query  320  KPCH------VLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKEKGQTAIVLDIGTGTGLLSMMAVSA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I+IINK S
Sbjct  107  VEKNGFSDKIKIINKHS  123



>ref|XP_010812776.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X3 
[Bos taurus]
Length=567

 Score =   150 bits (380),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/380 (29%), Positives = 180/380 (47%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+  + E VP+R T++ QLVES+ +W  + LF 
Sbjct  6     NILITELFDTELIGEGALPSYEHAHRHLVQANCEAVPHRATVYAQLVESRRMWSWNKLFP  65

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   ++   C      P  CD            +LS+   +F  DF K+
Sbjct  66    IRVQTSRGERVIIPPLELERC---PGAPSVCDIQLNQVSPADFTILSDVLPMFSVDFSKQ  122

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L+     G A  ++SWW +++D EG +  +  P W H      DP 
Sbjct  123   VSSSAACHSRQFEPLV----SGRAQVVLSWWDIEMDPEGKIKCTMAPSWAH-----SDPE  173

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R + +
Sbjct  174   ---ELQWRDHWMQCVYFLPQEEPVVQGLALC-LVAYHDDYCVWYSLQKTSPEKNGRVHPV  229

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D+N     ++A+   LK  +  +C+   D   L++ L +
Sbjct  230   RPVCDCQAHLLWNRPRFGEINDRNRTDQYIQALRTVLKPDS--VCLCVSDGSLLSM-LAY  286

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + ++ +  +N    D I +++KR   LT  D   +KV LL+
Sbjct  287   HLGVEQVFTI--ENSAVSHRLMKKIFKANHLE-DKINIIEKRPELLTPADLEGKKVSLLL  343

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  344   GEPFF--TTSLLPWHNLYFW  361



>ref|XP_009814319.1| PREDICTED: protein arginine N-methyltransferase 7 [Gavia stellata]
Length=681

 Score =   152 bits (383),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 109/383 (28%), Positives = 185/383 (48%), Gaps = 43/383 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFVILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S ++   
Sbjct  253   -SKPVRSASTYYRVQLQPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSTSALQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y ++   +       ++
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSVWYKLQKAREEENKADARV  361

Query  1357  SAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
              +  C+    L  +  R     D+N     + ++   LK  +  LCI +D S+   +A  
Sbjct  362   ESPVCRCQAHLLWNRPRFGELNDQNRTRQYITSLMKVLKTDSVCLCI-SDGSLLPVLA--  418

Query  1525  HHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVD  1698
             H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K+ 
Sbjct  419   HYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLEDKIKIIEARPELLTSSHLEDKKIS  473

Query  1699  LLIAEPFYYGSDSVLPWQNLRFW  1767
             +L+ EPF+  + S+LPW NL FW
Sbjct  474   VLLGEPFF--TTSLLPWHNLYFW  494


 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_004015140.1| PREDICTED: protein arginine N-methyltransferase 7 isoform 1 [Ovis 
aries]
Length=695

 Score =   152 bits (383),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 114/381 (30%), Positives = 181/381 (48%), Gaps = 39/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+  + E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQANCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   ++   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IRVQTSRGERVIIPPLELERC---PGAPSVCDIQLNQVSPADFTILSDVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHC-PSDVKDP  1173
               S     SR+ E L+     G A  ++SWW +++D EG +  +  P W H  P +++  
Sbjct  256   VSSSAACHSRQFEPLV----SGRAQVVLSWWDIEMDPEGKIKCTMAPFWAHSNPEELQ--  309

Query  1174  SLSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYK  1353
                    W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R + 
Sbjct  310   -------WRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQKTSPEKNERVHP  361

Query  1354  LSAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
             +    DCQ  L  +  R     D+N     ++A+   LK  +  LC V+D S+   +A  
Sbjct  362   VRPVCDCQAHLLWNRPRFGEINDRNRTEQYIQALRTVLKPDSVCLC-VSDGSLLSMLA--  418

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             +H  A  V ++           L       ++  D I +++KR   LT  D   +KV LL
Sbjct  419   YHLGAEQVFTV---ENSAASHRLMKKIFRANHLEDKINIIEKRPELLTPADLEGKKVSLL  475

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  + S+LPW NL FW
Sbjct  476   LGEPFF--TTSLLPWHNLYFW  494


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_007477290.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Monodelphis domestica]
Length=707

 Score =   152 bits (383),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 116/380 (31%), Positives = 186/380 (49%), Gaps = 36/380 (9%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLF-  843
             N  V+E+ D+EL+GEG +P+ +HAH NL+ E+ E VP+R T++ QLVESK +W  + LF 
Sbjct  157   NILVTELFDTELIGEGALPSYEHAHKNLVEENCEAVPHRATVYAQLVESKRMWSWNKLFP  216

Query  844   -NNEEKASDTIHLVPKGMD------TIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
              + +  + + I + P  M+      ++  ++  Q P      S    +LS    +F  DF
Sbjct  217   IHIQTDSVEKIIVAPSEMENCPGAPSVYDIQLNQMP------SGDFTVLSNVLTMFSVDF  270

Query  1003  WKRPDSSRETELL-IKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSL  1179
              K+  SS     +  +    G A  ++SWW + +D +G +  S  P W+H  SD K+   
Sbjct  271   SKQVYSSPAYHTMQFEPLVSGRAQVVLSWWDIDMDPDGKIKCSMAPYWVH--SDPKNIQ-  327

Query  1180  SCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQY-K  1353
                  W DHW QCV+F+PN    VQ  E ++L A   D  + Y + KT+++  +   Y +
Sbjct  328   -----WRDHWMQCVYFLPNEEPVVQ-GESLYLTAHRDDYCVWYHLHKTRNEKSKSNFYGE  381

Query  1354  LSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 +CQ  L  +  R     D+      ++A+   LK  +  LCI +D S+   +    
Sbjct  382   RPICECQAHLLWNRPRFGELNDQTRTEQYIQALKKVLKADSVCLCI-SDGSLLPIL----  436

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
              A    V  +F          L       ++  D I +++KR   LT  D   RK+ +L+
Sbjct  437   -AHCVGVEQVFTMENSAVSHRLMKKIFKVNHLEDKINIIEKRPELLTSADLGDRKISVLL  495

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  496   GEPFF--TTSLLPWHNLYFW  513


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V 
Sbjct  20   KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRAAVK  75

Query  320  KPCH------VLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  76   RVKEKGQTAIVLDIGTGTGLLSMMAVSA-----------GADFCYAIEVFKPMADAAVKI  124

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I+IINK S
Sbjct  125  VEKNGFSDKIKIINKHS  141



>ref|XP_008565333.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Galeopterus variegatus]
Length=692

 Score =   152 bits (383),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 115/381 (30%), Positives = 184/381 (48%), Gaps = 39/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHKHLVQENCEAVPHRATIYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                +      ++   ++   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IRVQTGIGEQVIVPPLELERC---PGAPSVCDIQLNQVSPTDFTVLSDVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHC-PSDVKDP  1173
               S     SR+ E L      G A  ++SWW +++D EG +  +  P W H  P +++  
Sbjct  256   VSSSAACHSRQFEPL----ASGRAQVVLSWWDIEMDPEGKIKCTMAPFWAHSNPEELQ--  309

Query  1174  SLSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYK  1353
                    W DHW QCV+F+P     VQ   +  L A H D  + Y ++  S     R ++
Sbjct  310   -------WRDHWMQCVYFLPQEEPIVQGSAFW-LVAHHDDYCVWYSLQRTSPEKNGRVHQ  361

Query  1354  LSAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
             +    DCQ  L  +  R     D++     + A+   LK  +  LC V+D S+   +A  
Sbjct  362   MRPVCDCQAHLLWNRPRFGEINDQDRTDQYVHALRTVLKSDSVCLC-VSDGSLLSMLA--  418

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             HH  A  V ++         + ++ +  +N    D I +++KR   LT  D   +KV +L
Sbjct  419   HHLGAEQVFTIESSA--ASHKLMKKIFKANHLE-DKINIIEKRPELLTSADLEGKKVSVL  475

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  + S+LPW NL FW
Sbjct  476   LGEPFF--TTSLLPWHNLYFW  494


 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 66/137 (48%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM  +  K+
Sbjct  58   RVRDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADVAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_006047715.1| PREDICTED: protein arginine N-methyltransferase 7 [Bubalus bubalis]
Length=695

 Score =   152 bits (383),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 115/380 (30%), Positives = 178/380 (47%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+  + E VP+R TI+ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQANCEAVPHRATIYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   ++   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IRVQTSRGERVIIPPLELERC---PGAPSVCDIQLNQVSPADFTILSDVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L+     G A  ++SWW +++D EG +  +  P W H      DP 
Sbjct  256   VSSSAACHSRQFEPLV----SGRAQVVLSWWDIEMDPEGKIKCTMAPSWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R + +
Sbjct  307   ---ELQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQKTSPEKNGRVHPV  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D+N     ++A+   LK  +  LC V+D S+   +A  +
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDQNRTDQYIQALRTVLKPDSVCLC-VSDGSLLSMLA--Y  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++           L       ++  D I +++KR   LT  D   +KV LL+
Sbjct  420   HLGVEQVFTI---ENSAASHRLMKKIFKANHLEDKINIIEKRPELLTPADLEGKKVSLLL  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  477   GEPFF--TTSLLPWHNLYFW  494


 Score = 70.9 bits (172),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_001505676.1| PREDICTED: protein arginine N-methyltransferase 7 [Ornithorhynchus 
anatinus]
Length=689

 Score =   151 bits (382),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 112/381 (29%), Positives = 190/381 (50%), Gaps = 38/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+    E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEAECEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASD--TIHLVPKGMD------TIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +  D   + L P  M+      ++  ++  Q P       +   +LS+   +F  DF
Sbjct  199   IHVQTGDDQNVLLSPSEMENCPGAPSVYDIQLNQVP------RDDFTILSDVLTMFSVDF  252

Query  1003  WKRPDSSRETELL-IKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHC-PSDVKDPS  1176
              K+  S     ++  ++   G A  ++SWW + +D EG +  S  P W+H  P++++   
Sbjct  253   SKQVHSKPACHVIQFESVGSGKAQVVLSWWDIDMDPEGKIKCSMAPYWVHSDPTNIQ---  309

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSY-VVKTQSQNMEVRQY-  1350
                   W DHW QCV+F+P   L V +DE ++L A   D  + Y + KT+ + +    + 
Sbjct  310   ------WRDHWMQCVYFLPREEL-VAQDETLYLAAQRDDYCVWYNLQKTRYEAIRSDSHG  362

Query  1351  KLSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
             +    +CQ  L  +  R     D+N     ++A+   +K  +  LCI   D   L I L 
Sbjct  363   ERPVCECQAHLLWNRPRFGELNDQNRTDQYVQALKKVVKTDSVCLCI--SDGSLLPI-LA  419

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             H   A  V ++         + ++ +  +N    + I V++KR   L   D  ++KV +L
Sbjct  420   HCLGAEQVFTIENSA--VSHRLMKKIFKANHLE-EKINVIEKRPELLIPADLENKKVSVL  476

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             +AEPF+  + S+LPW NL FW
Sbjct  477   LAEPFF--TTSLLPWHNLYFW  495


 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 66/137 (48%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG  EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGAVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIHAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA +A                 A E + PM     K+
Sbjct  58   RVKGRGQKATVLDIGTGTGLLSMMAVKA-----------GADFCYAVEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG+   I+IINK S
Sbjct  107  VEKNGLSDKIKIINKHS  123



>ref|XP_005692235.1| PREDICTED: protein arginine N-methyltransferase 7 [Capra hircus]
Length=695

 Score =   151 bits (382),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 116/381 (30%), Positives = 180/381 (47%), Gaps = 39/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+  + E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQANCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   ++   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IRVQTSRGERVIIPPLELERC---PGAPSVCDIQLNQVSPADFTILSDVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHC-PSDVKDP  1173
               S     SR+ E L+     G A  ++SWW +++D EG +  +  P W H  P +++  
Sbjct  256   VSSSAACHSRQFEPLV----SGRAQVVLSWWDIEMDPEGKIKCTMAPFWAHSNPEELQ--  309

Query  1174  SLSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQY  1350
                    W DHW QCV+F+P     VQ      L A H D  + Y + KT  +  E    
Sbjct  310   -------WRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQKTSPEKNESVHP  361

Query  1351  KLSAQDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
                  DCQ  L  +  R     D+N     ++A+   LK  +  LC V+D S+   +A  
Sbjct  362   VRPVCDCQAHLLWNRPRFGEINDRNRTEQYIQALRMVLKPDSVCLC-VSDGSLLSMLA--  418

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             +H  A  V ++           L       ++  D I +++KR   LT  D   +KV LL
Sbjct  419   YHLGAEQVFTV---ENSAASHRLMKKIFRANHLEDKINIIEKRPELLTPADLEGKKVSLL  475

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  S S+LPW NL FW
Sbjct  476   LGEPFF--STSLLPWHNLYFW  494


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_005896582.1| PREDICTED: protein arginine N-methyltransferase 7 [Bos mutus]
 gb|ELR55791.1| Protein arginine N-methyltransferase 7 [Bos mutus]
Length=695

 Score =   151 bits (382),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 114/380 (30%), Positives = 178/380 (47%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+  + E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQANCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   ++   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IRVQTSRGERVIIPPLELERC---PGAPSVCDIQLNQVSPADFTILSDVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L+     G A  ++SWW +++D EG +  +  P W H      DP 
Sbjct  256   VSSSAACHSRQFEPLV----SGRAQVVLSWWDIEMDPEGKIKCTMAPSWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R + +
Sbjct  307   ---ELQWRDHWMQCVYFLPQEEPVVQGLALC-LVAYHDDYCVWYSLQKTSPEKNGRVHPV  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D+N     ++A+   LK  +  LC V+D S+   +A  +
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDRNRTDQYIQALRTVLKPDSVCLC-VSDGSLLSMLA--Y  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++           L       ++  D I +++KR   LT  D   +KV LL+
Sbjct  420   HLGVEQVFTI---ENSAASHRLMKKIFKANHLEDKINIIEKRPELLTPADLEGKKVSLLL  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  477   GEPFF--TTSLLPWHNLYFW  494


 Score = 70.9 bits (172),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_007450007.1| PREDICTED: protein arginine N-methyltransferase 7 [Lipotes vexillifer]
Length=695

 Score =   151 bits (382),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 111/373 (30%), Positives = 177/373 (47%), Gaps = 23/373 (6%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+ ++ E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQKNCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQ-FPMHCDAISE-GIKLLSEPFKIFDFDFWKRPDS  1020
                + S    ++   ++   C      + +  + +S     +LS    +F  DF K+  S
Sbjct  199   IRVQTSLGEQVIVPPLELERCPGAPSVYDIQLNQVSPTDFTVLSNVLPMFSVDFSKQVSS  258

Query  1021  SRET-ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCSEAW  1197
             S  +     +    G A  ++SWW +++D EG +  +  P W H      DP       W
Sbjct  259   STASHSRQFEPLASGQAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---ELQW  310

Query  1198  CDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ-DCQ  1374
              DHW QCV+F+P     VQ      L A H D  + Y ++  S   + R +      DCQ
Sbjct  311   RDHWMQCVYFLPEEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPAKDGRAHPARPVCDCQ  369

Query  1375  --LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHARASNV  1548
               L  +  R     D+N     ++A+   LK  +  LCI   D   L++ L HH  A  V
Sbjct  370   AHLLWNRPRFGEINDQNRTDQYVQALRTVLKPDSVCLCI--SDGSLLSM-LAHHLGAEQV  426

Query  1549  ISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEPFYYG  1728
              ++           L       ++  D I +++KR   LT  D   +KV LL+ EPF+  
Sbjct  427   FTI---ENSAASHRLMKKIFKANHLEDKINIIEKRPELLTPADLEGKKVSLLLGEPFF--  481

Query  1729  SDSVLPWQNLRFW  1767
             + S+LPW NL FW
Sbjct  482   TTSLLPWHNLYFW  494


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDKGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I+IINK S
Sbjct  107  VEKNGFSDKIKIINKHS  123



>ref|XP_005592406.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Macaca fascicularis]
 ref|XP_005592407.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Macaca fascicularis]
Length=723

 Score =   152 bits (383),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 119/400 (30%), Positives = 181/400 (45%), Gaps = 55/400 (14%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R TI+ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVEENCEAVPHRATIYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   +D   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHLQTSLGEQVIVPPVDLENC---PGAPSVCDIQLNQVSPADFTVLSDVLPMFSIDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L      G A  ++SWW +++D EG +  +T P W H      DP 
Sbjct  256   VSSSAACHSRQFEPLT----SGRAQVVLSWWDIEMDPEGKIRCTTAPFWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R +++
Sbjct  307   ---EMQWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQRTSTEKNERVHQM  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDK--------------------NWRCSMLKAINNALKQK  1467
                 DCQ  L  +  R     D+                    NWR    +   +    K
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDQDRTDRYIQALSTLTSRNLLANWRKPCAEGARSPQVLK  422

Query  1468  ASPLCIVADDSIFLTIALGHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLK  1647
                +C+   D   L++ L HH     V ++         + L+ +  +N    D I +++
Sbjct  423   PDSVCLCVSDGSLLSV-LAHHLGVEQVFTVESSA--ASHKLLRKIFKANHLE-DKINIIE  478

Query  1648  KRSSALTMQDTHHRKVDLLIAEPFYYGSDSVLPWQNLRFW  1767
             KR   LT +D   RKV LL+ EPF+  + S+LPW +L FW
Sbjct  479   KRPELLTSEDLKSRKVSLLLGEPFF--TTSLLPWHSLYFW  516


 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KIFCSRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I +INK S
Sbjct  107  VEKNGFSDKILVINKHS  123



>ref|XP_006909857.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Pteropus alecto]
 ref|XP_006909858.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Pteropus alecto]
Length=695

 Score =   151 bits (382),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 114/378 (30%), Positives = 186/378 (49%), Gaps = 33/378 (9%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLF-  843
             N  ++E+ D+EL+GEG +P+ +HAH +L+ E+ E VP+R  ++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQENCEAVPHRANVYAQLVESRKMWSWNKLFP  198

Query  844   -NNEEKASDTIHLVPKGMDTIICVKHQQFPMHCDAISE-GIKLLSEPFKIFDFDFWKRPD  1017
              +   +  + + + P  M+         + +  + +S     +LS+   +F  DF K+  
Sbjct  199   IHVRTRHGERVIVPPPEMERCPGAP-SVYDIQLNQVSPTDFTVLSDVLPMFSVDFSKQVS  257

Query  1018  S-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLS  1182
             S     SR+ ELL      G A  ++SWW +++D EG +  +  P W H      DP + 
Sbjct  258   SSSACHSRQFELL----ASGRAQVVLSWWDIEMDPEGKIRCTMAPFWAHA-----DPQVL  308

Query  1183  CSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSA  1362
                 W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R + +  
Sbjct  309   ---QWRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQRTSPEKNGRVHPMRP  364

Query  1363  Q-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHA  1533
               DCQ  L  +  R     D +     ++A+   LK  +  LC V+D S+   +A  +H 
Sbjct  365   VCDCQAHLLWNRPRFGEINDPDRTDQYVQALKTVLKPDSVCLC-VSDGSLLSMLA--YHL  421

Query  1534  RASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAE  1713
              A  V ++         + ++ +  +N    D IKV++KR   LT  D   +KV +L+ E
Sbjct  422   GAEQVFTVESSA--ASHRLMKKIFKANHLE-DKIKVIEKRPELLTSADLEGKKVSVLLGE  478

Query  1714  PFYYGSDSVLPWQNLRFW  1767
             PF+  + S+LPW NL FW
Sbjct  479   PFF--TTSLLPWHNLYFW  494


 Score = 70.9 bits (172),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKERGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_009275016.1| PREDICTED: protein arginine N-methyltransferase 7 [Aptenodytes 
forsteri]
Length=689

 Score =   151 bits (381),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 110/384 (29%), Positives = 186/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y + K + +       +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSVWYKLQKARGEEENKANVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     ++++   LK  +  LCI +D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIESLMKVLKTDSVCLCI-SDGSLLPVLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K+
Sbjct  420   -HYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLEDKIKIIEARPELLTSSHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFCDKIKVINKHS  123



>ref|XP_010303550.1| PREDICTED: LOW QUALITY PROTEIN: protein arginine N-methyltransferase 
7 [Balearica regulorum gibbericeps]
Length=689

 Score =   151 bits (381),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 111/384 (29%), Positives = 186/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIVLSWWDIDMDPSGMISCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVR-QYK  1353
                   W DHW QCV+F+PN    V + E V+L A     ++ Y ++    + E +   +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDQYSVWYKLEKARGDEENKADVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  LCI +D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTQQYVKSLMKVLKTDSVCLCI-SDGSLLPVLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K+
Sbjct  420   -HYLGAKQVFTLENSAVSCSVMEKFFKA-----NHLEDKIKIIEARPELLTSSHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNTKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_009502869.1| PREDICTED: protein arginine N-methyltransferase 7 [Phalacrocorax 
carbo]
Length=689

 Score =   151 bits (381),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 111/384 (29%), Positives = 188/384 (49%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                KA D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVKAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYTVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVR-QYK  1353
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y ++    + E +   +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSVWYKLQKARGDEENKADVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++   LK  +  LCI +D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKTDSVCLCI-SDGSLLPMLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          +++ +A     ++  D IK+++    +LT      +K+
Sbjct  420   -HYLGAKQVFTLENSAVSCSVMKKFFKA-----NHLEDKIKIIEAHPESLTSSHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+AEPF+  + S+LPW NL FW
Sbjct  474   SVLVAEPFF--TTSLLPWHNLYFW  495


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWIEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIYAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKARGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_009676556.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Struthio camelus australis]
 ref|XP_009676557.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Struthio camelus australis]
Length=630

 Score =   150 bits (379),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 109/382 (29%), Positives = 184/382 (48%), Gaps = 41/382 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH++L+ E  E VP+R T++ QL ESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHEHLVQEGCEAVPHRATVYVQLAESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VRVEAEDGEKVIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVVMFSVDF  252

Query  1003  WKRPDS-SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSL  1179
              K   S S    + ++  K G A  ++SWW + +D  G +  +  P W+   S  +    
Sbjct  253   SKPVRSASAYYRVQLEPVKSGKAQIVLSWWDMDMDPSGKINCTMAPYWVKPTSAFQ----  308

Query  1180  SCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLS  1359
                  W DHW QCV+F+PN    V + E V+L A   + ++ Y ++   +       ++ 
Sbjct  309   -----WRDHWMQCVYFLPN-EEPVFQGENVYLTAYRDEYSVWYKLQKAREEENKADVRVD  362

Query  1360  AQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
             +  C+    L  +  R     D+N     + ++   LK  +  LCI +D S+   +A  H
Sbjct  363   SPVCRCQAHLLWNRPRFGELNDQNRTRQYINSLTKVLKTDSVCLCI-SDGSLLPVLA--H  419

Query  1528  HARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDL  1701
             +  A  V +L           ++L+A     ++  D IK+++ R   LT      RK+ +
Sbjct  420   YLGAKQVFTLENSAVSCSVMGKFLKA-----NHLEDKIKIVEARPELLTPSHLEDRKISV  474

Query  1702  LIAEPFYYGSDSVLPWQNLRFW  1767
             L+ EPF+  + S+LPW NL FW
Sbjct  475   LLGEPFF--TTSLLPWHNLYFW  494


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 63/137 (46%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E     Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDEDYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_010073991.1| PREDICTED: protein arginine N-methyltransferase 7 [Pterocles 
gutturalis]
Length=689

 Score =   150 bits (380),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 112/384 (29%), Positives = 186/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTVLSDVVTVFSVDF  252

Query  1003  WKRPDS-SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSL  1179
              K   S S    + ++  K G A  ++SWW + +D  G +  +  P W+   S  +    
Sbjct  253   SKPVRSASTSCRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCTMAPYWVKSTSAFQ----  308

Query  1180  SCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLS  1359
                  W DHW QCV+F+PN    V K E V+L A   + +L Y ++ +++  E  +  + 
Sbjct  309   -----WRDHWMQCVYFLPN-EEPVLKGEKVYLTACRDEYSLWYKLQ-KARGEEENKADVC  361

Query  1360  AQD----CQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
              +     CQ  L  +  R     D+N     +K++   LK  +  LCI +D S+   +A 
Sbjct  362   VESPVCWCQAHLLWNRPRFGELNDQNRTRQYIKSLMKVLKTDSICLCI-SDGSLLPVLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          +++ +A     ++  D IK+++ R   L       +K+
Sbjct  420   -HYLGAKRVFTLENSAVSCSVMKKFFKA-----NHLEDKIKIIETRPELLMSSHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAVVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|NP_001005831.1| protein arginine N-methyltransferase 7 [Gallus gallus]
 sp|Q5ZIB9.1|ANM7_CHICK RecName: Full=Protein arginine N-methyltransferase 7; AltName: 
Full=Histone-arginine N-methyltransferase PRMT7; AltName: 
Full=[Myelin basic protein]-arginine N-methyltransferase PRMT7 
[Gallus gallus]
 emb|CAG32524.1| hypothetical protein RCJMB04_28e13 [Gallus gallus]
Length=689

 Score =   150 bits (380),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 110/384 (29%), Positives = 186/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T     +   K G A  ++SWW + +D  GT+  +  P W+   S  +   
Sbjct  253   -SKPVRSASTCYRAQLDPVKSGKAQIVLSWWDIDMDPSGTINCTMAPYWVKPMSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+P     V + E VHL A   + ++ Y + K + ++      +
Sbjct  309   ------WRDHWMQCVYFLPK-EEQVLQGEKVHLTACRDEYSVWYTLQKAREEDESKADAR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +K++ + L+  +  LCI +D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYIKSLMSVLRTDSVCLCI-SDGSLLPVLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          +++ +A     ++  D IK+++ R   LT      +K+
Sbjct  420   -HYLGAEQVFTLENSAVSCSVMKKFFKA-----NHLEDKIKIVEARPELLTSSHLEEKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG+ EWV  +E     Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGSLEWVEEDEDYDYHQE----IARSRYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKGRGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFGDKIKVINKHS  123



>ref|XP_009088893.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Serinus canaria]
Length=639

 Score =   150 bits (378),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 114/389 (29%), Positives = 189/389 (49%), Gaps = 53/389 (14%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVES+ +W    LF 
Sbjct  89    NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESRRMWSWKKLFP  148

Query  847   NEEKASDTIH-LVP-------KGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D    LVP        G+ ++  V+  Q P      S    +LS+  K+F  DF
Sbjct  149   VHVEAEDGEKILVPPSEMENCPGLPSVCDVQLNQMP------SSDFSILSDVVKMFSVDF  202

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  S  P W+   S ++   
Sbjct  203   -SKPVQSASTCYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCSMAPYWVKPTSALQ---  258

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P+    V + E ++L A   + ++ Y ++    + E  +  +
Sbjct  259   ------WRDHWMQCVYFLPH-EEPVLQGEKLYLTACRDEYSVWYNLQKARADEEEHKADV  311

Query  1357  SAQD------CQLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIA  1518
               +         L  +  R     D+N     ++++   LK  +  LCI +D S+   +A
Sbjct  312   CVESPVCRCRAHLLWNRPRFGQLNDQNRTQQYIQSLRRVLKTDSVCLCI-SDGSLLPVLA  370

Query  1519  LGHHARASNVISLFPGLQDKG------EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDT  1680
               H+  A  V +    L++ G      E++L+A    N+   D IK+++ R   L     
Sbjct  371   --HYLGAKQVFT----LENSGVSCSVMEKFLKA----NNLE-DKIKIIEARPELLKPSHL  419

Query  1681  HHRKVDLLIAEPFYYGSDSVLPWQNLRFW  1767
               +K+ +L+ EPF+  + S+LPW NL FW
Sbjct  420   EDKKISVLVGEPFF--TTSLLPWHNLYFW  446



>ref|XP_009949116.1| PREDICTED: protein arginine N-methyltransferase 7 [Leptosomus 
discolor]
Length=689

 Score =   150 bits (379),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 111/384 (29%), Positives = 186/384 (48%), Gaps = 44/384 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYIQLVESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T  ++ ++  + G A  ++SWW + +D  G +  +  P W    S ++   
Sbjct  253   -SKPVRSASTYYKVQLEPVRSGKAQIVLSWWDIDMDPSGMINCTMAPYWAKSTSALQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVV-KTQSQNMEVRQYK  1353
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y + K +         +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGEKVYLTACRDEYSVWYKLQKARGGEKNKADVR  361

Query  1354  LSAQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIAL  1521
             + +  C+    L  +  R     D+N     +KA+   LK  +  LCI +D S+   +A 
Sbjct  362   VESPVCRCQAHLLWNRPRFGELNDQNRTRQYMKALMKILKTDSVCLCI-SDGSLLPVLA-  419

Query  1522  GHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKV  1695
              H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K+
Sbjct  420   -HYLGAKQVFTLENSAVSLSVMEKFFKA-----NHLEDKIKIIESRPELLTSSHLEDKKI  473

Query  1696  DLLIAEPFYYGSDSVLPWQNLRFW  1767
              +L+ EPF+  + S+LPW NL FW
Sbjct  474   SVLLGEPFF--TTSLLPWHNLYFW  495


 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNTKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKDRGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_005956910.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Pantholops hodgsonii]
Length=695

 Score =   150 bits (379),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 114/381 (30%), Positives = 181/381 (48%), Gaps = 39/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+  + E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQANCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   ++   C      P  CD            +LS+   +F  DF K+
Sbjct  199   ICVQTSRGERVIIPHLELERC---PGAPSVCDIQLNQVSPADFTILSDVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHC-PSDVKDP  1173
               S     SR+ E L+     G A  ++SWW +++D EG +  +  P W H  P +++  
Sbjct  256   VSSSAACHSRQFEPLV----SGRAQVVLSWWDIEMDPEGKIKCTMAPFWAHSNPEELQ--  309

Query  1174  SLSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYK  1353
                    W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R + 
Sbjct  310   -------WRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQKTSPEKNERVHP  361

Query  1354  LSAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
             +    DCQ  L  +  R     D+N     ++A+   LK  +  LC V+D S+   +A  
Sbjct  362   VRPVCDCQAHLLWNRPRFGEINDRNRTEQYIQALRTVLKPDSVCLC-VSDGSLLSMLA--  418

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             +H  A  V ++           L       ++  D I +++KR   LT  D   +KV LL
Sbjct  419   YHLGAEQVFTV---ENSAASHRLMKKIFRANHLEDKINIIEKRPELLTPADLEGKKVSLL  475

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  + S+LPW NL FW
Sbjct  476   LGEPFF--TTSLLPWHNLYFW  494


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_010849278.1| PREDICTED: protein arginine N-methyltransferase 7 [Bison bison 
bison]
Length=695

 Score =   150 bits (379),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 113/380 (30%), Positives = 177/380 (47%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+  + E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQANCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   ++   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IRVQTSRGERVIIPPLELERC---PGAPSVCDIQLNQVSPADFTILSDVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L+     G A  ++SWW +++D EG +  +  P W H      DP 
Sbjct  256   VSSSAACHSRQFEPLV----SGRAQVVLSWWDIEMDPEGKIKCTMAPSWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R + +
Sbjct  307   ---ELQWRDHWMQCVYFLPQEEPVVQGLALC-LVAYHDDYCVWYSLQKTSPEKNGRVHPV  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D+N     ++A+   LK  +  LC V+D S+   +A  +
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDRNRTDQYIQALRTVLKPDSVCLC-VSDGSLLSMLA--Y  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++           L       ++  D I +++KR   LT  D   +KV  L+
Sbjct  420   HLGVEQVFTI---ENSAASHRLMKKIFKANHLEDKINIIEKRPELLTPADLEGKKVSFLL  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  477   GEPFF--TTSLLPWHNLYFW  494


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>tpg|DAA20070.1| TPA: protein arginine N-methyltransferase 7 [Bos taurus]
Length=695

 Score =   150 bits (379),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 114/380 (30%), Positives = 181/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+  + E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQANCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   ++   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IRVQTSRGERVIIPPLELERC---PGAPSVCDIQLNQVSPADFTILSDVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L+     G A  ++SWW +++D EG +  +  P W H      DP 
Sbjct  256   VSSSAACHSRQFEPLV----SGRAQVVLSWWDIEMDPEGKIKCTMAPSWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R + +
Sbjct  307   ---ELQWRDHWMQCVYFLPQEEPVVQGLALC-LVAYHDDYCVWYSLQKTSPEKNGRVHPV  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D+N     ++A+   LK  +  LC V+D S+   +A  +
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDRNRTDQYIQALRTVLKPDSVCLC-VSDGSLLSMLA--Y  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + ++ +  +N    D I +++KR   LT  D   +KV LL+
Sbjct  420   HLGVEQVFTIENSA--VSHRLMKKIFKANHLE-DKINIIEKRPELLTPADLEGKKVSLLL  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  477   GEPFF--TTSLLPWHNLYFW  494


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_009676558.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Struthio camelus australis]
Length=698

 Score =   150 bits (379),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 109/382 (29%), Positives = 184/382 (48%), Gaps = 41/382 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH++L+ E  E VP+R T++ QL ESK +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHEHLVQEGCEAVPHRATVYVQLAESKRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VRVEAEDGEKVIVSPSEMENCPGVPSVCDIQLNQMP------SSDFTILSDVVVMFSVDF  252

Query  1003  WKRPDS-SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSL  1179
              K   S S    + ++  K G A  ++SWW + +D  G +  +  P W+   S  +    
Sbjct  253   SKPVRSASAYYRVQLEPVKSGKAQIVLSWWDMDMDPSGKINCTMAPYWVKPTSAFQ----  308

Query  1180  SCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLS  1359
                  W DHW QCV+F+PN    V + E V+L A   + ++ Y ++   +       ++ 
Sbjct  309   -----WRDHWMQCVYFLPN-EEPVFQGENVYLTAYRDEYSVWYKLQKAREEENKADVRVD  362

Query  1360  AQDCQ----LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
             +  C+    L  +  R     D+N     + ++   LK  +  LCI +D S+   +A  H
Sbjct  363   SPVCRCQAHLLWNRPRFGELNDQNRTRQYINSLTKVLKTDSVCLCI-SDGSLLPVLA--H  419

Query  1528  HARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDL  1701
             +  A  V +L           ++L+A     ++  D IK+++ R   LT      RK+ +
Sbjct  420   YLGAKQVFTLENSAVSCSVMGKFLKA-----NHLEDKIKIVEARPELLTPSHLEDRKISV  474

Query  1702  LIAEPFYYGSDSVLPWQNLRFW  1767
             L+ EPF+  + S+LPW NL FW
Sbjct  475   LLGEPFF--TTSLLPWHNLYFW  494


 Score = 68.9 bits (167),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 63/137 (46%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E     Q     +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGAMEWLEEDEDYDYHQE----IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_009926628.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X4 
[Haliaeetus albicilla]
Length=610

 Score =   149 bits (376),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 187/385 (49%), Gaps = 46/385 (12%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + L  
Sbjct  60    NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYIQLVESKRMWSWNKLLP  119

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  120   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SNDFTILSDVVTMFSVDF  173

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  I+SWW + +D  G +  +  P W+   S  +   
Sbjct  174   -SKPVRSASTYYRVQLEPVKSGKAQIILSWWDIDMDPSGKINCTMAPYWVKSTSAFQ---  229

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y ++ +++  E  +  +
Sbjct  230   ------WRDHWMQCVYFLPN-EEPVLQGETVYLTACRDEYSVWYKLQ-KARGPEENKADV  281

Query  1357  SAQD----CQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIA  1518
               +     CQ  L  +  R     D+N     +K++   LK  +  LCI +D S+   +A
Sbjct  282   CVESPVCRCQAHLLWNRPRFGALNDQNRTSQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA  340

Query  1519  LGHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRK  1692
               H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K
Sbjct  341   --HYLGAKQVFTLENSAVACSVMEKFXKA-----NHLDDKIKIIEARPELLTTSHLEDKK  393

Query  1693  VDLLIAEPFYYGSDSVLPWQNLRFW  1767
             + +L+ EPF+  + S+LPW NL FW
Sbjct  394   ISVLVGEPFF--TTSLLPWHNLYFW  416



>ref|XP_004600955.1| PREDICTED: protein arginine N-methyltransferase 7 [Sorex araneus]
Length=699

 Score =   150 bits (379),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 113/377 (30%), Positives = 179/377 (47%), Gaps = 31/377 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ +  E VP++ T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHRHLVQDPCEAVPHKATVYAQLVESRKMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQ-FPMHCDAISEG-IKLLSEPFKIFDFDFWKRPDS  1020
                + S    ++   ++   C      + +  + +S     +LS    +F  DF K+  S
Sbjct  199   VHVETSLGKQVIVPPLELERCPGAPSVYDIQLNQVSPADFTVLSNVLPMFSVDFSKQVSS  258

Query  1021  -----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSC  1185
                  SR+ +LL      G A  ++SWW +++D EG +  +  P W H      DP    
Sbjct  259   AAACHSRQFQLL----ASGRAQVVLSWWDIEMDPEGKIKCTMAPFWAH-----SDPE---  306

Query  1186  SEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKLSAQ  1365
                W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R   +   
Sbjct  307   ELQWRDHWMQCVYFLPQEEPVVQGSALC-LIAHHDDYCVWYSLQRTSPAKNGRALPVRPV  365

Query  1366  -DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++      +A+   LK   + LC V+D S+   +A  HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDQYAQALRTVLKPGGACLC-VSDGSLLPMLA--HHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
             A  V ++           L       ++  D I +++KR   LT +D   RKV +L+ EP
Sbjct  423   AQQVFTV---ESSAASHRLMKKIFKANHLEDKINIIEKRPELLTSEDLEGRKVSVLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW  1767
             F+  + S+LPW NL FW
Sbjct  480   FF--TTSLLPWHNLYFW  494


 Score = 69.7 bits (169),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTV-  316
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V 
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVR  57

Query  317  -----TKPCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
                  +   VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>gb|KFQ11527.1| Protein arginine N-methyltransferase 7, partial [Haliaeetus albicilla]
Length=688

 Score =   150 bits (379),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 113/383 (30%), Positives = 183/383 (48%), Gaps = 42/383 (11%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + L  
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYIQLVESKRMWSWNKLLP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SNDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  I+SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIILSWWDIDMDPSGKINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y ++ +++  E  +  +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGETVYLTACRDEYSVWYKLQ-KARGPEENKADV  360

Query  1357  SAQD----CQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIA  1518
               +     CQ  L  +  R     D+N     +K++   LK  +  LCI +D S+   +A
Sbjct  361   CVESPVCRCQAHLLWNRPRFGALNDQNRTSQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA  419

Query  1519  LGHHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVD  1698
               H+  A  V   F  LQ            +N    D IK+++ R   LT      +K+ 
Sbjct  420   --HYLGAKQVQYFF--LQYTTSSPPPXXXKANHLD-DKIKIIEARPELLTTSHLEDKKIS  474

Query  1699  LLIAEPFYYGSDSVLPWQNLRFW  1767
             +L+ EPF+  + S+LPW NL FW
Sbjct  475   VLVGEPFF--TTSLLPWHNLYFW  495


 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 63/137 (46%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V 
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNTKYYQGIRAAVN  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_005218626.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Bos taurus]
Length=700

 Score =   150 bits (379),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 114/380 (30%), Positives = 181/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+  + E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQANCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   ++   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IRVQTSRGERVIIPPLELERC---PGAPSVCDIQLNQVSPADFTILSDVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L+     G A  ++SWW +++D EG +  +  P W H      DP 
Sbjct  256   VSSSAACHSRQFEPLV----SGRAQVVLSWWDIEMDPEGKIKCTMAPSWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R + +
Sbjct  307   ---ELQWRDHWMQCVYFLPQEEPVVQGLALC-LVAYHDDYCVWYSLQKTSPEKNGRVHPV  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D+N     ++A+   LK  +  LC V+D S+   +A  +
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDRNRTDQYIQALRTVLKPDSVCLC-VSDGSLLSMLA--Y  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + ++ +  +N    D I +++KR   LT  D   +KV LL+
Sbjct  420   HLGVEQVFTIENSA--VSHRLMKKIFKANHLE-DKINIIEKRPELLTPADLEGKKVSLLL  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  477   GEPFF--TTSLLPWHNLYFW  494


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|NP_001095460.1| protein arginine N-methyltransferase 7 [Bos taurus]
 sp|A6QQV6.1|ANM7_BOVIN RecName: Full=Protein arginine N-methyltransferase 7; AltName: 
Full=Histone-arginine N-methyltransferase PRMT7; AltName: 
Full=[Myelin basic protein]-arginine N-methyltransferase PRMT7 
[Bos taurus]
 gb|AAI50010.1| PRMT7 protein [Bos taurus]
Length=695

 Score =   150 bits (379),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 114/380 (30%), Positives = 181/380 (48%), Gaps = 37/380 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+  + E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQANCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   ++   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IRVQTSRGERVIIPPLELERC---PGAPSVCDIQLNQVSPADFTILSDVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               S     SR+ E L+     G A  ++SWW +++D EG +  +  P W H      DP 
Sbjct  256   VSSSAACHSRQFEPLV----SGRAQVVLSWWDIEMDPEGKIKCTMAPSWAH-----SDPE  306

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R + +
Sbjct  307   ---ELQWRDHWMQCVYFLPQEEPVVQGLALC-LVAYHDDYCVWYSLQKTSPEKNGRVHPV  362

Query  1357  SAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGH  1527
                 DCQ  L  +  R     D+N     ++A+   LK  +  LC V+D S+   +A  +
Sbjct  363   RPVCDCQAHLLWNRPRFGEINDRNRTDQYIQALRTVLKPDSVCLC-VSDGSLLSMLA--Y  419

Query  1528  HARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLI  1707
             H     V ++         + ++ +  +N    D I +++KR   LT  D   +KV LL+
Sbjct  420   HLGVEQVFTIENSA--VSHRLMKKIFKANHLE-DKINIIEKRPELLTPADLEGKKVSLLL  476

Query  1708  AEPFYYGSDSVLPWQNLRFW  1767
              EPF+  + S+LPW NL FW
Sbjct  477   GEPFF--TTSLLPWHNLYFW  494


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_009926627.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X3 
[Haliaeetus albicilla]
Length=637

 Score =   149 bits (377),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 187/385 (49%), Gaps = 46/385 (12%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVESK +W  + L  
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYIQLVESKRMWSWNKLLP  198

Query  847   NEEKASDTIHLVPK--------GMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D   ++          G+ ++  ++  Q P      S    +LS+   +F  DF
Sbjct  199   VHVEAEDGEKIIVSPSEMENCPGVPSVCDIQLNQMP------SNDFTILSDVVTMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  I+SWW + +D  G +  +  P W+   S  +   
Sbjct  253   -SKPVRSASTYYRVQLEPVKSGKAQIILSWWDIDMDPSGKINCTMAPYWVKSTSAFQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+PN    V + E V+L A   + ++ Y ++ +++  E  +  +
Sbjct  309   ------WRDHWMQCVYFLPN-EEPVLQGETVYLTACRDEYSVWYKLQ-KARGPEENKADV  360

Query  1357  SAQD----CQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIA  1518
               +     CQ  L  +  R     D+N     +K++   LK  +  LCI +D S+   +A
Sbjct  361   CVESPVCRCQAHLLWNRPRFGALNDQNRTSQYIKSLMKVLKTDSVCLCI-SDGSLLPVLA  419

Query  1519  LGHHARASNVISLFPGLQDKG--EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRK  1692
               H+  A  V +L          E++ +A     ++  D IK+++ R   LT      +K
Sbjct  420   --HYLGAKQVFTLENSAVACSVMEKFXKA-----NHLDDKIKIIEARPELLTTSHLEDKK  472

Query  1693  VDLLIAEPFYYGSDSVLPWQNLRFW  1767
             + +L+ EPF+  + S+LPW NL FW
Sbjct  473   ISVLVGEPFF--TTSLLPWHNLYFW  495


 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 63/137 (46%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG  EW+  +E+    Q     +A + Y DML+D  RN  + + I   V 
Sbjct  2    KTFCGRANPTTGAMEWLEEDENYDYHQE----IARSRYADMLHDKDRNTKYYQGIRAAVN  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAVEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFRDKIKVINKHS  123



>ref|XP_009088892.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Serinus canaria]
Length=689

 Score =   150 bits (378),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 114/389 (29%), Positives = 189/389 (49%), Gaps = 53/389 (14%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +PT +HAH  L+ E  E VP+R T++ QLVES+ +W    LF 
Sbjct  139   NILVTELFDTELIGEGALPTYEHAHKYLVQEGCEAVPHRATVYVQLVESRRMWSWKKLFP  198

Query  847   NEEKASDTIH-LVP-------KGMDTIICVKHQQFPMHCDAISEGIKLLSEPFKIFDFDF  1002
                +A D    LVP        G+ ++  V+  Q P      S    +LS+  K+F  DF
Sbjct  199   VHVEAEDGEKILVPPSEMENCPGLPSVCDVQLNQMP------SSDFSILSDVVKMFSVDF  252

Query  1003  WKRPDSSRET--ELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPS  1176
               +P  S  T   + ++  K G A  ++SWW + +D  G +  S  P W+   S ++   
Sbjct  253   -SKPVQSASTCYRVQLEPVKSGKAQIVLSWWDIDMDPSGMINCSMAPYWVKPTSALQ---  308

Query  1177  LSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYKL  1356
                   W DHW QCV+F+P+    V + E ++L A   + ++ Y ++    + E  +  +
Sbjct  309   ------WRDHWMQCVYFLPH-EEPVLQGEKLYLTACRDEYSVWYNLQKARADEEEHKADV  361

Query  1357  SAQD------CQLFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIA  1518
               +         L  +  R     D+N     ++++   LK  +  LCI +D S+   +A
Sbjct  362   CVESPVCRCRAHLLWNRPRFGQLNDQNRTQQYIQSLRRVLKTDSVCLCI-SDGSLLPVLA  420

Query  1519  LGHHARASNVISLFPGLQDKG------EQYLQAVAASNDYSMDCIKVLKKRSSALTMQDT  1680
               H+  A  V +    L++ G      E++L+A    N+   D IK+++ R   L     
Sbjct  421   --HYLGAKQVFT----LENSGVSCSVMEKFLKA----NNLE-DKIKIIEARPELLKPSHL  469

Query  1681  HHRKVDLLIAEPFYYGSDSVLPWQNLRFW  1767
               +K+ +L+ EPF+  + S+LPW NL FW
Sbjct  470   EDKKISVLVGEPFF--TTSLLPWHNLYFW  496


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            + F  + +P TG+ EW  +EE +  +      +A + Y DML+D  RN  + + I   V+
Sbjct  2    KTFCGRANPTTGSMEW--LEEGEDYDYHQE--IARSRYADMLHDKDRNVKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMAA A                 A E + PM     K+
Sbjct  58   RVKERGEKAIVLDIGTGTGLLSMMAASA-----------GADFCYAIEVFKPMANAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_005956909.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Pantholops hodgsonii]
Length=708

 Score =   150 bits (379),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 114/381 (30%), Positives = 181/381 (48%), Gaps = 39/381 (10%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  ++E+ D+EL+GEG +P+ +HAH +L+  + E VP+R T++ QLVES+ +W  + LF 
Sbjct  139   NILITELFDTELIGEGALPSYEHAHRHLVQANCEAVPHRATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++   ++   C      P  CD            +LS+   +F  DF K+
Sbjct  199   ICVQTSRGERVIIPHLELERC---PGAPSVCDIQLNQVSPADFTILSDVLPMFSVDFSKQ  255

Query  1012  PDS-----SRETELLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHC-PSDVKDP  1173
               S     SR+ E L+     G A  ++SWW +++D EG +  +  P W H  P +++  
Sbjct  256   VSSSAACHSRQFEPLV----SGRAQVVLSWWDIEMDPEGKIKCTMAPFWAHSNPEELQ--  309

Query  1174  SLSCSEAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQSQNMEVRQYK  1353
                    W DHW QCV+F+P     VQ      L A H D  + Y ++  S     R + 
Sbjct  310   -------WRDHWMQCVYFLPQEEPVVQGSALC-LVAHHDDYCVWYSLQKTSPEKNERVHP  361

Query  1354  LSAQ-DCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALG  1524
             +    DCQ  L  +  R     D+N     ++A+   LK  +  LC V+D S+   +A  
Sbjct  362   VRPVCDCQAHLLWNRPRFGEINDRNRTEQYIQALRTVLKPDSVCLC-VSDGSLLSMLA--  418

Query  1525  HHARASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLL  1704
             +H  A  V ++           L       ++  D I +++KR   LT  D   +KV LL
Sbjct  419   YHLGAEQVFTV---ENSAASHRLMKKIFRANHLEDKINIIEKRPELLTPADLEGKKVSLL  475

Query  1705  IAEPFYYGSDSVLPWQNLRFW  1767
             + EPF+  + S+LPW NL FW
Sbjct  476   LGEPFF--TTSLLPWHNLYFW  494


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 65/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNMKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA  A                 A E + PM     K+
Sbjct  58   RVKDRGQKALVLDIGTGTGLLSMMAVTA-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



>ref|XP_006156972.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X1 
[Tupaia chinensis]
 ref|XP_006156973.1| PREDICTED: protein arginine N-methyltransferase 7 isoform X2 
[Tupaia chinensis]
Length=699

 Score =   150 bits (378),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 111/377 (29%), Positives = 178/377 (47%), Gaps = 31/377 (8%)
 Frame = +1

Query  667   NNTVSEILDSELLGEGLIPTLQHAHDNLLVESPETVPYRGTIFGQLVESKDLWKMHDLFN  846
             N  V+E+ D+EL+GEG +P+ +HAH +L+ E  E VP++ T++ QLVES+ +W  + LF 
Sbjct  139   NILVTELFDTELIGEGALPSYEHAHQHLVQEGCEAVPHKATVYAQLVESRRMWSWNKLFP  198

Query  847   NEEKASDTIHLVPKGMDTIICVKHQQFPMHCD-----AISEGIKLLSEPFKIFDFDFWKR  1011
                + S    ++    +   C      P  CD            +LS+   +F  DF K+
Sbjct  199   IHVQTSLGERVIVPPAELESC---PGAPSVCDIQLNQVSPSDFTVLSDVLPMFSVDFSKQ  255

Query  1012  PDSSRETE-LLIKATKGGTAHAIISWWLLQLDREGTVFYSTGPKWIHCPSDVKDPSLSCS  1188
               SS        +    G A  ++SWW +++D EG +  +  P W H      DP     
Sbjct  256   VSSSAACHGRPFEPVASGQAQVVLSWWDIEMDPEGKIRCTMAPFWAH-----SDPE---G  307

Query  1189  EAWCDHWKQCVWFIPNIGLSVQKDEYVHLHAVHTDINLSYVVKTQS--QNMEVRQYKLSA  1362
               W DHW QCV+F+P     V++   + L A H D  + Y ++  S  +N  V Q +   
Sbjct  308   LQWRDHWMQCVYFLPQ-EEPVEQGSALCLVAHHDDYCVWYSLQRTSPEENGRVSQMR-PV  365

Query  1363  QDCQ--LFLSPERIAIYGDKNWRCSMLKAINNALKQKASPLCIVADDSIFLTIALGHHAR  1536
              DCQ  L  +  R     D++     ++A+   L  +A  +C+   D   L++ L HH  
Sbjct  366   CDCQAHLLWNRPRFGEINDQDRTDQYIQALRTVL--RADSVCLCVSDGSLLSV-LAHHLG  422

Query  1537  ASNVISLFPGLQDKGEQYLQAVAASNDYSMDCIKVLKKRSSALTMQDTHHRKVDLLIAEP  1716
             A  V ++         + ++ +  +N      I ++ KR   LT  D   +KV LL+ EP
Sbjct  423   AEQVFTV--ESSTASHKLMKKIFKANHLEGK-INIIAKRPELLTSADLEGKKVSLLLGEP  479

Query  1717  FYYGSDSVLPWQNLRFW  1767
             F+  + S+LPW NL FW
Sbjct  480   FF--TTSLLPWHNLYFW  494


 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 64/137 (47%), Gaps = 21/137 (15%)
 Frame = +2

Query  140  RMFQLKLDPLTGNSEWVVIEESDTPEQTPTPLLATTSYLDMLNDSPRNRAFREAIDKTVT  319
            ++F  + +P TG+ EW+  +E     Q     +A +SY DML+D  RN  + + I   V+
Sbjct  2    KVFCGRANPTTGSVEWLEEDEHYDYHQE----IARSSYADMLHDKDRNIKYYQGIRAAVS  57

Query  320  K------PCHVLDIGAGTGLLSMMAARAMGPADSASNSDSKGMVTACESYLPMVKLMRKV  481
            +         VLDIG GTGLLSMMA                    A E + PM     K+
Sbjct  58   RVKDRGQKAVVLDIGTGTGLLSMMAVTV-----------GADFCYAIEVFKPMADAAVKI  106

Query  482  LRANGIERGIRIINKRS  532
            +  NG    I++INK S
Sbjct  107  VEKNGFSDKIKVINKHS  123



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5869337085684