BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23709_g1_i6 len=1579 path=[2491:0-384 2875:385-589 2418:590-616
10192:617-629 10205:630-644 3132:645-879 3367:880-915 3402:916-925
820:926-951 10288:952-963 3448:964-1146 3631:1147-1182
3667:1183-1277 3762:1278-1578]

Length=1579
                                                                      Score     E

ref|XP_011075851.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    503   7e-173   
gb|EYU45341.1|  hypothetical protein MIMGU_mgv1a009902mg                503   1e-172   
emb|CDP09298.1|  unnamed protein product                                499   4e-171   
ref|XP_011084590.1|  PREDICTED: transcription factor HBP-1b(c38)-...    497   2e-170   
ref|XP_009794636.1|  PREDICTED: transcription factor TGA2-like          487   1e-166   
ref|XP_009627416.1|  PREDICTED: transcription factor HBP-1b(c38)-...    484   1e-165   
ref|XP_009803516.1|  PREDICTED: transcription factor HBP-1b(c38)-...    483   4e-165   
ref|XP_006356348.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    481   2e-164   
ref|XP_010313245.1|  PREDICTED: transcription factor HBP-1b(c38)        479   2e-163   
gb|EPS67211.1|  hypothetical protein M569_07557                         467   9e-159   
ref|XP_006465763.1|  PREDICTED: transcription factor TGA6-like is...    452   6e-153   
ref|XP_006432426.1|  hypothetical protein CICLE_v100010812mg            452   9e-153   
gb|AGD98703.1|  bZIP transcription factor family protein 5              451   2e-152   
ref|XP_003627926.1|  TGA transcription factor                           456   3e-152   
gb|KDP40547.1|  hypothetical protein JCGZ_24546                         455   4e-152   
gb|AFK47127.1|  unknown                                                 455   8e-152   
ref|XP_006465757.1|  PREDICTED: transcription factor TGA6-like is...    454   1e-151   
ref|XP_006432430.1|  hypothetical protein CICLE_v100010812mg            454   2e-151   
ref|XP_006432427.1|  hypothetical protein CICLE_v100010812mg            453   2e-151   
ref|XP_006465760.1|  PREDICTED: transcription factor TGA6-like is...    453   2e-151   
ref|XP_004511049.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    454   2e-151   
ref|XP_002263159.2|  PREDICTED: transcription factor TGA2 isoform X2    453   5e-151   Vitis vinifera
ref|XP_011020421.1|  PREDICTED: transcription factor TGA2-like is...    453   6e-151   
ref|XP_011020425.1|  PREDICTED: transcription factor TGA2-like is...    453   7e-151   
ref|XP_010659087.1|  PREDICTED: transcription factor TGA2 isoform X1    452   7e-151   
ref|XP_002303938.2|  hypothetical protein POPTR_0003s19410g             452   1e-150   Populus trichocarpa [western balsam poplar]
gb|KHG29238.1|  hypothetical protein F383_00102                         451   3e-150   
ref|XP_010095986.1|  Transcription factor HBP-1b(c1)                    447   4e-150   
ref|XP_007028143.1|  TGACG motif-binding factor 6 isoform 1             449   9e-150   
ref|XP_002513027.1|  Transcription factor HBP-1b(c1), putative          449   9e-150   Ricinus communis
ref|XP_006605394.1|  PREDICTED: uncharacterized protein LOC100816...    444   1e-149   
ref|XP_007142625.1|  hypothetical protein PHAVU_007G003600g             449   1e-149   
ref|XP_007133721.1|  hypothetical protein PHAVU_011G203400g             449   2e-149   
ref|XP_008231625.1|  PREDICTED: transcription factor TGA2-like          443   4e-149   
ref|XP_006605392.1|  PREDICTED: uncharacterized protein LOC100816...    446   6e-149   
ref|XP_009372782.1|  PREDICTED: transcription factor TGA2-like          442   8e-149   
ref|NP_001242879.1|  uncharacterized protein LOC100816123               445   1e-148   
ref|XP_006368634.1|  hypothetical protein POPTR_0001s06700g             446   2e-148   
ref|XP_006605391.1|  PREDICTED: uncharacterized protein LOC100816...    445   2e-148   
gb|KHN37272.1|  Transcription factor HBP-1b(c1)                         441   2e-148   
ref|XP_003546706.1|  PREDICTED: transcription factor HBP-1b(c1) i...    446   3e-148   
ref|XP_008375358.1|  PREDICTED: transcription factor TGA2-like          440   7e-148   
gb|ACU78078.1|  TGA1a-related protein 6                                 439   1e-147   
ref|XP_006598094.1|  PREDICTED: transcription factor HBP-1b(c1) i...    445   1e-147   
gb|KHN37699.1|  Transcription factor HBP-1b(c1)                         442   2e-147   
ref|XP_009361886.1|  PREDICTED: transcription factor TGA2-like          439   2e-147   
ref|NP_001237963.1|  bZIP transcription factor bZIP99                   442   6e-147   
ref|XP_006594375.1|  PREDICTED: transcription factor HBP-1b(c1) i...    442   1e-146   
ref|XP_010245498.1|  PREDICTED: transcription factor TGA2-like is...    442   1e-146   
ref|XP_010247478.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    441   3e-146   
gb|KHG21339.1|  hypothetical protein F383_27590                         440   4e-146   
ref|XP_011000603.1|  PREDICTED: transcription factor TGA2-like is...    441   4e-146   
ref|XP_011000608.1|  PREDICTED: transcription factor TGA2-like is...    440   6e-146   
ref|XP_004228505.1|  PREDICTED: transcription factor HBP-1b(c38)-...    434   1e-145   
ref|XP_006432429.1|  hypothetical protein CICLE_v100010812mg            438   2e-145   
ref|XP_004498681.1|  PREDICTED: transcription factor TGA6-like is...    434   2e-145   
ref|XP_008446973.1|  PREDICTED: transcription factor TGA2-like is...    433   3e-145   
ref|XP_003632741.1|  PREDICTED: transcription factor HBP-1b(c38)        437   5e-145   
ref|XP_004307087.1|  PREDICTED: transcription factor HBP-1b(c1)-like    432   6e-145   
gb|KHG00991.1|  hypothetical protein F383_22932                         435   6e-145   
ref|XP_007028137.1|  Transcription factor HBP-1b(c1) isoform 3          431   1e-144   
ref|XP_008445387.1|  PREDICTED: transcription factor TGA2-like          431   2e-144   
ref|XP_004142384.1|  PREDICTED: transcription factor HBP-1b(c1)-like    431   2e-144   
ref|XP_004165289.1|  PREDICTED: transcription factor HBP-1b(c1)-like    431   3e-144   
ref|XP_004498677.1|  PREDICTED: transcription factor TGA6-like is...    434   3e-144   
gb|KGN52332.1|  hypothetical protein Csa_5G624430                       431   3e-144   
ref|XP_004498678.1|  PREDICTED: transcription factor TGA6-like is...    434   3e-144   
ref|XP_004498680.1|  PREDICTED: transcription factor TGA6-like is...    432   4e-144   
ref|XP_010670519.1|  PREDICTED: transcription factor TGA6 isoform X2    432   4e-144   
ref|XP_004498676.1|  PREDICTED: transcription factor TGA6-like is...    434   5e-144   
ref|XP_010067716.1|  PREDICTED: transcription factor TGA2               428   2e-143   
gb|ADK74339.1|  bZIP transcription factor                               432   2e-143   
ref|XP_010670518.1|  PREDICTED: transcription factor TGA6 isoform X1    432   2e-143   
gb|KHG28384.1|  Transcription factor HBP-1b                             428   3e-143   
ref|XP_007203875.1|  hypothetical protein PRUPE_ppa005279mg             432   6e-143   
ref|XP_004146772.1|  PREDICTED: transcription factor HBP-1b(c1)-like    427   6e-143   
ref|XP_009803519.1|  PREDICTED: transcription factor HBP-1b(c38)-...    425   9e-143   
ref|XP_009803518.1|  PREDICTED: transcription factor HBP-1b(c38)-...    424   2e-142   
ref|XP_004303596.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    429   5e-142   
ref|XP_004249310.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    428   8e-142   
emb|CDM83014.1|  unnamed protein product                                424   9e-142   
ref|XP_006351371.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    428   9e-142   
ref|XP_003564436.1|  PREDICTED: transcription factor HBP-1b(c1)         427   6e-141   
sp|P23923.1|HBP1B_WHEAT  RecName: Full=Transcription factor HBP-1...    422   7e-141   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009414219.1|  PREDICTED: transcription factor HBP-1b(c38)-...    425   9e-141   
ref|XP_009384968.1|  PREDICTED: transcription factor HBP-1b(c38)-...    425   2e-140   
ref|XP_009414215.1|  PREDICTED: transcription factor HBP-1b(c38)-...    426   2e-140   
gb|EPS70828.1|  hypothetical protein M569_03931                         425   3e-140   
ref|XP_008350323.1|  PREDICTED: transcription factor HBP-1b(c38)-...    424   4e-140   
ref|XP_003558037.1|  PREDICTED: transcription factor TGA2-like is...    420   4e-140   
ref|XP_010557921.1|  PREDICTED: transcription factor TGA6               420   5e-140   
ref|XP_011079069.1|  PREDICTED: transcription factor HBP-1b(c38)-...    424   5e-140   
gb|EYU20805.1|  hypothetical protein MIMGU_mgv1a006646mg                423   7e-140   
ref|XP_009338082.1|  PREDICTED: transcription factor HBP-1b(c38)-...    423   9e-140   
ref|XP_002458658.1|  hypothetical protein SORBIDRAFT_03g037560          424   1e-139   Sorghum bicolor [broomcorn]
ref|XP_011027238.1|  PREDICTED: transcription factor HBP-1b(c38)-...    421   1e-139   
ref|XP_006399172.1|  hypothetical protein EUTSA_v10014082mg             418   2e-139   
ref|XP_009419684.1|  PREDICTED: transcription factor HBP-1b(c38)-...    417   3e-139   
gb|ABR46137.1|  bZIP transcription factor TGA2                          417   4e-139   Arabidopsis lyrata [lyrate rockcress]
ref|XP_010520066.1|  PREDICTED: transcription factor TGA6-like is...    417   4e-139   
ref|XP_011027237.1|  PREDICTED: transcription factor HBP-1b(c38)-...    421   5e-139   
ref|XP_002307972.2|  hypothetical protein POPTR_0006s03720g             422   6e-139   Populus trichocarpa [western balsam poplar]
ref|XP_011027235.1|  PREDICTED: transcription factor HBP-1b(c38)-...    421   1e-138   
ref|XP_002871242.1|  bZIP transcription factor TGA2                     416   1e-138   
ref|XP_004984573.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    416   1e-138   
ref|XP_010245499.1|  PREDICTED: transcription factor TGA2-like is...    420   3e-138   
ref|XP_009412198.1|  PREDICTED: transcription factor HBP-1b(c1)-like    415   3e-138   
ref|XP_009419683.1|  PREDICTED: transcription factor HBP-1b(c38)-...    419   5e-138   
gb|AGH18703.1|  TGA-type basic leucine zipper protein                   414   5e-138   
ref|XP_006644064.1|  PREDICTED: transcription factor HBP-1b(c38)-...    414   5e-138   
ref|XP_010055972.1|  PREDICTED: transcription factor HBP-1b(c38)-...    419   5e-138   
ref|XP_010245493.1|  PREDICTED: transcription factor TGA2-like is...    421   5e-138   
ref|XP_009419682.1|  PREDICTED: transcription factor HBP-1b(c38)-...    419   6e-138   
ref|XP_011000427.1|  PREDICTED: transcription factor HBP-1b(c38)-...    414   7e-138   
ref|XP_006649994.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    414   7e-138   
gb|AHF20184.1|  bzip transcription factor                               418   9e-138   
gb|KCW65891.1|  hypothetical protein EUGRSUZ_G03217                     413   1e-137   
ref|XP_006832856.1|  hypothetical protein AMTR_s00095p00059370          417   1e-137   
ref|XP_011020430.1|  PREDICTED: transcription factor TGA2-like is...    416   4e-137   
gb|AHN63210.1|  transcription factor TGA2                               417   4e-137   
ref|NP_001049945.1|  Os03g0318600                                       412   4e-137   Oryza sativa Japonica Group [Japonica rice]
ref|NP_566415.3|  transcription factor TGA6                             412   4e-137   Arabidopsis thaliana [mouse-ear cress]
gb|ABN09201.1|  TGA transcription factor 2                              412   5e-137   Populus tremula x Populus alba [gray poplar]
gb|KDP29258.1|  hypothetical protein JCGZ_16647                         417   6e-137   
ref|XP_009393095.1|  PREDICTED: transcription factor HBP-1b(c1)-like    412   6e-137   
ref|XP_010534337.1|  PREDICTED: transcription factor TGA6-like is...    412   7e-137   
gb|KDO44924.1|  hypothetical protein CISIN_1g015258mg                   412   8e-137   
ref|XP_009146627.1|  PREDICTED: transcription factor TGA6 isoform X1    411   8e-137   
ref|XP_004493401.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    415   2e-136   
ref|XP_006421095.1|  hypothetical protein CICLE_v10005080mg             414   2e-136   
emb|CDP09569.1|  unnamed protein product                                415   2e-136   
ref|XP_011075425.1|  PREDICTED: transcription factor HBP-1b(c38)-...    415   2e-136   
emb|CDY08443.1|  BnaA05g26790D                                          410   3e-136   
ref|XP_002323247.1|  DNA-binding protein VBP1                           414   4e-136   Populus trichocarpa [western balsam poplar]
gb|ACV53508.1|  leucine zipper transcription factor TGA                 414   5e-136   Capsicum annuum
ref|XP_011000426.1|  PREDICTED: transcription factor HBP-1b(c38)-...    414   6e-136   
ref|XP_008658211.1|  PREDICTED: uncharacterized protein LOC100217...    409   6e-136   
dbj|BAB72064.1|  bZIP transcription factor                              409   6e-136   Oryza sativa [red rice]
ref|XP_009135220.1|  PREDICTED: transcription factor TGA6-like          409   7e-136   
dbj|BAO45899.1|  basic leucine zipper protein                           413   8e-136   
dbj|BAB72061.1|  bZIP transcription factor                              409   8e-136   Oryza sativa [red rice]
dbj|BAJ94197.1|  predicted protein                                      414   1e-135   
ref|XP_006644874.1|  PREDICTED: transcription factor HBP-1b(c1)-like    409   1e-135   
sp|Q41558.2|HBP1C_WHEAT  RecName: Full=Transcription factor HBP-1...    414   1e-135   Triticum aestivum [Canadian hard winter wheat]
gb|AEF30410.1|  putative TGA2-like protein 2                            408   1e-135   
emb|CDM84630.1|  unnamed protein product                                413   2e-135   
ref|XP_009759888.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    412   2e-135   
ref|XP_004967673.1|  PREDICTED: transcription factor HBP-1b(c38)-...    408   2e-135   
ref|XP_010464983.1|  PREDICTED: transcription factor TGA6 isoform X2    408   2e-135   
ref|XP_004958749.1|  PREDICTED: transcription factor HBP-1b(c38)-...    408   2e-135   
ref|NP_001042751.1|  Os01g0279900                                       407   2e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010534328.1|  PREDICTED: transcription factor TGA6-like is...    408   2e-135   
ref|XP_007028142.1|  Transcription factor HBP-1b(c1) isoform 8          407   2e-135   
ref|NP_001141940.1|  putative bZIP transcription factor superfami...    408   2e-135   Zea mays [maize]
gb|EMS58753.1|  Transcription factor HBP-1b(c1)                         412   3e-135   
ref|XP_010498764.1|  PREDICTED: transcription factor TGA6-like is...    407   3e-135   
gb|ABP88233.1|  transcription factor bZIP98                             406   3e-135   Glycine max [soybeans]
emb|CDY00762.1|  BnaC03g37460D                                          407   3e-135   
dbj|BAD44579.1|  bZip transcription factor TGA6 / AtbZip45              407   4e-135   Arabidopsis thaliana [mouse-ear cress]
gb|EMT32868.1|  putative Transcription factor HBP-1b(c1)                412   6e-135   
ref|NP_001132337.1|  putative bZIP transcription factor superfami...    406   7e-135   Zea mays [maize]
ref|XP_009120759.1|  PREDICTED: transcription factor TGA6-like is...    406   1e-134   
ref|NP_001060695.1|  Os07g0687700                                       406   1e-134   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ90602.1|  predicted protein                                      405   2e-134   
gb|KDO44920.1|  hypothetical protein CISIN_1g015258mg                   408   2e-134   
ref|XP_011075858.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    403   2e-134   
gb|AGI17587.1|  transcription factor TGA2                               408   4e-134   
ref|XP_006658160.1|  PREDICTED: transcription factor HBP-1b(c38)-...    404   5e-134   
ref|XP_003624994.1|  TGA transcription factor                           407   5e-134   
gb|AFK49203.1|  unknown                                                 409   6e-134   
ref|XP_002457410.1|  hypothetical protein SORBIDRAFT_03g006790          403   9e-134   Sorghum bicolor [broomcorn]
ref|XP_010904691.1|  PREDICTED: transcription factor HBP-1b(c38)-...    407   1e-133   
ref|XP_010904690.1|  PREDICTED: transcription factor HBP-1b(c38)-...    408   1e-133   
gb|AES81212.2|  leucine zipper transcription factor                     406   2e-133   
ref|XP_008651318.1|  PREDICTED: uncharacterized protein LOC100279...    402   2e-133   
gb|AAT28675.1|  bZIP transcription factor                               408   2e-133   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003624993.1|  TGA transcription factor                           407   2e-133   
ref|XP_006288172.1|  hypothetical protein CARUB_v10001409mg             402   3e-133   
ref|XP_010230791.1|  PREDICTED: transcription factor HBP-1b(c38)        402   3e-133   
ref|XP_004958748.1|  PREDICTED: transcription factor HBP-1b(c38)-...    402   3e-133   
gb|EEC71673.1|  hypothetical protein OsI_04142                          407   3e-133   Oryza sativa Indica Group [Indian rice]
gb|EEC82717.1|  hypothetical protein OsI_27401                          402   3e-133   Oryza sativa Indica Group [Indian rice]
gb|EEE54337.1|  hypothetical protein OsJ_01313                          403   5e-133   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70410.1|  hypothetical protein OsI_01405                          403   5e-133   Oryza sativa Indica Group [Indian rice]
ref|XP_004970302.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    406   7e-133   
gb|ADW40546.1|  bZIP transcription factor                               401   8e-133   
ref|XP_010673023.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    401   1e-132   
ref|NP_001030678.1|  transcription factor TGA6                          402   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008443255.1|  PREDICTED: transcription factor HBP-1b(c38)-...    405   1e-132   
emb|CDY52616.1|  BnaCnng22950D                                          400   1e-132   
emb|CDX98971.1|  BnaC09g48640D                                          400   2e-132   
ref|XP_010464979.1|  PREDICTED: transcription factor TGA6 isoform X1    400   2e-132   
ref|XP_010228694.1|  PREDICTED: transcription factor TGA2-like is...    399   2e-132   
ref|XP_010228695.1|  PREDICTED: transcription factor TGA2-like is...    399   2e-132   
ref|XP_009122312.1|  PREDICTED: transcription factor TGA2               399   3e-132   
ref|XP_010423270.1|  PREDICTED: transcription factor TGA2               399   3e-132   
ref|NP_196312.1|  transcription factor TGA2                             399   4e-132   Arabidopsis thaliana [mouse-ear cress]
gb|ABR46126.1|  bZIP transcription factor TGA2                          399   4e-132   Arabidopsis thaliana [mouse-ear cress]
emb|CDX70053.1|  BnaA10g24020D                                          399   5e-132   
ref|XP_010036354.1|  PREDICTED: transcription factor TGA2-like is...    403   7e-132   
ref|XP_010036355.1|  PREDICTED: transcription factor TGA2-like is...    403   8e-132   
gb|KGN59439.1|  hypothetical protein Csa_3G819960                       403   2e-131   
ref|XP_007162093.1|  hypothetical protein PHAVU_001G123300g             402   2e-131   
ref|XP_004136637.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    403   2e-131   
ref|XP_010673021.1|  PREDICTED: transcription factor HBP-1b(c38)-...    402   2e-131   
ref|XP_010673022.1|  PREDICTED: transcription factor HBP-1b(c38)-...    401   3e-131   
ref|XP_003562427.1|  PREDICTED: transcription factor HBP-1b(c38)        397   3e-131   
ref|NP_001105448.1|  octopine synthase binding factor3                  401   5e-131   Zea mays [maize]
ref|XP_006826801.1|  hypothetical protein AMTR_s00010p00030830          400   1e-130   
gb|ACN31945.1|  unknown                                                 400   2e-130   Zea mays [maize]
ref|XP_008786824.1|  PREDICTED: transcription factor TGA2-like is...    400   2e-130   
ref|XP_008786823.1|  PREDICTED: transcription factor TGA2-like is...    400   2e-130   
ref|XP_006644065.1|  PREDICTED: transcription factor HBP-1b(c38)-...    394   3e-130   
ref|XP_010464987.1|  PREDICTED: transcription factor TGA6 isoform X5    394   8e-130   
ref|XP_010486922.1|  PREDICTED: transcription factor TGA6 isoform X3    394   8e-130   
ref|XP_010498804.1|  PREDICTED: transcription factor TGA6-like is...    394   8e-130   
ref|XP_008651314.1|  PREDICTED: uncharacterized protein LOC100279...    394   1e-129   
gb|ACU20527.1|  unknown                                                 396   1e-129   Glycine max [soybeans]
ref|XP_004162630.1|  PREDICTED: LOW QUALITY PROTEIN: TGACG-sequen...    398   1e-129   
gb|AFO63289.1|  bZIP10                                                  397   2e-129   
gb|KHN08879.1|  Transcription factor HBP-1b(c1)                         395   3e-129   
ref|XP_006603764.1|  PREDICTED: bZIP transcription factor bZIP96 ...    396   4e-129   
ref|XP_006603762.1|  PREDICTED: bZIP transcription factor bZIP96 ...    396   5e-129   
ref|XP_004967674.1|  PREDICTED: transcription factor HBP-1b(c38)-...    390   8e-129   
tpg|DAA57189.1|  TPA: LOW QUALITY PROTEIN: putative bZIP transcri...    390   9e-129   
ref|XP_010922090.1|  PREDICTED: transcription factor HBP-1b(c38)-...    395   9e-129   
ref|NP_001105735.1|  LOC542756                                          390   1e-128   Zea mays [maize]
gb|EYU18627.1|  hypothetical protein MIMGU_mgv1a006504mg                394   2e-128   
ref|NP_196313.1|  OCS-element binding factor 5                          389   3e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008654394.1|  PREDICTED: putative bZIP transcription facto...    389   3e-128   
ref|XP_010491292.1|  PREDICTED: transcription factor TGA5               389   6e-128   
ref|XP_008651325.1|  PREDICTED: uncharacterized protein LOC100279...    387   8e-128   
dbj|BAJ95134.1|  predicted protein                                      389   8e-128   
ref|XP_008651324.1|  PREDICTED: uncharacterized protein LOC100279...    387   2e-127   
ref|XP_008446977.1|  PREDICTED: transcription factor TGA2-like is...    387   2e-127   
ref|XP_008651323.1|  PREDICTED: uncharacterized protein LOC100279...    387   2e-127   
ref|XP_006407352.1|  hypothetical protein EUTSA_v10021187mg             387   2e-127   
ref|XP_008651321.1|  PREDICTED: uncharacterized protein LOC100279...    387   2e-127   
ref|XP_006407351.1|  hypothetical protein EUTSA_v10021187mg             386   2e-127   
ref|XP_002871243.1|  ocs-element binding factor 5                       387   3e-127   
ref|XP_008655435.1|  PREDICTED: octopine synthase binding factor3...    394   3e-127   
ref|NP_001078141.1|  transcription factor TGA6                          386   3e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423272.1|  PREDICTED: transcription factor TGA5-like is...    387   3e-127   
gb|ACF79461.1|  unknown                                                 391   4e-127   Zea mays [maize]
ref|NP_001137124.1|  uncharacterized protein LOC100217305               385   5e-127   Zea mays [maize]
ref|XP_008788486.1|  PREDICTED: transcription factor HBP-1b(c38)-...    391   6e-127   
gb|ACF80806.1|  unknown                                                 389   6e-127   Zea mays [maize]
ref|XP_006288178.1|  hypothetical protein CARUB_v10001413mg             385   9e-127   
ref|XP_008788487.1|  PREDICTED: transcription factor HBP-1b(c38)-...    390   9e-127   
ref|NP_974293.1|  transcription factor TGA6                             385   1e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009146628.1|  PREDICTED: transcription factor TGA6 isoform X2    384   1e-126   
ref|XP_008655434.1|  PREDICTED: octopine synthase binding factor3...    391   3e-126   
ref|XP_011021829.1|  PREDICTED: transcription factor HBP-1b(c38)        388   4e-126   
ref|XP_008651313.1|  PREDICTED: uncharacterized protein LOC100279...    389   4e-126   
ref|XP_002882771.1|  hypothetical protein ARALYDRAFT_478587             384   9e-126   
ref|XP_010464986.1|  PREDICTED: transcription factor TGA6 isoform X4    381   2e-125   
ref|XP_010498795.1|  PREDICTED: transcription factor TGA6-like is...    381   2e-125   
ref|XP_007046280.1|  BZIP transcription factor family protein iso...    387   2e-125   
gb|AGH18704.1|  TGA-type basic leucine zipper protein                   383   3e-125   
dbj|BAB03134.1|  leucine zipper transcription factor HBP-1b             381   5e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002311449.2|  PERIANTHIA family protein                          385   7e-125   Populus trichocarpa [western balsam poplar]
gb|KHN30362.1|  TGACG-sequence-specific DNA-binding protein TGA-2.1     384   3e-124   
ref|XP_009120767.1|  PREDICTED: transcription factor TGA6-like is...    378   3e-124   
emb|CAA49525.1|  ocs-element binding factor 5                           377   1e-123   Arabidopsis thaliana [mouse-ear cress]
gb|AAC37470.1|  leucine zipper                                          377   1e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520068.1|  PREDICTED: transcription factor TGA6-like is...    376   2e-123   
gb|AAB02138.1|  CREB-like protein                                       380   3e-123   Vicia faba [broad bean]
ref|XP_009125669.1|  PREDICTED: transcription factor TGA5               376   3e-123   
emb|CDY14061.1|  BnaC02g01780D                                          376   4e-123   
ref|XP_009417650.1|  PREDICTED: transcription factor HBP-1b(c38)-...    380   4e-123   
emb|CDY05010.1|  BnaAnng01920D                                          375   1e-122   
ref|XP_010263259.1|  PREDICTED: transcription factor HBP-1b(c38)-...    379   1e-122   
ref|XP_010263274.1|  PREDICTED: transcription factor HBP-1b(c38)-...    379   2e-122   
ref|XP_004168679.1|  PREDICTED: transcription factor HBP-1b(c1)-like    374   9e-122   
ref|XP_008788459.1|  PREDICTED: transcription factor TGA2-like          374   1e-121   
ref|XP_008243192.1|  PREDICTED: transcription factor HBP-1b(c38)        377   1e-121   
ref|XP_007226716.1|  hypothetical protein PRUPE_ppa019842mg             375   7e-121   
ref|XP_010520069.1|  PREDICTED: transcription factor TGA6-like is...    369   9e-121   
ref|XP_006299748.1|  hypothetical protein CARUB_v10015943mg             368   1e-120   
ref|XP_010265200.1|  PREDICTED: transcription factor TGA2-like is...    374   2e-120   
ref|XP_010265199.1|  PREDICTED: transcription factor TGA2-like is...    374   2e-120   
emb|CBI27049.3|  unnamed protein product                                374   2e-120   
ref|XP_010423275.1|  PREDICTED: transcription factor TGA5-like is...    369   2e-120   
ref|XP_004150536.1|  PREDICTED: transcription factor HBP-1b(c1)-like    374   4e-120   
ref|XP_007028136.1|  BZIP domain class transcription factor isofo...    367   4e-120   
ref|XP_010647867.1|  PREDICTED: transcription factor TGA2-like          373   6e-120   
ref|XP_002969636.1|  hypothetical protein SELMODRAFT_231344             367   7e-120   
gb|AGH18702.1|  TGA-type basic leucine zipper protein                   368   8e-120   
ref|XP_003521130.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    372   9e-120   
ref|XP_006576781.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    372   1e-119   
ref|XP_006576782.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    372   1e-119   
ref|XP_008445646.1|  PREDICTED: transcription factor HBP-1b(c38) ...    372   1e-119   
ref|XP_008445645.1|  PREDICTED: transcription factor HBP-1b(c38) ...    372   1e-119   
ref|XP_009146631.1|  PREDICTED: transcription factor TGA6 isoform X5    365   2e-119   
ref|NP_001237098.1|  bZIP transcription factor bZIP96                   371   3e-119   
ref|XP_009146629.1|  PREDICTED: transcription factor TGA6 isoform X3    365   4e-119   
ref|XP_009146630.1|  PREDICTED: transcription factor TGA6 isoform X4    365   4e-119   
emb|CDY42138.1|  BnaC05g40810D                                          365   8e-119   
gb|KDP29380.1|  hypothetical protein JCGZ_18301                         369   1e-118   
ref|XP_010423276.1|  PREDICTED: transcription factor TGA5-like is...    363   4e-118   
tpg|DAA57190.1|  TPA: putative bZIP transcription factor superfam...    363   6e-118   
ref|XP_010498787.1|  PREDICTED: transcription factor TGA6-like is...    361   9e-118   
ref|XP_002968543.1|  hypothetical protein SELMODRAFT_231160             361   1e-117   
ref|XP_008245049.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    357   4e-117   
gb|EMS49766.1|  Transcription factor HBP-1b(c1)                         360   1e-116   
gb|AFI93430.1|  perianthia                                              363   2e-116   
gb|KHG15230.1|  Transcription factor PERIANTHIA -like protein           363   5e-116   
ref|XP_010102841.1|  Transcription factor PERIANTHIA                    356   1e-115   
emb|CDP00588.1|  unnamed protein product                                362   2e-115   
ref|XP_007028135.1|  BZIP domain class transcription factor isofo...    355   2e-115   
ref|XP_004297131.1|  PREDICTED: transcription factor HBP-1b(c1)-like    360   3e-115   
ref|XP_011075426.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    359   4e-115   
ref|XP_002975942.1|  hypothetical protein SELMODRAFT_232668             354   9e-115   
gb|KDO58848.1|  hypothetical protein CISIN_1g0457862mg                  350   1e-114   
ref|XP_010423277.1|  PREDICTED: transcription factor TGA5-like is...    353   1e-114   
ref|XP_010093582.1|  TGACG-sequence-specific DNA-binding protein ...    358   6e-114   
ref|XP_010667846.1|  PREDICTED: transcription factor TGA2-like          355   2e-113   
ref|XP_006399174.1|  hypothetical protein EUTSA_v10015975mg             350   3e-113   
ref|XP_002529145.1|  Transcription factor HBP-1b(c1), putative          356   4e-113   
ref|XP_007142889.1|  hypothetical protein PHAVU_007G025500g             355   5e-113   
gb|AFK48734.1|  unknown                                                 346   7e-113   
ref|XP_006484430.1|  PREDICTED: transcription factor PERIANTHIA-like    348   1e-112   
ref|XP_011077152.1|  PREDICTED: transcription factor HBP-1b(c38)-...    354   2e-112   
gb|KDO70045.1|  hypothetical protein CISIN_1g018357mg                   349   4e-112   
gb|AFW84811.1|  putative bZIP transcription factor superfamily pr...    346   4e-112   
ref|XP_008360061.1|  PREDICTED: transcription factor HBP-1b(c38)-...    352   5e-112   
ref|XP_007046281.1|  BZIP transcription factor family protein iso...    347   7e-112   
ref|XP_008360059.1|  PREDICTED: transcription factor HBP-1b(c38)-...    352   8e-112   
ref|XP_008350867.1|  PREDICTED: transcription factor HBP-1b(c38)-...    352   8e-112   
gb|AGW51748.1|  basic leucine zipper transcription factor               348   1e-111   
ref|XP_007218367.1|  hypothetical protein PRUPE_ppa011185mg             343   1e-111   
gb|KHG15340.1|  Transcription factor PERIANTHIA -like protein           350   1e-111   
ref|XP_010534338.1|  PREDICTED: transcription factor TGA6-like is...    346   1e-111   
ref|XP_002970901.1|  hypothetical protein SELMODRAFT_231689             346   1e-111   
dbj|BAD81089.1|  putative HBP-1b                                        344   2e-111   
ref|XP_008347016.1|  PREDICTED: transcription factor TGA2-like          343   2e-111   
ref|XP_009356451.1|  PREDICTED: transcription factor HBP-1b(c38)-...    348   3e-111   
ref|XP_006362551.1|  PREDICTED: transcription factor PERIANTHIA-like    349   3e-111   
ref|XP_006437714.1|  hypothetical protein CICLE_v10031441mg             350   3e-111   
ref|XP_008655436.1|  PREDICTED: octopine synthase binding factor3...    350   3e-111   
ref|XP_009336602.1|  PREDICTED: transcription factor HBP-1b(c38)-...    350   5e-111   
ref|XP_010066737.1|  PREDICTED: transcription factor HBP-1b(c38)        350   5e-111   
ref|XP_009356446.1|  PREDICTED: transcription factor HBP-1b(c38)-...    350   5e-111   
ref|XP_009336601.1|  PREDICTED: transcription factor HBP-1b(c38)-...    350   7e-111   
ref|XP_009356442.1|  PREDICTED: transcription factor HBP-1b(c38)-...    350   7e-111   
ref|XP_008339696.1|  PREDICTED: transcription factor HBP-1b(c38)        349   9e-111   
ref|XP_009356433.1|  PREDICTED: transcription factor HBP-1b(c38)-...    349   1e-110   
ref|XP_009356415.1|  PREDICTED: transcription factor HBP-1b(c38)-...    349   1e-110   
ref|XP_007028139.1|  BZIP domain class transcription factor isofo...    342   2e-110   
ref|XP_001779456.1|  predicted protein                                  342   4e-110   
gb|AAD34570.1|AF143442_1  NPR1-interactor protein 1                     339   4e-110   
gb|AGT16289.1|  Basic-leucine zipper domain                             342   6e-110   
gb|ADL36610.1|  BZIP domain class transcription factor                  345   8e-110   
dbj|BAB17733.1|  putative transcription factor HBP-1b - wheat           339   9e-110   
gb|AFK39309.1|  unknown                                                 338   1e-109   
gb|AGT16544.1|  TGACG motif-biding factor 6                             341   2e-109   
ref|XP_001779430.1|  predicted protein                                  340   3e-109   
gb|AGT17377.1|  bZIP transcription factor                               340   3e-109   
gb|EAZ13886.1|  hypothetical protein OsJ_03813                          345   4e-109   
ref|XP_004239421.1|  PREDICTED: transcription factor HBP-1b(c38)-...    345   7e-109   
gb|EMT21326.1|  Transcription factor HBP-1b(c38)                        338   1e-108   
ref|XP_009799344.1|  PREDICTED: transcription factor HBP-1b(c38)-...    344   2e-108   
ref|XP_009799342.1|  PREDICTED: transcription factor HBP-1b(c38)-...    344   4e-108   
ref|XP_001770560.1|  predicted protein                                  338   4e-108   
gb|AGT17454.1|  hypothetical protein SHCRBa_258_F08_R_30                338   5e-108   
ref|XP_009621407.1|  PREDICTED: transcription factor HBP-1b(c38)-...    343   6e-108   
ref|XP_010229877.1|  PREDICTED: transcription factor HBP-1b(c38)-...    338   6e-108   
ref|XP_009799343.1|  PREDICTED: transcription factor HBP-1b(c38)-...    343   7e-108   
ref|XP_004958747.1|  PREDICTED: transcription factor HBP-1b(c38)-...    338   8e-108   
ref|XP_004958746.1|  PREDICTED: transcription factor HBP-1b(c38)-...    338   8e-108   
ref|XP_001757958.1|  predicted protein                                  336   2e-107   
ref|XP_006391115.1|  hypothetical protein EUTSA_v10018547mg             340   2e-107   
ref|XP_010932613.1|  PREDICTED: transcription factor TGA2-like          340   2e-107   
ref|XP_006850081.1|  hypothetical protein AMTR_s00022p00217850          339   1e-106   
ref|XP_006574877.1|  PREDICTED: transcription factor PERIANTHIA-l...    338   3e-106   
ref|XP_006300957.1|  hypothetical protein CARUB_v10021345mg             337   5e-106   
ref|XP_006655440.1|  PREDICTED: transcription factor HBP-1b(c1)-like    332   7e-106   
gb|EMT24705.1|  putative Transcription factor HBP-1b(c1)                330   1e-105   
ref|XP_010415491.1|  PREDICTED: transcription factor PERIANTHIA-l...    335   1e-105   
ref|XP_007028140.1|  BZIP domain class transcription factor isofo...    329   1e-105   
ref|XP_010511873.1|  PREDICTED: transcription factor PERIANTHIA-l...    335   2e-105   
ref|XP_004961656.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    330   3e-105   
gb|KFK41287.1|  hypothetical protein AALP_AA2G110300                    335   3e-105   
ref|NP_177031.1|  transcription factor PERIANTHIA                       335   3e-105   
gb|KDP24594.1|  hypothetical protein JCGZ_25510                         336   4e-105   
ref|XP_002888675.1|  transcription factor perianthia                    334   4e-105   
ref|XP_010415492.1|  PREDICTED: transcription factor PERIANTHIA-l...    334   4e-105   
ref|XP_010265201.1|  PREDICTED: transcription factor TGA2-like is...    333   5e-105   
emb|CDP10109.1|  unnamed protein product                                333   5e-105   
gb|EMS67944.1|  Transcription factor HBP-1b(c1)                         328   5e-105   
ref|XP_010511874.1|  PREDICTED: transcription factor PERIANTHIA-l...    334   6e-105   
ref|XP_003536694.1|  PREDICTED: transcription factor PERIANTHIA-like    334   6e-105   
gb|KHN11437.1|  Transcription factor HBP-1b(c1)                         333   1e-104   
gb|AAD19660.1|  transcription factor PERIANTHIA                         332   2e-104   
ref|XP_006574878.1|  PREDICTED: transcription factor PERIANTHIA-l...    332   2e-104   
ref|XP_006605892.1|  PREDICTED: transcription factor PERIANTHIA-like    332   3e-104   
emb|CDY38608.1|  BnaC06g30310D                                          332   3e-104   
ref|XP_009105416.1|  PREDICTED: transcription factor PERIANTHIA         331   4e-104   
emb|CDX95999.1|  BnaA07g27320D                                          331   5e-104   
ref|XP_004966886.1|  PREDICTED: transcription factor HBP-1b(c1)-like    328   7e-104   
ref|XP_009772597.1|  PREDICTED: transcription factor TGA2-like is...    332   7e-104   
ref|XP_002980439.1|  hypothetical protein SELMODRAFT_112221             322   8e-104   
dbj|BAD43215.1|  bZip transcription factor TGA6 / AtbZip45              324   8e-104   
ref|XP_010470818.1|  PREDICTED: transcription factor PERIANTHIA i...    330   1e-103   
ref|XP_009772593.1|  PREDICTED: transcription factor TGA2-like is...    332   1e-103   
ref|XP_006656865.1|  PREDICTED: transcription factor HBP-1b(c1)-like    331   2e-103   
ref|XP_008367369.1|  PREDICTED: transcription factor HBP-1b(c38)-...    332   3e-103   
ref|XP_010470819.1|  PREDICTED: transcription factor PERIANTHIA i...    328   6e-103   
gb|KHN07408.1|  Transcription factor HBP-1b(c1)                         328   6e-103   
ref|NP_001057342.1|  Os06g0265400                                       326   7e-103   
ref|XP_010257393.1|  PREDICTED: transcription factor HBP-1b(c38)-...    327   8e-103   
ref|XP_009386729.1|  PREDICTED: transcription factor TGA2-like is...    327   1e-102   
ref|XP_009613715.1|  PREDICTED: transcription factor TGA2-like is...    329   1e-102   
ref|XP_009357109.1|  PREDICTED: transcription factor HBP-1b(c38)-...    330   1e-102   
ref|XP_009613713.1|  PREDICTED: transcription factor TGA2-like is...    329   2e-102   
ref|XP_009772596.1|  PREDICTED: transcription factor TGA2-like is...    329   2e-102   
gb|EMT03892.1|  Glucose-6-phosphate 1-dehydrogenase 4, chloroplastic    345   2e-102   
ref|XP_003521195.1|  PREDICTED: transcription factor HBP-1b(c1)-like    328   3e-102   
ref|XP_009611363.1|  PREDICTED: transcription factor HBP-1b(c38)-...    328   3e-102   
ref|XP_009386728.1|  PREDICTED: transcription factor TGA2-like is...    328   3e-102   
ref|XP_010265827.1|  PREDICTED: transcription factor TGA2-like          327   3e-102   
gb|EAZ36566.1|  hypothetical protein OsJ_20904                          327   4e-102   
ref|XP_009611364.1|  PREDICTED: transcription factor HBP-1b(c38)-...    328   5e-102   
ref|XP_007162295.1|  hypothetical protein PHAVU_001G140100g             327   6e-102   
gb|EAZ00440.1|  hypothetical protein OsI_22461                          326   6e-102   
ref|XP_007162296.1|  hypothetical protein PHAVU_001G140100g             327   6e-102   
ref|XP_009370244.1|  PREDICTED: transcription factor HBP-1b(c38)-...    325   8e-102   
ref|XP_009794165.1|  PREDICTED: transcription factor HBP-1b(c38)-...    327   8e-102   
gb|AAY15214.1|  TGA10 transcription factor                              327   1e-101   
ref|XP_009794164.1|  PREDICTED: transcription factor HBP-1b(c38)-...    327   1e-101   
ref|XP_006604382.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    327   1e-101   
ref|XP_003554196.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    326   1e-101   
ref|XP_008445648.1|  PREDICTED: transcription factor HBP-1b(c38) ...    325   1e-101   
ref|XP_008445647.1|  PREDICTED: transcription factor HBP-1b(c38) ...    325   2e-101   
ref|XP_009613714.1|  PREDICTED: transcription factor TGA2-like is...    327   2e-101   
ref|XP_008804825.1|  PREDICTED: transcription factor TGA2               320   2e-101   
ref|XP_007028940.1|  BZIP transcription factor family protein           324   6e-101   
gb|KCW90292.1|  hypothetical protein EUGRSUZ_A02436                     321   6e-101   
ref|XP_010686013.1|  PREDICTED: transcription factor TGA2 isoform X2    325   7e-101   
ref|XP_006485024.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    324   7e-101   
ref|XP_006437046.1|  hypothetical protein CICLE_v10031361mg             324   8e-101   
ref|XP_006485023.1|  PREDICTED: transcription factor HBP-1b(c1)-l...    324   8e-101   
ref|XP_008800656.1|  PREDICTED: transcription factor HBP-1b(c38)-...    323   9e-101   
ref|XP_010271664.1|  PREDICTED: transcription factor TGA2-like          324   1e-100   
ref|XP_010111398.1|  Transcription factor HBP-1b(c1)                    324   2e-100   
ref|XP_009779356.1|  PREDICTED: transcription factor TGA2               324   2e-100   
ref|XP_004309443.1|  PREDICTED: transcription factor HBP-1b(c1)-like    325   3e-100   
ref|XP_002308062.2|  hypothetical protein POPTR_0006s05770g             324   3e-100   
ref|XP_010943572.1|  PREDICTED: transcription factor HBP-1b(c38)-...    321   3e-100   
ref|XP_011007183.1|  PREDICTED: transcription factor TGA2 isoform X1    323   5e-100   
ref|XP_010907586.1|  PREDICTED: transcription factor TGA2-like          322   5e-100   
ref|XP_008787881.1|  PREDICTED: transcription factor TGA6-like is...    321   5e-100   
ref|XP_011007200.1|  PREDICTED: transcription factor TGA2 isoform X2    322   5e-100   
ref|XP_011088886.1|  PREDICTED: transcription factor TGA2 isoform X3    320   5e-100   
ref|XP_010928452.1|  PREDICTED: transcription factor TGA2-like          320   6e-100   
ref|XP_010907104.1|  PREDICTED: transcription factor TGA2-like is...    322   8e-100   
ref|NP_001289788.1|  transcription factor TGA2                          322   8e-100   
ref|XP_006424250.1|  hypothetical protein CICLE_v100284281mg            320   8e-100   
ref|XP_002322683.2|  hypothetical protein POPTR_0016s04970g             318   8e-100   
ref|XP_010686011.1|  PREDICTED: transcription factor TGA2 isoform X1    322   9e-100   
ref|XP_006347246.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    321   1e-99    
gb|ACR35498.1|  unknown                                                 317   1e-99    
emb|CBI30045.3|  unnamed protein product                                319   1e-99    
ref|XP_007204568.1|  hypothetical protein PRUPE_ppa003825mg             323   2e-99    
ref|XP_008787873.1|  PREDICTED: transcription factor TGA6-like is...    321   2e-99    
gb|KHG27506.1|  hypothetical protein F383_06803                         316   2e-99    
ref|XP_008241036.1|  PREDICTED: transcription factor TGA2               322   3e-99    
ref|XP_011088884.1|  PREDICTED: transcription factor TGA2 isoform X1    320   3e-99    
ref|XP_008801022.1|  PREDICTED: transcription factor TGA1-like is...    316   3e-99    
ref|XP_010057941.1|  PREDICTED: transcription factor TGA2               320   3e-99    
ref|XP_008787868.1|  PREDICTED: transcription factor TGA6-like is...    320   3e-99    
ref|XP_006487951.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    321   3e-99    
ref|XP_006487952.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    321   3e-99    
ref|XP_010910366.1|  PREDICTED: transcription factor HBP-1b(c1)-like    312   3e-99    
ref|XP_010261147.1|  PREDICTED: transcription factor TGA1-like is...    316   4e-99    
ref|XP_006487948.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    320   4e-99    
ref|XP_007153359.1|  hypothetical protein PHAVU_003G028800g             319   4e-99    
ref|XP_006487950.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    320   5e-99    
ref|XP_002275147.1|  PREDICTED: transcription factor TGA2               320   5e-99    
ref|XP_002442812.1|  hypothetical protein SORBIDRAFT_08g003260          316   6e-99    
ref|XP_011020273.1|  PREDICTED: transcription factor TGA2-like          320   6e-99    
ref|XP_008801021.1|  PREDICTED: transcription factor TGA4-like is...    316   6e-99    
ref|XP_008801018.1|  PREDICTED: transcription factor TGA4-like is...    316   6e-99    
gb|KDO58071.1|  hypothetical protein CISIN_1g036039mg                   320   9e-99    
ref|XP_010905948.1|  PREDICTED: transcription factor TGA4-like is...    315   1e-98    
ref|XP_006384820.1|  bZIP family transcription factor family protein    319   1e-98    
ref|XP_010905949.1|  PREDICTED: transcription factor TGA4-like is...    315   1e-98    
ref|XP_010532205.1|  PREDICTED: transcription factor PERIANTHIA-like    317   1e-98    
ref|XP_002438208.1|  hypothetical protein SORBIDRAFT_10g009592          312   1e-98    
ref|XP_011088885.1|  PREDICTED: transcription factor TGA2 isoform X2    318   2e-98    
gb|EYU26706.1|  hypothetical protein MIMGU_mgv1a007923mg                315   2e-98    
ref|XP_006855016.1|  hypothetical protein AMTR_s00031p00017860          318   2e-98    
gb|EEE51664.1|  hypothetical protein OsJ_32993                          317   2e-98    
ref|XP_009371925.1|  PREDICTED: transcription factor HBP-1b(c38)-...    319   2e-98    
gb|AFW76926.1|  putative bZIP transcription factor superfamily pr...    316   2e-98    
gb|KHG19393.1|  hypothetical protein F383_24687                         315   3e-98    
ref|XP_006662738.1|  PREDICTED: TGACG-sequence-specific DNA-bindi...    317   3e-98    
gb|EMT26672.1|  putative Transcription factor HBP-1b(c1)                312   3e-98    
gb|EEC67690.1|  hypothetical protein OsI_35143                          320   3e-98    
ref|XP_010322437.1|  PREDICTED: transcription factor TGA2 isoform X4    315   3e-98    



>ref|XP_011075851.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Sesamum 
indicum]
 ref|XP_011075852.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Sesamum 
indicum]
 ref|XP_011075853.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Sesamum 
indicum]
 ref|XP_011075854.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Sesamum 
indicum]
 ref|XP_011075855.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Sesamum 
indicum]
 ref|XP_011075856.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Sesamum 
indicum]
 ref|XP_011075857.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Sesamum 
indicum]
Length=328

 Score =   503 bits (1296),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 289/312 (93%), Positives = 299/312 (96%), Gaps = 0/312 (0%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKSR  1028
             MAD SPRTDTSTDADTEDKN+ FQNN    IV SDGSD++RDQKTLRRLAQNREAARKSR
Sbjct  1     MADASPRTDTSTDADTEDKNLRFQNNQLQAIVASDGSDKSRDQKTLRRLAQNREAARKSR  60

Query  1027  LRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWL  848
             LRKKAYVQQLE+SRMKLTQLEQELQRARQQGIFISSSGDQSQS+ GNGALAFDVEYARWL
Sbjct  61    LRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQSQSIGGNGALAFDVEYARWL  120

Query  847   EEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTP  668
             EEHNRRINELRGAVNSHAGD ELRIIV+ I+AHY+DIFRIKG+AAKADVFHILSGMWKTP
Sbjct  121   EEHNRRINELRGAVNSHAGDGELRIIVEGIVAHYDDIFRIKGDAAKADVFHILSGMWKTP  180

Query  667   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  488
             AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL
Sbjct  181   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  240

Query  487   AETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  308
             AETLAGSLGPS SSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ
Sbjct  241   AETLAGSLGPSSSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  300

Query  307   AARAFLGISDYF  272
             +ARA L ISDYF
Sbjct  301   SARALLAISDYF  312



>gb|EYU45341.1| hypothetical protein MIMGU_mgv1a009902mg [Erythranthe guttata]
Length=328

 Score =   503 bits (1294),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 290/312 (93%), Positives = 298/312 (96%), Gaps = 0/312 (0%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKSR  1028
             MA+ SPRTDTSTDADTEDKNM FQNN   G++ SDGSD+ RDQKTLRRLAQNREAARKSR
Sbjct  1     MAEGSPRTDTSTDADTEDKNMRFQNNQLQGMIASDGSDKPRDQKTLRRLAQNREAARKSR  60

Query  1027  LRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWL  848
             LRKKAYVQQLE+SRMKLTQLEQELQRARQQGIFISSSGDQSQS  GNGALAFDVEYARWL
Sbjct  61    LRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQSQSAGGNGALAFDVEYARWL  120

Query  847   EEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTP  668
             EEHNRRINELRGAVNSHAGD ELRIIVD I+AHYEDIFRIK +AAKADVFHILSGMWKTP
Sbjct  121   EEHNRRINELRGAVNSHAGDGELRIIVDGIIAHYEDIFRIKADAAKADVFHILSGMWKTP  180

Query  667   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  488
             AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL
Sbjct  181   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  240

Query  487   AETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  308
             AETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ
Sbjct  241   AETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  300

Query  307   AARAFLGISDYF  272
             +ARA L ISDYF
Sbjct  301   SARALLAISDYF  312



>emb|CDP09298.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   499 bits (1284),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 284/313 (91%), Positives = 293/313 (94%), Gaps = 1/313 (0%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKSR  1028
             MADVSPRTDTSTDA TEDKN  F NN  L +V SDGSD++RDQKTLRRLAQNREAARKSR
Sbjct  1     MADVSPRTDTSTDASTEDKNSRFHNNQGLAVVASDGSDKSRDQKTLRRLAQNREAARKSR  60

Query  1027  LRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWL  848
             LRKKAYVQQLE+SRMKLTQLEQELQRARQQGIFISSSGDQSQSMSGNGALAFDVEYARWL
Sbjct  61    LRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQSQSMSGNGALAFDVEYARWL  120

Query  847   EEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTP  668
             EEHNRRINELRGAVNSHAGD ELRIIVD I+AHY+DIFRIK +AAKADVFHILSGMWKTP
Sbjct  121   EEHNRRINELRGAVNSHAGDGELRIIVDGILAHYDDIFRIKADAAKADVFHILSGMWKTP  180

Query  667   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  488
             AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL
Sbjct  181   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  240

Query  487   AETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTR  311
             AETLA       GS+GNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTR
Sbjct  241   AETLAGSLGPSGGSTGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTR  300

Query  310   QAARAFLGISDYF  272
             Q+ARA L ISDYF
Sbjct  301   QSARALLAISDYF  313



>ref|XP_011084590.1| PREDICTED: transcription factor HBP-1b(c38)-like [Sesamum indicum]
Length=328

 Score =   497 bits (1279),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 284/312 (91%), Positives = 297/312 (95%), Gaps = 0/312 (0%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKSR  1028
             MAD SPRTDTSTDADTEDKN+ F+NN    I  SDGSD++RDQKTLRRLAQNREAARKSR
Sbjct  1     MADASPRTDTSTDADTEDKNLRFKNNQLQTIATSDGSDKSRDQKTLRRLAQNREAARKSR  60

Query  1027  LRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWL  848
             LRKKAYVQQLE+SRMKLTQLEQELQRARQQGIF+SSSGDQSQS SGNGALAFDVEYARWL
Sbjct  61    LRKKAYVQQLESSRMKLTQLEQELQRARQQGIFVSSSGDQSQSASGNGALAFDVEYARWL  120

Query  847   EEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTP  668
             EEHNRRINELRGAVNSHAGD ELRIIV+ I+AH++DIFRIKGEAAKADVFHILSGMWKTP
Sbjct  121   EEHNRRINELRGAVNSHAGDGELRIIVEGIVAHWDDIFRIKGEAAKADVFHILSGMWKTP  180

Query  667   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  488
             AERCFLWLGGFRSSELLKLLI+QLEPLTEQQ+LAINNLQQSSQQAEDALSQGMEALQQSL
Sbjct  181   AERCFLWLGGFRSSELLKLLISQLEPLTEQQVLAINNLQQSSQQAEDALSQGMEALQQSL  240

Query  487   AETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  308
             AETLAGSL  SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ
Sbjct  241   AETLAGSLSSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  300

Query  307   AARAFLGISDYF  272
             +ARA L ISDYF
Sbjct  301   SARALLAISDYF  312



>ref|XP_009794636.1| PREDICTED: transcription factor TGA2-like [Nicotiana sylvestris]
 gb|AAF06696.1|AF031487_1 bZIP transcription factor [Nicotiana tabacum]
Length=325

 Score =   487 bits (1254),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 287/312 (92%), Positives = 295/312 (95%), Gaps = 3/312 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKSR  1028
             MAD+SP   TSTDADTEDKN  F N+  LG V SDGSDRTRDQKTLRRLAQNREAARKSR
Sbjct  1     MADISP--STSTDADTEDKNR-FLNSQQLGAVASDGSDRTRDQKTLRRLAQNREAARKSR  57

Query  1027  LRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWL  848
             LRKKAYVQQLE+SRMKLTQLEQELQRARQQGIFIS SGDQSQSMSGNGALAFDVEYARWL
Sbjct  58    LRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISGSGDQSQSMSGNGALAFDVEYARWL  117

Query  847   EEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTP  668
             EE NRRINELRGAVNSHAGD ELRIIVD I+AHY+DIFRIKG+AAK+DVFHILSGMWKTP
Sbjct  118   EEQNRRINELRGAVNSHAGDGELRIIVDGILAHYDDIFRIKGDAAKSDVFHILSGMWKTP  177

Query  667   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  488
             AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL
Sbjct  178   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  237

Query  487   AETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  308
             AETLAGSLGPS SSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ
Sbjct  238   AETLAGSLGPSSSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  297

Query  307   AARAFLGISDYF  272
             +ARA L ISDYF
Sbjct  298   SARALLAISDYF  309



>ref|XP_009627416.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana tomentosiformis]
 ref|XP_009627417.1| PREDICTED: transcription factor HBP-1b(c38)-like [Nicotiana tomentosiformis]
Length=327

 Score =   484 bits (1247),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 281/313 (90%), Positives = 296/313 (95%), Gaps = 2/313 (1%)
 Frame = -1

Query  1210  MMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKS  1031
             MMAD+SP   TSTDADT+DKN+ F N+  +  V SDGSD+ RDQKTLRRLAQNREAARKS
Sbjct  1     MMADISP--STSTDADTDDKNLRFLNSQPVASVTSDGSDKPRDQKTLRRLAQNREAARKS  58

Query  1030  RLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARW  851
             RLRKKAYVQQLE+SRMKLTQLEQELQRARQQGIFISSSGDQSQS +GNGALAFDVEYARW
Sbjct  59    RLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQSQSKTGNGALAFDVEYARW  118

Query  850   LEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKT  671
             LEEHNRRI ELRGAV+SHAGD ELRIIVD I+AHY+DIFRIKG+AAKADVFHILSGMWKT
Sbjct  119   LEEHNRRITELRGAVSSHAGDGELRIIVDGILAHYDDIFRIKGDAAKADVFHILSGMWKT  178

Query  670   PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQS  491
             PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQ+SSQQAEDALSQGMEALQQS
Sbjct  179   PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQESSQQAEDALSQGMEALQQS  238

Query  490   LAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTR  311
             LAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR+LTTR
Sbjct  239   LAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRVLTTR  298

Query  310   QAARAFLGISDYF  272
             Q+ARA L ISDYF
Sbjct  299   QSARALLAISDYF  311



>ref|XP_009803516.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009803517.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Nicotiana 
sylvestris]
Length=327

 Score =   483 bits (1244),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 280/313 (89%), Positives = 296/313 (95%), Gaps = 2/313 (1%)
 Frame = -1

Query  1210  MMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKS  1031
             MMA++SP   TSTDADT+DKN+ F N+  +  V SDGSD+ RDQKTLRRLAQNREAARKS
Sbjct  1     MMAEISP--STSTDADTDDKNLRFMNSQPVASVTSDGSDKPRDQKTLRRLAQNREAARKS  58

Query  1030  RLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARW  851
             RLRKKAYVQQLE+SRMKLTQLEQELQRARQQGIFISSSGDQSQS +GNGALAFDVEYARW
Sbjct  59    RLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQSQSKTGNGALAFDVEYARW  118

Query  850   LEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKT  671
             LEEHNRRI ELRGAV+SHAGD ELRIIVD I+AHY+DIFRIKG+AAKADVFHILSGMWKT
Sbjct  119   LEEHNRRITELRGAVSSHAGDGELRIIVDGILAHYDDIFRIKGDAAKADVFHILSGMWKT  178

Query  670   PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQS  491
             PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQ+SSQQAEDALSQGMEALQQS
Sbjct  179   PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQESSQQAEDALSQGMEALQQS  238

Query  490   LAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTR  311
             LAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR+LTTR
Sbjct  239   LAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRVLTTR  298

Query  310   QAARAFLGISDYF  272
             Q+ARA L ISDYF
Sbjct  299   QSARALLAISDYF  311



>ref|XP_006356348.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356349.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X2 [Solanum 
tuberosum]
Length=325

 Score =   481 bits (1239),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 286/313 (91%), Positives = 294/313 (94%), Gaps = 4/313 (1%)
 Frame = -1

Query  1210  MMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKS  1031
             MMAD+SP   TSTDADTEDKN     N  L  V SDGSDR +DQKTLRRLAQNREAARKS
Sbjct  1     MMADISP--STSTDADTEDKNRFL--NQQLCAVASDGSDRPKDQKTLRRLAQNREAARKS  56

Query  1030  RLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARW  851
             RLRKKAYVQQLE+SRMKLTQLEQELQRARQQGIFIS SGDQSQSMSGNGALAFDVEYARW
Sbjct  57    RLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISGSGDQSQSMSGNGALAFDVEYARW  116

Query  850   LEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKT  671
             LEE NRRINELRGAVNSHAGDAELRIIVD I+AHY+DIFRIKG+AAKADVFHILSGMWKT
Sbjct  117   LEEQNRRINELRGAVNSHAGDAELRIIVDGILAHYDDIFRIKGDAAKADVFHILSGMWKT  176

Query  670   PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQS  491
             PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQS
Sbjct  177   PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQS  236

Query  490   LAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTR  311
             LAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTR
Sbjct  237   LAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTR  296

Query  310   QAARAFLGISDYF  272
             Q+ARA L I+DYF
Sbjct  297   QSARALLAITDYF  309



>ref|XP_010313245.1| PREDICTED: transcription factor HBP-1b(c38) [Solanum lycopersicum]
Length=324

 Score =   479 bits (1232),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 285/312 (91%), Positives = 293/312 (94%), Gaps = 4/312 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKSR  1028
             MAD+SP   TSTDADTEDKN     N  L  V SDGSDR +DQKTLRRLAQNREAARKSR
Sbjct  1     MADISP--STSTDADTEDKNRFL--NQQLCAVASDGSDRPKDQKTLRRLAQNREAARKSR  56

Query  1027  LRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWL  848
             LRKKAYVQQLE+SRMKLTQLEQELQRARQQGIFIS SGDQSQSMSGNGALAFDVEYARWL
Sbjct  57    LRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISGSGDQSQSMSGNGALAFDVEYARWL  116

Query  847   EEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTP  668
             EE NRRINELRGAVNSHAGDAELRIIVD I+AHY+DIFRIKG+AAKADVFHILSGMWKTP
Sbjct  117   EEQNRRINELRGAVNSHAGDAELRIIVDGILAHYDDIFRIKGDAAKADVFHILSGMWKTP  176

Query  667   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  488
             AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL
Sbjct  177   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  236

Query  487   AETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  308
             AETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ
Sbjct  237   AETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  296

Query  307   AARAFLGISDYF  272
             +ARA L I+DYF
Sbjct  297   SARALLAITDYF  308



>gb|EPS67211.1| hypothetical protein M569_07557, partial [Genlisea aurea]
Length=324

 Score =   467 bits (1202),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 264/308 (86%), Positives = 290/308 (94%), Gaps = 0/308 (0%)
 Frame = -1

Query  1195  SPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKSRLRKK  1016
             SPRTDTSTDADTEDKN+ FQNN     V SDGSD++RDQKTLRRLAQNREAARKSRLRKK
Sbjct  1     SPRTDTSTDADTEDKNLRFQNNQLQVAVASDGSDKSRDQKTLRRLAQNREAARKSRLRKK  60

Query  1015  AYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLEEHN  836
             AYVQQLE+SRMKLTQLEQELQRARQQGIF SSSGDQ+Q++ GNGALAFDVEY RWLE+HN
Sbjct  61    AYVQQLESSRMKLTQLEQELQRARQQGIFTSSSGDQAQAVGGNGALAFDVEYGRWLEDHN  120

Query  835   RRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERC  656
             RRINELRGAVNS AGD ELR+IVD I+ HYE+IFRIKGEAAK+DVFH+LSGMWKTPAERC
Sbjct  121   RRINELRGAVNSQAGDGELRMIVDGILTHYEEIFRIKGEAAKSDVFHVLSGMWKTPAERC  180

Query  655   FLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETL  476
             FLWLGGFRSSEL+KLL++QLEPLT+QQ+LAINNLQQSSQ+AEDALSQGMEALQQSLA+TL
Sbjct  181   FLWLGGFRSSELIKLLMSQLEPLTDQQVLAINNLQQSSQEAEDALSQGMEALQQSLADTL  240

Query  475   AgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARA  296
             AGSLGPSGSS NVANYMGQMAMAMGKLGTLEGFIRQAD+LR+ TLQQ+HR+LTTRQ+ARA
Sbjct  241   AGSLGPSGSSVNVANYMGQMAMAMGKLGTLEGFIRQADHLRRGTLQQLHRVLTTRQSARA  300

Query  295   FLGISDYF  272
              L +SDYF
Sbjct  301   LLAMSDYF  308



>ref|XP_006465763.1| PREDICTED: transcription factor TGA6-like isoform X7 [Citrus 
sinensis]
Length=331

 Score =   452 bits (1164),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 257/315 (82%), Positives = 280/315 (89%), Gaps = 3/315 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD STDADT++KN  F    +  +V SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADASPRTDISTDADTDEKNQRFDRGQSTAVVASDSSDRSKDKLDQKTLRRLAQNREAAR  60

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AFDVEYA
Sbjct  61    KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHSMSGNGAMAFDVEYA  120

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N++INELR AVNSHA D ELR++VD IMAHY++IFR+K  AAKADVFH+LSGMW
Sbjct  121   RWLEEQNKQINELRSAVNSHASDTELRMVVDGIMAHYDEIFRLKANAAKADVFHLLSGMW  180

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCF+WLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQ
Sbjct  181   KTPAERCFMWLGGFRSSELLKLLVNQLEPLTEQQLVGIGNLQQSSQQAEDALSQGMEALQ  240

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLAETL+     S  SGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT
Sbjct  241   QSLAETLSSGSLGSSGSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  300

Query  316   TRQAARAFLGISDYF  272
             TRQ+ARA L I DYF
Sbjct  301   TRQSARALLAIHDYF  315



>ref|XP_006432426.1| hypothetical protein CICLE_v100010812mg [Citrus clementina]
 gb|ESR45666.1| hypothetical protein CICLE_v100010812mg [Citrus clementina]
Length=340

 Score =   452 bits (1164),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 257/315 (82%), Positives = 280/315 (89%), Gaps = 3/315 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD STDADT++KN  F    +  +V SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADASPRTDISTDADTDEKNQRFDRGQSTAVVASDSSDRSKDKLDQKTLRRLAQNREAAR  60

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AFDVEYA
Sbjct  61    KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHSMSGNGAMAFDVEYA  120

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N++INELR AVNSHA D ELR++VD IMAHY++IFR+K  AAKADVFH+LSGMW
Sbjct  121   RWLEEQNKQINELRSAVNSHASDTELRMVVDGIMAHYDEIFRLKANAAKADVFHLLSGMW  180

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCF+WLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQ
Sbjct  181   KTPAERCFMWLGGFRSSELLKLLVNQLEPLTEQQLVGIGNLQQSSQQAEDALSQGMEALQ  240

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLAETL+     S  SGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT
Sbjct  241   QSLAETLSSGSLGSSGSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  300

Query  316   TRQAARAFLGISDYF  272
             TRQ+ARA L I DYF
Sbjct  301   TRQSARALLAIHDYF  315



>gb|AGD98703.1| bZIP transcription factor family protein 5 [Camellia sinensis]
Length=328

 Score =   451 bits (1160),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 275/312 (88%), Positives = 293/312 (94%), Gaps = 0/312 (0%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKSR  1028
             M D+SPRTDTSTD DT+DKN+ FQ++ +  IV SD SD++RDQKTLRRL QNREAARKSR
Sbjct  1     MEDISPRTDTSTDGDTDDKNLRFQSDQSQAIVTSDASDKSRDQKTLRRLVQNREAARKSR  60

Query  1027  LRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWL  848
             LRKKAYVQQLE+SRMKLTQLEQELQRARQQGIFISSSGDQSQSMSGNGA AFDVEYARWL
Sbjct  61    LRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQSQSMSGNGAQAFDVEYARWL  120

Query  847   EEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTP  668
             EEH RR+NELRGAVNSHAGD ELRIIVD I+AHY+DIFRIKG+AAKADVFHILSGMWKTP
Sbjct  121   EEHIRRVNELRGAVNSHAGDGELRIIVDGILAHYDDIFRIKGDAAKADVFHILSGMWKTP  180

Query  667   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  488
             AERCFLWLGGFRSSELLKLLINQLEPLTEQQLL I  LQ+SS QAEDALSQGMEALQQSL
Sbjct  181   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLGITKLQESSLQAEDALSQGMEALQQSL  240

Query  487   AETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  308
             AETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ+HR+LTTRQ
Sbjct  241   AETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQLHRVLTTRQ  300

Query  307   AARAFLGISDYF  272
             +ARA L I+DYF
Sbjct  301   SARALLAINDYF  312



>ref|XP_003627926.1| TGA transcription factor [Medicago truncatula]
 gb|AET02402.1| BZIP family transcription factor [Medicago truncatula]
Length=466

 Score =   456 bits (1172),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 259/316 (82%), Positives = 283/316 (90%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD STD DT+DKN  F  N +L + GSD SDR++D   QKTLRRLAQNREAAR
Sbjct  135   MADASPRTDISTDGDTDDKNQRFDRNQSLAVAGSDSSDRSKDKSDQKTLRRLAQNREAAR  194

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQG+FISSSG+Q+ S+SGNGA+ FD EYA
Sbjct  195   KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGVFISSSGEQTHSLSGNGAMQFDAEYA  254

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR+INELR AVNSHA D ELR+IVD I+AHY++IFR+KG AAKADVFH+LSGMW
Sbjct  255   RWLEEQNRQINELRAAVNSHASDTELRMIVDGIVAHYDEIFRLKGVAAKADVFHLLSGMW  314

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQ
Sbjct  315   KTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGITNLQQSSQQAEDALSQGMEALQ  374

Query  496   QSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSLAETL+  +   SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL
Sbjct  375   QSLAETLSTGAPSSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  434

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  435   TTRQSARALLAIHDYF  450



>gb|KDP40547.1| hypothetical protein JCGZ_24546 [Jatropha curcas]
Length=465

 Score =   455 bits (1171),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 269/321 (84%), Positives = 287/321 (89%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STDADT+DKN  F    +  I  SD SDR++D   QKTLRRLAQN
Sbjct  129   WGESNMADASPRTDISTDADTDDKNQRFDRGQSTAIAASDSSDRSKDKMDQKTLRRLAQN  188

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AF
Sbjct  189   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHSMSGNGAMAF  248

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEE NR+INELR AVNSHAGDAELRII+D IMAHY++IFR+K  AAKADVFH+
Sbjct  249   DVEYARWLEEQNRQINELRSAVNSHAGDAELRIIIDGIMAHYDEIFRLKSNAAKADVFHL  308

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  309   LSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLVGIGNLQQSSQQAEDALSQG  368

Query  511   MEALQQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAET  +GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ
Sbjct  369   MEALQQSLAETLSSGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  428

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DYF
Sbjct  429   MHRILTTRQSARALLAIHDYF  449



>gb|AFK47127.1| unknown [Medicago truncatula]
Length=466

 Score =   455 bits (1170),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 258/316 (82%), Positives = 283/316 (90%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD STD DT+DKN  F  N +L + GSD SDR++D   Q+TLRRLAQNREAAR
Sbjct  135   MADASPRTDISTDGDTDDKNQRFDRNQSLAVAGSDSSDRSKDKSDQRTLRRLAQNREAAR  194

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQG+FISSSG+Q+ S+SGNGA+ FD EYA
Sbjct  195   KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGVFISSSGEQTHSLSGNGAMQFDAEYA  254

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR+INELR AVNSHA D ELR+IVD I+AHY++IFR+KG AAKADVFH+LSGMW
Sbjct  255   RWLEEQNRQINELRAAVNSHASDTELRMIVDGIVAHYDEIFRLKGVAAKADVFHLLSGMW  314

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQ
Sbjct  315   KTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGITNLQQSSQQAEDALSQGMEALQ  374

Query  496   QSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSLAETL+  +   SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL
Sbjct  375   QSLAETLSTGAPSSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  434

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  435   TTRQSARALLAIHDYF  450



>ref|XP_006465757.1| PREDICTED: transcription factor TGA6-like isoform X1 [Citrus 
sinensis]
 ref|XP_006465758.1| PREDICTED: transcription factor TGA6-like isoform X2 [Citrus 
sinensis]
 ref|XP_006465759.1| PREDICTED: transcription factor TGA6-like isoform X3 [Citrus 
sinensis]
Length=453

 Score =   454 bits (1167),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 258/320 (81%), Positives = 281/320 (88%), Gaps = 3/320 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STDADT++KN  F    +  +V SD SDR++D   QKTLRRLAQN
Sbjct  118   WGESNMADASPRTDISTDADTDEKNQRFDRGQSTAVVASDSSDRSKDKLDQKTLRRLAQN  177

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AF
Sbjct  178   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHSMSGNGAMAF  237

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEE N++INELR AVNSHA D ELR++VD IMAHY++IFR+K  AAKADVFH+
Sbjct  238   DVEYARWLEEQNKQINELRSAVNSHASDTELRMVVDGIMAHYDEIFRLKANAAKADVFHL  297

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCF+WLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  298   LSGMWKTPAERCFMWLGGFRSSELLKLLVNQLEPLTEQQLVGIGNLQQSSQQAEDALSQG  357

Query  511   MEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM  332
             MEALQQSLAETL+     S  SGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM
Sbjct  358   MEALQQSLAETLSSGSLGSSGSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM  417

Query  331   HRILTTRQAARAFLGISDYF  272
             HRILTTRQ+ARA L I DYF
Sbjct  418   HRILTTRQSARALLAIHDYF  437



>ref|XP_006432430.1| hypothetical protein CICLE_v100010812mg [Citrus clementina]
 gb|ESR45670.1| hypothetical protein CICLE_v100010812mg [Citrus clementina]
Length=462

 Score =   454 bits (1167),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 258/320 (81%), Positives = 281/320 (88%), Gaps = 3/320 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STDADT++KN  F    +  +V SD SDR++D   QKTLRRLAQN
Sbjct  118   WGESNMADASPRTDISTDADTDEKNQRFDRGQSTAVVASDSSDRSKDKLDQKTLRRLAQN  177

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AF
Sbjct  178   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHSMSGNGAMAF  237

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEE N++INELR AVNSHA D ELR++VD IMAHY++IFR+K  AAKADVFH+
Sbjct  238   DVEYARWLEEQNKQINELRSAVNSHASDTELRMVVDGIMAHYDEIFRLKANAAKADVFHL  297

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCF+WLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  298   LSGMWKTPAERCFMWLGGFRSSELLKLLVNQLEPLTEQQLVGIGNLQQSSQQAEDALSQG  357

Query  511   MEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM  332
             MEALQQSLAETL+     S  SGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM
Sbjct  358   MEALQQSLAETLSSGSLGSSGSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM  417

Query  331   HRILTTRQAARAFLGISDYF  272
             HRILTTRQ+ARA L I DYF
Sbjct  418   HRILTTRQSARALLAIHDYF  437



>ref|XP_006432427.1| hypothetical protein CICLE_v100010812mg [Citrus clementina]
 ref|XP_006432428.1| hypothetical protein CICLE_v100010812mg [Citrus clementina]
 gb|ESR45667.1| hypothetical protein CICLE_v100010812mg [Citrus clementina]
 gb|ESR45668.1| hypothetical protein CICLE_v100010812mg [Citrus clementina]
Length=458

 Score =   453 bits (1166),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 258/320 (81%), Positives = 281/320 (88%), Gaps = 3/320 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STDADT++KN  F    +  +V SD SDR++D   QKTLRRLAQN
Sbjct  114   WGESNMADASPRTDISTDADTDEKNQRFDRGQSTAVVASDSSDRSKDKLDQKTLRRLAQN  173

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AF
Sbjct  174   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHSMSGNGAMAF  233

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEE N++INELR AVNSHA D ELR++VD IMAHY++IFR+K  AAKADVFH+
Sbjct  234   DVEYARWLEEQNKQINELRSAVNSHASDTELRMVVDGIMAHYDEIFRLKANAAKADVFHL  293

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCF+WLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  294   LSGMWKTPAERCFMWLGGFRSSELLKLLVNQLEPLTEQQLVGIGNLQQSSQQAEDALSQG  353

Query  511   MEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM  332
             MEALQQSLAETL+     S  SGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM
Sbjct  354   MEALQQSLAETLSSGSLGSSGSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM  413

Query  331   HRILTTRQAARAFLGISDYF  272
             HRILTTRQ+ARA L I DYF
Sbjct  414   HRILTTRQSARALLAIHDYF  433



>ref|XP_006465760.1| PREDICTED: transcription factor TGA6-like isoform X4 [Citrus 
sinensis]
 ref|XP_006465761.1| PREDICTED: transcription factor TGA6-like isoform X5 [Citrus 
sinensis]
 ref|XP_006465762.1| PREDICTED: transcription factor TGA6-like isoform X6 [Citrus 
sinensis]
Length=449

 Score =   453 bits (1165),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 258/320 (81%), Positives = 281/320 (88%), Gaps = 3/320 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STDADT++KN  F    +  +V SD SDR++D   QKTLRRLAQN
Sbjct  114   WGESNMADASPRTDISTDADTDEKNQRFDRGQSTAVVASDSSDRSKDKLDQKTLRRLAQN  173

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AF
Sbjct  174   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHSMSGNGAMAF  233

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEE N++INELR AVNSHA D ELR++VD IMAHY++IFR+K  AAKADVFH+
Sbjct  234   DVEYARWLEEQNKQINELRSAVNSHASDTELRMVVDGIMAHYDEIFRLKANAAKADVFHL  293

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCF+WLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  294   LSGMWKTPAERCFMWLGGFRSSELLKLLVNQLEPLTEQQLVGIGNLQQSSQQAEDALSQG  353

Query  511   MEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM  332
             MEALQQSLAETL+     S  SGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM
Sbjct  354   MEALQQSLAETLSSGSLGSSGSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM  413

Query  331   HRILTTRQAARAFLGISDYF  272
             HRILTTRQ+ARA L I DYF
Sbjct  414   HRILTTRQSARALLAIHDYF  433



>ref|XP_004511049.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Cicer arietinum]
Length=470

 Score =   454 bits (1167),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 259/317 (82%), Positives = 284/317 (90%), Gaps = 4/317 (1%)
 Frame = -1

Query  1210  MMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAA  1040
             +MAD SPRTD STD DT+DKN  F  N +L  VGSD SDR++D   QKTLRRLAQNREAA
Sbjct  138   VMADASPRTDISTDVDTDDKNQRFDQNQSLVAVGSDSSDRSKDKSDQKTLRRLAQNREAA  197

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQG+FISSSG+Q+ S+SGNGA+ FD EY
Sbjct  198   RKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGVFISSSGEQTHSLSGNGAMQFDAEY  257

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEE NR+INELR AVNSHA D ELR+IVD I+AHY++IFR+KG AAKADVFH+LSGM
Sbjct  258   ARWLEEQNRQINELRAAVNSHASDTELRMIVDGILAHYDEIFRLKGVAAKADVFHLLSGM  317

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFRSSELLKLL++QLEPLTEQQL+ I NLQQSSQQAEDALSQGMEAL
Sbjct  318   WKTPAERCFLWLGGFRSSELLKLLVSQLEPLTEQQLMGITNLQQSSQQAEDALSQGMEAL  377

Query  499   QQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             QQSLAETL+  +   SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI
Sbjct  378   QQSLAETLSTGAPSSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  437

Query  322   LTTRQAARAFLGISDYF  272
             LTTRQ+ARA L I DYF
Sbjct  438   LTTRQSARALLAIHDYF  454



>ref|XP_002263159.2| PREDICTED: transcription factor TGA2 isoform X2 [Vitis vinifera]
 emb|CBI35106.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   453 bits (1165),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 269/321 (84%), Positives = 286/321 (89%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STD DT+DK   F+       + SD SDR++D   QKTLRRLAQN
Sbjct  133   WGESAMADASPRTDISTDVDTDDKVQRFERGQPASNMASDSSDRSKDKNDQKTLRRLAQN  192

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SRMKLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AF
Sbjct  193   REAARKSRLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQAHSMSGNGAMAF  252

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEE NR+INELR AVNSHA DAELR+IVD+IMAHY+DIFR+KG AAKADVFH+
Sbjct  253   DVEYARWLEEQNRQINELRSAVNSHASDAELRVIVDNIMAHYDDIFRLKGVAAKADVFHL  312

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQLL I NLQQSSQQAEDALSQG
Sbjct  313   LSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLLGIGNLQQSSQQAEDALSQG  372

Query  511   MEALQQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAET  +GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ
Sbjct  373   MEALQQSLAETLSSGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  432

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DYF
Sbjct  433   MHRILTTRQSARALLAIHDYF  453



>ref|XP_011020421.1| PREDICTED: transcription factor TGA2-like isoform X1 [Populus 
euphratica]
 ref|XP_011020422.1| PREDICTED: transcription factor TGA2-like isoform X1 [Populus 
euphratica]
 ref|XP_011020423.1| PREDICTED: transcription factor TGA2-like isoform X1 [Populus 
euphratica]
 ref|XP_011020424.1| PREDICTED: transcription factor TGA2-like isoform X1 [Populus 
euphratica]
 ref|XP_011020427.1| PREDICTED: transcription factor TGA2-like isoform X1 [Populus 
euphratica]
 ref|XP_011020428.1| PREDICTED: transcription factor TGA2-like isoform X1 [Populus 
euphratica]
Length=488

 Score =   453 bits (1166),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 267/321 (83%), Positives = 288/321 (90%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STDADT+DKN  +    +  +V SD SDRTRD   QKTLRRLAQN
Sbjct  152   WGEANMADGSPRTDISTDADTDDKNQRYDRGQSTALVASDSSDRTRDKMDQKTLRRLAQN  211

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AF
Sbjct  212   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHSMSGNGAMAF  271

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEE NR+INELR AVNSHAGDAELRII+D IMAHY+++F++K  AAKADVFH+
Sbjct  272   DVEYARWLEEQNRQINELRSAVNSHAGDAELRIIIDGIMAHYDEVFKLKSNAAKADVFHL  331

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  332   LSGMWKTPAERCFLWLGGFRSSELLKLLMNQLEPLTEQQLVGIGNLQQSSQQAEDALSQG  391

Query  511   MEALQQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSL+ET  +GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ
Sbjct  392   MEALQQSLSETLSSGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  451

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DYF
Sbjct  452   MHRILTTRQSARALLAIHDYF  472



>ref|XP_011020425.1| PREDICTED: transcription factor TGA2-like isoform X2 [Populus 
euphratica]
 ref|XP_011020429.1| PREDICTED: transcription factor TGA2-like isoform X2 [Populus 
euphratica]
Length=488

 Score =   453 bits (1166),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 267/321 (83%), Positives = 288/321 (90%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STDADT+DKN  +    +  +V SD SDRTRD   QKTLRRLAQN
Sbjct  152   WGEANMADGSPRTDISTDADTDDKNQRYDRGQSTALVASDSSDRTRDKMDQKTLRRLAQN  211

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AF
Sbjct  212   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHSMSGNGAMAF  271

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEE NR+INELR AVNSHAGDAELRII+D IMAHY+++F++K  AAKADVFH+
Sbjct  272   DVEYARWLEEQNRQINELRSAVNSHAGDAELRIIIDGIMAHYDEVFKLKSNAAKADVFHL  331

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  332   LSGMWKTPAERCFLWLGGFRSSELLKLLMNQLEPLTEQQLVGIGNLQQSSQQAEDALSQG  391

Query  511   MEALQQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSL+ET  +GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ
Sbjct  392   MEALQQSLSETLSSGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  451

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DYF
Sbjct  452   MHRILTTRQSARALLAIHDYF  472



>ref|XP_010659087.1| PREDICTED: transcription factor TGA2 isoform X1 [Vitis vinifera]
 ref|XP_010659088.1| PREDICTED: transcription factor TGA2 isoform X1 [Vitis vinifera]
 ref|XP_010659089.1| PREDICTED: transcription factor TGA2 isoform X1 [Vitis vinifera]
 ref|XP_010659090.1| PREDICTED: transcription factor TGA2 isoform X1 [Vitis vinifera]
 ref|XP_010659091.1| PREDICTED: transcription factor TGA2 isoform X1 [Vitis vinifera]
 ref|XP_010659092.1| PREDICTED: transcription factor TGA2 isoform X1 [Vitis vinifera]
 ref|XP_010659093.1| PREDICTED: transcription factor TGA2 isoform X1 [Vitis vinifera]
Length=473

 Score =   452 bits (1164),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 269/321 (84%), Positives = 286/321 (89%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STD DT+DK   F+       + SD SDR++D   QKTLRRLAQN
Sbjct  137   WGESAMADASPRTDISTDVDTDDKVQRFERGQPASNMASDSSDRSKDKNDQKTLRRLAQN  196

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SRMKLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AF
Sbjct  197   REAARKSRLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQAHSMSGNGAMAF  256

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEE NR+INELR AVNSHA DAELR+IVD+IMAHY+DIFR+KG AAKADVFH+
Sbjct  257   DVEYARWLEEQNRQINELRSAVNSHASDAELRVIVDNIMAHYDDIFRLKGVAAKADVFHL  316

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQLL I NLQQSSQQAEDALSQG
Sbjct  317   LSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLLGIGNLQQSSQQAEDALSQG  376

Query  511   MEALQQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAET  +GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ
Sbjct  377   MEALQQSLAETLSSGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  436

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DYF
Sbjct  437   MHRILTTRQSARALLAIHDYF  457



>ref|XP_002303938.2| hypothetical protein POPTR_0003s19410g [Populus trichocarpa]
 gb|EEE78917.2| hypothetical protein POPTR_0003s19410g [Populus trichocarpa]
Length=487

 Score =   452 bits (1163),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 272/349 (78%), Positives = 295/349 (85%), Gaps = 6/349 (2%)
 Frame = -1

Query  1306  GENSSFVLYKEHTVMQILI*SYIWKIGIW*YPMMADVSPRTDTSTDADTEDKNMGFQNNH  1127
             GEN    L K     ++ I S       W    MAD SPRTD STDADT+DKN  +    
Sbjct  125   GENRRLPLEKVQQSNRVSIPSV--NTENWGEANMADASPRTDISTDADTDDKNQRYDRGQ  182

Query  1126  ALGIVGSDGSDRTRD---QKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqel  956
             +  +V SD SDRTRD   QKTLRRLAQNREAARKSRLRKKAYVQQLE+SR+KL+QLEQEL
Sbjct  183   STALVASDSSDRTRDKMDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLSQLEQEL  242

Query  955   qrarqqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELR  776
             QRARQQGIFISSSGDQ+ SMSGNGA+AFDVEYARWLEE NR+INELR AVNSHAGDAELR
Sbjct  243   QRARQQGIFISSSGDQTHSMSGNGAMAFDVEYARWLEEQNRQINELRSAVNSHAGDAELR  302

Query  775   IIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQL  596
             II D IMAHY+++F++K  AAKADVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL+NQL
Sbjct  303   IITDGIMAHYDEVFKLKSNAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLMNQL  362

Query  595   EPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAET-LAgslgpsgssGNVANYMGQ  419
             EPLTEQQL+ I NLQQSSQQAEDALSQGMEALQQSL+ET  +GSLG SG SGNVANYMGQ
Sbjct  363   EPLTEQQLVGIGNLQQSSQQAEDALSQGMEALQQSLSETLSSGSLGSSGPSGNVANYMGQ  422

Query  418   MAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             MAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ+ARA L I DYF
Sbjct  423   MAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYF  471



>gb|KHG29238.1| hypothetical protein F383_00102 [Gossypium arboreum]
Length=462

 Score =   451 bits (1159),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 266/321 (83%), Positives = 284/321 (88%), Gaps = 5/321 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTDTSTD DTE+KN  F       IV SD SDR++D   QKTLRRLAQN
Sbjct  127   WGDSNMADGSPRTDTSTD-DTEEKNQRFGRGQTNAIVASDSSDRSKDKTDQKTLRRLAQN  185

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISS+GDQS SMSGNGALAF
Sbjct  186   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSTGDQSHSMSGNGALAF  245

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEY+RWLEEHN+ INELR AVNSHAGDAELR IVDS+ AH++DIFR+KG AAKADVFHI
Sbjct  246   DVEYSRWLEEHNKHINELRAAVNSHAGDAELRTIVDSVTAHFDDIFRLKGIAAKADVFHI  305

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLW+GGFRSSELLKLL +QLEPLTEQQ + I NLQQSSQQAEDALSQG
Sbjct  306   LSGMWKTPAERCFLWIGGFRSSELLKLLASQLEPLTEQQFMGIQNLQQSSQQAEDALSQG  365

Query  511   MEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETLA  S  PSG SGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQ
Sbjct  366   MEALQQSLAETLANGSPAPSGPSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQ  425

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I+DYF
Sbjct  426   MHRILTTRQSARALLAINDYF  446



>ref|XP_010095986.1| Transcription factor HBP-1b(c1) [Morus notabilis]
 gb|EXB62679.1| Transcription factor HBP-1b(c1) [Morus notabilis]
Length=386

 Score =   447 bits (1150),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 267/318 (84%), Positives = 284/318 (89%), Gaps = 5/318 (2%)
 Frame = -1

Query  1213  PMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREA  1043
             P MAD SPRTD STD DT++KN  F      GIVG D SDR+ D   QKTLRRLAQNREA
Sbjct  54    PPMADASPRTDISTDVDTDEKNQRFDRGQ-YGIVGFDSSDRSNDKTDQKTLRRLAQNREA  112

Query  1042  ARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVE  863
             ARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISS+GDQ+ SMSGNGA+AFDVE
Sbjct  113   ARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSAGDQAHSMSGNGAMAFDVE  172

Query  862   YARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSG  683
             YARWLEE NR+INELR AVNSHA D ELRII+D I+AHY++IFR+KG AAKADVFH+LSG
Sbjct  173   YARWLEEQNRQINELRSAVNSHASDTELRIIIDGILAHYDEIFRLKGIAAKADVFHLLSG  232

Query  682   MWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEA  503
             MWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQLL I NLQQSSQQAEDALSQGMEA
Sbjct  233   MWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLLGITNLQQSSQQAEDALSQGMEA  292

Query  502   LQQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             LQQSLAET   GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR
Sbjct  293   LQQSLAETLSNGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  352

Query  325   ILTTRQAARAFLGISDYF  272
             ILTTRQ+ARA L I DYF
Sbjct  353   ILTTRQSARALLAIHDYF  370



>ref|XP_007028143.1| TGACG motif-binding factor 6 isoform 1 [Theobroma cacao]
 ref|XP_007028144.1| TGACG motif-binding factor 6 isoform 1 [Theobroma cacao]
 ref|XP_007028145.1| TGACG motif-binding factor 6 isoform 1 [Theobroma cacao]
 gb|EOY08645.1| TGACG motif-binding factor 6 isoform 1 [Theobroma cacao]
 gb|EOY08646.1| TGACG motif-binding factor 6 isoform 1 [Theobroma cacao]
 gb|EOY08647.1| TGACG motif-binding factor 6 isoform 1 [Theobroma cacao]
Length=465

 Score =   449 bits (1156),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 267/321 (83%), Positives = 286/321 (89%), Gaps = 5/321 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STD DT++KN  F+      IV SD SDR++D   QKTLRRLAQN
Sbjct  130   WGDSNMADASPRTDISTD-DTDEKNQRFERGQTNAIVASDSSDRSKDKTDQKTLRRLAQN  188

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS SMSGNGALAF
Sbjct  189   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSMSGNGALAF  248

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEEHNR+INELR AVNSHAGD ELR IVD++ AH++DIFR+KG AAKADVFHI
Sbjct  249   DVEYARWLEEHNRQINELRAAVNSHAGDTELRTIVDNVTAHFDDIFRLKGIAAKADVFHI  308

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLW+GGFRSSELLKLL NQLEPLTEQQ +  +NLQQSSQQAEDALSQG
Sbjct  309   LSGMWKTPAERCFLWIGGFRSSELLKLLANQLEPLTEQQFMGFHNLQQSSQQAEDALSQG  368

Query  511   MEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETLA  S GPSGSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQ
Sbjct  369   MEALQQSLAETLANGSPGPSGSSGNVANYMGQMAMAMGKLGTLEGFVRQADNLRQQTLQQ  428

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I+DYF
Sbjct  429   MHRILTTRQSARALLAINDYF  449



>ref|XP_002513027.1| Transcription factor HBP-1b(c1), putative [Ricinus communis]
 gb|EEF49530.1| Transcription factor HBP-1b(c1), putative [Ricinus communis]
Length=463

 Score =   449 bits (1156),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 266/321 (83%), Positives = 286/321 (89%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STD DT+DKN  F    +  I  SD SDR++D   QKTLRRLAQN
Sbjct  127   WEESNMADGSPRTDLSTDGDTDDKNQRFDRGLSTAIAASDSSDRSKDKMDQKTLRRLAQN  186

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AF
Sbjct  187   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHSMSGNGAMAF  246

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEE NR+INELR AVNSHAGDAELRII+D +MAHY++IFR+K  AAKADVFH+
Sbjct  247   DVEYARWLEEQNRQINELRSAVNSHAGDAELRIIIDGVMAHYDEIFRLKSNAAKADVFHL  306

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ + NLQQSSQQAEDALSQG
Sbjct  307   LSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLVGLGNLQQSSQQAEDALSQG  366

Query  511   MEALQQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAET  +GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ
Sbjct  367   MEALQQSLAETLSSGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  426

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DYF
Sbjct  427   MHRILTTRQSARALLAIHDYF  447



>ref|XP_006605394.1| PREDICTED: uncharacterized protein LOC100816123 isoform X4 [Glycine 
max]
Length=332

 Score =   444 bits (1143),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 259/316 (82%), Positives = 284/316 (90%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD STD DT+DKN  F  + +L  V SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADASPRTDISTDVDTDDKNPRFDRSQSLVAVVSDSSDRSKDKSDQKTLRRLAQNREAAR  60

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGI IS+SGDQ+ SMSGNGA+AFDVEYA
Sbjct  61    KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIIISNSGDQAHSMSGNGAMAFDVEYA  120

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR++NELR AVNSHAGD ELR+I+D IMAHY++IFR+K +AAKADVFH+LSGMW
Sbjct  121   RWLEEQNRQVNELRAAVNSHAGDTELRMIIDGIMAHYDEIFRLKADAAKADVFHLLSGMW  180

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQ
Sbjct  181   KTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLVGITNLQQSSQQAEDALSQGMEALQ  240

Query  496   QSLAE-TLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSL+E    GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFI+QADNLRQQTLQQ+HRIL
Sbjct  241   QSLSETLSTGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIKQADNLRQQTLQQIHRIL  300

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  301   TTRQSARALLAIHDYF  316



>ref|XP_007142625.1| hypothetical protein PHAVU_007G003600g [Phaseolus vulgaris]
 gb|ESW14619.1| hypothetical protein PHAVU_007G003600g [Phaseolus vulgaris]
Length=444

 Score =   449 bits (1154),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 261/316 (83%), Positives = 285/316 (90%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD STDADT+DKN  F  +HAL    SD SDR++D   QKTLRRLAQNREAAR
Sbjct  113   MADASPRTDISTDADTDDKNPQFDRSHALVAAASDSSDRSKDKSDQKTLRRLAQNREAAR  172

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQG+FISSSGDQ+ SMSGNGA+AFDVEYA
Sbjct  173   KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGVFISSSGDQAHSMSGNGAMAFDVEYA  232

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RW+EE NR+INELR AVNSHAGD EL +I+D +MAHY++IFR+KG AAKADVFH+LSGMW
Sbjct  233   RWVEEQNRQINELRAAVNSHAGDTELCMIIDGVMAHYDEIFRLKGNAAKADVFHLLSGMW  292

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQ
Sbjct  293   KTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLVGITNLQQSSQQAEDALSQGMEALQ  352

Query  496   QSLAE-TLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSL+E    GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFI+QADNLRQQTLQQ+HRIL
Sbjct  353   QSLSETLSTGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIKQADNLRQQTLQQIHRIL  412

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  413   TTRQSARALLAIHDYF  428



>ref|XP_007133721.1| hypothetical protein PHAVU_011G203400g [Phaseolus vulgaris]
 gb|AAK84889.1|AF402608_1 TGA-type basic leucine zipper protein TGA2.1 [Phaseolus vulgaris]
 gb|ESW05715.1| hypothetical protein PHAVU_011G203400g [Phaseolus vulgaris]
Length=467

 Score =   449 bits (1154),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 260/316 (82%), Positives = 281/316 (89%), Gaps = 5/316 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD STD DT+DKN  F  N +L  V SD SDR++D   QKTLRRLAQNREAAR
Sbjct  137   MADASPRTDISTDVDTDDKNQPFDRNQSLAAV-SDSSDRSKDKSDQKTLRRLAQNREAAR  195

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ ++SGNGA+ FD EYA
Sbjct  196   KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHTLSGNGAMQFDAEYA  255

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR+INELR AVNSHA D ELR+IVD I+AHY++IFR+KG AAKADVFH+LSGMW
Sbjct  256   RWLEEQNRQINELRAAVNSHASDTELRMIVDGILAHYDEIFRMKGVAAKADVFHLLSGMW  315

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQ
Sbjct  316   KTPAERCFLWLGGFRSSELLKLLANQLEPLTEQQLMGITNLQQSSQQAEDALSQGMEALQ  375

Query  496   QSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSLAETL+  +   SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL
Sbjct  376   QSLAETLSTGAPASSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  435

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  436   TTRQSARALLAIHDYF  451



>ref|XP_008231625.1| PREDICTED: transcription factor TGA2-like [Prunus mume]
Length=333

 Score =   443 bits (1139),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 263/317 (83%), Positives = 285/317 (90%), Gaps = 5/317 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQN-NHALGIVGSDGSDRTRD---QKTLRRLAQNREAA  1040
             MAD SPRTD STD DT+DKN  F    +A+G  GSD SD+++D   QKTLRRLAQNREAA
Sbjct  1     MADGSPRTDISTDVDTDDKNQRFDVVQYAIGPAGSDSSDKSKDPKDQKTLRRLAQNREAA  60

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGD + SMSGNGA+AFDVEY
Sbjct  61    RKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDAAHSMSGNGAMAFDVEY  120

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
              RW EE NR+INELR AVNSHA DAELR IVD I+AHY++IFR+KG AAKADVFH+LSGM
Sbjct  121   GRWQEEQNRQINELRSAVNSHASDAELRTIVDGILAHYDEIFRLKGTAAKADVFHLLSGM  180

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGM+AL
Sbjct  181   WKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLVGITNLQQSSQQAEDALSQGMDAL  240

Query  499   QQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             QQSLAET  +GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI
Sbjct  241   QQSLAETLSSGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  300

Query  322   LTTRQAARAFLGISDYF  272
             LTTRQ+ARA L I+DYF
Sbjct  301   LTTRQSARALLAINDYF  317



>ref|XP_006605392.1| PREDICTED: uncharacterized protein LOC100816123 isoform X2 [Glycine 
max]
 ref|XP_006605393.1| PREDICTED: uncharacterized protein LOC100816123 isoform X3 [Glycine 
max]
Length=420

 Score =   446 bits (1146),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 259/316 (82%), Positives = 284/316 (90%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD STD DT+DKN  F  + +L  V SD SDR++D   QKTLRRLAQNREAAR
Sbjct  89    MADASPRTDISTDVDTDDKNPRFDRSQSLVAVVSDSSDRSKDKSDQKTLRRLAQNREAAR  148

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGI IS+SGDQ+ SMSGNGA+AFDVEYA
Sbjct  149   KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIIISNSGDQAHSMSGNGAMAFDVEYA  208

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR++NELR AVNSHAGD ELR+I+D IMAHY++IFR+K +AAKADVFH+LSGMW
Sbjct  209   RWLEEQNRQVNELRAAVNSHAGDTELRMIIDGIMAHYDEIFRLKADAAKADVFHLLSGMW  268

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQ
Sbjct  269   KTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLVGITNLQQSSQQAEDALSQGMEALQ  328

Query  496   QSLAE-TLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSL+E    GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFI+QADNLRQQTLQQ+HRIL
Sbjct  329   QSLSETLSTGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIKQADNLRQQTLQQIHRIL  388

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  389   TTRQSARALLAIHDYF  404



>ref|XP_009372782.1| PREDICTED: transcription factor TGA2-like [Pyrus x bretschneideri]
 ref|XP_009372783.1| PREDICTED: transcription factor TGA2-like [Pyrus x bretschneideri]
 ref|XP_009372784.1| PREDICTED: transcription factor TGA2-like [Pyrus x bretschneideri]
Length=333

 Score =   442 bits (1137),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 259/317 (82%), Positives = 286/317 (90%), Gaps = 5/317 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGF-QNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAA  1040
             MAD SPRTD STD +T+DKN  F ++ +A+  V SD SD+++D   QKTLRRLAQNREAA
Sbjct  1     MADGSPRTDISTDVETDDKNQRFDRDQYAIAPVASDSSDKSKDPKDQKTLRRLAQNREAA  60

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFIS+SGD + S SGNGA+AFDVEY
Sbjct  61    RKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISNSGDAAHSNSGNGAMAFDVEY  120

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
              RW EEHNR+INELR AVNSHA DAELRIIVD ++AHY+++FR+KG AAKADVFH+LSGM
Sbjct  121   GRWQEEHNRQINELRSAVNSHASDAELRIIVDGVLAHYDEVFRLKGTAAKADVFHLLSGM  180

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFRSSELLKLL+ QLEPLTEQQL+ INNLQQSSQQAEDALSQGMEAL
Sbjct  181   WKTPAERCFLWLGGFRSSELLKLLVTQLEPLTEQQLVGINNLQQSSQQAEDALSQGMEAL  240

Query  499   QQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             QQSLAET  +GSLG SG+SGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI
Sbjct  241   QQSLAETLSSGSLGSSGNSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  300

Query  322   LTTRQAARAFLGISDYF  272
             LTTRQ+ARA L I DYF
Sbjct  301   LTTRQSARALLAIHDYF  317



>ref|NP_001242879.1| uncharacterized protein LOC100816123 [Glycine max]
 gb|ACU17693.1| unknown [Glycine max]
Length=429

 Score =   445 bits (1145),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 259/316 (82%), Positives = 284/316 (90%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD STD DT+DKN  F  + +L  V SD SDR++D   QKTLRRLAQNREAAR
Sbjct  113   MADASPRTDISTDVDTDDKNPRFDRSQSLVAVVSDSSDRSKDKSDQKTLRRLAQNREAAR  172

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGI IS+SGDQ+ SMSGNGA+AFDVEYA
Sbjct  173   KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIIISNSGDQAHSMSGNGAMAFDVEYA  232

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR++NELR AVNSHAGD ELR+I+D IMAHY++IFR+K +AAKADVFH+LSGMW
Sbjct  233   RWLEEQNRQVNELRAAVNSHAGDTELRMIIDGIMAHYDEIFRLKADAAKADVFHLLSGMW  292

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQ
Sbjct  293   KTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLVGIANLQQSSQQAEDALSQGMEALQ  352

Query  496   QSLAE-TLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSL+E    GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFI+QADNLRQQTLQQ+HRIL
Sbjct  353   QSLSETLSTGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIKQADNLRQQTLQQIHRIL  412

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  413   TTRQSARALLAIHDYF  428



>ref|XP_006368634.1| hypothetical protein POPTR_0001s06700g [Populus trichocarpa]
 gb|ERP65203.1| hypothetical protein POPTR_0001s06700g [Populus trichocarpa]
Length=465

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 263/321 (82%), Positives = 286/321 (89%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STDADT+DKN  F  + +  +V SD SDR++D   QKTLRRLAQN
Sbjct  129   WGETNMADASPRTDISTDADTDDKNQRFDGSLSTALVASDSSDRSKDKMDQKTLRRLAQN  188

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIF+SSSGDQS SMSGNGA+AF
Sbjct  189   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFVSSSGDQSHSMSGNGAMAF  248

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLE+ NR+INELR AVNSH GD ELRII+D IMAHY+++FR+K  AAKADVFH+
Sbjct  249   DVEYARWLEDQNRQINELRSAVNSHTGDTELRIIIDGIMAHYDEVFRLKSNAAKADVFHL  308

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLT+QQL+ I NLQQSSQQAEDALSQG
Sbjct  309   LSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTDQQLVGIGNLQQSSQQAEDALSQG  368

Query  511   MEALQQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAET  +GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ
Sbjct  369   MEALQQSLAETLSSGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  428

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L I DYF
Sbjct  429   MQRILTTRQSARALLAIHDYF  449



>ref|XP_006605391.1| PREDICTED: uncharacterized protein LOC100816123 isoform X1 [Glycine 
max]
 gb|KHN27124.1| Transcription factor HBP-1b(c1) [Glycine soja]
Length=444

 Score =   445 bits (1145),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 259/316 (82%), Positives = 284/316 (90%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD STD DT+DKN  F  + +L  V SD SDR++D   QKTLRRLAQNREAAR
Sbjct  113   MADASPRTDISTDVDTDDKNPRFDRSQSLVAVVSDSSDRSKDKSDQKTLRRLAQNREAAR  172

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGI IS+SGDQ+ SMSGNGA+AFDVEYA
Sbjct  173   KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIIISNSGDQAHSMSGNGAMAFDVEYA  232

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR++NELR AVNSHAGD ELR+I+D IMAHY++IFR+K +AAKADVFH+LSGMW
Sbjct  233   RWLEEQNRQVNELRAAVNSHAGDTELRMIIDGIMAHYDEIFRLKADAAKADVFHLLSGMW  292

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQ
Sbjct  293   KTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLVGITNLQQSSQQAEDALSQGMEALQ  352

Query  496   QSLAE-TLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSL+E    GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFI+QADNLRQQTLQQ+HRIL
Sbjct  353   QSLSETLSTGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIKQADNLRQQTLQQIHRIL  412

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  413   TTRQSARALLAIHDYF  428



>gb|KHN37272.1| Transcription factor HBP-1b(c1) [Glycine soja]
Length=332

 Score =   441 bits (1134),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 258/316 (82%), Positives = 283/316 (90%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD STD DT+DKN  F  + +L  V SD SDR++D   QK+LRRLAQNREAAR
Sbjct  1     MADASPRTDISTDVDTDDKNPRFDRSQSLVAVASDSSDRSKDKSDQKSLRRLAQNREAAR  60

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFIS+SGDQ+ SMSGNGA+AFDVEYA
Sbjct  61    KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISNSGDQAHSMSGNGAMAFDVEYA  120

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR+INELR  VNSHAGD ELR+I+D IMAHY++IFR+K +AAKADVFH+LSGMW
Sbjct  121   RWLEEQNRQINELRAGVNSHAGDTELRMIIDGIMAHYDEIFRLKADAAKADVFHLLSGMW  180

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQ
Sbjct  181   KTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLVGITNLQQSSQQAEDALSQGMEALQ  240

Query  496   QSLAE-TLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSL+E    GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFI+QADNLRQQTL Q+HRIL
Sbjct  241   QSLSETLSTGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIKQADNLRQQTLHQIHRIL  300

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  301   TTRQSARALLAIHDYF  316



>ref|XP_003546706.1| PREDICTED: transcription factor HBP-1b(c1) isoform X1 [Glycine 
max]
 ref|XP_006598095.1| PREDICTED: transcription factor HBP-1b(c1) isoform X3 [Glycine 
max]
 gb|KHN35294.1| TGACG-sequence-specific DNA-binding protein TGA-2.1 [Glycine 
soja]
Length=468

 Score =   446 bits (1147),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 256/316 (81%), Positives = 281/316 (89%), Gaps = 5/316 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD STD DT+DKN  +  N AL  V SD SDR++D   QKTLRRLAQNREAAR
Sbjct  138   MADASPRTDISTDGDTDDKNQPYDRNEALAAV-SDSSDRSKDKSDQKTLRRLAQNREAAR  196

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQ GIFISSSGDQ+ ++SGNGA+ FD EYA
Sbjct  197   KSRLRKKAYVQQLESSRLKLTQLEQELQRARQHGIFISSSGDQAHTLSGNGAMQFDAEYA  256

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR+INEL+ AVNSHA D ELR+IVD I+AHY++IFR+KG AAKADVFH+LSGMW
Sbjct  257   RWLEEQNRQINELKAAVNSHASDTELRMIVDGILAHYDEIFRLKGVAAKADVFHLLSGMW  316

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL++QLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQ
Sbjct  317   KTPAERCFLWLGGFRSSELLKLLVSQLEPLTEQQLMGITNLQQSSQQAEDALSQGMEALQ  376

Query  496   QSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSLAETL+  +   SGSSGNVANYMGQMAMAMGKLGTLEGFI+QADNLRQQTLQQMHRIL
Sbjct  377   QSLAETLSTGAPASSGSSGNVANYMGQMAMAMGKLGTLEGFIQQADNLRQQTLQQMHRIL  436

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  437   TTRQSARALLAIHDYF  452



>ref|XP_008375358.1| PREDICTED: transcription factor TGA2-like [Malus domestica]
 ref|XP_008375359.1| PREDICTED: transcription factor TGA2-like [Malus domestica]
Length=333

 Score =   440 bits (1131),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 259/317 (82%), Positives = 285/317 (90%), Gaps = 5/317 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGF-QNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAA  1040
             MAD SPRTD STD DT+DKN  F ++ +A+  V SD SD+++D   QKTLRRLAQNREAA
Sbjct  1     MADGSPRTDISTDVDTDDKNQRFDRDQYAIAPVASDSSDKSKDPKDQKTLRRLAQNREAA  60

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFIS+SGD + S SGNGA+ F+VEY
Sbjct  61    RKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISNSGDAAHSNSGNGAMTFNVEY  120

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
              RWLEE NR+INELR AVNSHA DAELRIIVD I+AHY++IFR+KG AAKADVFH+LSGM
Sbjct  121   GRWLEEQNRQINELRSAVNSHASDAELRIIVDGILAHYDEIFRLKGTAAKADVFHLLSGM  180

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFRSSELLKLL+ QLEPLTEQQL+ INNLQQSSQQAEDALSQGM+AL
Sbjct  181   WKTPAERCFLWLGGFRSSELLKLLVTQLEPLTEQQLVGINNLQQSSQQAEDALSQGMDAL  240

Query  499   QQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             QQSLAET  +GSLG SG+SGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI
Sbjct  241   QQSLAETLSSGSLGSSGNSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  300

Query  322   LTTRQAARAFLGISDYF  272
             LTTRQ+ARA L I DYF
Sbjct  301   LTTRQSARALLAIHDYF  317



>gb|ACU78078.1| TGA1a-related protein 6 [Malus hupehensis]
Length=333

 Score =   439 bits (1129),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 258/317 (81%), Positives = 285/317 (90%), Gaps = 5/317 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGF-QNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAA  1040
             MAD SPRTD ST+ +T+DKN  F ++ +A+  V SD SD+++D   QKTLRRLAQNREAA
Sbjct  1     MADGSPRTDISTNGETDDKNRRFDRDQYAIAPVASDSSDKSKDPKDQKTLRRLAQNREAA  60

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFIS+SGD + S SGNGA+AFDVEY
Sbjct  61    RKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISNSGDAAHSNSGNGAMAFDVEY  120

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
              RW EEHNR+INELR AVNSHA D ELRIIVD ++AHY+++FR+KG AAKADVFH+LSGM
Sbjct  121   GRWQEEHNRQINELRSAVNSHASDTELRIIVDGVLAHYDEVFRLKGTAAKADVFHLLSGM  180

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFRSSELLKLL+ QLEPLTEQQLL INNLQQSSQQAEDALSQGMEAL
Sbjct  181   WKTPAERCFLWLGGFRSSELLKLLVTQLEPLTEQQLLGINNLQQSSQQAEDALSQGMEAL  240

Query  499   QQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             QQSLAET  +GSLG SG+SGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI
Sbjct  241   QQSLAETLSSGSLGSSGNSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  300

Query  322   LTTRQAARAFLGISDYF  272
             LTTRQ+ARA L I DYF
Sbjct  301   LTTRQSARALLAIHDYF  317



>ref|XP_006598094.1| PREDICTED: transcription factor HBP-1b(c1) isoform X2 [Glycine 
max]
Length=493

 Score =   445 bits (1144),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 256/316 (81%), Positives = 281/316 (89%), Gaps = 5/316 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD STD DT+DKN  +  N AL  V SD SDR++D   QKTLRRLAQNREAAR
Sbjct  163   MADASPRTDISTDGDTDDKNQPYDRNEALAAV-SDSSDRSKDKSDQKTLRRLAQNREAAR  221

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQ GIFISSSGDQ+ ++SGNGA+ FD EYA
Sbjct  222   KSRLRKKAYVQQLESSRLKLTQLEQELQRARQHGIFISSSGDQAHTLSGNGAMQFDAEYA  281

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR+INEL+ AVNSHA D ELR+IVD I+AHY++IFR+KG AAKADVFH+LSGMW
Sbjct  282   RWLEEQNRQINELKAAVNSHASDTELRMIVDGILAHYDEIFRLKGVAAKADVFHLLSGMW  341

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL++QLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQ
Sbjct  342   KTPAERCFLWLGGFRSSELLKLLVSQLEPLTEQQLMGITNLQQSSQQAEDALSQGMEALQ  401

Query  496   QSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSLAETL+  +   SGSSGNVANYMGQMAMAMGKLGTLEGFI+QADNLRQQTLQQMHRIL
Sbjct  402   QSLAETLSTGAPASSGSSGNVANYMGQMAMAMGKLGTLEGFIQQADNLRQQTLQQMHRIL  461

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  462   TTRQSARALLAIHDYF  477



>gb|KHN37699.1| Transcription factor HBP-1b(c1) [Glycine soja]
Length=438

 Score =   442 bits (1138),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 258/321 (80%), Positives = 282/321 (88%), Gaps = 5/321 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STD DT+DKN  F  N AL  V SD SDR++D   QKTLRRLAQN
Sbjct  103   WEESTMADASPRTDISTDGDTDDKNHPFDRNQALTAV-SDSSDRSKDKSDQKTLRRLAQN  161

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ ++SGNGA+ F
Sbjct  162   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHTLSGNGAMQF  221

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D EYARWLEE NR+INELR AVNSHA D ELR+IVD I+AHY++IFR+KG AAKADVFH+
Sbjct  222   DAEYARWLEEQNRQINELRAAVNSHASDTELRMIVDGILAHYDEIFRLKGVAAKADVFHL  281

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL++QLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  282   LSGMWKTPAERCFLWLGGFRSSELLKLLVSQLEPLTEQQLMGITNLQQSSQQAEDALSQG  341

Query  511   MEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETL+  +   SGSSGNVA+YMGQMAMAMGKLGTLEGFI+QADNLRQQTLQQ
Sbjct  342   MEALQQSLAETLSTGAPASSGSSGNVASYMGQMAMAMGKLGTLEGFIQQADNLRQQTLQQ  401

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DY 
Sbjct  402   MHRILTTRQSARALLAIHDYI  422



>ref|XP_009361886.1| PREDICTED: transcription factor TGA2-like [Pyrus x bretschneideri]
 ref|XP_009361887.1| PREDICTED: transcription factor TGA2-like [Pyrus x bretschneideri]
Length=333

 Score =   439 bits (1128),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 258/317 (81%), Positives = 285/317 (90%), Gaps = 5/317 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGF-QNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAA  1040
             MAD SPRTD STD DT+DKN  F ++ +A+  V SD SD+++D   QKTLRRLAQNREAA
Sbjct  1     MADGSPRTDISTDVDTDDKNQRFDRDQYAIAPVASDSSDKSKDPKDQKTLRRLAQNREAA  60

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFIS+SGD + S SGNGA+ F+VEY
Sbjct  61    RKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISNSGDAAHSNSGNGAMTFNVEY  120

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
              RWLEE NR+INELR AVNSHA DAELRIIVD I+AHY++IF++KG AAKADVFH+LSGM
Sbjct  121   GRWLEEQNRQINELRSAVNSHASDAELRIIVDGILAHYDEIFKLKGTAAKADVFHLLSGM  180

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFRSSELLKLL+ QLEPLTEQQL+ INNLQQSSQQAEDALSQGM+AL
Sbjct  181   WKTPAERCFLWLGGFRSSELLKLLVTQLEPLTEQQLVGINNLQQSSQQAEDALSQGMDAL  240

Query  499   QQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             QQSLAET  +GSLG SG+SGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI
Sbjct  241   QQSLAETLSSGSLGSSGNSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  300

Query  322   LTTRQAARAFLGISDYF  272
             LTTRQ+ARA L I DYF
Sbjct  301   LTTRQSARALLAIHDYF  317



>ref|NP_001237963.1| bZIP transcription factor bZIP99 [Glycine max]
 gb|ABI34658.1| bZIP transcription factor bZIP99 [Glycine max]
Length=467

 Score =   442 bits (1137),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 258/321 (80%), Positives = 282/321 (88%), Gaps = 5/321 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STD DT+DKN  F  N AL  V SD SDR++D   QKTLRRLAQN
Sbjct  132   WEESTMADASPRTDISTDGDTDDKNHPFDRNQALTAV-SDSSDRSKDKSDQKTLRRLAQN  190

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ ++SGNGA+ F
Sbjct  191   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHTLSGNGAMQF  250

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D EYARWLEE NR+INELR AVNSHA D ELR+IVD I+AHY++IFR+KG AAKADVFH+
Sbjct  251   DAEYARWLEEQNRQINELRAAVNSHASDTELRMIVDGILAHYDEIFRLKGVAAKADVFHL  310

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL++QLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  311   LSGMWKTPAERCFLWLGGFRSSELLKLLVSQLEPLTEQQLMGITNLQQSSQQAEDALSQG  370

Query  511   MEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETL+  +   SGSSGNVA+YMGQMAMAMGKLGTLEGFI+QADNLRQQTLQQ
Sbjct  371   MEALQQSLAETLSTGAPASSGSSGNVASYMGQMAMAMGKLGTLEGFIQQADNLRQQTLQQ  430

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DY 
Sbjct  431   MHRILTTRQSARALLAIHDYI  451



>ref|XP_006594375.1| PREDICTED: transcription factor HBP-1b(c1) isoform X1 [Glycine 
max]
 ref|XP_006594376.1| PREDICTED: transcription factor HBP-1b(c1) isoform X2 [Glycine 
max]
Length=469

 Score =   442 bits (1136),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 258/321 (80%), Positives = 282/321 (88%), Gaps = 5/321 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STD DT+DKN  F  N AL  V SD SDR++D   QKTLRRLAQN
Sbjct  134   WEESTMADASPRTDISTDGDTDDKNHPFDRNQALTAV-SDSSDRSKDKSDQKTLRRLAQN  192

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ ++SGNGA+ F
Sbjct  193   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHTLSGNGAMQF  252

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D EYARWLEE NR+INELR AVNSHA D ELR+IVD I+AHY++IFR+KG AAKADVFH+
Sbjct  253   DAEYARWLEEQNRQINELRAAVNSHASDTELRMIVDGILAHYDEIFRLKGVAAKADVFHL  312

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL++QLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  313   LSGMWKTPAERCFLWLGGFRSSELLKLLVSQLEPLTEQQLMGITNLQQSSQQAEDALSQG  372

Query  511   MEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETL+  +   SGSSGNVA+YMGQMAMAMGKLGTLEGFI+QADNLRQQTLQQ
Sbjct  373   MEALQQSLAETLSTGAPASSGSSGNVASYMGQMAMAMGKLGTLEGFIQQADNLRQQTLQQ  432

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DY 
Sbjct  433   MHRILTTRQSARALLAIHDYI  453



>ref|XP_010245498.1| PREDICTED: transcription factor TGA2-like isoform X2 [Nelumbo 
nucifera]
Length=468

 Score =   442 bits (1136),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 271/321 (84%), Positives = 293/321 (91%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTDTSTD DT+DKN   +   +  +VGSD SDR++D   QKTLRRLAQN
Sbjct  132   WGESSMADASPRTDTSTDVDTDDKNQKMETGQSTAVVGSDSSDRSKDKLDQKTLRRLAQN  191

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS S+SGNGALAF
Sbjct  192   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSVSGNGALAF  251

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D+EYARWLEEHNR+INELR AVNSHA D+ELR+IVD +MAHY+DIFR+KG AAKADVFH+
Sbjct  252   DIEYARWLEEHNRQINELRNAVNSHASDSELRVIVDGVMAHYDDIFRLKGIAAKADVFHM  311

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  312   LSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGICNLQQSSQQAEDALSQG  371

Query  511   MEALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETLA GSLGPSGSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQ
Sbjct  372   MEALQQSLAETLASGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQ  431

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I+DYF
Sbjct  432   MHRILTTRQSARALLAINDYF  452



>ref|XP_010247478.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor TGA2-like 
[Nelumbo nucifera]
Length=484

 Score =   441 bits (1134),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 265/321 (83%), Positives = 284/321 (88%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHAL-GIVGSDGSDRTRD---QKTLRRLAQ  1055
             W    MAD SPRTDTSTD DT+DKN   +   +   +V SD SDR++D   QKTLRRLAQ
Sbjct  132   WGESTMADASPRTDTSTDVDTDDKNPRMEMGQSTTAVVASDSSDRSKDKADQKTLRRLAQ  191

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSSGDQS SMSGNGALA
Sbjct  192   NREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSGDQSHSMSGNGALA  251

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD+EYARWLEEHNR+INELR AVNSHA D+ELRIIVD +MAHY+DIFR+KG AAKADVFH
Sbjct  252   FDIEYARWLEEHNRQINELRNAVNSHASDSELRIIVDGVMAHYDDIFRLKGTAAKADVFH  311

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCFLW+GGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  312   ILSGMWKTPAERCFLWIGGFRSSELLKLLVNQLEPLTEQQLVGICNLQQSSQQAEDALSQ  371

Query  514   GMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             GMEALQQSLAETLA        SGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQ
Sbjct  372   GMEALQQSLAETLASGSLGPSGSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQ  431

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I+DYF
Sbjct  432   MHRILTTRQSARALLAINDYF  452



>gb|KHG21339.1| hypothetical protein F383_27590 [Gossypium arboreum]
Length=470

 Score =   440 bits (1132),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 263/321 (82%), Positives = 283/321 (88%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQN  1052
             W    MAD SP+TD STDADT++K+  F    +  +  SD SDR++   DQKTLRRLAQN
Sbjct  134   WGESNMADGSPKTDISTDADTDEKSQRFDRGKSSIVAVSDSSDRSKSNLDQKTLRRLAQN  193

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS SM GNGA+AF
Sbjct  194   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSMGGNGAMAF  253

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEE NR+INELR AVNSHA DAELRIIVD +MAHY++IFR+K  AAKADVFH+
Sbjct  254   DVEYARWLEEQNRQINELRTAVNSHASDAELRIIVDGVMAHYDEIFRLKSNAAKADVFHL  313

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  314   LSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLVGIGNLQQSSQQAEDALSQG  373

Query  511   MEALQQSLAE-TLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAE    GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ
Sbjct  374   MEALQQSLAETLSTGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  433

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DYF
Sbjct  434   MHRILTTRQSARALLAIHDYF  454



>ref|XP_011000603.1| PREDICTED: transcription factor TGA2-like isoform X1 [Populus 
euphratica]
 ref|XP_011000604.1| PREDICTED: transcription factor TGA2-like isoform X1 [Populus 
euphratica]
 ref|XP_011000605.1| PREDICTED: transcription factor TGA2-like isoform X1 [Populus 
euphratica]
 ref|XP_011000606.1| PREDICTED: transcription factor TGA2-like isoform X1 [Populus 
euphratica]
 ref|XP_011000607.1| PREDICTED: transcription factor TGA2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   441 bits (1133),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 266/321 (83%), Positives = 285/321 (89%), Gaps = 6/321 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STDADT+DKN  F  + AL  V SD SDR++D   QKTLRRLAQN
Sbjct  144   WGETNMADASPRTDISTDADTDDKNRRFDQSTAL--VVSDSSDRSKDKMDQKTLRRLAQN  201

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+S +KLTQLEQELQRARQQGIF+SSSGDQS SMSGNGA+AF
Sbjct  202   REAARKSRLRKKAYVQQLESSGLKLTQLEQELQRARQQGIFVSSSGDQSHSMSGNGAMAF  261

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEE NR+INELR AVNSH GDAELRII+D IMAHY+++FR+K  AAKADVFH+
Sbjct  262   DVEYARWLEEQNRQINELRSAVNSHTGDAELRIIIDGIMAHYDEVFRLKSNAAKADVFHL  321

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL N LEPLT+QQL+ I NLQQSSQQAEDALSQG
Sbjct  322   LSGMWKTPAERCFLWLGGFRSSELLKLLGNHLEPLTDQQLVGIGNLQQSSQQAEDALSQG  381

Query  511   MEALQQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAET  +GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ
Sbjct  382   MEALQQSLAETLSSGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  441

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DYF
Sbjct  442   MHRILTTRQSARALLAIHDYF  462



>ref|XP_011000608.1| PREDICTED: transcription factor TGA2-like isoform X2 [Populus 
euphratica]
Length=476

 Score =   440 bits (1132),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 266/321 (83%), Positives = 285/321 (89%), Gaps = 6/321 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STDADT+DKN  F  + AL  V SD SDR++D   QKTLRRLAQN
Sbjct  142   WGETNMADASPRTDISTDADTDDKNRRFDQSTAL--VVSDSSDRSKDKMDQKTLRRLAQN  199

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+S +KLTQLEQELQRARQQGIF+SSSGDQS SMSGNGA+AF
Sbjct  200   REAARKSRLRKKAYVQQLESSGLKLTQLEQELQRARQQGIFVSSSGDQSHSMSGNGAMAF  259

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEE NR+INELR AVNSH GDAELRII+D IMAHY+++FR+K  AAKADVFH+
Sbjct  260   DVEYARWLEEQNRQINELRSAVNSHTGDAELRIIIDGIMAHYDEVFRLKSNAAKADVFHL  319

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL N LEPLT+QQL+ I NLQQSSQQAEDALSQG
Sbjct  320   LSGMWKTPAERCFLWLGGFRSSELLKLLGNHLEPLTDQQLVGIGNLQQSSQQAEDALSQG  379

Query  511   MEALQQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAET  +GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ
Sbjct  380   MEALQQSLAETLSSGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  439

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DYF
Sbjct  440   MHRILTTRQSARALLAIHDYF  460



>ref|XP_004228505.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum lycopersicum]
 ref|XP_010314690.1| PREDICTED: transcription factor HBP-1b(c38)-like [Solanum lycopersicum]
Length=327

 Score =   434 bits (1116),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 268/312 (86%), Positives = 290/312 (93%), Gaps = 1/312 (0%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKSR  1028
             MADVS  TDTSTD DT+DKN+ + N+  LG   SD SD+TRDQKTLRRL+QNREAARKSR
Sbjct  1     MADVSAMTDTSTDVDTDDKNLRYLNSLTLGAT-SDASDKTRDQKTLRRLSQNREAARKSR  59

Query  1027  LRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWL  848
             LRKKAYVQQLE+SRMKLTQLEQELQRARQQGI++SSSGDQSQ+MSGNGALAFDVEYARWL
Sbjct  60    LRKKAYVQQLESSRMKLTQLEQELQRARQQGIYVSSSGDQSQAMSGNGALAFDVEYARWL  119

Query  847   EEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTP  668
             EEHNRR NELRGAV+SHAGD ELRIIVD I+AHY+++F+IK +AAKADVFHILSGMWKTP
Sbjct  120   EEHNRRTNELRGAVSSHAGDGELRIIVDGILAHYDELFKIKADAAKADVFHILSGMWKTP  179

Query  667   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  488
             AERCFLWLGGFRSSELLKLLINQLEPLT+QQ LAINNLQQSSQ AEDALSQG+E+LQQSL
Sbjct  180   AERCFLWLGGFRSSELLKLLINQLEPLTDQQSLAINNLQQSSQLAEDALSQGIESLQQSL  239

Query  487   AETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  308
             AETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFI QADNLRQ+ LQQMHRILTTRQ
Sbjct  240   AETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFILQADNLRQRMLQQMHRILTTRQ  299

Query  307   AARAFLGISDYF  272
             +ARA L I DYF
Sbjct  300   SARALLAIGDYF  311



>ref|XP_006432429.1| hypothetical protein CICLE_v100010812mg [Citrus clementina]
 gb|ESR45669.1| hypothetical protein CICLE_v100010812mg [Citrus clementina]
Length=453

 Score =   438 bits (1127),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 254/320 (79%), Positives = 276/320 (86%), Gaps = 8/320 (3%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STDADT++KN  F    +  +V SD SDR++D   QKTLRRLAQN
Sbjct  114   WGESNMADASPRTDISTDADTDEKNQRFDRGQSTAVVASDSSDRSKDKLDQKTLRRLAQN  173

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AF
Sbjct  174   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHSMSGNGAMAF  233

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEE N++INELR AVNSHA D ELR++VD IMAHY++IFR+K  AAKADVFH+
Sbjct  234   DVEYARWLEEQNKQINELRSAVNSHASDTELRMVVDGIMAHYDEIFRLKANAAKADVFHL  293

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCF+WLGGFRSSELLKL     EPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  294   LSGMWKTPAERCFMWLGGFRSSELLKL-----EPLTEQQLVGIGNLQQSSQQAEDALSQG  348

Query  511   MEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM  332
             MEALQQSLAETL+     S  SGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM
Sbjct  349   MEALQQSLAETLSSGSLGSSGSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM  408

Query  331   HRILTTRQAARAFLGISDYF  272
             HRILTTRQ+ARA L I DYF
Sbjct  409   HRILTTRQSARALLAIHDYF  428



>ref|XP_004498681.1| PREDICTED: transcription factor TGA6-like isoform X6 [Cicer arietinum]
 ref|XP_004498682.1| PREDICTED: transcription factor TGA6-like isoform X7 [Cicer arietinum]
 ref|XP_004498683.1| PREDICTED: transcription factor TGA6-like isoform X8 [Cicer arietinum]
 ref|XP_004498684.1| PREDICTED: transcription factor TGA6-like isoform X9 [Cicer arietinum]
Length=332

 Score =   434 bits (1115),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 254/316 (80%), Positives = 280/316 (89%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             MA+ SP TD STD DT+DKN  F  + +L  + SD  DR++   DQKTLRRLAQNREAAR
Sbjct  1     MAEGSPITDISTDGDTDDKNQRFDRSRSLAAMASDSGDRSKNKSDQKTLRRLAQNREAAR  60

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+K TQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AFDVEYA
Sbjct  61    KSRLRKKAYVQQLESSRLKFTQLEQELQRARQQGIFISSSGDQAHSMSGNGAMAFDVEYA  120

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR+INELRGAVNSHA + EL +I+D I+AHY++IFR+KG AAKADVFH+LSGMW
Sbjct  121   RWLEEQNRQINELRGAVNSHASETELHMIMDGILAHYDEIFRLKGIAAKADVFHLLSGMW  180

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLLINQLEPLT+QQL+ I NLQQSSQ+AEDALSQGMEALQ
Sbjct  181   KTPAERCFLWLGGFRSSELLKLLINQLEPLTDQQLVGITNLQQSSQEAEDALSQGMEALQ  240

Query  496   QSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSL+ETL    LG S SSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ+HRIL
Sbjct  241   QSLSETLTTGPLGSSSSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQIHRIL  300

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  301   TTRQSARALLAIHDYF  316



>ref|XP_008446973.1| PREDICTED: transcription factor TGA2-like isoform X1 [Cucumis 
melo]
 ref|XP_008446975.1| PREDICTED: transcription factor TGA2-like isoform X1 [Cucumis 
melo]
 ref|XP_008446976.1| PREDICTED: transcription factor TGA2-like isoform X1 [Cucumis 
melo]
Length=331

 Score =   433 bits (1113),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 258/319 (81%), Positives = 281/319 (88%), Gaps = 11/319 (3%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGF---QNNHALGIVGSDGSDRTRD---QKTLRRLAQNRE  1046
             M DVSPRTD STD DT+DK+      Q N     V SD SDRT+D   QKTLRRLAQNRE
Sbjct  1     MTDVSPRTDISTDVDTDDKHQRLDMLQRN----AVASDSSDRTKDKSDQKTLRRLAQNRE  56

Query  1045  AARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDV  866
             AARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SM+GNGA+AFDV
Sbjct  57    AARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHSMAGNGAMAFDV  116

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EYARWLEE N++INELR AVNSHA D ELR+IVD I+AHY+++FR+KG AAKADVFH+LS
Sbjct  117   EYARWLEEQNKQINELRAAVNSHASDTELRMIVDGILAHYDEVFRLKGVAAKADVFHLLS  176

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I+NLQQSSQQ EDALSQGME
Sbjct  177   GMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGISNLQQSSQQTEDALSQGME  236

Query  505   ALQQSLAE-TLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMH  329
             ALQQSLAE   +GSLG S +SGNVANYMGQMA AMGKLGTLEGFIRQADNLRQQTLQQMH
Sbjct  237   ALQQSLAETLSSGSLGSSNTSGNVANYMGQMATAMGKLGTLEGFIRQADNLRQQTLQQMH  296

Query  328   RILTTRQAARAFLGISDYF  272
             RILTTRQ+ARA L I DYF
Sbjct  297   RILTTRQSARALLAIHDYF  315



>ref|XP_003632741.1| PREDICTED: transcription factor HBP-1b(c38) [Vitis vinifera]
 emb|CBI30127.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   437 bits (1123),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 268/322 (83%), Positives = 290/322 (90%), Gaps = 5/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD SPRTDTSTD DT++KN  F+   +  +V SD SDR++    DQKTLRRLAQ
Sbjct  114   WGESNMADASPRTDTSTDVDTDEKNQRFEMGQSAALVASDSSDRSKEKAGDQKTLRRLAQ  173

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLENSRMKLTQLEQELQRARQQGIFISSSGDQS SMSGNGALA
Sbjct  174   NREAARKSRLRKKAYVQQLENSRMKLTQLEQELQRARQQGIFISSSGDQSHSMSGNGALA  233

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDVEYARWLEEHNR+INELR AVNSHA D ELR IVD++ AH++DIFR+KG AAKADVFH
Sbjct  234   FDVEYARWLEEHNRQINELRSAVNSHASDTELRTIVDNVTAHFDDIFRLKGIAAKADVFH  293

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFRSSE+LKLL+NQLEPLTEQQL++I NLQQSSQQAEDALSQ
Sbjct  294   ILSGMWKTPAERCFMWIGGFRSSEVLKLLVNQLEPLTEQQLMSIYNLQQSSQQAEDALSQ  353

Query  514   GMEALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETL  GS GPSGSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQ
Sbjct  354   GMEALQQSLAETLTSGSPGPSGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQ  413

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I+DYF
Sbjct  414   QMHRILTTRQSARALLAINDYF  435



>ref|XP_004307087.1| PREDICTED: transcription factor HBP-1b(c1)-like [Fragaria vesca 
subsp. vesca]
Length=334

 Score =   432 bits (1111),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 257/319 (81%), Positives = 281/319 (88%), Gaps = 8/319 (3%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQ--NNHALGIVGSDGSDRTRD---QKTLRRLAQNREA  1043
             MAD SPRTD STD DT+DKN  +   + +A+    SD SD+++D   QKTLRRLAQNREA
Sbjct  1     MAD-SPRTDISTDVDTDDKNQMYDRGDQYAITAAVSDSSDKSKDPKDQKTLRRLAQNREA  59

Query  1042  ARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgi-fisssgdqsqsmsgnGALAFDV  866
             ARKSRLRKKAYVQQLE SR+KL+QLEQELQRARQQGI   SS GD + S SGNGA+AFDV
Sbjct  60    ARKSRLRKKAYVQQLETSRLKLSQLEQELQRARQQGIFISSSGGDAAHSTSGNGAMAFDV  119

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EY RWLE+ NR+INELR AVNSHA DAELRIIVD I+AHY++IFR+KG AAKADVFH+LS
Sbjct  120   EYGRWLEDQNRQINELRSAVNSHASDAELRIIVDGILAHYDEIFRLKGTAAKADVFHLLS  179

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGME
Sbjct  180   GMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLVGITNLQQSSQQAEDALSQGME  239

Query  505   ALQQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMH  329
             ALQQSLAET  +GSLG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMH
Sbjct  240   ALQQSLAETLSSGSLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMH  299

Query  328   RILTTRQAARAFLGISDYF  272
             RILTTRQ+ARA L I+DYF
Sbjct  300   RILTTRQSARALLAINDYF  318



>gb|KHG00991.1| hypothetical protein F383_22932 [Gossypium arboreum]
Length=411

 Score =   435 bits (1119),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 257/322 (80%), Positives = 281/322 (87%), Gaps = 5/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHA-LGIVGSDGSDRTR---DQKTLRRLAQ  1055
             W    MAD SPRTD STDA+T++KN+ F +      +  SD SDR++   DQK LRRLAQ
Sbjct  74    WGESDMADASPRTDISTDAETDEKNLRFDSEKVNAAVAASDSSDRSKSNLDQKILRRLAQ  133

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS S+ GNGA+ 
Sbjct  134   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSLGGNGAMT  193

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDVEY RWLEEHNR+INELR AVNSHAGDAELRIIVD +MAHY++IFR+K   AKADVFH
Sbjct  194   FDVEYGRWLEEHNRQINELRMAVNSHAGDAELRIIVDGVMAHYDEIFRLKSNVAKADVFH  253

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             +LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ ++NLQQSSQQAEDALSQ
Sbjct  254   LLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLVGVSNLQQSSQQAEDALSQ  313

Query  514   GMEALQQSLAE-TLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAE    GSLG S S+GNVANYMGQMAMAMGKLGTLEGFI QADNLRQQTLQ
Sbjct  314   GMEALQQSLAETLSTGSLGSSSSTGNVANYMGQMAMAMGKLGTLEGFICQADNLRQQTLQ  373

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I DYF
Sbjct  374   QMHRILTTRQSARALLAIHDYF  395



>ref|XP_007028137.1| Transcription factor HBP-1b(c1) isoform 3 [Theobroma cacao]
 ref|XP_007028138.1| Transcription factor HBP-1b(c1) isoform 3 [Theobroma cacao]
 ref|XP_007028141.1| Transcription factor HBP-1b(c1) isoform 3 [Theobroma cacao]
 gb|EOY08639.1| Transcription factor HBP-1b(c1) isoform 3 [Theobroma cacao]
 gb|EOY08640.1| Transcription factor HBP-1b(c1) isoform 3 [Theobroma cacao]
 gb|EOY08643.1| Transcription factor HBP-1b(c1) isoform 3 [Theobroma cacao]
Length=331

 Score =   431 bits (1109),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 266/316 (84%), Positives = 284/316 (90%), Gaps = 5/316 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTDTSTD   E KN  F+      IV SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADASPRTDTSTDDTDE-KNQRFERGQTNAIVASDSSDRSKDKTDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS SMSGNGALAFDVEYA
Sbjct  60    KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSMSGNGALAFDVEYA  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEEHNR+INELR AVNSHAGD ELR IVD++ AH++DIFR+KG AAKADVFH+LSGMW
Sbjct  120   RWLEEHNRQINELRAAVNSHAGDTELRTIVDNVTAHFDDIFRLKGIAAKADVFHVLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLW+GGFRSSELLKLL NQLEPLTEQQ + I+NLQQSSQQAEDALSQGMEALQ
Sbjct  180   KTPAERCFLWIGGFRSSELLKLLANQLEPLTEQQFMGIHNLQQSSQQAEDALSQGMEALQ  239

Query  496   QSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSLAETL  GS GPSGSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQMHRIL
Sbjct  240   QSLAETLTNGSPGPSGSSGNVANYMGQMAMAMGKLGTLEGFVRQADNLRQQTLQQMHRIL  299

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I+DYF
Sbjct  300   TTRQSARALLAINDYF  315



>ref|XP_008445387.1| PREDICTED: transcription factor TGA2-like [Cucumis melo]
 ref|XP_008445388.1| PREDICTED: transcription factor TGA2-like [Cucumis melo]
 ref|XP_008445389.1| PREDICTED: transcription factor TGA2-like [Cucumis melo]
 ref|XP_008445390.1| PREDICTED: transcription factor TGA2-like [Cucumis melo]
 ref|XP_008445391.1| PREDICTED: transcription factor TGA2-like [Cucumis melo]
 ref|XP_008445393.1| PREDICTED: transcription factor TGA2-like [Cucumis melo]
 ref|XP_008445394.1| PREDICTED: transcription factor TGA2-like [Cucumis melo]
 ref|XP_008445395.1| PREDICTED: transcription factor TGA2-like [Cucumis melo]
 ref|XP_008445396.1| PREDICTED: transcription factor TGA2-like [Cucumis melo]
 ref|XP_008445397.1| PREDICTED: transcription factor TGA2-like [Cucumis melo]
Length=333

 Score =   431 bits (1108),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 255/317 (80%), Positives = 281/317 (89%), Gaps = 4/317 (1%)
 Frame = -1

Query  1210  MMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAA  1040
             M  + SPRTD STD DT++K+           + SD SDR++D   QKTLRRLAQNREAA
Sbjct  1     MATEGSPRTDISTDGDTDEKSRRPDRGQLALTMASDSSDRSKDKTDQKTLRRLAQNREAA  60

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AFDVEY
Sbjct  61    RKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHSMSGNGAMAFDVEY  120

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLE+HNR++NELR AVNSHA D ELRI+VD I+ HY+++FR+KG AAKADVFH+LSGM
Sbjct  121   ARWLEDHNRQLNELRSAVNSHASDPELRIVVDGILVHYDELFRLKGNAAKADVFHLLSGM  180

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEAL
Sbjct  181   WKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLVGITNLQQSSQQAEDALSQGMEAL  240

Query  499   QQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             QQSLAET  +G+LG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI
Sbjct  241   QQSLAETLSSGALGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  300

Query  322   LTTRQAARAFLGISDYF  272
             LTTRQ+ARA L I DYF
Sbjct  301   LTTRQSARALLAIHDYF  317



>ref|XP_004142384.1| PREDICTED: transcription factor HBP-1b(c1)-like [Cucumis sativus]
Length=331

 Score =   431 bits (1107),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 257/319 (81%), Positives = 280/319 (88%), Gaps = 11/319 (3%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGF---QNNHALGIVGSDGSDRTRD---QKTLRRLAQNRE  1046
             M DVSPRTD STD DT+DK+      Q N     V SD SDRT+D   QKTLRRLAQNRE
Sbjct  1     MTDVSPRTDISTDVDTDDKHQRLDMLQRN----AVASDSSDRTKDKSDQKTLRRLAQNRE  56

Query  1045  AARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDV  866
             AARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SM+GNGA+AFDV
Sbjct  57    AARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHSMAGNGAMAFDV  116

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EYARWLEE N++INELR AVNSHA D ELR+IVD I+AHY+++FR+KG AAKADVFH+LS
Sbjct  117   EYARWLEEQNKQINELRAAVNSHASDTELRMIVDGILAHYDEVFRLKGVAAKADVFHLLS  176

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I+NLQQSSQQ EDALSQGME
Sbjct  177   GMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGISNLQQSSQQTEDALSQGME  236

Query  505   ALQQSLAE-TLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMH  329
             ALQQSLAE   +GSLG S +SGNVANYMGQMA AMGKLGTLEGFIRQADNLRQQTLQQMH
Sbjct  237   ALQQSLAETLSSGSLGSSNTSGNVANYMGQMATAMGKLGTLEGFIRQADNLRQQTLQQMH  296

Query  328   RILTTRQAARAFLGISDYF  272
             RILT RQ+ARA L I DYF
Sbjct  297   RILTIRQSARALLAIHDYF  315



>ref|XP_004165289.1| PREDICTED: transcription factor HBP-1b(c1)-like [Cucumis sativus]
Length=333

 Score =   431 bits (1107),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 255/317 (80%), Positives = 281/317 (89%), Gaps = 4/317 (1%)
 Frame = -1

Query  1210  MMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAA  1040
             M  + SPRTD STD DT++K+           + SD SDR++D   QKTLRRLAQNREAA
Sbjct  1     MATEGSPRTDISTDGDTDEKSGRPDRGQLALTMASDSSDRSKDKTDQKTLRRLAQNREAA  60

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AFDVEY
Sbjct  61    RKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHSMSGNGAMAFDVEY  120

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLE+HNR++NELR AVNSHA D ELRI+VD I+ HY+++FR+KG AAKADVFH+LSGM
Sbjct  121   ARWLEDHNRQLNELRSAVNSHASDPELRIVVDGILVHYDELFRLKGNAAKADVFHLLSGM  180

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEAL
Sbjct  181   WKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLVGITNLQQSSQQAEDALSQGMEAL  240

Query  499   QQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             QQSLAET  +G+LG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI
Sbjct  241   QQSLAETLSSGALGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  300

Query  322   LTTRQAARAFLGISDYF  272
             LTTRQ+ARA L I DYF
Sbjct  301   LTTRQSARALLAIHDYF  317



>ref|XP_004498677.1| PREDICTED: transcription factor TGA6-like isoform X2 [Cicer arietinum]
Length=433

 Score =   434 bits (1116),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 254/316 (80%), Positives = 280/316 (89%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             MA+ SP TD STD DT+DKN  F  + +L  + SD  DR++   DQKTLRRLAQNREAAR
Sbjct  102   MAEGSPITDISTDGDTDDKNQRFDRSRSLAAMASDSGDRSKNKSDQKTLRRLAQNREAAR  161

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+K TQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AFDVEYA
Sbjct  162   KSRLRKKAYVQQLESSRLKFTQLEQELQRARQQGIFISSSGDQAHSMSGNGAMAFDVEYA  221

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR+INELRGAVNSHA + EL +I+D I+AHY++IFR+KG AAKADVFH+LSGMW
Sbjct  222   RWLEEQNRQINELRGAVNSHASETELHMIMDGILAHYDEIFRLKGIAAKADVFHLLSGMW  281

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLLINQLEPLT+QQL+ I NLQQSSQ+AEDALSQGMEALQ
Sbjct  282   KTPAERCFLWLGGFRSSELLKLLINQLEPLTDQQLVGITNLQQSSQEAEDALSQGMEALQ  341

Query  496   QSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSL+ETL    LG S SSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ+HRIL
Sbjct  342   QSLSETLTTGPLGSSSSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQIHRIL  401

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  402   TTRQSARALLAIHDYF  417



>gb|KGN52332.1| hypothetical protein Csa_5G624430 [Cucumis sativus]
Length=348

 Score =   431 bits (1108),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 257/319 (81%), Positives = 280/319 (88%), Gaps = 11/319 (3%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGF---QNNHALGIVGSDGSDRTRD---QKTLRRLAQNRE  1046
             M DVSPRTD STD DT+DK+      Q N     V SD SDRT+D   QKTLRRLAQNRE
Sbjct  18    MTDVSPRTDISTDVDTDDKHQRLDMLQRN----AVASDSSDRTKDKSDQKTLRRLAQNRE  73

Query  1045  AARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDV  866
             AARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SM+GNGA+AFDV
Sbjct  74    AARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHSMAGNGAMAFDV  133

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EYARWLEE N++INELR AVNSHA D ELR+IVD I+AHY+++FR+KG AAKADVFH+LS
Sbjct  134   EYARWLEEQNKQINELRAAVNSHASDTELRMIVDGILAHYDEVFRLKGVAAKADVFHLLS  193

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I+NLQQSSQQ EDALSQGME
Sbjct  194   GMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGISNLQQSSQQTEDALSQGME  253

Query  505   ALQQSLAE-TLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMH  329
             ALQQSLAE   +GSLG S +SGNVANYMGQMA AMGKLGTLEGFIRQADNLRQQTLQQMH
Sbjct  254   ALQQSLAETLSSGSLGSSNTSGNVANYMGQMATAMGKLGTLEGFIRQADNLRQQTLQQMH  313

Query  328   RILTTRQAARAFLGISDYF  272
             RILT RQ+ARA L I DYF
Sbjct  314   RILTIRQSARALLAIHDYF  332



>ref|XP_004498678.1| PREDICTED: transcription factor TGA6-like isoform X3 [Cicer arietinum]
 ref|XP_004498679.1| PREDICTED: transcription factor TGA6-like isoform X4 [Cicer arietinum]
Length=423

 Score =   434 bits (1115),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 254/316 (80%), Positives = 280/316 (89%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             MA+ SP TD STD DT+DKN  F  + +L  + SD  DR++   DQKTLRRLAQNREAAR
Sbjct  92    MAEGSPITDISTDGDTDDKNQRFDRSRSLAAMASDSGDRSKNKSDQKTLRRLAQNREAAR  151

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+K TQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AFDVEYA
Sbjct  152   KSRLRKKAYVQQLESSRLKFTQLEQELQRARQQGIFISSSGDQAHSMSGNGAMAFDVEYA  211

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR+INELRGAVNSHA + EL +I+D I+AHY++IFR+KG AAKADVFH+LSGMW
Sbjct  212   RWLEEQNRQINELRGAVNSHASETELHMIMDGILAHYDEIFRLKGIAAKADVFHLLSGMW  271

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLLINQLEPLT+QQL+ I NLQQSSQ+AEDALSQGMEALQ
Sbjct  272   KTPAERCFLWLGGFRSSELLKLLINQLEPLTDQQLVGITNLQQSSQEAEDALSQGMEALQ  331

Query  496   QSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSL+ETL    LG S SSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ+HRIL
Sbjct  332   QSLSETLTTGPLGSSSSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQIHRIL  391

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  392   TTRQSARALLAIHDYF  407



>ref|XP_004498680.1| PREDICTED: transcription factor TGA6-like isoform X5 [Cicer arietinum]
Length=389

 Score =   432 bits (1111),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 254/316 (80%), Positives = 280/316 (89%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             MA+ SP TD STD DT+DKN  F  + +L  + SD  DR++   DQKTLRRLAQNREAAR
Sbjct  58    MAEGSPITDISTDGDTDDKNQRFDRSRSLAAMASDSGDRSKNKSDQKTLRRLAQNREAAR  117

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+K TQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AFDVEYA
Sbjct  118   KSRLRKKAYVQQLESSRLKFTQLEQELQRARQQGIFISSSGDQAHSMSGNGAMAFDVEYA  177

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR+INELRGAVNSHA + EL +I+D I+AHY++IFR+KG AAKADVFH+LSGMW
Sbjct  178   RWLEEQNRQINELRGAVNSHASETELHMIMDGILAHYDEIFRLKGIAAKADVFHLLSGMW  237

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLLINQLEPLT+QQL+ I NLQQSSQ+AEDALSQGMEALQ
Sbjct  238   KTPAERCFLWLGGFRSSELLKLLINQLEPLTDQQLVGITNLQQSSQEAEDALSQGMEALQ  297

Query  496   QSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSL+ETL    LG S SSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ+HRIL
Sbjct  298   QSLSETLTTGPLGSSSSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQIHRIL  357

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  358   TTRQSARALLAIHDYF  373



>ref|XP_010670519.1| PREDICTED: transcription factor TGA6 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=397

 Score =   432 bits (1112),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 256/321 (80%), Positives = 282/321 (88%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDR---TRDQKTLRRLAQN  1052
             W    MAD SPRTD STDADT+++N  F    ++    SD SDR   T+DQKTLRRLAQN
Sbjct  61    WGESDMADGSPRTDISTDADTDERNKRFDRIQSMTHGASDSSDRSKETKDQKTLRRLAQN  120

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ S  GNGA+AF
Sbjct  121   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQANSTGGNGAMAF  180

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEY+RWLEE NR+INELR AVN+HAGDAEL +IV S++ HY++IFR+K  AAK DVFH+
Sbjct  181   DVEYSRWLEEQNRQINELRAAVNAHAGDAELSVIVTSVVGHYDEIFRLKANAAKNDVFHL  240

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQ++ I NLQQSSQQAEDALSQG
Sbjct  241   LSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQVINIQNLQQSSQQAEDALSQG  300

Query  511   MEALQQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAET  +G+LG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ
Sbjct  301   MEALQQSLAETLSSGNLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  360

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DYF
Sbjct  361   MHRILTTRQSARALLAIHDYF  381



>ref|XP_004498676.1| PREDICTED: transcription factor TGA6-like isoform X1 [Cicer arietinum]
Length=438

 Score =   434 bits (1115),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 253/316 (80%), Positives = 279/316 (88%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             MA+ SP TD STD DT+DKN  F  + +L  + SD  DR++   DQKTLRRLAQNREAAR
Sbjct  107   MAEGSPITDISTDGDTDDKNQRFDRSRSLAAMASDSGDRSKNKSDQKTLRRLAQNREAAR  166

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+K TQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AFDVEYA
Sbjct  167   KSRLRKKAYVQQLESSRLKFTQLEQELQRARQQGIFISSSGDQAHSMSGNGAMAFDVEYA  226

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR+INELRGAVNSHA + EL +I+D I+AHY++IFR+KG AAKADVFH+LSGMW
Sbjct  227   RWLEEQNRQINELRGAVNSHASETELHMIMDGILAHYDEIFRLKGIAAKADVFHLLSGMW  286

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLLINQLEPLT+QQL+ I NLQQSSQ+AEDALSQGMEALQ
Sbjct  287   KTPAERCFLWLGGFRSSELLKLLINQLEPLTDQQLVGITNLQQSSQEAEDALSQGMEALQ  346

Query  496   QSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSL+ETL     G S SSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ+HRIL
Sbjct  347   QSLSETLTTGPLGSSSSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQIHRIL  406

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  407   TTRQSARALLAIHDYF  422



>ref|XP_010067716.1| PREDICTED: transcription factor TGA2 [Eucalyptus grandis]
 ref|XP_010067717.1| PREDICTED: transcription factor TGA2 [Eucalyptus grandis]
 ref|XP_010067718.1| PREDICTED: transcription factor TGA2 [Eucalyptus grandis]
 gb|KCW65892.1| hypothetical protein EUGRSUZ_G03217 [Eucalyptus grandis]
 gb|KCW65893.1| hypothetical protein EUGRSUZ_G03217 [Eucalyptus grandis]
 gb|KCW65894.1| hypothetical protein EUGRSUZ_G03217 [Eucalyptus grandis]
Length=331

 Score =   428 bits (1101),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 254/316 (80%), Positives = 277/316 (88%), Gaps = 5/316 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD S+D DT++KN  F    +  IV  D SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADGSPRTDISSD-DTDEKNQRFDRGKSTAIVAYDSSDRSKDKTDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ S  GNGA+ FDVEYA
Sbjct  60    KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHSSGGNGAMTFDVEYA  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR+INELR AV +HAGD ELRIIVD IMAHY++IFR+K  AAK DVFH+LSGMW
Sbjct  120   RWLEEQNRQINELRSAVTAHAGDGELRIIVDGIMAHYDEIFRLKSNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCF+WLGGFR SELLKLL+NQLEPLTEQQL  I NLQQSSQQAEDALSQGMEALQ
Sbjct  180   KTPAERCFMWLGGFRPSELLKLLVNQLEPLTEQQLTGIGNLQQSSQQAEDALSQGMEALQ  239

Query  496   QSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSLAETL  GSLG +GSSGNVANYMGQMAMAMGKLGTL+GFIRQADNLRQQTLQQM+R+L
Sbjct  240   QSLAETLCSGSLGSAGSSGNVANYMGQMAMAMGKLGTLDGFIRQADNLRQQTLQQMNRLL  299

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  300   TTRQSARALLAIHDYF  315



>gb|ADK74339.1| bZIP transcription factor [Phalaenopsis amabilis]
Length=445

 Score =   432 bits (1112),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 261/321 (81%), Positives = 289/321 (90%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD SPRTDTSTD DT+D+N  F    A+G++ SD SDR++    DQKTLRRLAQ
Sbjct  109   WEESAMADNSPRTDTSTDVDTDDRNQRFDKGQAIGVIASDSSDRSKGKAGDQKTLRRLAQ  168

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSSGDQS S+ GNGALA
Sbjct  169   NREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSGDQSHSVGGNGALA  228

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD+EYARWLEEHNR+INELR AVN+HAGD++LRIIVD + AH+++IFR+KG AAKADVFH
Sbjct  229   FDIEYARWLEEHNRQINELRAAVNAHAGDSDLRIIVDGVTAHFDEIFRLKGIAAKADVFH  288

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             +LSGMWKTPA+RCFLWLGGFRSSELLKLL+NQLEPLTEQQ++ + NLQQSSQQAEDALSQ
Sbjct  289   MLSGMWKTPAQRCFLWLGGFRSSELLKLLVNQLEPLTEQQVVGLCNLQQSSQQAEDALSQ  348

Query  514   GMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             GMEALQQSL ETLAGSLG SGSSGNVANYMGQMAMAMGKLGTLE F+ QADNLRQQTLQQ
Sbjct  349   GMEALQQSLGETLAGSLGSSGSSGNVANYMGQMAMAMGKLGTLENFLHQADNLRQQTLQQ  408

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I+DYF
Sbjct  409   MHRILTTRQSARALLAINDYF  429



>ref|XP_010670518.1| PREDICTED: transcription factor TGA6 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=455

 Score =   432 bits (1112),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 256/321 (80%), Positives = 282/321 (88%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDR---TRDQKTLRRLAQN  1052
             W    MAD SPRTD STDADT+++N  F    ++    SD SDR   T+DQKTLRRLAQN
Sbjct  119   WGESDMADGSPRTDISTDADTDERNKRFDRIQSMTHGASDSSDRSKETKDQKTLRRLAQN  178

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ S  GNGA+AF
Sbjct  179   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQANSTGGNGAMAF  238

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEY+RWLEE NR+INELR AVN+HAGDAEL +IV S++ HY++IFR+K  AAK DVFH+
Sbjct  239   DVEYSRWLEEQNRQINELRAAVNAHAGDAELSVIVTSVVGHYDEIFRLKANAAKNDVFHL  298

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQ++ I NLQQSSQQAEDALSQG
Sbjct  299   LSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQVINIQNLQQSSQQAEDALSQG  358

Query  511   MEALQQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAET  +G+LG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ
Sbjct  359   MEALQQSLAETLSSGNLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  418

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DYF
Sbjct  419   MHRILTTRQSARALLAIHDYF  439



>gb|KHG28384.1| Transcription factor HBP-1b [Gossypium arboreum]
Length=332

 Score =   428 bits (1100),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 264/317 (83%), Positives = 279/317 (88%), Gaps = 6/317 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTDTSTD   E KN  F       IV SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADASPRTDTSTDDTDE-KNQRFGRGQMNAIVASDSSDRSKDKTDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS SMSGNGALAFDVEYA
Sbjct  60    KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSMSGNGALAFDVEYA  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEEHNR+INELR AVNSHAGDAELRIIVDS+  H++DIFR+KG AAKADVFHILSGMW
Sbjct  120   RWLEEHNRKINELRTAVNSHAGDAELRIIVDSVTTHFDDIFRLKGTAAKADVFHILSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLW+GGFRSSELLKLL NQLEPLTEQQ + I  LQQSSQQAED+LSQGMEALQ
Sbjct  180   KTPAERCFLWIGGFRSSELLKLLSNQLEPLTEQQFMGIQKLQQSSQQAEDSLSQGMEALQ  239

Query  496   QSLAETLA--gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             QSLAETLA      PSGSSGNVANYMGQMAMAMGKLGTLEGF+ QADNLRQQTLQQMHRI
Sbjct  240   QSLAETLANGSPSAPSGSSGNVANYMGQMAMAMGKLGTLEGFLLQADNLRQQTLQQMHRI  299

Query  322   LTTRQAARAFLGISDYF  272
             LTTRQ+ARA L I+DYF
Sbjct  300   LTTRQSARALLAINDYF  316



>ref|XP_007203875.1| hypothetical protein PRUPE_ppa005279mg [Prunus persica]
 gb|EMJ05074.1| hypothetical protein PRUPE_ppa005279mg [Prunus persica]
Length=469

 Score =   432 bits (1111),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 267/322 (83%), Positives = 289/322 (90%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD SPRTDTSTD   + KN   + N   G++ SD SDR++    DQKTLRRLAQ
Sbjct  133   WGESSMADGSPRTDTSTDDTED-KNQRTELNQMTGLLVSDSSDRSKEKPGDQKTLRRLAQ  191

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS SMSGNGALA
Sbjct  192   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSMSGNGALA  251

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDVEYARWLEEHNR+INELR AVNSHAGD ELR ++D+++AHY+DIFR+KG AAKADVFH
Sbjct  252   FDVEYARWLEEHNRQINELRAAVNSHAGDTELRTVIDNVIAHYDDIFRLKGTAAKADVFH  311

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  312   ILSGMWKTPAERCFMWIGGFRSSELLKLLVNQLEPLTEQQLVGIYNLQQSSQQAEDALSQ  371

Query  514   GMEALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA GS GPSGSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQ
Sbjct  372   GMEALQQSLAETLASGSPGPSGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQ  431

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L ISDYF
Sbjct  432   QMHRILTTRQSARALLAISDYF  453



>ref|XP_004146772.1| PREDICTED: transcription factor HBP-1b(c1)-like [Cucumis sativus]
 gb|KGN47762.1| hypothetical protein Csa_6G401330 [Cucumis sativus]
Length=333

 Score =   427 bits (1098),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 254/317 (80%), Positives = 280/317 (88%), Gaps = 4/317 (1%)
 Frame = -1

Query  1210  MMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAA  1040
             M  + SPRTD STD DT++K+           + SD SDR++D   QKTLRRLAQNREAA
Sbjct  1     MATEGSPRTDISTDGDTDEKSGRPDRGQLALTMASDSSDRSKDKTDQKTLRRLAQNREAA  60

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGA+AFDVEY
Sbjct  61    RKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHSMSGNGAMAFDVEY  120

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLE+HNR++NELR AVNSHA D ELRI+VD I+ HY+++FR+KG AAKADVFH+LSGM
Sbjct  121   ARWLEDHNRQLNELRSAVNSHASDPELRIVVDGILVHYDELFRLKGNAAKADVFHLLSGM  180

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGF SSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEAL
Sbjct  181   WKTPAERCFLWLGGFCSSELLKLLVNQLEPLTEQQLVGITNLQQSSQQAEDALSQGMEAL  240

Query  499   QQSLAET-LAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             QQSLAET  +G+LG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI
Sbjct  241   QQSLAETLSSGALGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  300

Query  322   LTTRQAARAFLGISDYF  272
             LTTRQ+ARA L I DYF
Sbjct  301   LTTRQSARALLAIHDYF  317



>ref|XP_009803519.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X3 [Nicotiana 
sylvestris]
Length=290

 Score =   425 bits (1092),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 252/281 (90%), Positives = 266/281 (95%), Gaps = 2/281 (1%)
 Frame = -1

Query  1210  MMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKS  1031
             MMA++SP   TSTDADT+DKN+ F N+  +  V SDGSD+ RDQKTLRRLAQNREAARKS
Sbjct  1     MMAEISP--STSTDADTDDKNLRFMNSQPVASVTSDGSDKPRDQKTLRRLAQNREAARKS  58

Query  1030  RLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARW  851
             RLRKKAYVQQLE+SRMKLTQLEQELQRARQQGIFISSSGDQSQS +GNGALAFDVEYARW
Sbjct  59    RLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQSQSKTGNGALAFDVEYARW  118

Query  850   LEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKT  671
             LEEHNRRI ELRGAV+SHAGD ELRIIVD I+AHY+DIFRIKG+AAKADVFHILSGMWKT
Sbjct  119   LEEHNRRITELRGAVSSHAGDGELRIIVDGILAHYDDIFRIKGDAAKADVFHILSGMWKT  178

Query  670   PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQS  491
             PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQ+SSQQAEDALSQGMEALQQS
Sbjct  179   PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQESSQQAEDALSQGMEALQQS  238

Query  490   LAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQ  368
             LAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQ
Sbjct  239   LAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQ  279



>ref|XP_009803518.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Nicotiana 
sylvestris]
Length=298

 Score =   424 bits (1091),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 252/285 (88%), Positives = 268/285 (94%), Gaps = 2/285 (1%)
 Frame = -1

Query  1210  MMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKS  1031
             MMA++SP   TSTDADT+DKN+ F N+  +  V SDGSD+ RDQKTLRRLAQNREAARKS
Sbjct  1     MMAEISP--STSTDADTDDKNLRFMNSQPVASVTSDGSDKPRDQKTLRRLAQNREAARKS  58

Query  1030  RLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARW  851
             RLRKKAYVQQLE+SRMKLTQLEQELQRARQQGIFISSSGDQSQS +GNGALAFDVEYARW
Sbjct  59    RLRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQSQSKTGNGALAFDVEYARW  118

Query  850   LEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKT  671
             LEEHNRRI ELRGAV+SHAGD ELRIIVD I+AHY+DIFRIKG+AAKADVFHILSGMWKT
Sbjct  119   LEEHNRRITELRGAVSSHAGDGELRIIVDGILAHYDDIFRIKGDAAKADVFHILSGMWKT  178

Query  670   PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQS  491
             PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQ+SSQQAEDALSQGMEALQQS
Sbjct  179   PAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQESSQQAEDALSQGMEALQQS  238

Query  490   LAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNL  356
             LAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQ + +
Sbjct  239   LAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLEGFIRQIERM  283



>ref|XP_004303596.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Fragaria vesca subsp. vesca]
Length=451

 Score =   429 bits (1104),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 260/322 (81%), Positives = 287/322 (89%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD SPRTDTSTD   + KN   + N   G++ SD SDR++    DQKTLRRLAQ
Sbjct  115   WGESNMADGSPRTDTSTDDTED-KNQMIERNQMAGLLASDSSDRSKEKPGDQKTLRRLAQ  173

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGALA
Sbjct  174   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHSMSGNGALA  233

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDVEYARWLEEHN++INELR AVNSHAGD ELR ++D+++AHY+DIFRIKG AAKADVFH
Sbjct  234   FDVEYARWLEEHNKQINELRAAVNSHAGDTELRTVIDNVIAHYDDIFRIKGTAAKADVFH  293

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFRSSELLKLL+ QLEPLTEQQ++ I NLQQSSQQAEDALSQ
Sbjct  294   ILSGMWKTPAERCFMWIGGFRSSELLKLLVRQLEPLTEQQVMGIYNLQQSSQQAEDALSQ  353

Query  514   GMEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSL+ETLA  S GPSG+SGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQ
Sbjct  354   GMEALQQSLSETLASGSPGPSGTSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQ  413

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I+DYF
Sbjct  414   QMHRILTTRQSARALLAINDYF  435



>ref|XP_004249310.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1 
[Solanum lycopersicum]
Length=447

 Score =   428 bits (1101),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 238/322 (74%), Positives = 268/322 (83%), Gaps = 5/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD   RTDTSTD D +D+N   +   +  I  SD SD+++    DQKTLRRLAQ
Sbjct  109   WGESNMADSGSRTDTSTDMDGDDRNQRIETGQSRAIAASDSSDKSKEKVLDQKTLRRLAQ  168

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLENSR+KL+QLEQ+LQRARQQG +IS+  DQS     +G LA
Sbjct  169   NREAARKSRLRKKAYVQQLENSRLKLSQLEQDLQRARQQGKYISNMADQSNGAGASGTLA  228

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD EY+RWLEEHN+ INELR AVNSHA D ELR IV+++ AHY+++FR+KG AAKADVFH
Sbjct  229   FDAEYSRWLEEHNKHINELRTAVNSHASDPELRSIVNNVTAHYDEVFRVKGNAAKADVFH  288

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             +LSGMWKTPAERCF+W+GGFR SELLKLL+NQLEPLTEQQL  I NLQQSS QAEDALSQ
Sbjct  289   VLSGMWKTPAERCFMWIGGFRPSELLKLLVNQLEPLTEQQLAGIYNLQQSSHQAEDALSQ  348

Query  514   GMEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA  S    GSSG+VANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQ
Sbjct  349   GMEALQQSLAETLANGSPATEGSSGDVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQ  408

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L IS+YF
Sbjct  409   QMHRILTTRQSARALLAISEYF  430



>emb|CDM83014.1| unnamed protein product [Triticum aestivum]
Length=332

 Score =   424 bits (1090),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 254/317 (80%), Positives = 275/317 (87%), Gaps = 8/317 (3%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MA+ SPRT+TSTD DT++  M    N AL +V SD SDR+RD    QKT+RRLAQNREAA
Sbjct  1     MAEASPRTETSTD-DTDENLMLEPGNAALAVV-SDSSDRSRDKNGDQKTMRRLAQNREAA  58

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSS DQS SMSGNGALAFD EY
Sbjct  59    RKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSADQSHSMSGNGALAFDTEY  118

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR++NELR AVN+HAGD ELR +V+ IM+HY++IF+ KG AAKADVFH+LSGM
Sbjct  119   ARWLEEHNRQVNELRAAVNAHAGDTELRSVVEKIMSHYDEIFKQKGNAAKADVFHVLSGM  178

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFR SELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALSQGMEAL
Sbjct  179   WKTPAERCFLWLGGFRPSELLKLLSTQLEPLTEQQLSGICNLQQSSQQAEDALSQGMEAL  238

Query  499   QQSLAETLA--gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             QQSLAETLA       SGS+GNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTLQQM R
Sbjct  239   QQSLAETLAGSIGSSGSGSTGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLQQMQR  298

Query  325   ILTTRQAARAFLGISDY  275
             ILTTRQ+ARA L ISDY
Sbjct  299   ILTTRQSARALLVISDY  315



>ref|XP_006351371.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Solanum tuberosum]
Length=446

 Score =   428 bits (1101),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 238/322 (74%), Positives = 268/322 (83%), Gaps = 5/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD   RTDTSTD D +D+N   +   +  I  SD SD+++    DQKTLRRLAQ
Sbjct  108   WGESNMADSGSRTDTSTDMDGDDRNQRIETGQSRAIAASDSSDKSKEKVLDQKTLRRLAQ  167

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLENSR+KL+QLEQ+LQRARQQG +IS+  DQS     +G LA
Sbjct  168   NREAARKSRLRKKAYVQQLENSRLKLSQLEQDLQRARQQGKYISNMADQSNGAGASGTLA  227

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD EY+RWLEEHN+ INELR AVNSHA D ELR IV+++ AHY+++FR+KG AAKADVFH
Sbjct  228   FDAEYSRWLEEHNKHINELRTAVNSHASDPELRSIVNNVTAHYDEVFRVKGNAAKADVFH  287

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             +LSGMWKTPAERCF+W+GGFR SELLKLL+NQLEPLTEQQL  I NLQQSS QAEDALSQ
Sbjct  288   VLSGMWKTPAERCFMWIGGFRPSELLKLLVNQLEPLTEQQLAGIYNLQQSSHQAEDALSQ  347

Query  514   GMEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA  S    GSSG+VANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQ
Sbjct  348   GMEALQQSLAETLANGSPATEGSSGDVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQ  407

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L IS+YF
Sbjct  408   QMHRILTTRQSARALLAISEYF  429



>ref|XP_003564436.1| PREDICTED: transcription factor HBP-1b(c1) [Brachypodium distachyon]
Length=476

 Score =   427 bits (1099),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 253/323 (78%), Positives = 274/323 (85%), Gaps = 6/323 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDAD--TEDKNMGFQNNHALGIVGSDGSDRTRDQ---KTLRRLA  1058
             W    MAD SPRTDTSTD D   +++N  F+  H     GSD SD++RDQ   K+LRRLA
Sbjct  138   WGESSMADTSPRTDTSTDPDIDVDERNQMFEQGHLAAPTGSDSSDKSRDQLDHKSLRRLA  197

Query  1057  QNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGAL  878
             QNREAARKSRLRKKAY+Q LE SR+KLTQLEQELQRARQQGIFISSSGDQS S SGNGAL
Sbjct  198   QNREAARKSRLRKKAYIQNLETSRLKLTQLEQELQRARQQGIFISSSGDQSHSTSGNGAL  257

Query  877   AFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVF  698
             AFD+EYARWLEEHN+ INELR  VN+HAGD +LR IVD IMAHY++ FR+KG AAKADVF
Sbjct  258   AFDMEYARWLEEHNKHINELRAGVNAHAGDDDLRSIVDCIMAHYDEFFRLKGVAAKADVF  317

Query  697   HILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALS  518
             H+LSGMWKTPAERCF+WLGGFRSSELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALS
Sbjct  318   HVLSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTEQQLAGICNLQQSSQQAEDALS  377

Query  517   QGMEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTL  341
             QGMEALQQSLAETLA    GP+GSS NVANYMGQMAMAMGKLGTLE F+RQADNLR QTL
Sbjct  378   QGMEALQQSLAETLASGSLGPAGSSSNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTL  437

Query  340   QQMHRILTTRQAARAFLGISDYF  272
             QQM RILTTRQ+ARA L ISDYF
Sbjct  438   QQMQRILTTRQSARALLAISDYF  460



>sp|P23923.1|HBP1B_WHEAT RecName: Full=Transcription factor HBP-1b(c38) [Triticum aestivum]
 emb|CAA40102.1| HBP-1b [Triticum aestivum]
Length=332

 Score =   422 bits (1084),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 253/317 (80%), Positives = 274/317 (86%), Gaps = 8/317 (3%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MA+ SPRT+TSTD DT++  M    N AL +V SD SDR+RD    QKT+RRLAQNREAA
Sbjct  1     MAEASPRTETSTD-DTDENLMLEPGNAALAVV-SDSSDRSRDKNGDQKTMRRLAQNREAA  58

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSS DQS SMSGNGALAFD EY
Sbjct  59    RKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSADQSHSMSGNGALAFDTEY  118

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR++NELR AVN+HAGD ELR +V+ IM+HY++IF+ KG AAKADVFH+LSGM
Sbjct  119   ARWLEEHNRQVNELRAAVNAHAGDTELRSVVEKIMSHYDEIFKQKGNAAKADVFHVLSGM  178

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFR SELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALSQGMEAL
Sbjct  179   WKTPAERCFLWLGGFRPSELLKLLSTQLEPLTEQQLSGICNLQQSSQQAEDALSQGMEAL  238

Query  499   QQSLAETLA--gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             QQSLAETLA       SGS+GNVANYMGQMAMAMGKLGTLE F+ QADNLRQQTLQQM R
Sbjct  239   QQSLAETLAGSIGSSGSGSTGNVANYMGQMAMAMGKLGTLENFLSQADNLRQQTLQQMQR  298

Query  325   ILTTRQAARAFLGISDY  275
             ILTTRQ+ARA L ISDY
Sbjct  299   ILTTRQSARALLVISDY  315



>ref|XP_009414219.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=419

 Score =   425 bits (1092),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 251/321 (78%), Positives = 273/321 (85%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD SPRTD STD D  DKN   +      I  SD SD+T+    DQKTLRRLAQ
Sbjct  83    WGETTMADASPRTDASTDVDAGDKNHKPKRGQVAAIAASDSSDKTKEKTGDQKTLRRLAQ  142

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE SR+KLT +EQELQ ARQQGIFISSSGDQS +MSGN  LA
Sbjct  143   NREAARKSRLRKKAYVQQLEGSRLKLTHIEQELQHARQQGIFISSSGDQSHAMSGNEGLA  202

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             F+ EYARW EEHNR+I+ELR AVN+HA + +LR IVD IMAHY++IF++KG AAKADVFH
Sbjct  203   FNSEYARWREEHNRQISELRTAVNAHASENDLRAIVDGIMAHYDEIFKLKGTAAKADVFH  262

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             +LSGMWKTPAERCFLWLGGFRSSELLKLL +QLEPLTEQQL+ + NLQQSSQQAEDALSQ
Sbjct  263   MLSGMWKTPAERCFLWLGGFRSSELLKLLTSQLEPLTEQQLMGLCNLQQSSQQAEDALSQ  322

Query  514   GMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             GMEALQQSLAETLAGSLG SGSSGNVANYMGQMAMAMGKLGTLE F+ QADNLRQQTLQQ
Sbjct  323   GMEALQQSLAETLAGSLGSSGSSGNVANYMGQMAMAMGKLGTLENFLCQADNLRQQTLQQ  382

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQAARA L I+DYF
Sbjct  383   MCRILTTRQAARALLAINDYF  403



>ref|XP_009384968.1| PREDICTED: transcription factor HBP-1b(c38)-like [Musa acuminata 
subsp. malaccensis]
Length=448

 Score =   425 bits (1092),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 262/321 (82%), Positives = 285/321 (89%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQ  1055
             W    MAD SPRTDTSTD DT+DKN   +      I  SD SDR++D    QKTLRRLAQ
Sbjct  112   WGESTMADASPRTDTSTDVDTDDKNQRSERGQLAAIAASDSSDRSKDKTLDQKTLRRLAQ  171

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ +M GNGALA
Sbjct  172   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHAMGGNGALA  231

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDVEYARWL++HNR+I+ELR AVN+HA + +LR+IVD IM HYE+IFR+KG AAKADVFH
Sbjct  232   FDVEYARWLDDHNRQISELRTAVNAHASENDLRVIVDGIMTHYEEIFRLKGVAAKADVFH  291

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  292   ILSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGICNLQQSSQQAEDALSQ  351

Query  514   GMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             GMEALQQSLAETLAGSLGPSGS+GNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTLQQ
Sbjct  352   GMEALQQSLAETLAGSLGPSGSTGNVANYMGQMAMAMGKLGTLETFLRQADNLRQQTLQQ  411

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L ISDYF
Sbjct  412   MIRILTTRQSARALLAISDYF  432



>ref|XP_009414215.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009414216.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009414217.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009414218.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=467

 Score =   426 bits (1094),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 251/321 (78%), Positives = 273/321 (85%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD SPRTD STD D  DKN   +      I  SD SD+T+    DQKTLRRLAQ
Sbjct  131   WGETTMADASPRTDASTDVDAGDKNHKPKRGQVAAIAASDSSDKTKEKTGDQKTLRRLAQ  190

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE SR+KLT +EQELQ ARQQGIFISSSGDQS +MSGN  LA
Sbjct  191   NREAARKSRLRKKAYVQQLEGSRLKLTHIEQELQHARQQGIFISSSGDQSHAMSGNEGLA  250

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             F+ EYARW EEHNR+I+ELR AVN+HA + +LR IVD IMAHY++IF++KG AAKADVFH
Sbjct  251   FNSEYARWREEHNRQISELRTAVNAHASENDLRAIVDGIMAHYDEIFKLKGTAAKADVFH  310

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             +LSGMWKTPAERCFLWLGGFRSSELLKLL +QLEPLTEQQL+ + NLQQSSQQAEDALSQ
Sbjct  311   MLSGMWKTPAERCFLWLGGFRSSELLKLLTSQLEPLTEQQLMGLCNLQQSSQQAEDALSQ  370

Query  514   GMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             GMEALQQSLAETLAGSLG SGSSGNVANYMGQMAMAMGKLGTLE F+ QADNLRQQTLQQ
Sbjct  371   GMEALQQSLAETLAGSLGSSGSSGNVANYMGQMAMAMGKLGTLENFLCQADNLRQQTLQQ  430

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQAARA L I+DYF
Sbjct  431   MCRILTTRQAARALLAINDYF  451



>gb|EPS70828.1| hypothetical protein M569_03931 [Genlisea aurea]
Length=474

 Score =   425 bits (1093),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 249/353 (71%), Positives = 281/353 (80%), Gaps = 17/353 (5%)
 Frame = -1

Query  1306  GENSSFVLYKEHTVMQILI*SYIWKIGIW*YPMMADVSPRTDTSTDADTEDKNMGFQNNH  1127
             G N++  +Y    V Q            W    MAD S RTDTSTDAD +DKN  F+   
Sbjct  115   GPNANVAIYSSAPVAQN---------ENWSESNMADSSSRTDTSTDADPDDKNQKFEAGQ  165

Query  1126  ALGIVGSDGSDR----TRDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqe  959
             + G+  SD S++    T+DQKTLRRLAQNREAARKSRLRKKAYVQQLENSR+KLTQLEQE
Sbjct  166   SAGLTASDSSNKSKEKTQDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQE  225

Query  958   lqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAEL  779
             LQRARQQGIFISS  DQ+ + + NGA++FD EYARWL+E N+ +NELR AVN+HAGD EL
Sbjct  226   LQRARQQGIFISSMRDQTNATNPNGAMSFDSEYARWLDEQNKHVNELRTAVNAHAGDTEL  285

Query  778   RIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQ  599
             R IVD + AH+ DIFR+KG AAK DVFHILSGMWKTPAERCFLW+GGFR SELLKLL+NQ
Sbjct  286   RTIVDGVSAHFNDIFRVKGNAAKTDVFHILSGMWKTPAERCFLWIGGFRPSELLKLLVNQ  345

Query  598   LEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLA----gslgpsgssGNVAN  431
             LE LTEQQ+  + NLQQ+S QAEDALSQGMEALQQSLAETLA     S GP GSSGNV N
Sbjct  346   LENLTEQQVNGLYNLQQTSHQAEDALSQGMEALQQSLAETLADGSSPSSGPDGSSGNVGN  405

Query  430   YMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             YMGQMAMAMGKLG+LEGF++QADNLRQQTLQQMHRILTTRQ+ARA L ISDYF
Sbjct  406   YMGQMAMAMGKLGSLEGFLKQADNLRQQTLQQMHRILTTRQSARALLLISDYF  458



>ref|XP_008350323.1| PREDICTED: transcription factor HBP-1b(c38)-like [Malus domestica]
 ref|XP_008350324.1| PREDICTED: transcription factor HBP-1b(c38)-like [Malus domestica]
Length=452

 Score =   424 bits (1091),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 260/322 (81%), Positives = 286/322 (89%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD SPRTDTSTD   + KN   + N    ++ SD SDR++    DQKTLRRLAQ
Sbjct  116   WGESNMADGSPRTDTSTDDTED-KNQKIERNQMTALLASDSSDRSKEKSGDQKTLRRLAQ  174

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS SMSGNGALA
Sbjct  175   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSMSGNGALA  234

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDVEYARWLEEHNR+INELR AVNSHAGD ELR ++D+++AHY DIFR+KG AAKADVFH
Sbjct  235   FDVEYARWLEEHNRQINELRAAVNSHAGDTELRTVIDNVIAHYNDIFRLKGTAAKADVFH  294

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFRSSELLKLL++QLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  295   ILSGMWKTPAERCFMWIGGFRSSELLKLLVSQLEPLTEQQLVGIYNLQQSSQQAEDALSQ  354

Query  514   GMEALQQSLAETL-AgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSL+ETL +GS  PSGSSGNVANYMGQMAMAMGKLGTL+GF+RQADNLRQQTLQ
Sbjct  355   GMEALQQSLSETLASGSPAPSGSSGNVANYMGQMAMAMGKLGTLDGFLRQADNLRQQTLQ  414

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I+DYF
Sbjct  415   QMHRILTTRQSARALLAINDYF  436



>ref|XP_003558037.1| PREDICTED: transcription factor TGA2-like isoform X1 [Brachypodium 
distachyon]
Length=334

 Score =   420 bits (1079),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 249/318 (78%), Positives = 275/318 (86%), Gaps = 6/318 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGS------DGSDRTRDQKTLRRLAQNRE  1046
             MAD S RTD S   DT+DKN   +N     +V S      D SDR  DQK LRRLAQNRE
Sbjct  1     MADASSRTDNSIVVDTDDKNQRMENGQNGAMVPSNSSDPSDRSDRPMDQKVLRRLAQNRE  60

Query  1045  AARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDV  866
             AARKSRLRKKAYVQQLE+S++KL  LEQELQ+ARQQGIFISSSGDQ+ +MSGNGA+ FD+
Sbjct  61    AARKSRLRKKAYVQQLESSKLKLASLEQELQKARQQGIFISSSGDQTHAMSGNGAMTFDL  120

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EY RWLEE N++INELR AVN+HA D++LR+IVD IMAHY++IF++KG AAKADVFH+LS
Sbjct  121   EYTRWLEEQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFKLKGAAAKADVFHMLS  180

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQLL ++NLQQSSQQAEDALSQGME
Sbjct  181   GMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLLGLSNLQQSSQQAEDALSQGME  240

Query  505   ALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             ALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTL QM R
Sbjct  241   ALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLHQMQR  300

Query  325   ILTTRQAARAFLGISDYF  272
             ILT RQAARA L I DYF
Sbjct  301   ILTIRQAARALLAIHDYF  318



>ref|XP_010557921.1| PREDICTED: transcription factor TGA6 [Tarenaya hassleriana]
 ref|XP_010557923.1| PREDICTED: transcription factor TGA6 [Tarenaya hassleriana]
 ref|XP_010557924.1| PREDICTED: transcription factor TGA6 [Tarenaya hassleriana]
Length=331

 Score =   420 bits (1079),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 250/316 (79%), Positives = 277/316 (88%), Gaps = 5/316 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRT  STDADT+ ++  F+    LG+  SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADTSPRTSVSTDADTDHRDQRFEVGQ-LGVAASDSSDRSKDKLDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSSGDQ+ S SGNGA+AFDVEY+
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSGDQAHSTSGNGAMAFDVEYS  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RW EE NR++NELR A+N+HA DAELRIIVD +MAHYE++FRIK  A+K DVFH+LSG+W
Sbjct  120   RWQEEKNRQMNELRSALNAHASDAELRIIVDGVMAHYEELFRIKSNASKNDVFHLLSGLW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKL+ NQLEPLTEQQ + I NLQQSSQQAEDALSQGMEALQ
Sbjct  180   KTPAERCFLWLGGFRSSELLKLVANQLEPLTEQQSIGIINLQQSSQQAEDALSQGMEALQ  239

Query  496   QSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSLAETL+  +LG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLR QTLQQM RIL
Sbjct  240   QSLAETLSNGTLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMLRIL  299

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA   I +YF
Sbjct  300   TTRQSARALQAIHEYF  315



>ref|XP_011079069.1| PREDICTED: transcription factor HBP-1b(c38)-like [Sesamum indicum]
Length=468

 Score =   424 bits (1091),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 248/322 (77%), Positives = 272/322 (84%), Gaps = 5/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD S RTDTSTD D EDKN   +   +  +  SD SD+++    DQKTLRRLAQ
Sbjct  131   WGESNMADSSSRTDTSTDVDPEDKNQMNEMGQSAAVTVSDSSDKSKEKTLDQKTLRRLAQ  190

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISS GDQS + SGNGALA
Sbjct  191   NREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSIGDQSNAGSGNGALA  250

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD EYARW+EE N+RINELR AVNSHA D ELR +VD++   + DIFR+KG AAKADVFH
Sbjct  251   FDAEYARWMEEQNKRINELRTAVNSHASDTELRTVVDNVTTQFNDIFRLKGNAAKADVFH  310

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFR SELLKLL+NQLEPLTEQQ+ AI NLQQSS QAEDALSQ
Sbjct  311   ILSGMWKTPAERCFMWIGGFRPSELLKLLVNQLEPLTEQQMTAIYNLQQSSHQAEDALSQ  370

Query  514   GMEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQ SLAET+A  S GP  SSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQ
Sbjct  371   GMEALQHSLAETIANGSSGPESSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQ  430

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHR LTTRQ+ARA L I++YF
Sbjct  431   QMHRTLTTRQSARALLLINEYF  452



>gb|EYU20805.1| hypothetical protein MIMGU_mgv1a006646mg [Erythranthe guttata]
Length=436

 Score =   423 bits (1087),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 239/317 (75%), Positives = 262/317 (83%), Gaps = 10/317 (3%)
 Frame = -1

Query  1210  MMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQNREA  1043
             M AD S RTDTSTDAD +DKN   +   + G   SD SD+++    DQKTLRRLAQNREA
Sbjct  109   MAADSSSRTDTSTDADPDDKNQMIEMGQSAGPAVSDSSDKSKEKTLDQKTLRRLAQNREA  168

Query  1042  ARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVE  863
             ARKSRLRKKAYVQQLE+SRMKLTQLEQEL+  RQ G F+S++GDQS +     A AFDVE
Sbjct  169   ARKSRLRKKAYVQQLESSRMKLTQLEQELKPPRQHGAFVSNNGDQSNAG----ASAFDVE  224

Query  862   YARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSG  683
             YARW+EE +RRINELR AV SHA D EL  IVDS+  H+ DIFR+KG AAKADVFHILSG
Sbjct  225   YARWMEEQSRRINELRTAVTSHASDTELHSIVDSVKTHFNDIFRLKGNAAKADVFHILSG  284

Query  682   MWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEA  503
             MWKTPAERCFLWLGGFR SELLKLL+NQLEPLTEQQ+    NLQQSS QAEDALSQGMEA
Sbjct  285   MWKTPAERCFLWLGGFRPSELLKLLVNQLEPLTEQQMTGFYNLQQSSHQAEDALSQGMEA  344

Query  502   LQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             LQQSLAETLA   G  GSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQMHR 
Sbjct  345   LQQSLAETLA--SGTEGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMHRT  402

Query  322   LTTRQAARAFLGISDYF  272
             LTTRQ+ARA + I+DYF
Sbjct  403   LTTRQSARALVLINDYF  419



>ref|XP_009338082.1| PREDICTED: transcription factor HBP-1b(c38)-like [Pyrus x bretschneideri]
Length=452

 Score =   423 bits (1088),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 259/322 (80%), Positives = 287/322 (89%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD SPRTDTSTD   + KN   + N    ++ SD SDR++    DQKTLRRLAQ
Sbjct  116   WGESNMADGSPRTDTSTDDTED-KNQKIEGNQMTALLASDSSDRSKEKSGDQKTLRRLAQ  174

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS SM+GNGALA
Sbjct  175   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSMNGNGALA  234

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDVEYARWLEEHNR+INELR AVNSHAGD ELR ++D+++AHY+DIFR+KG AAKADVFH
Sbjct  235   FDVEYARWLEEHNRQINELRAAVNSHAGDTELRTVIDNVIAHYDDIFRLKGTAAKADVFH  294

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFRSSELLKLL++QLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  295   ILSGMWKTPAERCFMWIGGFRSSELLKLLVSQLEPLTEQQLVGIYNLQQSSQQAEDALSQ  354

Query  514   GMEALQQSLAETL-AgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSL+ETL +GS  PSGSSGNVANYMGQMAMAMGKLGTL+GF+RQADNLRQQTLQ
Sbjct  355   GMEALQQSLSETLASGSPAPSGSSGNVANYMGQMAMAMGKLGTLDGFLRQADNLRQQTLQ  414

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I+DYF
Sbjct  415   QMHRILTTRQSARALLAINDYF  436



>ref|XP_002458658.1| hypothetical protein SORBIDRAFT_03g037560 [Sorghum bicolor]
 gb|EES03778.1| hypothetical protein SORBIDRAFT_03g037560 [Sorghum bicolor]
Length=468

 Score =   424 bits (1089),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 249/321 (78%), Positives = 276/321 (86%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MA  SP TDTS+D DT+++N  F+         SD SD++RD   QKTLRRLAQN
Sbjct  132   WGESAMAGGSPMTDTSSDPDTDERNQMFEQGLVTVPTASDSSDKSRDKLDQKTLRRLAQN  191

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAY+Q LE+SR+KLTQLEQELQRARQQGIFIS+SGDQ QS SGNGALAF
Sbjct  192   REAARKSRLRKKAYIQNLESSRLKLTQLEQELQRARQQGIFISTSGDQPQSTSGNGALAF  251

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D+EYARWLEEHN+ +NELR AVN+HAGD +LR IVDSIMAHY++IFR+KG AAKADVFH+
Sbjct  252   DMEYARWLEEHNKHVNELRAAVNAHAGDNDLRGIVDSIMAHYDEIFRLKGVAAKADVFHV  311

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCF+WLGGFRSSELLKLL   LEPLT+QQL+ I+NLQQSSQQAEDALSQG
Sbjct  312   LSGMWKTPAERCFMWLGGFRSSELLKLLAGHLEPLTDQQLVGISNLQQSSQQAEDALSQG  371

Query  511   MEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETLA    GP+G SGNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQ
Sbjct  372   MEALQQSLAETLASGSLGPAGPSGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQ  431

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L ISDYF
Sbjct  432   MQRILTTRQSARALLAISDYF  452



>ref|XP_011027238.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X3 [Populus 
euphratica]
Length=399

 Score =   421 bits (1083),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 258/322 (80%), Positives = 283/322 (88%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MA+ SPRTDTSTD   E KN  F+      I GSD SD+++    DQKTLRRLAQ
Sbjct  63    WGETNMAEASPRTDTSTDDTDE-KNQRFERGQLAAIAGSDSSDKSKEKAGDQKTLRRLAQ  121

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQ+ARQQGIFISSSGDQ+ SMSGNGALA
Sbjct  122   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQKARQQGIFISSSGDQTHSMSGNGALA  181

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD EYARWLEEHNR+I+ELR AVNSHAGDAELR IVD++ +H+ D+FR+KG AAKADVFH
Sbjct  182   FDAEYARWLEEHNRQISELRAAVNSHAGDAELRTIVDNVASHFSDVFRLKGTAAKADVFH  241

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFRSSELLKLL NQLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  242   ILSGMWKTPAERCFMWIGGFRSSELLKLLENQLEPLTEQQLMGIYNLQQSSQQAEDALSQ  301

Query  514   GMEALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA G+ G SGSSGNVANYMGQMAMAMGKLGTLEGF+R+ADNLRQQTL+
Sbjct  302   GMEALQQSLAETLANGNPGSSGSSGNVANYMGQMAMAMGKLGTLEGFLREADNLRQQTLE  361

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I DYF
Sbjct  362   QMHRILTTRQSARALLAIHDYF  383



>ref|XP_006399172.1| hypothetical protein EUTSA_v10014082mg [Eutrema salsugineum]
 dbj|BAJ34211.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ40625.1| hypothetical protein EUTSA_v10014082mg [Eutrema salsugineum]
Length=330

 Score =   418 bits (1074),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 239/315 (76%), Positives = 274/315 (87%), Gaps = 4/315 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD STD DT+ +++G +    L    SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADTSPRTDVSTDGDTDHRDLGSEG-ALLNTAASDSSDRSKDKLDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISS+GDQ+ S  GNGALAFD E++
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSTGDQAHSTGGNGALAFDAEHS  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N+++NELR A+N+HAGDAELR I+D +MAHYE++FRIK  AAK DVFH+LSGMW
Sbjct  120   RWLEEKNKQMNELRSALNAHAGDAELRTIIDGVMAHYEELFRIKSNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL NQLEP+TE+Q++ IN+LQQ+SQQAEDALSQGME+LQ
Sbjct  180   KTPAERCFLWLGGFRSSELLKLLANQLEPMTERQMMGINSLQQTSQQAEDALSQGMESLQ  239

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SSGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  240   QSLADTLSSGSLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLT  299

Query  316   TRQAARAFLGISDYF  272
             TRQ+ARA L I DYF
Sbjct  300   TRQSARAILAIHDYF  314



>ref|XP_009419684.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=332

 Score =   417 bits (1073),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 256/316 (81%), Positives = 282/316 (89%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MAD SPRTDTSTD DT+DKN   +         SD SDR++D    QKTLRRLAQNREAA
Sbjct  1     MADASPRTDTSTDVDTDDKNQRLERGQLAFAAASDSSDRSKDKTLDQKTLRRLAQNREAA  60

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQ+ARQQGIFIS+SGDQS + SGNGAL FDVEY
Sbjct  61    RKSRLRKKAYVQQLESSRLKLTQLEQELQKARQQGIFISNSGDQSHATSGNGALTFDVEY  120

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR+I+ELR AVN+HA + +LR+IVD +MAHY++IFR+KG AAKADVFHILSGM
Sbjct  121   ARWLEEHNRQISELRAAVNAHASENDLRVIVDGVMAHYDEIFRLKGIAAKADVFHILSGM  180

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFRSSELLKLL NQLEPLTEQQ++ I NLQQSSQQAEDALSQGM+AL
Sbjct  181   WKTPAERCFLWLGGFRSSELLKLLANQLEPLTEQQMMGICNLQQSSQQAEDALSQGMDAL  240

Query  499   QQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QQSL+ETLAGSLGPSG+SGNVANYMGQMAMAMGKLGTLE F+ QADNLRQQTLQQMHRIL
Sbjct  241   QQSLSETLAGSLGPSGTSGNVANYMGQMAMAMGKLGTLENFLHQADNLRQQTLQQMHRIL  300

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L ISDYF
Sbjct  301   TTRQSARALLAISDYF  316



>gb|ABR46137.1| bZIP transcription factor TGA2 [Arabidopsis lyrata]
 gb|ABR46138.1| bZIP transcription factor TGA2 [Arabidopsis lyrata]
 gb|ABR46139.1| bZIP transcription factor TGA2 [Arabidopsis lyrata]
 gb|ABR46140.1| bZIP transcription factor TGA2 [Arabidopsis lyrata]
 gb|ABR46141.1| bZIP transcription factor TGA2 [Arabidopsis lyrata]
 gb|ABR46142.1| bZIP transcription factor TGA2 [Arabidopsis lyrata]
 gb|ABR46143.1| bZIP transcription factor TGA2 [Arabidopsis lyrata]
 gb|ABR46144.1| bZIP transcription factor TGA2 [Arabidopsis lyrata]
Length=330

 Score =   417 bits (1072),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 243/319 (76%), Positives = 276/319 (87%), Gaps = 12/319 (4%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQ----NNHALGIVGSDGSDRTR---DQKTLRRLAQNR  1049
             MAD SPRTD STD DT+  ++G +    NN A     SD SDR++   DQKTLRRLAQNR
Sbjct  1     MADTSPRTDVSTDEDTDHPDLGSEGALVNNAA-----SDSSDRSKGKMDQKTLRRLAQNR  55

Query  1048  EAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFD  869
             EAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISS+GDQ+ +  GNGALAFD
Sbjct  56    EAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSTGDQAHATGGNGALAFD  115

Query  868   VEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHIL  689
              E++RWLEE N+++NELR A+N+HAGD+ELRIIVD +MAHYE++FRIK  AAK DVFH+L
Sbjct  116   AEHSRWLEEKNKQMNELRSALNAHAGDSELRIIVDGVMAHYEELFRIKSNAAKNDVFHLL  175

Query  688   SGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGM  509
             SGMWKTPAERCFLWLGGFRSSELLKLL NQLEP+TE+QL+ INNLQQ+SQQAEDALSQGM
Sbjct  176   SGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQLMGINNLQQTSQQAEDALSQGM  235

Query  508   EALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMH  329
             E+LQQSLA+TL+     S SSGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QTLQQM 
Sbjct  236   ESLQQSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMI  295

Query  328   RILTTRQAARAFLGISDYF  272
             R+LTTRQ+ARA L I DYF
Sbjct  296   RVLTTRQSARALLAIHDYF  314



>ref|XP_010520066.1| PREDICTED: transcription factor TGA6-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010520067.1| PREDICTED: transcription factor TGA6-like isoform X1 [Tarenaya 
hassleriana]
Length=333

 Score =   417 bits (1073),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 249/315 (79%), Positives = 274/315 (87%), Gaps = 5/315 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRT  STDADT+ ++  F+    LGIV SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADTSPRTSVSTDADTDHRDQRFEGGQ-LGIVASDSSDRSKDKLDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSSGDQ+ S  GNGA+AFDVEY+
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSGDQAHSTGGNGAMAFDVEYS  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RW E+ NR++NELR A+N+HA DAELRIIVD +MAHYE++FRIK  AAK DVFH+LSGMW
Sbjct  120   RWQEDKNRQMNELRSAINAHASDAELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             K PAERCFLWLGGFRSSELLKL+  QLEPLTEQQ + I NLQQSS QAEDALSQGMEALQ
Sbjct  180   KPPAERCFLWLGGFRSSELLKLVATQLEPLTEQQSIGIINLQQSSHQAEDALSQGMEALQ  239

Query  496   QSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSLAETL+  +LG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLR QTLQQM RIL
Sbjct  240   QSLAETLSNGTLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMLRIL  299

Query  319   TTRQAARAFLGISDY  275
             TTRQ+ARA L I +Y
Sbjct  300   TTRQSARALLAIHEY  314



>ref|XP_011027237.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Populus 
euphratica]
Length=442

 Score =   421 bits (1082),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 258/322 (80%), Positives = 283/322 (88%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MA+ SPRTDTSTD   E KN  F+      I GSD SD+++    DQKTLRRLAQ
Sbjct  106   WGETNMAEASPRTDTSTDDTDE-KNQRFERGQLAAIAGSDSSDKSKEKAGDQKTLRRLAQ  164

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQ+ARQQGIFISSSGDQ+ SMSGNGALA
Sbjct  165   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQKARQQGIFISSSGDQTHSMSGNGALA  224

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD EYARWLEEHNR+I+ELR AVNSHAGDAELR IVD++ +H+ D+FR+KG AAKADVFH
Sbjct  225   FDAEYARWLEEHNRQISELRAAVNSHAGDAELRTIVDNVASHFSDVFRLKGTAAKADVFH  284

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFRSSELLKLL NQLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  285   ILSGMWKTPAERCFMWIGGFRSSELLKLLENQLEPLTEQQLMGIYNLQQSSQQAEDALSQ  344

Query  514   GMEALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA G+ G SGSSGNVANYMGQMAMAMGKLGTLEGF+R+ADNLRQQTL+
Sbjct  345   GMEALQQSLAETLANGNPGSSGSSGNVANYMGQMAMAMGKLGTLEGFLREADNLRQQTLE  404

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I DYF
Sbjct  405   QMHRILTTRQSARALLAIHDYF  426



>ref|XP_002307972.2| hypothetical protein POPTR_0006s03720g [Populus trichocarpa]
 gb|EEE91495.2| hypothetical protein POPTR_0006s03720g [Populus trichocarpa]
Length=470

 Score =   422 bits (1084),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 257/322 (80%), Positives = 283/322 (88%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MA+ SPRTDTSTD   E KN  F+    + I  SD SD+++    DQKTLRRLAQ
Sbjct  134   WGETNMAEASPRTDTSTDDTDE-KNQRFERGQLVAIAASDSSDKSKERAGDQKTLRRLAQ  192

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQ+ARQQGIFISSSGDQ+ SMSGNGALA
Sbjct  193   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQKARQQGIFISSSGDQTHSMSGNGALA  252

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD EYARWLEEHNR+I+ELR AVNSHAGD ELR IVD++ +H+ D+FR+KG AAKADVFH
Sbjct  253   FDAEYARWLEEHNRQISELRAAVNSHAGDTELRTIVDNVASHFSDVFRLKGTAAKADVFH  312

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  313   ILSGMWKTPAERCFMWIGGFRSSELLKLLVNQLEPLTEQQLMGIYNLQQSSQQAEDALSQ  372

Query  514   GMEALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA G+ G SGSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTL+
Sbjct  373   GMEALQQSLAETLANGNPGSSGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLE  432

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I DYF
Sbjct  433   QMHRILTTRQSARALLAIHDYF  454



>ref|XP_011027235.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Populus 
euphratica]
 ref|XP_011027236.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Populus 
euphratica]
Length=468

 Score =   421 bits (1083),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 258/322 (80%), Positives = 283/322 (88%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MA+ SPRTDTSTD   E KN  F+      I GSD SD+++    DQKTLRRLAQ
Sbjct  132   WGETNMAEASPRTDTSTDDTDE-KNQRFERGQLAAIAGSDSSDKSKEKAGDQKTLRRLAQ  190

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQ+ARQQGIFISSSGDQ+ SMSGNGALA
Sbjct  191   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQKARQQGIFISSSGDQTHSMSGNGALA  250

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD EYARWLEEHNR+I+ELR AVNSHAGDAELR IVD++ +H+ D+FR+KG AAKADVFH
Sbjct  251   FDAEYARWLEEHNRQISELRAAVNSHAGDAELRTIVDNVASHFSDVFRLKGTAAKADVFH  310

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFRSSELLKLL NQLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  311   ILSGMWKTPAERCFMWIGGFRSSELLKLLENQLEPLTEQQLMGIYNLQQSSQQAEDALSQ  370

Query  514   GMEALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA G+ G SGSSGNVANYMGQMAMAMGKLGTLEGF+R+ADNLRQQTL+
Sbjct  371   GMEALQQSLAETLANGNPGSSGSSGNVANYMGQMAMAMGKLGTLEGFLREADNLRQQTLE  430

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I DYF
Sbjct  431   QMHRILTTRQSARALLAIHDYF  452



>ref|XP_002871242.1| bZIP transcription factor TGA2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47501.1| bZIP transcription factor TGA2 [Arabidopsis lyrata subsp. lyrata]
Length=330

 Score =   416 bits (1069),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 242/319 (76%), Positives = 276/319 (87%), Gaps = 12/319 (4%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQ----NNHALGIVGSDGSDRTR---DQKTLRRLAQNR  1049
             MAD SPRTD STD DT+  ++G +    NN A     SD SDR++   DQK+LRRLAQNR
Sbjct  1     MADTSPRTDVSTDEDTDHPDLGSEGALVNNAA-----SDSSDRSKGKMDQKSLRRLAQNR  55

Query  1048  EAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFD  869
             EAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISS+GDQ+ +  GNGALAFD
Sbjct  56    EAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSTGDQAHATGGNGALAFD  115

Query  868   VEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHIL  689
              E++RWLEE N+++NELR A+N+HAGD+ELRIIVD +MAHYE++FRIK  AAK DVFH+L
Sbjct  116   AEHSRWLEEKNKQMNELRSALNAHAGDSELRIIVDGVMAHYEELFRIKSNAAKNDVFHLL  175

Query  688   SGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGM  509
             SGMWKTPAERCFLWLGGFRSSELLKLL NQLEP+TE+QL+ INNLQQ+SQQAEDALSQGM
Sbjct  176   SGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQLMGINNLQQTSQQAEDALSQGM  235

Query  508   EALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMH  329
             E+LQQSLA+TL+     S SSGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QTLQQM 
Sbjct  236   ESLQQSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMI  295

Query  328   RILTTRQAARAFLGISDYF  272
             R+LTTRQ+ARA L I DYF
Sbjct  296   RVLTTRQSARALLAIHDYF  314



>ref|XP_004984573.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Setaria 
italica]
 ref|XP_004984574.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X2 [Setaria 
italica]
Length=335

 Score =   416 bits (1069),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 248/319 (78%), Positives = 276/319 (87%), Gaps = 7/319 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSD-------RTRDQKTLRRLAQNR  1049
             MAD S RTDTST  DT+DKN   +N  +  IV +  S        +  DQK LRRLAQNR
Sbjct  1     MADASSRTDTSTVVDTDDKNQRLENGQSGAIVMASNSSDRSDRSDKPMDQKVLRRLAQNR  60

Query  1048  EAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFD  869
             EAARKSRLRKKAYVQQLE+S++KL  LEQELQ+ARQQGIFISSSGDQ+ +MSGNGA+ FD
Sbjct  61    EAARKSRLRKKAYVQQLESSKLKLASLEQELQKARQQGIFISSSGDQTHAMSGNGAMTFD  120

Query  868   VEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHIL  689
             +EY+RW EE N++INELR AVN+HA D++LR+IVD IMAHY++IFR+KG AAKADVFHIL
Sbjct  121   LEYSRWQEEQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFRLKGVAAKADVFHIL  180

Query  688   SGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGM  509
             SGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ ++NLQQSSQQAEDALSQGM
Sbjct  181   SGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGLSNLQQSSQQAEDALSQGM  240

Query  508   EALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMH  329
             EALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTL QM 
Sbjct  241   EALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLHQMQ  300

Query  328   RILTTRQAARAFLGISDYF  272
             RILT RQAARA L I DYF
Sbjct  301   RILTIRQAARALLAIHDYF  319



>ref|XP_010245499.1| PREDICTED: transcription factor TGA2-like isoform X3 [Nelumbo 
nucifera]
Length=465

 Score =   420 bits (1080),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 271/364 (74%), Positives = 293/364 (80%), Gaps = 47/364 (13%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTDTSTD DT+DKN   +   +  +VGSD SDR++D   QKTLRRLAQN
Sbjct  86    WGESSMADASPRTDTSTDVDTDDKNQKMETGQSTAVVGSDSSDRSKDKLDQKTLRRLAQN  145

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS S+SGNGALAF
Sbjct  146   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSVSGNGALAF  205

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D+EYARWLEEHNR+INELR AVNSHA D+ELR+IVD +MAHY+DIFR+KG AAKADVFH+
Sbjct  206   DIEYARWLEEHNRQINELRNAVNSHASDSELRVIVDGVMAHYDDIFRLKGIAAKADVFHM  265

Query  691   LSGMWKTPAERCFLWLGGFRSSELLK----------------------------------  614
             LSGMWKTPAERCFLWLGGFRSSELLK                                  
Sbjct  266   LSGMWKTPAERCFLWLGGFRSSELLKDAPPPPXAEKDFLVFSCKWLRAPAPTPATLLPPG  325

Query  613   ---------LLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLA-gsl  464
                      LL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQQSLAETLA GSL
Sbjct  326   SDHHPTTAPLLVNQLEPLTEQQLMGICNLQQSSQQAEDALSQGMEALQQSLAETLASGSL  385

Query  463   gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGI  284
             GPSGSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQMHRILTTRQ+ARA L I
Sbjct  386   GPSGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMHRILTTRQSARALLAI  445

Query  283   SDYF  272
             +DYF
Sbjct  446   NDYF  449



>ref|XP_009412198.1| PREDICTED: transcription factor HBP-1b(c1)-like [Musa acuminata 
subsp. malaccensis]
Length=332

 Score =   415 bits (1067),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 259/316 (82%), Positives = 282/316 (89%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MAD SPRTDTSTD DT+DK+   +      +  SD SDR++D    QKTLRRLAQNREAA
Sbjct  1     MADTSPRTDTSTDVDTDDKDQMLEQGQLAVVAASDSSDRSKDKTLDQKTLRRLAQNREAA  60

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE SRMKLTQLEQELQRARQQGIFISSSGDQ+ +M GNGALAFDVEY
Sbjct  61    RKSRLRKKAYVQQLETSRMKLTQLEQELQRARQQGIFISSSGDQTHAMGGNGALAFDVEY  120

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR+INELR AV +HA + +LR+IVD IMAHY++ F++KG AAKADVFHILSGM
Sbjct  121   ARWLEEHNRQINELRTAVTAHASENDLRVIVDGIMAHYDEKFKLKGVAAKADVFHILSGM  180

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFRSSELLKLL +QLEPLTEQQ++ I NLQQSSQQAEDALSQGMEAL
Sbjct  181   WKTPAERCFLWLGGFRSSELLKLLASQLEPLTEQQVMGICNLQQSSQQAEDALSQGMEAL  240

Query  499   QQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTLQQMHRIL
Sbjct  241   QQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLESFLRQADNLRQQTLQQMHRIL  300

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I+DYF
Sbjct  301   TTRQSARALLAINDYF  316



>ref|XP_009419683.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=457

 Score =   419 bits (1077),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 256/316 (81%), Positives = 282/316 (89%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MAD SPRTDTSTD DT+DKN   +         SD SDR++D    QKTLRRLAQNREAA
Sbjct  126   MADASPRTDTSTDVDTDDKNQRLERGQLAFAAASDSSDRSKDKTLDQKTLRRLAQNREAA  185

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQ+ARQQGIFIS+SGDQS + SGNGAL FDVEY
Sbjct  186   RKSRLRKKAYVQQLESSRLKLTQLEQELQKARQQGIFISNSGDQSHATSGNGALTFDVEY  245

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR+I+ELR AVN+HA + +LR+IVD +MAHY++IFR+KG AAKADVFHILSGM
Sbjct  246   ARWLEEHNRQISELRAAVNAHASENDLRVIVDGVMAHYDEIFRLKGIAAKADVFHILSGM  305

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFRSSELLKLL NQLEPLTEQQ++ I NLQQSSQQAEDALSQGM+AL
Sbjct  306   WKTPAERCFLWLGGFRSSELLKLLANQLEPLTEQQMMGICNLQQSSQQAEDALSQGMDAL  365

Query  499   QQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QQSL+ETLAGSLGPSG+SGNVANYMGQMAMAMGKLGTLE F+ QADNLRQQTLQQMHRIL
Sbjct  366   QQSLSETLAGSLGPSGTSGNVANYMGQMAMAMGKLGTLENFLHQADNLRQQTLQQMHRIL  425

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L ISDYF
Sbjct  426   TTRQSARALLAISDYF  441



>gb|AGH18703.1| TGA-type basic leucine zipper protein [Triticum monococcum]
Length=334

 Score =   414 bits (1065),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 246/318 (77%), Positives = 274/318 (86%), Gaps = 6/318 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGS------DGSDRTRDQKTLRRLAQNRE  1046
             MAD S RTDTS   DT+DKN   +N     IV S      D SDR  DQK LRRLAQNRE
Sbjct  1     MADASSRTDTSIVVDTDDKNQRMENGQNGAIVPSNSSEPSDRSDRPMDQKVLRRLAQNRE  60

Query  1045  AARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDV  866
             AARKSRLRKKAYVQQLE+S++KL  LEQELQ+ARQQGIFISSSGDQ+ +MSGNGA+ FD+
Sbjct  61    AARKSRLRKKAYVQQLESSKLKLASLEQELQKARQQGIFISSSGDQTHAMSGNGAMTFDL  120

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EY RWLEE N++INELR AVN+HA D++LR+IVD IMAHY++IF++KG AAKADVFH+LS
Sbjct  121   EYTRWLEEQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFKLKGAAAKADVFHMLS  180

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ +++L+QSS QAEDALSQGME
Sbjct  181   GMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGLSSLEQSSHQAEDALSQGME  240

Query  505   ALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             ALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTL QM R
Sbjct  241   ALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLHQMQR  300

Query  325   ILTTRQAARAFLGISDYF  272
             ILT RQAARA L I D F
Sbjct  301   ILTIRQAARALLAIHDCF  318



>ref|XP_006644064.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Oryza 
brachyantha]
Length=330

 Score =   414 bits (1065),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 256/315 (81%), Positives = 275/315 (87%), Gaps = 6/315 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MAD+SPRTDTSTD      N   +   A  +  SD SDR++D    QKTLRRLAQNREAA
Sbjct  1     MADMSPRTDTSTDDTD--DNHMLEPGQAALVAASDSSDRSKDKHEDQKTLRRLAQNREAA  58

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSS DQ+ SMSGNGALAFD+EY
Sbjct  59    RKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSVDQTHSMSGNGALAFDMEY  118

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR+INELR AVN+HA D ELR +VD IM+HYE+IF+ KG AAKADVFH+LSGM
Sbjct  119   ARWLEEHNRQINELRSAVNAHASDNELRAVVDKIMSHYEEIFKQKGSAAKADVFHVLSGM  178

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFR SELLKLL  QLEPLTEQQL  I+NLQQSSQQAEDALSQGMEAL
Sbjct  179   WKTPAERCFLWLGGFRPSELLKLLSTQLEPLTEQQLSGISNLQQSSQQAEDALSQGMEAL  238

Query  499   QQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QQSLAETLAGSLG SGS+GNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTLQQM RIL
Sbjct  239   QQSLAETLAGSLGSSGSTGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLQQMQRIL  298

Query  319   TTRQAARAFLGISDY  275
             TTRQ+ARA L ISDY
Sbjct  299   TTRQSARALLVISDY  313



>ref|XP_010055972.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 ref|XP_010055976.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 ref|XP_010055985.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 ref|XP_010055993.1| PREDICTED: transcription factor HBP-1b(c38)-like [Eucalyptus 
grandis]
 gb|KCW90037.1| hypothetical protein EUGRSUZ_A02240 [Eucalyptus grandis]
Length=468

 Score =   419 bits (1078),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 252/323 (78%), Positives = 281/323 (87%), Gaps = 8/323 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVG-SDGSDRTR----DQKTLRRLA  1058
             W    MAD SPRTDTSTD   + KN  F+    LG+   SD SDR++    DQKTLRRLA
Sbjct  132   WGDSTMADSSPRTDTSTDDTGD-KNHRFEGGQ-LGVAAASDSSDRSKEKATDQKTLRRLA  189

Query  1057  QNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGAL  878
             QNREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFIS SG+QS SMSGNGAL
Sbjct  190   QNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISGSGEQSHSMSGNGAL  249

Query  877   AFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVF  698
             AFDVEYARWLEEHN+ +NELR AVN+HAGD ELR IVD++ AH+++IF++KG AAKADVF
Sbjct  250   AFDVEYARWLEEHNKVVNELRNAVNAHAGDTELRTIVDNVAAHFDEIFKLKGTAAKADVF  309

Query  697   HILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALS  518
             HILSGMWKTPAERCF+W+GGFRSSE+LKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALS
Sbjct  310   HILSGMWKTPAERCFMWIGGFRSSEVLKLLVNQLEPLTEQQLVGIGNLQQSSQQAEDALS  369

Query  517   QGMEALQQSLAETLAgslgpsg-ssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTL  341
             QG+EALQQSLAETLA S   +   SGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTL
Sbjct  370   QGLEALQQSLAETLANSTTATAGPSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTL  429

Query  340   QQMHRILTTRQAARAFLGISDYF  272
             QQMHR+LTTRQ+ARA L I+DYF
Sbjct  430   QQMHRVLTTRQSARALLAINDYF  452



>ref|XP_010245493.1| PREDICTED: transcription factor TGA2-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010245494.1| PREDICTED: transcription factor TGA2-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010245496.1| PREDICTED: transcription factor TGA2-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010245497.1| PREDICTED: transcription factor TGA2-like isoform X1 [Nelumbo 
nucifera]
Length=511

 Score =   421 bits (1082),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 271/364 (74%), Positives = 293/364 (80%), Gaps = 47/364 (13%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTDTSTD DT+DKN   +   +  +VGSD SDR++D   QKTLRRLAQN
Sbjct  132   WGESSMADASPRTDTSTDVDTDDKNQKMETGQSTAVVGSDSSDRSKDKLDQKTLRRLAQN  191

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS S+SGNGALAF
Sbjct  192   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSVSGNGALAF  251

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D+EYARWLEEHNR+INELR AVNSHA D+ELR+IVD +MAHY+DIFR+KG AAKADVFH+
Sbjct  252   DIEYARWLEEHNRQINELRNAVNSHASDSELRVIVDGVMAHYDDIFRLKGIAAKADVFHM  311

Query  691   LSGMWKTPAERCFLWLGGFRSSELLK----------------------------------  614
             LSGMWKTPAERCFLWLGGFRSSELLK                                  
Sbjct  312   LSGMWKTPAERCFLWLGGFRSSELLKDAPPPPXAEKDFLVFSCKWLRAPAPTPATLLPPG  371

Query  613   ---------LLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLA-gsl  464
                      LL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQQSLAETLA GSL
Sbjct  372   SDHHPTTAPLLVNQLEPLTEQQLMGICNLQQSSQQAEDALSQGMEALQQSLAETLASGSL  431

Query  463   gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGI  284
             GPSGSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQMHRILTTRQ+ARA L I
Sbjct  432   GPSGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMHRILTTRQSARALLAI  491

Query  283   SDYF  272
             +DYF
Sbjct  492   NDYF  495



>ref|XP_009419682.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=464

 Score =   419 bits (1077),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 256/316 (81%), Positives = 282/316 (89%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MAD SPRTDTSTD DT+DKN   +         SD SDR++D    QKTLRRLAQNREAA
Sbjct  133   MADASPRTDTSTDVDTDDKNQRLERGQLAFAAASDSSDRSKDKTLDQKTLRRLAQNREAA  192

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQ+ARQQGIFIS+SGDQS + SGNGAL FDVEY
Sbjct  193   RKSRLRKKAYVQQLESSRLKLTQLEQELQKARQQGIFISNSGDQSHATSGNGALTFDVEY  252

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR+I+ELR AVN+HA + +LR+IVD +MAHY++IFR+KG AAKADVFHILSGM
Sbjct  253   ARWLEEHNRQISELRAAVNAHASENDLRVIVDGVMAHYDEIFRLKGIAAKADVFHILSGM  312

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFRSSELLKLL NQLEPLTEQQ++ I NLQQSSQQAEDALSQGM+AL
Sbjct  313   WKTPAERCFLWLGGFRSSELLKLLANQLEPLTEQQMMGICNLQQSSQQAEDALSQGMDAL  372

Query  499   QQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QQSL+ETLAGSLGPSG+SGNVANYMGQMAMAMGKLGTLE F+ QADNLRQQTLQQMHRIL
Sbjct  373   QQSLSETLAGSLGPSGTSGNVANYMGQMAMAMGKLGTLENFLHQADNLRQQTLQQMHRIL  432

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L ISDYF
Sbjct  433   TTRQSARALLAISDYF  448



>ref|XP_011000427.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Populus 
euphratica]
Length=332

 Score =   414 bits (1064),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 254/317 (80%), Positives = 283/317 (89%), Gaps = 6/317 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQNREAA  1040
             MA+ SPRTDTSTD   + KN  F+   +  IV SD SD+++    DQKTLRRLAQNREAA
Sbjct  1     MAEASPRTDTSTDDTDD-KNRRFERGQSTAIVASDSSDKSKEKAGDQKTLRRLAQNREAA  59

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGALAFD EY
Sbjct  60    RKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHSMSGNGALAFDAEY  119

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             +RWLEE NR I+ELR AVNSHAGDAELR IVD+++AH+ +++R+KG AAKADVFHILSGM
Sbjct  120   SRWLEEQNRHISELRAAVNSHAGDAELRTIVDNVVAHFNEVYRLKGTAAKADVFHILSGM  179

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCF+W+GGFRSSELLKLL+NQLEPLTEQQ + I NLQQSSQQAEDALSQGMEAL
Sbjct  180   WKTPAERCFMWIGGFRSSELLKLLMNQLEPLTEQQQMGICNLQQSSQQAEDALSQGMEAL  239

Query  499   QQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             QQSLAETLA G+ G SGSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTL+QMHRI
Sbjct  240   QQSLAETLANGNPGSSGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLEQMHRI  299

Query  322   LTTRQAARAFLGISDYF  272
             LTTRQ+ARA L I+DYF
Sbjct  300   LTTRQSARALLAINDYF  316



>ref|XP_006649994.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006649995.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X2 [Oryza 
brachyantha]
Length=333

 Score =   414 bits (1064),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 250/318 (79%), Positives = 279/318 (88%), Gaps = 7/318 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSD------RTRDQKTLRRLAQNRE  1046
             MAD S RTDTST  DTEDKN    +  + GI+ S+ SD      +  DQK LRRLAQNRE
Sbjct  1     MADASSRTDTSTVLDTEDKNQML-DGQSGGIMPSNSSDRSDRSDKPMDQKVLRRLAQNRE  59

Query  1045  AARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDV  866
             AARKSRLRKKAYVQQLE+S++KL  LEQE+Q+ARQQGI+ISSSGDQ+ +MSGNGA+ FD+
Sbjct  60    AARKSRLRKKAYVQQLESSKLKLASLEQEIQKARQQGIYISSSGDQTHAMSGNGAMTFDL  119

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EYARWLEE N++INELR AVN+HA D++LR+IVD IMAHY++IFR+KG AAKADVFHILS
Sbjct  120   EYARWLEEQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFRLKGVAAKADVFHILS  179

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQLL ++NLQQSSQQAEDALSQGME
Sbjct  180   GMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLLGLSNLQQSSQQAEDALSQGME  239

Query  505   ALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             ALQQSLA+TLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTL QM R
Sbjct  240   ALQQSLADTLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLHQMQR  299

Query  325   ILTTRQAARAFLGISDYF  272
             ILT RQAARA L I DYF
Sbjct  300   ILTIRQAARALLAIHDYF  317



>gb|AHF20184.1| bzip transcription factor, partial [Musa acuminata AAA Group]
Length=444

 Score =   418 bits (1074),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 258/321 (80%), Positives = 283/321 (88%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQ  1055
             W    MA+ SPRTDTSTD DT+DKN   +      +  SD SDR++D    QKTLRRLAQ
Sbjct  112   WGESTMANASPRTDTSTDVDTDDKNQRSERGQLAAVAASDSSDRSKDKTLDQKTLRRLAQ  171

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ +M GNGALA
Sbjct  172   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHAMGGNGALA  231

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDVEYARWL++HNR+I+ELR AVN+HA + +LR+IVD IM HYE+IFR+KG AAKADVFH
Sbjct  232   FDVEYARWLDDHNRQISELRTAVNAHASENDLRVIVDGIMTHYEEIFRLKGVAAKADVFH  291

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             I SGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  292   ISSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGICNLQQSSQQAEDALSQ  351

Query  514   GMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             GMEAL QSLAETLAGSLGPSGS+GNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTLQQ
Sbjct  352   GMEALHQSLAETLAGSLGPSGSTGNVANYMGQMAMAMGKLGTLETFLRQADNLRQQTLQQ  411

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L ISDYF
Sbjct  412   MIRILTTRQSARALLAISDYF  432



>gb|KCW65891.1| hypothetical protein EUGRSUZ_G03217 [Eucalyptus grandis]
Length=326

 Score =   413 bits (1062),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 250/316 (79%), Positives = 272/316 (86%), Gaps = 10/316 (3%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRTD S+D DT++KN  F    +  IV  D SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADGSPRTDISSD-DTDEKNQRFDRGKSTAIVAYDSSDRSKDKTDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ S  GNGA+ FDVEYA
Sbjct  60    KSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHSSGGNGAMTFDVEYA  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR+INELR AV +HAGD ELRIIVD IMAHY++IFR+K  AAK DVFH+LSGMW
Sbjct  120   RWLEEQNRQINELRSAVTAHAGDGELRIIVDGIMAHYDEIFRLKSNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCF+WLGGFR SELLK     LEPLTEQQL  I NLQQSSQQAEDALSQGMEALQ
Sbjct  180   KTPAERCFMWLGGFRPSELLK-----LEPLTEQQLTGIGNLQQSSQQAEDALSQGMEALQ  234

Query  496   QSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSLAETL  GSLG +GSSGNVANYMGQMAMAMGKLGTL+GFIRQADNLRQQTLQQM+R+L
Sbjct  235   QSLAETLCSGSLGSAGSSGNVANYMGQMAMAMGKLGTLDGFIRQADNLRQQTLQQMNRLL  294

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I DYF
Sbjct  295   TTRQSARALLAIHDYF  310



>ref|XP_006832856.1| hypothetical protein AMTR_s00095p00059370 [Amborella trichopoda]
 gb|ERM98134.1| hypothetical protein AMTR_s00095p00059370 [Amborella trichopoda]
Length=447

 Score =   417 bits (1073),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 244/322 (76%), Positives = 273/322 (85%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQ  1055
             W    MAD SPRTDTSTD DT+DKN  ++  H   IV SD SDR++D    QKTLRRLAQ
Sbjct  111   WAESTMADGSPRTDTSTDVDTDDKNQRYEAGHNAAIVPSDSSDRSKDKMGDQKTLRRLAQ  170

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE SR+KL Q  ++  +  +Q     SSGDQS SM+GNGALA
Sbjct  171   NREAARKSRLRKKAYVQQLETSRLKL-QQLEQELQRARQQGIFISSGDQSHSMNGNGALA  229

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD+EY+RWLEEHNR+INELR AVNSHAGD ELRI VD++MAHY+DIFR+KG AAKADVFH
Sbjct  230   FDMEYSRWLEEHNRQINELRAAVNSHAGDNELRISVDAVMAHYDDIFRLKGTAAKADVFH  289

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             +LSGMWKTPAERCFLWLGGFRSSELLK+L+  LEPLTEQQL+ I NLQQSSQQAE+ALSQ
Sbjct  290   MLSGMWKTPAERCFLWLGGFRSSELLKILVPHLEPLTEQQLMGICNLQQSSQQAEEALSQ  349

Query  514   GMEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQ+LAETLA    GPSG SGNVANYMGQMA+AMGKLGTLE F+RQADNLRQQTLQ
Sbjct  350   GMEALQQALAETLATGSLGPSGPSGNVANYMGQMAVAMGKLGTLENFLRQADNLRQQTLQ  409

Query  337   QMHRILTTRQAARAFLGISDYF  272
             Q+HRILTTRQ+ARA L I+DYF
Sbjct  410   QLHRILTTRQSARALLAINDYF  431



>ref|XP_011020430.1| PREDICTED: transcription factor TGA2-like isoform X3 [Populus 
euphratica]
Length=447

 Score =   416 bits (1070),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 249/294 (85%), Positives = 269/294 (91%), Gaps = 4/294 (1%)
 Frame = -1

Query  1141  FQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTq  971
             +    +  +V SD SDRTRD   QKTLRRLAQNREAARKSRLRKKAYVQQLE+SR+KLTQ
Sbjct  138   YDRGQSTALVASDSSDRTRDKMDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQ  197

Query  970   leqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAG  791
             LEQELQRARQQGIFISSSGDQ+ SMSGNGA+AFDVEYARWLEE NR+INELR AVNSHAG
Sbjct  198   LEQELQRARQQGIFISSSGDQTHSMSGNGAMAFDVEYARWLEEQNRQINELRSAVNSHAG  257

Query  790   DAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKL  611
             DAELRII+D IMAHY+++F++K  AAKADVFH+LSGMWKTPAERCFLWLGGFRSSELLKL
Sbjct  258   DAELRIIIDGIMAHYDEVFKLKSNAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKL  317

Query  610   LINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAET-LAgslgpsgssGNVA  434
             L+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEALQQSL+ET  +GSLG SGSSGNVA
Sbjct  318   LMNQLEPLTEQQLVGIGNLQQSSQQAEDALSQGMEALQQSLSETLSSGSLGSSGSSGNVA  377

Query  433   NYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             NYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ+ARA L I DYF
Sbjct  378   NYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYF  431



>gb|AHN63210.1| transcription factor TGA2 [Salvia miltiorrhiza f. alba]
Length=460

 Score =   417 bits (1071),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 246/318 (77%), Positives = 269/318 (85%), Gaps = 4/318 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREA  1043
             W    MAD S  T+TSTD D +DKN  F+   +  +  SD  DR+   KTLRRLAQNREA
Sbjct  130   WRESNMADSSSHTETSTDMDPDDKNYKFEIGQSTAVGASDSGDRS---KTLRRLAQNREA  186

Query  1042  ARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVE  863
             ARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFIS+SGDQS S S NGALAFDVE
Sbjct  187   ARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISNSGDQSHSGSANGALAFDVE  246

Query  862   YARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSG  683
             YARW EE N+ +NELR AVNSHA D ELRIIVDS+  H+ D+FR+K  AAKADVFHILSG
Sbjct  247   YARWTEEQNKLVNELRTAVNSHASDTELRIIVDSVTTHFNDVFRLKTNAAKADVFHILSG  306

Query  682   MWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEA  503
             MWKTPAERCF+WLGGFR SELLKLL+NQLEPLTEQQL  I NL++SS QAEDALSQGM+A
Sbjct  307   MWKTPAERCFMWLGGFRPSELLKLLVNQLEPLTEQQLTGIYNLRESSHQAEDALSQGMDA  366

Query  502   LQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             LQQSLAETLA  + GP GSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQMHR
Sbjct  367   LQQSLAETLANGTSGPEGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMHR  426

Query  325   ILTTRQAARAFLGISDYF  272
             +LTTRQ+ARA L I DYF
Sbjct  427   VLTTRQSARAQLLIHDYF  444



>ref|NP_001049945.1| Os03g0318600 [Oryza sativa Japonica Group]
 gb|AAT28674.1| bZIP transcription factor [Oryza sativa Japonica Group]
 gb|ABF95638.1| Transcription factor HBP-1b, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95639.1| Transcription factor HBP-1b, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95640.1| Transcription factor HBP-1b, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95641.1| Transcription factor HBP-1b, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11859.1| Os03g0318600 [Oryza sativa Japonica Group]
 dbj|BAH01240.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75133.1| hypothetical protein OsI_11323 [Oryza sativa Indica Group]
 gb|EEE58954.1| hypothetical protein OsJ_10635 [Oryza sativa Japonica Group]
 gb|AEF30416.1| putative TGA2-like protein 1 [Oryza sativa Japonica Group]
Length=333

 Score =   412 bits (1059),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 248/318 (78%), Positives = 277/318 (87%), Gaps = 7/318 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSD------RTRDQKTLRRLAQNRE  1046
             MAD S RTDTST  DT+DKN    +  +  IV S+ SD      +  DQK LRRLAQNRE
Sbjct  1     MADASSRTDTSTVLDTDDKNQ-MVDGQSGAIVPSNSSDRSDRSDKPMDQKVLRRLAQNRE  59

Query  1045  AARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDV  866
             AARKSRLRKKAYVQQLE+S++KL  LEQE+ +ARQQGI+ISSSGDQ+ +MSGNGA+ FD+
Sbjct  60    AARKSRLRKKAYVQQLESSKLKLASLEQEINKARQQGIYISSSGDQTHAMSGNGAMTFDL  119

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EYARWLEE N++INELR AVN+HA D++LR+IVD IMAHY++IFR+KG AAKADVFHILS
Sbjct  120   EYARWLEEQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFRLKGVAAKADVFHILS  179

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQLL ++NLQQSSQQAEDALSQGME
Sbjct  180   GMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLLGLSNLQQSSQQAEDALSQGME  239

Query  505   ALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             ALQQSLA+TLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTL QM R
Sbjct  240   ALQQSLADTLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLHQMQR  299

Query  325   ILTTRQAARAFLGISDYF  272
             ILT RQAARA L I DYF
Sbjct  300   ILTIRQAARALLAIHDYF  317



>ref|NP_566415.3| transcription factor TGA6 [Arabidopsis thaliana]
 ref|NP_974292.1| transcription factor TGA6 [Arabidopsis thaliana]
 sp|Q39140.2|TGA6_ARATH RecName: Full=Transcription factor TGA6; AltName: Full=bZIP transcription 
factor 45; Short=AtbZIP45 [Arabidopsis thaliana]
 gb|AAG51079.1|AC069472_19 transcription factor HBP-1B-like; 31032-33264 [Arabidopsis thaliana]
 emb|CAC42807.1| transcription factor TGA6 [Arabidopsis thaliana]
 gb|ABL66771.1| At3g12250 [Arabidopsis thaliana]
 dbj|BAH30448.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75172.1| transcription factor TGA6 [Arabidopsis thaliana]
 gb|AEE75173.1| transcription factor TGA6 [Arabidopsis thaliana]
Length=330

 Score =   412 bits (1059),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 238/314 (76%), Positives = 271/314 (86%), Gaps = 4/314 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD S RTD STD DT+ +++G    H +    SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADTSSRTDVSTDGDTDHRDLGSDRGH-MHAAASDSSDRSKDKLDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S  GNGALAFD E++
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHS  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR++NELR A+N+HAGD ELRIIVD +MAHYE++FRIK  AAK DVFH+LSGMW
Sbjct  120   RWLEEKNRQMNELRSALNAHAGDTELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL NQLEP+TE+Q++ IN+LQQ+SQQAEDALSQGME+LQ
Sbjct  180   KTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVMGINSLQQTSQQAEDALSQGMESLQ  239

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SS NVA+YMGQMAMAMG+LGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  240   QSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMLRVLT  299

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L I DY
Sbjct  300   TRQSARALLAIHDY  313



>gb|ABN09201.1| TGA transcription factor 2 [Populus tremula x Populus alba]
Length=332

 Score =   412 bits (1058),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 252/317 (79%), Positives = 281/317 (89%), Gaps = 6/317 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQNREAA  1040
             MA+ SPRTDTSTD   + KN  F+   +  I   D SD+++    DQKTLRRLAQNREAA
Sbjct  1     MAEASPRTDTSTDDTDD-KNQRFERGQSTAISAPDSSDKSKEKTGDQKTLRRLAQNREAA  59

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGALAFD EY
Sbjct  60    RKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHSMSGNGALAFDAEY  119

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             +RWLEE NR I+ELR AVNSHAGD ELR IVD+++AH+ +++R+KG AAKADVFHILSGM
Sbjct  120   SRWLEEQNRHISELRAAVNSHAGDTELRTIVDNVVAHFNEVYRLKGTAAKADVFHILSGM  179

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCF+W+GGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGMEAL
Sbjct  180   WKTPAERCFMWIGGFRSSELLKLLVNQLEPLTEQQLMGIYNLQQSSQQAEDALSQGMEAL  239

Query  499   QQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             QQSLAETLA G+ G SGSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTL+QMHRI
Sbjct  240   QQSLAETLANGNPGSSGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLEQMHRI  299

Query  322   LTTRQAARAFLGISDYF  272
             LTTRQ+ARA L I+DYF
Sbjct  300   LTTRQSARALLAINDYF  316



>gb|KDP29258.1| hypothetical protein JCGZ_16647 [Jatropha curcas]
Length=468

 Score =   417 bits (1071),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 257/322 (80%), Positives = 283/322 (88%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    +AD SPRTDTSTD   E K+  F+   +  +V SD SD+++    DQKTLRRLAQ
Sbjct  132   WGETNVADGSPRTDTSTDDTDE-KHQRFERGQSTAVVASDSSDKSKEKAGDQKTLRRLAQ  190

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS SMSGNGALA
Sbjct  191   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSMSGNGALA  250

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDVEYARWLEE NR+INELR AVNSHAGD ELR IVD+++AH+ +IFR+KG AAKADVFH
Sbjct  251   FDVEYARWLEEPNRQINELRTAVNSHAGDTELRTIVDNVIAHFNEIFRLKGTAAKADVFH  310

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILS MWKTPAERCF+W+GGFRSSELLKLL+NQLEPLTE QL+ I NLQQSSQQAEDALS 
Sbjct  311   ILSDMWKTPAERCFMWIGGFRSSELLKLLVNQLEPLTEPQLMGIYNLQQSSQQAEDALSH  370

Query  514   GMEALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA G+ G SGSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTL+
Sbjct  371   GMEALQQSLAETLASGTPGSSGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLE  430

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I+DYF
Sbjct  431   QMHRILTTRQSARALLAINDYF  452



>ref|XP_009393095.1| PREDICTED: transcription factor HBP-1b(c1)-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009393096.1| PREDICTED: transcription factor HBP-1b(c1)-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009393097.1| PREDICTED: transcription factor HBP-1b(c1)-like [Musa acuminata 
subsp. malaccensis]
Length=332

 Score =   412 bits (1058),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 257/316 (81%), Positives = 280/316 (89%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MADVSPRTDTSTD DT+DK+   +      +  SD SDR++D    QKT+RRLAQNREAA
Sbjct  1     MADVSPRTDTSTDVDTDDKDKRLERGQHAVVAASDSSDRSKDKTLDQKTVRRLAQNREAA  60

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFIS SGDQS +M GNGALAFDVEY
Sbjct  61    RKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISGSGDQSHAMGGNGALAFDVEY  120

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR+INELR AVN+HA + +L +IVD +MA Y++IFR+KG AAKADVFHILSGM
Sbjct  121   ARWLEEHNRQINELRSAVNAHASENDLCVIVDGVMAQYDEIFRLKGIAAKADVFHILSGM  180

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFRSSELLKLL NQLEPLTEQQ++ I NLQQSSQQAEDALSQGMEAL
Sbjct  181   WKTPAERCFLWLGGFRSSELLKLLANQLEPLTEQQMMGICNLQQSSQQAEDALSQGMEAL  240

Query  499   QQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QQSLAETLAGSL PSGSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTLQQMHRIL
Sbjct  241   QQSLAETLAGSLAPSGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLQQMHRIL  300

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I  YF
Sbjct  301   TTRQSARALLAIHGYF  316



>ref|XP_010534337.1| PREDICTED: transcription factor TGA6-like isoform X2 [Tarenaya 
hassleriana]
Length=331

 Score =   412 bits (1058),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 243/316 (77%), Positives = 273/316 (86%), Gaps = 5/316 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD SPRT  STDADT+ ++  F N   L +  SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADTSPRTSISTDADTDHRDQMF-NGGQLVVAASDSSDRSKDKLDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQE Q++RQQGIF+SSSGDQ+ S  GNGA+AFD EY+
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQEFQKSRQQGIFMSSSGDQAHSTGGNGAMAFDAEYS  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RW EE +R +NELR A+N+HA DAELRIIVD++MAHYE++FRIK  AAK DVFH+LSGMW
Sbjct  120   RWQEEKSRHMNELRSALNAHASDAELRIIVDALMAHYEELFRIKSNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKL+ +QLEPLTEQQ + I NLQQSSQQAEDALSQGM+ALQ
Sbjct  180   KTPAERCFLWLGGFRSSELLKLVASQLEPLTEQQSIGIINLQQSSQQAEDALSQGMDALQ  239

Query  496   QSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSLAETL+  +LG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLR Q LQQM RIL
Sbjct  240   QSLAETLSNGTLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRLQMLQQMLRIL  299

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L I +YF
Sbjct  300   TTRQSARALLAIHEYF  315



>gb|KDO44924.1| hypothetical protein CISIN_1g015258mg [Citrus sinensis]
Length=358

 Score =   412 bits (1060),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 251/322 (78%), Positives = 279/322 (87%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MA+ SP    ++  DTEDKN  F+      +  SD SD+++    DQKTLRRLAQ
Sbjct  22    WGESNMAEASP-ITDTSTDDTEDKNQRFERGQLTAVAASDSSDKSKEKSGDQKTLRRLAQ  80

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS SMSGNGA A
Sbjct  81    NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSMSGNGAAA  140

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDVEY+RWLEEHNR I ELR AVNSHAGD ELR IVD++ +H+++IFR+KG A+KADVFH
Sbjct  141   FDVEYSRWLEEHNRHIVELRAAVNSHAGDTELRTIVDNVTSHFDEIFRLKGIASKADVFH  200

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  201   ILSGMWKTPAERCFMWIGGFRSSELLKLLVNQLEPLTEQQLVGIYNLQQSSQQAEDALSQ  260

Query  514   GMEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GM+ALQQSLAETLA  S  PSG+SGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQ
Sbjct  261   GMDALQQSLAETLANGSPSPSGTSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQ  320

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I+DYF
Sbjct  321   QMHRILTTRQSARALLAINDYF  342



>ref|XP_009146627.1| PREDICTED: transcription factor TGA6 isoform X1 [Brassica rapa]
Length=331

 Score =   411 bits (1057),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 238/314 (76%), Positives = 269/314 (86%), Gaps = 3/314 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD S RTD STD DT+ +++G +    +    SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADTSSRTDASTDGDTDPRDLGSERGQMMLAGASDSSDRSKDKLDQKTLRRLAQNREAAR  60

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S  GNGALAFD E++
Sbjct  61    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHS  120

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR +NELR A+N+HAGD ELR IVD +MAHYE++FRIK  AAK DVFH+LSGMW
Sbjct  121   RWLEEKNRLMNELRSALNAHAGDTELRTIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMW  180

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL NQLEP+TE+Q+L IN+LQQ+SQQAEDALSQGME+LQ
Sbjct  181   KTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVLGINSLQQTSQQAEDALSQGMESLQ  240

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLAETL+     S SS NVA+YMGQMAMAMG+LGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  241   QSLAETLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMIRVLT  300

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L I DY
Sbjct  301   TRQSARALLAIHDY  314



>ref|XP_004493401.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Cicer arietinum]
Length=458

 Score =   415 bits (1067),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 251/321 (78%), Positives = 276/321 (86%), Gaps = 15/321 (5%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SP  DTSTD DTEDKN   +          D S+R++D   QKTLRRLAQN
Sbjct  133   WGESNMADGSP--DTSTD-DTEDKNRMLER--------GDSSERSKDKSDQKTLRRLAQN  181

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISS+G+Q+ SMSGNGA+AF
Sbjct  182   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSTGEQTHSMSGNGAMAF  241

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEEHNR+ NELR A+NSHAGD ELR IVD+ M  +EDI+R+KG AAKADVFHI
Sbjct  242   DVEYARWLEEHNRQTNELRAAINSHAGDIELRTIVDNFMTQFEDIYRLKGIAAKADVFHI  301

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCF+W+GGFRSSELLKLL++ LEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  302   LSGMWKTPAERCFMWIGGFRSSELLKLLVSHLEPLTEQQLMGIYNLQQSSQQAEDALSQG  361

Query  511   MEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             M+ALQQSL+ETLA  S  PS SSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQ
Sbjct  362   MDALQQSLSETLANGSPNPSNSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQ  421

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L ISDYF
Sbjct  422   MLRILTTRQSARALLAISDYF  442



>ref|XP_006421095.1| hypothetical protein CICLE_v10005080mg [Citrus clementina]
 ref|XP_006421096.1| hypothetical protein CICLE_v10005080mg [Citrus clementina]
 ref|XP_006421097.1| hypothetical protein CICLE_v10005080mg [Citrus clementina]
 ref|XP_006477494.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
isoform X1 [Citrus sinensis]
 ref|XP_006477495.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
isoform X2 [Citrus sinensis]
 ref|XP_006477496.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
isoform X3 [Citrus sinensis]
 gb|ESR34335.1| hypothetical protein CICLE_v10005080mg [Citrus clementina]
 gb|ESR34336.1| hypothetical protein CICLE_v10005080mg [Citrus clementina]
 gb|ESR34337.1| hypothetical protein CICLE_v10005080mg [Citrus clementina]
 gb|KDO44921.1| hypothetical protein CISIN_1g015258mg [Citrus sinensis]
 gb|KDO44922.1| hypothetical protein CISIN_1g015258mg [Citrus sinensis]
 gb|KDO44923.1| hypothetical protein CISIN_1g015258mg [Citrus sinensis]
Length=410

 Score =   414 bits (1063),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 251/322 (78%), Positives = 279/322 (87%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MA+ SP    ++  DTEDKN  F+      +  SD SD+++    DQKTLRRLAQ
Sbjct  74    WGESNMAEASP-ITDTSTDDTEDKNQRFERGQLTAVAASDSSDKSKEKSGDQKTLRRLAQ  132

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS SMSGNGA A
Sbjct  133   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSMSGNGAAA  192

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDVEY+RWLEEHNR I ELR AVNSHAGD ELR IVD++ +H+++IFR+KG A+KADVFH
Sbjct  193   FDVEYSRWLEEHNRHIVELRAAVNSHAGDTELRTIVDNVTSHFDEIFRLKGIASKADVFH  252

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  253   ILSGMWKTPAERCFMWIGGFRSSELLKLLVNQLEPLTEQQLVGIYNLQQSSQQAEDALSQ  312

Query  514   GMEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GM+ALQQSLAETLA  S  PSG+SGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQ
Sbjct  313   GMDALQQSLAETLANGSPSPSGTSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQ  372

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I+DYF
Sbjct  373   QMHRILTTRQSARALLAINDYF  394



>emb|CDP09569.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   415 bits (1067),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 252/322 (78%), Positives = 275/322 (85%), Gaps = 5/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD S RTDTSTD D EDKN       + G    D SD+++    DQKTLRRLAQ
Sbjct  125   WGESNMADSSSRTDTSTDPDGEDKNQRGDMGQSTGAATYDSSDKSKEKNMDQKTLRRLAQ  184

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISS GDQS   SGNGA+A
Sbjct  185   NREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSMGDQSHGTSGNGAMA  244

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDV+YARWLEEHNR INELR AVN+HAGDA+LR+IVD++ AHY DIFR+KG AAKADVFH
Sbjct  245   FDVDYARWLEEHNRHINELRTAVNAHAGDADLRVIVDNVTAHYNDIFRVKGTAAKADVFH  304

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFR SELLKLL + LEPLTEQQ+  I NLQ+SS QAEDALSQ
Sbjct  305   ILSGMWKTPAERCFMWIGGFRPSELLKLLEHHLEPLTEQQMAGIYNLQESSHQAEDALSQ  364

Query  514   GMEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA  + GP G+SGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQ
Sbjct  365   GMEALQQSLAETLANGASGPEGASGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQ  424

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I+DYF
Sbjct  425   QMHRILTTRQSARALLTINDYF  446



>ref|XP_011075425.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Sesamum 
indicum]
Length=466

 Score =   415 bits (1067),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 245/321 (76%), Positives = 266/321 (83%), Gaps = 5/321 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNH----ALGIVGSDGSDRTRDQKTLRRLAQ  1055
             W    MAD S RTDTSTD D +D+N  F+       A+        D+T DQKTLRRLAQ
Sbjct  131   WGESNMADSSSRTDTSTDVDPDDRNQKFEMGQSAVVAVSDSSDKSKDKTPDQKTLRRLAQ  190

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISS GDQS + S NGALA
Sbjct  191   NREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSMGDQSHAGSANGALA  250

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD EYARWLE+ NR+INELR AVNSHA D EL  IVD++  H+ DIFR+KG AAKADVFH
Sbjct  251   FDAEYARWLEDQNRQINELRAAVNSHASDTELLAIVDNVTTHFSDIFRLKGNAAKADVFH  310

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFR SELLKLL+NQLEPLTEQQL  I NLQQSS QAEDALSQ
Sbjct  311   ILSGMWKTPAERCFMWIGGFRPSELLKLLVNQLEPLTEQQLTGIYNLQQSSHQAEDALSQ  370

Query  514   GMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             GM+ALQQSLAETLA S G  GS+ NV NYMGQMAMAMGKLGTL+GF+RQADNLRQQTLQQ
Sbjct  371   GMDALQQSLAETLA-SGGSEGSAANVGNYMGQMAMAMGKLGTLDGFLRQADNLRQQTLQQ  429

Query  334   MHRILTTRQAARAFLGISDYF  272
             MHRILTTRQ+ARA L I DYF
Sbjct  430   MHRILTTRQSARALLLIHDYF  450



>emb|CDY08443.1| BnaA05g26790D [Brassica napus]
Length=331

 Score =   410 bits (1053),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 239/314 (76%), Positives = 269/314 (86%), Gaps = 3/314 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD S RTD STD DT+ +++G +    +    SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADTSSRTDASTDGDTDPRDLGSERGQMMLAGASDSSDRSKDKLDQKTLRRLAQNREAAR  60

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S SGNGALAFD E++
Sbjct  61    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTSGNGALAFDAEHS  120

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR +NELR A+N+HAGD ELR IVD  MAHYE++FRIK  AAK DVFH+LSGMW
Sbjct  121   RWLEEKNRLMNELRSALNAHAGDTELRTIVDGAMAHYEELFRIKSNAAKNDVFHLLSGMW  180

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL NQLEP+TE+Q+L IN+LQQ+SQQAEDALSQGME+LQ
Sbjct  181   KTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVLGINSLQQTSQQAEDALSQGMESLQ  240

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLAETL+     S SS NVA+YMGQMAMAMG+LGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  241   QSLAETLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMIRVLT  300

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L I DY
Sbjct  301   TRQSARALLAIHDY  314



>ref|XP_002323247.1| DNA-binding protein VBP1 [Populus trichocarpa]
 gb|EEF05008.1| DNA-binding protein VBP1 [Populus trichocarpa]
Length=463

 Score =   414 bits (1065),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 254/322 (79%), Positives = 283/322 (88%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MA+ SPRTDTSTD   + KN  F+   +  IV SD SD+++    DQKTLRRLAQ
Sbjct  127   WGETSMAEASPRTDTSTDDTDD-KNQRFERGQSTAIVASDSSDKSKEKAGDQKTLRRLAQ  185

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGALA
Sbjct  186   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHSMSGNGALA  245

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD EY+RWLEE NR I+ELR AVNSHAGD EL  IVD+++AH+ +++R+KG AAKADVFH
Sbjct  246   FDAEYSRWLEEQNRHISELRAAVNSHAGDTELHTIVDNVVAHFNEVYRLKGTAAKADVFH  305

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  306   ILSGMWKTPAERCFMWIGGFRSSELLKLLVNQLEPLTEQQLMGIYNLQQSSQQAEDALSQ  365

Query  514   GMEALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA G+ G SGSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTL+
Sbjct  366   GMEALQQSLAETLANGNPGSSGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLE  425

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I+DYF
Sbjct  426   QMHRILTTRQSARALLAINDYF  447



>gb|ACV53508.1| leucine zipper transcription factor TGA [Capsicum annuum]
Length=445

 Score =   414 bits (1063),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 231/322 (72%), Positives = 268/322 (83%), Gaps = 5/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    +AD   RTDTSTD D +D+N   +   +  I  SD SD+++    DQKTLRRLAQ
Sbjct  107   WGESNLADSGSRTDTSTDMDGDDRNQRIETGQSRTIAASDSSDKSKEKVLDQKTLRRLAQ  166

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLENSR+KL+QLEQ+LQRARQQG +IS+ GDQS  +  +G LA
Sbjct  167   NREAARKSRLRKKAYVQQLENSRLKLSQLEQDLQRARQQGKYISNMGDQSNGVGASGTLA  226

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD EY+RWLEEHN+ INELR AVNSHA D ELR IV+++ AH++++FR+KG AAKADVFH
Sbjct  227   FDAEYSRWLEEHNKHINELRNAVNSHASDPELRSIVNNVTAHFDEVFRVKGNAAKADVFH  286

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             +LSGMWKTPAERCF+W+GGFR SELLKLL+ +LEPLTEQQL  I NLQQSS QAEDALSQ
Sbjct  287   VLSGMWKTPAERCFMWIGGFRPSELLKLLVTRLEPLTEQQLAGIYNLQQSSHQAEDALSQ  346

Query  514   GMEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GME LQQSLAETLA  S    GSSG+VANYMGQMAMAMGKLGTL+GF+RQAD+LRQQTLQ
Sbjct  347   GMEQLQQSLAETLANGSPATEGSSGDVANYMGQMAMAMGKLGTLDGFLRQADSLRQQTLQ  406

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I++YF
Sbjct  407   QMHRILTTRQSARALLAINEYF  428



>ref|XP_011000426.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Populus 
euphratica]
Length=463

 Score =   414 bits (1064),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 255/322 (79%), Positives = 284/322 (88%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MA+ SPRTDTSTD   + KN  F+   +  IV SD SD+++    DQKTLRRLAQ
Sbjct  127   WGETSMAEASPRTDTSTDDTDD-KNRRFERGQSTAIVASDSSDKSKEKAGDQKTLRRLAQ  185

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ SMSGNGALA
Sbjct  186   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQTHSMSGNGALA  245

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD EY+RWLEE NR I+ELR AVNSHAGDAELR IVD+++AH+ +++R+KG AAKADVFH
Sbjct  246   FDAEYSRWLEEQNRHISELRAAVNSHAGDAELRTIVDNVVAHFNEVYRLKGTAAKADVFH  305

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFRSSELLKLL+NQLEPLTEQQ + I NLQQSSQQAEDALSQ
Sbjct  306   ILSGMWKTPAERCFMWIGGFRSSELLKLLMNQLEPLTEQQQMGICNLQQSSQQAEDALSQ  365

Query  514   GMEALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA G+ G SGSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTL+
Sbjct  366   GMEALQQSLAETLANGNPGSSGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLE  425

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I+DYF
Sbjct  426   QMHRILTTRQSARALLAINDYF  447



>ref|XP_008658211.1| PREDICTED: uncharacterized protein LOC100217305 isoform X2 [Zea 
mays]
 gb|ACL54053.1| unknown [Zea mays]
 gb|ADX60127.1| bZIP transcription factor [Zea mays]
 gb|AFW88530.1| putative bZIP transcription factor superfamily protein [Zea mays]
Length=335

 Score =   409 bits (1052),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 245/319 (77%), Positives = 274/319 (86%), Gaps = 7/319 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSD-------RTRDQKTLRRLAQNR  1049
             MAD S RTDTST  D +DKN   +N  +  +V +  S        +  DQK LRRLAQNR
Sbjct  1     MADASSRTDTSTVVDMDDKNQRLENGQSGAMVPASNSSDRSDRSDKPMDQKVLRRLAQNR  60

Query  1048  EAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFD  869
             EAARKSRLRKKAYVQQLE+S++KL  LEQELQ+ARQQGIFISSSGDQ+ +MSGNGA+ FD
Sbjct  61    EAARKSRLRKKAYVQQLESSKLKLASLEQELQKARQQGIFISSSGDQTHTMSGNGAMTFD  120

Query  868   VEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHIL  689
             +EY+RW EE N++INELR AVN+HA D++LR+IVD IMAHY++IFR+KG AAKADVFHIL
Sbjct  121   LEYSRWQEEQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFRLKGIAAKADVFHIL  180

Query  688   SGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGM  509
             SGMWKT AERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ ++NLQQSSQQAEDALSQGM
Sbjct  181   SGMWKTSAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGLSNLQQSSQQAEDALSQGM  240

Query  508   EALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMH  329
             EALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTL QM 
Sbjct  241   EALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLHQMQ  300

Query  328   RILTTRQAARAFLGISDYF  272
             RILT RQAARA L I DYF
Sbjct  301   RILTIRQAARALLAIHDYF  319



>dbj|BAB72064.1| bZIP transcription factor [Oryza sativa]
Length=332

 Score =   409 bits (1051),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 251/316 (79%), Positives = 276/316 (87%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQ---KTLRRLAQNREAAR  1037
             MAD SPRTDTSTD DT+++N  F+         SD SDR++D+   KTLRRLAQNREAAR
Sbjct  1     MADTSPRTDTSTDPDTDERNQMFEQGQLAAPTASDSSDRSKDKLDHKTLRRLAQNREAAR  60

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAY+Q LE+SR+KLTQ+EQELQRARQQGIFIS+S DQS S SGNGALAFD+EYA
Sbjct  61    KSRLRKKAYIQNLESSRLKLTQIEQELQRARQQGIFISTSSDQSHSASGNGALAFDMEYA  120

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEEHN+ INELR AVN+HAGD +L+  VDSIMAHY +IF++KG AAKADVFH+LSGMW
Sbjct  121   RWLEEHNKHINELRAAVNAHAGDNDLKSTVDSIMAHYNEIFKLKGVAAKADVFHVLSGMW  180

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCF+WLGGFRSSELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALSQGMEALQ
Sbjct  181   KTPAERCFMWLGGFRSSELLKLLAGQLEPLTEQQLAGIANLQQSSQQAEDALSQGMEALQ  240

Query  496   QSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSLAETLA  SLGP+GSSGNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQM RIL
Sbjct  241   QSLAETLASGSLGPAGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQMQRIL  300

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L ISDYF
Sbjct  301   TTRQSARALLAISDYF  316



>ref|XP_009135220.1| PREDICTED: transcription factor TGA6-like [Brassica rapa]
 emb|CDX73830.1| BnaA03g32170D [Brassica napus]
Length=331

 Score =   409 bits (1051),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 233/314 (74%), Positives = 272/314 (87%), Gaps = 3/314 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD S RTD STD DT+ ++MG +    +  V SD S R++D   QKT+RRLAQNREAAR
Sbjct  1     MADTSSRTDASTDGDTDPRDMGSERGQGMLAVASDSSGRSKDKLDQKTVRRLAQNREAAR  60

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S  GNGALAFD E++
Sbjct  61    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHS  120

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N+++NELR A+N+HAGD ELRIIV+ +M+HYE++FRIK  AAK DVFH+LSGMW
Sbjct  121   RWLEEKNKQMNELRSALNAHAGDTELRIIVEGVMSHYEELFRIKSNAAKNDVFHLLSGMW  180

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKL+ NQLEP+TE+Q++ +N+LQQ+SQQAEDALSQGME+LQ
Sbjct  181   KTPAERCFLWLGGFRSSELLKLIANQLEPMTERQVMGLNSLQQTSQQAEDALSQGMESLQ  240

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SS NVA+YMGQMAMAMG+LGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  241   QSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMIRVLT  300

Query  316   TRQAARAFLGISDY  275
             TRQ+ARAFL I DY
Sbjct  301   TRQSARAFLAIHDY  314



>dbj|BAO45899.1| basic leucine zipper protein [Acacia mangium]
Length=450

 Score =   413 bits (1062),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 252/321 (79%), Positives = 276/321 (86%), Gaps = 5/321 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD ++  DT+DKN   +    L +  SD S+R++D   QKTLRRLAQN
Sbjct  115   WGESNMADGSPRTDDTSTDDTDDKNQRSERGQ-LVVGASDSSERSKDKSDQKTLRRLAQN  173

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISS GDQS SMSGNGA+ F
Sbjct  174   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSMGDQSHSMSGNGAMTF  233

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             DVEYARWLEEHNR+INELR AVNSHAGD ELR IVD++M+HYE+IFR+KG AAKADVFHI
Sbjct  234   DVEYARWLEEHNRQINELRAAVNSHAGDIELRTIVDNVMSHYEEIFRLKGVAAKADVFHI  293

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCF+W+GGFRSSELLKLL N LEPLTEQQL+ I +LQQSSQQAEDALSQG
Sbjct  294   LSGMWKTPAERCFMWIGGFRSSELLKLLGNHLEPLTEQQLMNIYSLQQSSQQAEDALSQG  353

Query  511   MEALQQSLAETLAgslgpsg-ssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             M+ALQQSLAETLA         SGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQ
Sbjct  354   MDALQQSLAETLANESSTPSGPSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQ  413

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L ISDYF
Sbjct  414   MLRILTTRQSARALLAISDYF  434



>dbj|BAB72061.1| bZIP transcription factor [Oryza sativa]
Length=333

 Score =   409 bits (1050),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 247/318 (78%), Positives = 276/318 (87%), Gaps = 7/318 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSD------RTRDQKTLRRLAQNRE  1046
             MAD S RTDTST  DT+DKN    +  +  IV S+ SD      +  DQK LRRLAQNRE
Sbjct  1     MADASSRTDTSTVLDTDDKNQ-MVDGQSGAIVPSNSSDRSDRSDKPMDQKVLRRLAQNRE  59

Query  1045  AARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDV  866
             AARKSRLRKKAYVQQLE+S++KL  LEQE+ +ARQQGI+ISSSGDQ+ +MSGNGA+ FD+
Sbjct  60    AARKSRLRKKAYVQQLESSKLKLASLEQEINKARQQGIYISSSGDQTHAMSGNGAMTFDL  119

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EYARWLEE N++INELR AVN+HA D++LR+IVD IMAHY++IFR+KG AAKADVFHILS
Sbjct  120   EYARWLEEQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFRLKGVAAKADVFHILS  179

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQLL ++NLQQSSQQAEDALSQGME
Sbjct  180   GMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLLGLSNLQQSSQQAEDALSQGME  239

Query  505   ALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             ALQQSLA TLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLE F+RQAD+LRQQTL QM R
Sbjct  240   ALQQSLAGTLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLENFLRQADSLRQQTLHQMQR  299

Query  325   ILTTRQAARAFLGISDYF  272
             ILT RQAARA L I DYF
Sbjct  300   ILTIRQAARALLAIHDYF  317



>dbj|BAJ94197.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score =   414 bits (1064),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 247/323 (76%), Positives = 273/323 (85%), Gaps = 6/323 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTE--DKNMGFQNNHALGIVGSDGSDRTRDQ---KTLRRLA  1058
             W    MAD SPRTDTSTD D +  ++N  F+         SD SD++RD+   K+LRRLA
Sbjct  137   WGESSMADTSPRTDTSTDPDIDIDERNQMFEQGQLAAPTASDSSDKSRDKLDHKSLRRLA  196

Query  1057  QNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGAL  878
             QNREAARKSRLRKKAY+Q LE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ S  GNGA+
Sbjct  197   QNREAARKSRLRKKAYIQNLESSRLKLTQLEQELQRARQQGIFISSSGDQAHSAGGNGAV  256

Query  877   AFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVF  698
             AFD+EYARWLEEHN+ INELR A N+HAGD +LR IVDSIMA Y++ FR+KG AAKADVF
Sbjct  257   AFDMEYARWLEEHNKHINELRAAANAHAGDDDLRSIVDSIMAQYDEFFRLKGVAAKADVF  316

Query  697   HILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALS  518
             H+LSGMWKTPAERCF+WLGGFRSSELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALS
Sbjct  317   HVLSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTEQQLTGICNLQQSSQQAEDALS  376

Query  517   QGMEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTL  341
             QGMEALQQSLAETLA    GP+GSSGNVA+YMGQMAMAMGKLGTLE F+RQADNLR QTL
Sbjct  377   QGMEALQQSLAETLASGSLGPAGSSGNVASYMGQMAMAMGKLGTLENFLRQADNLRLQTL  436

Query  340   QQMHRILTTRQAARAFLGISDYF  272
             QQM RILTTRQ+ARA L ISDYF
Sbjct  437   QQMQRILTTRQSARALLAISDYF  459



>ref|XP_006644874.1| PREDICTED: transcription factor HBP-1b(c1)-like [Oryza brachyantha]
Length=354

 Score =   409 bits (1051),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 254/321 (79%), Positives = 279/321 (87%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQ---KTLRRLAQN  1052
             W    MAD SPRTDTSTD DT+++N  F+         SD SDR++D+   KTLRRLAQN
Sbjct  18    WGESTMADTSPRTDTSTDPDTDERNQMFEQGQLAAPTASDSSDRSKDKLDHKTLRRLAQN  77

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAY+Q LE SR+KLTQLEQELQRARQQGIFIS++GDQS S+SGNGALAF
Sbjct  78    REAARKSRLRKKAYIQNLETSRLKLTQLEQELQRARQQGIFISTTGDQSHSVSGNGALAF  137

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D+EYARWLEEHN+ INELR AVNSHA D +LR IVD+IMAHY++IF++KG AAKADVFH+
Sbjct  138   DMEYARWLEEHNKHINELRAAVNSHASDNDLRSIVDNIMAHYDEIFKLKGVAAKADVFHV  197

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCF+WLGGFRSSELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALSQG
Sbjct  198   LSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTEQQLAGIANLQQSSQQAEDALSQG  257

Query  511   MEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETLA  SLGP+GSSGNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQ
Sbjct  258   MEALQQSLAETLASGSLGPAGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQ  317

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L ISDYF
Sbjct  318   MQRILTTRQSARALLAISDYF  338



>sp|Q41558.2|HBP1C_WHEAT RecName: Full=Transcription factor HBP-1b(c1), partial [Triticum 
aestivum]
 dbj|BAA02305.2| transcription factor HBP-1b(c1) [Triticum aestivum]
Length=476

 Score =   414 bits (1063),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 249/323 (77%), Positives = 275/323 (85%), Gaps = 6/323 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTE--DKNMGFQNNHALGIVGSDGSDRTRDQ---KTLRRLA  1058
             W    MAD SPRTDTSTD D +  ++N  F+         SD SD++RD+   K+LRRLA
Sbjct  138   WGESSMADTSPRTDTSTDPDIDIDERNQMFEQGQLAAPTASDSSDKSRDKLDHKSLRRLA  197

Query  1057  QNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGAL  878
             QNREAARKSRLRKKAY+Q LE+SR+KLTQLEQELQRARQQGIFISSSGDQSQS SGNGA+
Sbjct  198   QNREAARKSRLRKKAYIQNLESSRLKLTQLEQELQRARQQGIFISSSGDQSQSASGNGAV  257

Query  877   AFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVF  698
             AFD+EYARWLEEHN+ INELR A N+HAGD +LR IVDSIM+ Y++ FR+KG AAKADVF
Sbjct  258   AFDMEYARWLEEHNKHINELRAAANAHAGDDDLRKIVDSIMSQYDEFFRLKGVAAKADVF  317

Query  697   HILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALS  518
             H+LSGMWKTPAERCF+WLGGFRSSELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALS
Sbjct  318   HVLSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTEQQLTGICNLQQSSQQAEDALS  377

Query  517   QGMEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTL  341
             QGMEALQQSLAETLA    GP+GSSGNVA+YMGQMAMAMGKLGTLE F+RQADNLR QTL
Sbjct  378   QGMEALQQSLAETLASGSLGPAGSSGNVASYMGQMAMAMGKLGTLENFLRQADNLRLQTL  437

Query  340   QQMHRILTTRQAARAFLGISDYF  272
             QQM RILTTRQ+ARA L ISDYF
Sbjct  438   QQMQRILTTRQSARALLAISDYF  460



>gb|AEF30410.1| putative TGA2-like protein 2 [Oryza sativa Japonica Group]
Length=332

 Score =   408 bits (1049),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 250/316 (79%), Positives = 274/316 (87%), Gaps = 4/316 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQ---KTLRRLAQNREAAR  1037
             MAD SPRTDTSTD DT+++N  F+         SD SDR++D+   KTLRRLAQNREAAR
Sbjct  1     MADTSPRTDTSTDPDTDERNQMFEQGQLAAPTASDSSDRSKDKLDHKTLRRLAQNREAAR  60

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAY+Q LE+SR+KLTQ+EQELQRARQQGIFIS+S DQS S SGN ALAFD+EYA
Sbjct  61    KSRLRKKAYIQNLESSRLKLTQIEQELQRARQQGIFISTSSDQSHSASGNRALAFDMEYA  120

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEEHN+ INELR AVN+HAGD +L   VDSIMAHY +IF++KG AAKADVFH+LSGMW
Sbjct  121   RWLEEHNKHINELRAAVNAHAGDNDLESTVDSIMAHYNEIFKLKGVAAKADVFHVLSGMW  180

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCF+WLGGFRSSELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALSQGMEALQ
Sbjct  181   KTPAERCFMWLGGFRSSELLKLLAGQLEPLTEQQLAGIANLQQSSQQAEDALSQGMEALQ  240

Query  496   QSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QSLAETLA  SLGP+GSSGNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQM RIL
Sbjct  241   QSLAETLASGSLGPAGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQMQRIL  300

Query  319   TTRQAARAFLGISDYF  272
             TTRQ+ARA L ISDYF
Sbjct  301   TTRQSARALLAISDYF  316



>emb|CDM84630.1| unnamed protein product [Triticum aestivum]
Length=477

 Score =   413 bits (1062),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 249/323 (77%), Positives = 275/323 (85%), Gaps = 6/323 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTE--DKNMGFQNNHALGIVGSDGSDRTRDQ---KTLRRLA  1058
             W    MAD SPRTDTSTD D +  ++N  F+         SD SD++RD+   K+LRRLA
Sbjct  139   WGESSMADTSPRTDTSTDPDIDIDERNQMFEQGQLAAPTASDSSDKSRDKLDHKSLRRLA  198

Query  1057  QNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGAL  878
             QNREAARKSRLRKKAY+Q LE+SR+KLTQLEQELQRARQQGIFISSSGDQSQS SGNGA+
Sbjct  199   QNREAARKSRLRKKAYIQNLESSRLKLTQLEQELQRARQQGIFISSSGDQSQSASGNGAV  258

Query  877   AFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVF  698
             AFD+EYARWLEEHN+ INELR A N+HAGD +LR IVDSIM+ Y++ FR+KG AAKADVF
Sbjct  259   AFDMEYARWLEEHNKHINELRAAANAHAGDDDLRKIVDSIMSQYDEFFRLKGVAAKADVF  318

Query  697   HILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALS  518
             H+LSGMWKTPAERCF+WLGGFRSSELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALS
Sbjct  319   HVLSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTEQQLTGICNLQQSSQQAEDALS  378

Query  517   QGMEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTL  341
             QGMEALQQSLAETLA    GP+GSSGNVA+YMGQMAMAMGKLGTLE F+RQADNLR QTL
Sbjct  379   QGMEALQQSLAETLASGSLGPAGSSGNVASYMGQMAMAMGKLGTLENFLRQADNLRLQTL  438

Query  340   QQMHRILTTRQAARAFLGISDYF  272
             QQM RILTTRQ+ARA L ISDYF
Sbjct  439   QQMQRILTTRQSARALLAISDYF  461



>ref|XP_009759888.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1 
[Nicotiana sylvestris]
 sp|O24160.1|TGA21_TOBAC RecName: Full=TGACG-sequence-specific DNA-binding protein TGA-2.1; 
Short=TGA2.1 [Nicotiana tabacum]
 gb|AAB68661.1| leucine zipper transcription factor TGA2.1 [Nicotiana tabacum]
Length=456

 Score =   412 bits (1060),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 241/357 (68%), Positives = 280/357 (78%), Gaps = 11/357 (3%)
 Frame = -1

Query  1324  LQRRVAGENSSFVLYKEHTVMQILI*SYIWKIGI----W*YPMMADVSPRTDTSTDADTE  1157
             + R +A  N+S       +   +L  + +   G     W    MAD   RTDTSTD D +
Sbjct  86    INRTLAPSNTSLPTATPRSQTMLLQSNLVSASGTHHENWGESNMADSGSRTDTSTDMDGD  145

Query  1156  DKNMGFQNNHALGIVGSDGS-DRTRDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMK  980
             DKN   +   +     SD S ++  DQKTLRRLAQNREAARKSRLRKKAYVQQLENSR+K
Sbjct  146   DKNQLIEAGQS-----SDKSKEKVLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLK  200

Query  979   LTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNS  800
             L+QLEQ+LQRARQQG +IS+  DQS  +  NG LAFD EY+RWLEEHN+ INELR AVN+
Sbjct  201   LSQLEQDLQRARQQGKYISNIADQSNGVGANGPLAFDAEYSRWLEEHNKHINELRTAVNA  260

Query  799   HAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSEL  620
             HA D ELR IV+++ AH++++FR+KG AAKADVFH+LSGMWKTPAERCF+W+GGFR SEL
Sbjct  261   HASDPELRSIVNNVTAHFDEVFRVKGNAAKADVFHVLSGMWKTPAERCFMWIGGFRPSEL  320

Query  619   LKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAg-slgpsgssG  443
             LKLL+NQLEPLTEQQL  I NLQQSS QAEDALSQGMEALQQSLAETLA  S  P GSSG
Sbjct  321   LKLLVNQLEPLTEQQLAGIYNLQQSSHQAEDALSQGMEALQQSLAETLANGSPAPEGSSG  380

Query  442   NVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             +VANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQMHR+LTTRQ+ARA L I++YF
Sbjct  381   DVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMHRVLTTRQSARALLAINEYF  437



>ref|XP_004967673.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Setaria 
italica]
Length=330

 Score =   408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 251/315 (80%), Positives = 272/315 (86%), Gaps = 6/315 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MADVSPRT+TSTD      N G +      +  SD SDR++D    QKTLRRLAQNREAA
Sbjct  1     MADVSPRTETSTDDTD--DNHGLEPGPGALVAASDSSDRSKDKHEDQKTLRRLAQNREAA  58

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSS DQS SMSGNGALAFD+EY
Sbjct  59    RKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSVDQSHSMSGNGALAFDMEY  118

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR+I+ELR  V +HA D++LR +VD IM+HY++IFR+KG AAKADVFH+LSGM
Sbjct  119   ARWLEEHNRQISELRAGVTAHASDSDLRSVVDKIMSHYDEIFRLKGNAAKADVFHVLSGM  178

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFR SE+LKLL  QLEPLTEQQL  I NLQQSSQQAEDALSQGMEAL
Sbjct  179   WKTPAERCFLWLGGFRPSEVLKLLSTQLEPLTEQQLSGIGNLQQSSQQAEDALSQGMEAL  238

Query  499   QQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QQSLAETLAGSL  SGS+GNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQM RIL
Sbjct  239   QQSLAETLAGSLSSSGSTGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQMQRIL  298

Query  319   TTRQAARAFLGISDY  275
             TTRQAARA L ISDY
Sbjct  299   TTRQAARALLVISDY  313



>ref|XP_010464983.1| PREDICTED: transcription factor TGA6 isoform X2 [Camelina sativa]
 ref|XP_010464985.1| PREDICTED: transcription factor TGA6 isoform X2 [Camelina sativa]
 ref|XP_010486919.1| PREDICTED: transcription factor TGA6 isoform X1 [Camelina sativa]
 ref|XP_010486920.1| PREDICTED: transcription factor TGA6 isoform X1 [Camelina sativa]
Length=331

 Score =   408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 234/314 (75%), Positives = 269/314 (86%), Gaps = 3/314 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD S RTD STD DT+ ++ G +    +    SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADTSSRTDVSTDGDTDHRDQGSERGQMMLAAASDSSDRSKDKLDQKTLRRLAQNREAAR  60

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S  GNGALAFD E++
Sbjct  61    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHS  120

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N+++NELR A+N+HAGD ELR IVD +MAHYE++FRIK  AAK DVFH+LSGMW
Sbjct  121   RWLEEKNKQMNELRSALNAHAGDTELRTIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMW  180

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL NQLEP+TE+Q++ +N+LQQ+SQQAEDALSQGME+LQ
Sbjct  181   KTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVMGLNSLQQTSQQAEDALSQGMESLQ  240

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SS NVA+YMGQMAMAMG+LGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  241   QSLADTLSSGTLGSTSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMLRVLT  300

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L I DY
Sbjct  301   TRQSARALLAIHDY  314



>ref|XP_004958749.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X4 [Setaria 
italica]
Length=334

 Score =   408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 248/318 (78%), Positives = 272/318 (86%), Gaps = 6/318 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSD------RTRDQKTLRRLAQNRE  1046
             MAD S RTDTST  D  DKN   +N   +    S+ SD      +  DQKTLRRLAQNRE
Sbjct  1     MADASSRTDTSTVLDDNDKNQRMENGQIMAAAPSNSSDRSDRSDKPLDQKTLRRLAQNRE  60

Query  1045  AARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDV  866
             AARKSRLRKKAYVQQLE+S++KL QLEQELQ+ARQQGIFISSSGDQ+ +MSGNGAL FD+
Sbjct  61    AARKSRLRKKAYVQQLESSKLKLAQLEQELQKARQQGIFISSSGDQTHAMSGNGALTFDI  120

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EY RWLEE N++INELR AVN+HA D++LR+IVD IMAHY++IF++KG AAKADVFHILS
Sbjct  121   EYTRWLEEQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFKVKGVAAKADVFHILS  180

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCFLWLGGFR SELLKLL N LEPLTEQQLL + NLQQSSQQAEDALSQGME
Sbjct  181   GMWKTPAERCFLWLGGFRPSELLKLLANHLEPLTEQQLLGLTNLQQSSQQAEDALSQGME  240

Query  505   ALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             ALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTL QM R
Sbjct  241   ALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLHQMQR  300

Query  325   ILTTRQAARAFLGISDYF  272
             ILT RQA+RA L I DYF
Sbjct  301   ILTIRQASRALLAIHDYF  318



>ref|NP_001042751.1| Os01g0279900 [Oryza sativa Japonica Group]
 dbj|BAB72063.1| bZIP transcription factor [Oryza sativa]
 dbj|BAF04665.1| Os01g0279900 [Oryza sativa Japonica Group]
 dbj|BAH01331.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEF30411.1| putative TGA2-like protein 3 [Oryza sativa Japonica Group]
 gb|AIR77177.1| histone-binding protein [Oryza sativa Indica Group]
Length=329

 Score =   407 bits (1047),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 254/315 (81%), Positives = 275/315 (87%), Gaps = 7/315 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MAD+SPRTDTSTD   ++  +       L +  +  SDR++D    QKTLRRLAQNREAA
Sbjct  1     MADMSPRTDTSTDDTDDNHML---EPGQLALAAASDSDRSKDKHEDQKTLRRLAQNREAA  57

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSS DQ+ SMSGNGALAFD+EY
Sbjct  58    RKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSVDQTHSMSGNGALAFDMEY  117

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR+INELR AVN+HAGD ELR +VD IM+HYE+IF+ KG AAKADVFH+LSGM
Sbjct  118   ARWLEEHNRQINELRSAVNAHAGDNELRGVVDKIMSHYEEIFKQKGNAAKADVFHVLSGM  177

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFR SELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALSQGMEAL
Sbjct  178   WKTPAERCFLWLGGFRPSELLKLLSTQLEPLTEQQLSGIANLQQSSQQAEDALSQGMEAL  237

Query  499   QQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QQSLAETLAGSLG SGS+GNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTLQQM RIL
Sbjct  238   QQSLAETLAGSLGSSGSTGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLQQMQRIL  297

Query  319   TTRQAARAFLGISDY  275
             TTRQ+ARA L ISDY
Sbjct  298   TTRQSARALLVISDY  312



>ref|XP_010534328.1| PREDICTED: transcription factor TGA6-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010534329.1| PREDICTED: transcription factor TGA6-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010534330.1| PREDICTED: transcription factor TGA6-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010534331.1| PREDICTED: transcription factor TGA6-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010534332.1| PREDICTED: transcription factor TGA6-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010534333.1| PREDICTED: transcription factor TGA6-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010534334.1| PREDICTED: transcription factor TGA6-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010534335.1| PREDICTED: transcription factor TGA6-like isoform X1 [Tarenaya 
hassleriana]
Length=333

 Score =   408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 241/318 (76%), Positives = 273/318 (86%), Gaps = 7/318 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQ-----KTLRRLAQNREA  1043
             MAD SPRT  STDADT+ ++  F N   L +  SD SDR++D+     +TLRRLAQNREA
Sbjct  1     MADTSPRTSISTDADTDHRDQMF-NGGQLVVAASDSSDRSKDKLDQKPQTLRRLAQNREA  59

Query  1042  ARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVE  863
             ARKSRLRKKAYVQQLENSR+KLTQLEQE Q++RQQGIF+SSSGDQ+ S  GNGA+AFD E
Sbjct  60    ARKSRLRKKAYVQQLENSRLKLTQLEQEFQKSRQQGIFMSSSGDQAHSTGGNGAMAFDAE  119

Query  862   YARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSG  683
             Y+RW EE +R +NELR A+N+HA DAELRIIVD++MAHYE++FRIK  AAK DVFH+LSG
Sbjct  120   YSRWQEEKSRHMNELRSALNAHASDAELRIIVDALMAHYEELFRIKSNAAKNDVFHLLSG  179

Query  682   MWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEA  503
             MWKTPAERCFLWLGGFRSSELLKL+ +QLEPLTEQQ + I NLQQSSQQAEDALSQGM+A
Sbjct  180   MWKTPAERCFLWLGGFRSSELLKLVASQLEPLTEQQSIGIINLQQSSQQAEDALSQGMDA  239

Query  502   LQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             LQQSLAETL+  +LG SGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLR Q LQQM R
Sbjct  240   LQQSLAETLSNGTLGSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRLQMLQQMLR  299

Query  325   ILTTRQAARAFLGISDYF  272
             ILTTRQ+ARA L I +YF
Sbjct  300   ILTTRQSARALLAIHEYF  317



>ref|XP_007028142.1| Transcription factor HBP-1b(c1) isoform 8 [Theobroma cacao]
 gb|EOY08644.1| Transcription factor HBP-1b(c1) isoform 8 [Theobroma cacao]
Length=306

 Score =   407 bits (1045),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 241/273 (88%), Positives = 259/273 (95%), Gaps = 1/273 (0%)
 Frame = -1

Query  1087  RDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdq  908
             ++Q+TLRRLAQNREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ
Sbjct  18    KNQRTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQ  77

Query  907   sqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRI  728
             S SMSGNGALAFDVEYARWLEEHNR+INELR AVNSHAGD ELR IVD++ AH++DIFR+
Sbjct  78    SHSMSGNGALAFDVEYARWLEEHNRQINELRAAVNSHAGDTELRTIVDNVTAHFDDIFRL  137

Query  727   KGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQ  548
             KG AAKADVFH+LSGMWKTPAERCFLW+GGFRSSELLKLL NQLEPLTEQQ + I+NLQQ
Sbjct  138   KGIAAKADVFHVLSGMWKTPAERCFLWIGGFRSSELLKLLANQLEPLTEQQFMGIHNLQQ  197

Query  547   SSQQAEDALSQGMEALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIR  371
             SSQQAEDALSQGMEALQQSLAETL  GS GPSGSSGNVANYMGQMAMAMGKLGTLEGF+R
Sbjct  198   SSQQAEDALSQGMEALQQSLAETLTNGSPGPSGSSGNVANYMGQMAMAMGKLGTLEGFVR  257

Query  370   QADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             QADNLRQQTLQQMHRILTTRQ+ARA L I+DYF
Sbjct  258   QADNLRQQTLQQMHRILTTRQSARALLAINDYF  290



>ref|NP_001141940.1| putative bZIP transcription factor superfamily protein [Zea mays]
 ref|XP_008668195.1| PREDICTED: putative bZIP transcription factor superfamily protein 
isoform X1 [Zea mays]
 ref|XP_008668203.1| PREDICTED: putative bZIP transcription factor superfamily protein 
isoform X1 [Zea mays]
 gb|ACN33749.1| unknown [Zea mays]
 tpg|DAA45089.1| TPA: putative bZIP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05296.1| bZIP transcription factor, partial [Zea mays]
Length=335

 Score =   408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 247/319 (77%), Positives = 276/319 (87%), Gaps = 7/319 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIV-------GSDGSDRTRDQKTLRRLAQNR  1049
             MAD S RTDTST  D +DKN   +N  +  +         SD SD+  DQK LRRLAQNR
Sbjct  1     MADASSRTDTSTVLDMDDKNQRLENGQSGAMALASNSSDRSDRSDKPMDQKVLRRLAQNR  60

Query  1048  EAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFD  869
             EAARKSRLRKKAYVQQLE+S++KL  LEQELQ+ARQQGIFISSSGDQ+ +MSGNGA+ FD
Sbjct  61    EAARKSRLRKKAYVQQLESSKLKLASLEQELQKARQQGIFISSSGDQTHAMSGNGAMTFD  120

Query  868   VEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHIL  689
             +EY+RW EE N++INELR AVN+HA +++LR+IVD IMAHY++IFR+KG AAKADVFHIL
Sbjct  121   LEYSRWQEEENKQINELRTAVNAHASESDLRLIVDGIMAHYDEIFRLKGIAAKADVFHIL  180

Query  688   SGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGM  509
             SGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ ++NLQQSSQQAEDALSQGM
Sbjct  181   SGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGLSNLQQSSQQAEDALSQGM  240

Query  508   EALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMH  329
             EALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTL QM 
Sbjct  241   EALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLHQMQ  300

Query  328   RILTTRQAARAFLGISDYF  272
             RILT RQAARA L I DYF
Sbjct  301   RILTIRQAARALLAIHDYF  319



>gb|EMS58753.1| Transcription factor HBP-1b(c1) [Triticum urartu]
Length=467

 Score =   412 bits (1060),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 248/323 (77%), Positives = 274/323 (85%), Gaps = 6/323 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTE--DKNMGFQNNHALGIVGSDGSDRTRDQ---KTLRRLA  1058
             W    MAD SPRTDTSTD D +  ++N  F+         SD SD++RD+   K+LRRLA
Sbjct  129   WGESSMADTSPRTDTSTDPDIDIDERNQMFEQGQLAAPTASDSSDKSRDKLDHKSLRRLA  188

Query  1057  QNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGAL  878
             QNREAARKSRLRKKAY+Q LE+SR+KLTQLEQELQRARQQGIFISSSGDQSQS  GNGA+
Sbjct  189   QNREAARKSRLRKKAYIQNLESSRLKLTQLEQELQRARQQGIFISSSGDQSQSAGGNGAV  248

Query  877   AFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVF  698
             AFD+EYARWLEEHN+ INELR A N+HAGD +LR IVDSIMA Y++ FR+KG AAKADVF
Sbjct  249   AFDMEYARWLEEHNKHINELRAAANAHAGDDDLRKIVDSIMAQYDEFFRLKGVAAKADVF  308

Query  697   HILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALS  518
             H+LSGMWKTPAERCF+WLGGFRSSELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALS
Sbjct  309   HVLSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTEQQLTGICNLQQSSQQAEDALS  368

Query  517   QGMEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTL  341
             QGMEALQQSLAETL+    GP+GSSGNVA+YMGQMAMAMGKLGTLE F+RQADNLR QTL
Sbjct  369   QGMEALQQSLAETLSSGSLGPAGSSGNVASYMGQMAMAMGKLGTLENFLRQADNLRLQTL  428

Query  340   QQMHRILTTRQAARAFLGISDYF  272
             QQM RILTTRQ+ARA L ISDYF
Sbjct  429   QQMQRILTTRQSARALLAISDYF  451



>ref|XP_010498764.1| PREDICTED: transcription factor TGA6-like isoform X1 [Camelina 
sativa]
 ref|XP_010498771.1| PREDICTED: transcription factor TGA6-like isoform X1 [Camelina 
sativa]
 ref|XP_010498779.1| PREDICTED: transcription factor TGA6-like isoform X1 [Camelina 
sativa]
Length=331

 Score =   407 bits (1047),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 234/314 (75%), Positives = 269/314 (86%), Gaps = 3/314 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD S RTD STD DT+ ++ G +    +    SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADTSSRTDVSTDGDTDHRDQGSERGQMMLAAASDSSDRSKDKLDQKTLRRLAQNREAAR  60

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S  GNGALAFD E++
Sbjct  61    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHS  120

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N+++NELR A+N+HAGD ELR IVD +MAHYE++FRIK  AAK DVFH+LSGMW
Sbjct  121   RWLEEKNKQMNELRSALNAHAGDTELRTIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMW  180

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL NQLEP+TE+Q++ +N+LQQ+SQQAEDALSQGME+LQ
Sbjct  181   KTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVMGLNSLQQTSQQAEDALSQGMESLQ  240

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SS NVA+YMGQMAMAMG+LGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  241   QSLADTLSSGTLGSTSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMLRVLT  300

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L I DY
Sbjct  301   TRQSARALLAIHDY  314



>gb|ABP88233.1| transcription factor bZIP98, partial [Glycine max]
Length=300

 Score =   406 bits (1043),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 236/283 (83%), Positives = 259/283 (92%), Gaps = 4/283 (1%)
 Frame = -1

Query  1108  SDGSDRTRD---QKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqq  938
             SD SDR++D   QKTLRRLAQNREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQ 
Sbjct  2     SDSSDRSKDKSDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQH  61

Query  937   gifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSI  758
             GIFISSSGDQ+ ++SGNGA+ FD EYARWLEE NR+INEL+ AVNSHA D ELR+IVD I
Sbjct  62    GIFISSSGDQAHTLSGNGAMQFDAEYARWLEEQNRQINELKAAVNSHASDTELRMIVDGI  121

Query  757   MAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQ  578
             +AHY++IFR+KG AAKADVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL++QLEPLTEQ
Sbjct  122   LAHYDEIFRLKGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVSQLEPLTEQ  181

Query  577   QLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMG  401
             QL+ I NLQQSSQQAEDALSQGMEALQQSLAETL+  +   SGSSGNVANYMGQMAMAMG
Sbjct  182   QLMGITNLQQSSQQAEDALSQGMEALQQSLAETLSTGAPASSGSSGNVANYMGQMAMAMG  241

Query  400   KLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             KLGTLEGFI+QADNLRQQTLQQMHRILTTRQ+ARA L I DYF
Sbjct  242   KLGTLEGFIQQADNLRQQTLQQMHRILTTRQSARALLAIHDYF  284



>emb|CDY00762.1| BnaC03g37460D [Brassica napus]
Length=331

 Score =   407 bits (1046),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 232/314 (74%), Positives = 271/314 (86%), Gaps = 3/314 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD S RTD STD DT+ ++MG +    +    SD S R++D   QKT+RRLAQNREAAR
Sbjct  1     MADTSSRTDASTDGDTDPRDMGSERGQGMLAAASDSSGRSKDKLDQKTVRRLAQNREAAR  60

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S  GNGALAFD E++
Sbjct  61    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHS  120

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N+++NELR A+N+HAGD ELRIIV+ +M+HYE++FRIK  AAK DVFH+LSGMW
Sbjct  121   RWLEEKNKQMNELRSALNAHAGDTELRIIVEGVMSHYEELFRIKSSAAKNDVFHLLSGMW  180

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKL+ NQLEP+TE+Q++ +N+LQQ+SQQAEDALSQGME+LQ
Sbjct  181   KTPAERCFLWLGGFRSSELLKLIANQLEPITERQVMGLNSLQQTSQQAEDALSQGMESLQ  240

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SS NVA+YMGQMAMAMG+LGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  241   QSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMIRVLT  300

Query  316   TRQAARAFLGISDY  275
             TRQ+ARAFL I DY
Sbjct  301   TRQSARAFLAIHDY  314



>dbj|BAD44579.1| bZip transcription factor TGA6 / AtbZip45 [Arabidopsis thaliana]
 dbj|BAD44684.1| bZip transcription factor TGA6 / AtbZip45 [Arabidopsis thaliana]
Length=330

 Score =   407 bits (1045),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 236/314 (75%), Positives = 269/314 (86%), Gaps = 4/314 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD S RTD STD DT+ +++G    H +    SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADTSSRTDVSTDGDTDHRDLGSDRGH-MHAAASDSSDRSKDKLDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FI SSGDQ+ S  GNGALAFD E++
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFILSSGDQAHSTGGNGALAFDAEHS  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR++NELR A+N+HAGD ELRIIVD +MAHYE++FRIK  AAK DVFH+LSGMW
Sbjct  120   RWLEEKNRQMNELRSALNAHAGDTELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL NQLE +TE+Q++ IN+LQQ+SQQAEDALSQGME+LQ
Sbjct  180   KTPAERCFLWLGGFRSSELLKLLANQLEHMTERQVMGINSLQQTSQQAEDALSQGMESLQ  239

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SS NVA+YMGQMAMAMG+LGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  240   QSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMLRVLT  299

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L I DY
Sbjct  300   TRQSARALLAIHDY  313



>gb|EMT32868.1| putative Transcription factor HBP-1b(c1) [Aegilops tauschii]
Length=467

 Score =   412 bits (1058),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 248/323 (77%), Positives = 274/323 (85%), Gaps = 6/323 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTD--ADTEDKNMGFQNNHALGIVGSDGSDRTRDQ---KTLRRLA  1058
             W    MAD SPRTDTSTD   D +++N  F+         SD SD++RD+   K+LRRLA
Sbjct  129   WGESSMADTSPRTDTSTDLDIDIDERNQMFEQGQLAAPTASDSSDKSRDKLDHKSLRRLA  188

Query  1057  QNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGAL  878
             QNREAARKSRLRKKAY+Q LE+SR+KLTQLEQELQRARQQGIFISSSGDQSQS  GNGA+
Sbjct  189   QNREAARKSRLRKKAYIQNLESSRLKLTQLEQELQRARQQGIFISSSGDQSQSAGGNGAV  248

Query  877   AFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVF  698
             AFD+EYARWLEEHN+ INELR A N+HAGD +LR IVDSIM+ Y++ FR+KG AAKADVF
Sbjct  249   AFDMEYARWLEEHNKHINELRAAANAHAGDDDLRKIVDSIMSQYDEFFRLKGVAAKADVF  308

Query  697   HILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALS  518
             H+LSGMWKTPAERCF+WLGGFRSSELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALS
Sbjct  309   HVLSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTEQQLTGICNLQQSSQQAEDALS  368

Query  517   QGMEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTL  341
             QGMEALQQSLAETLA    GP+GSSGNVA+YMGQMAMAMGKLGTLE F+RQADNLR QTL
Sbjct  369   QGMEALQQSLAETLASGSLGPAGSSGNVASYMGQMAMAMGKLGTLENFLRQADNLRLQTL  428

Query  340   QQMHRILTTRQAARAFLGISDYF  272
             QQM RILTTRQ+ARA L ISDYF
Sbjct  429   QQMQRILTTRQSARALLAISDYF  451



>ref|NP_001132337.1| putative bZIP transcription factor superfamily protein [Zea mays]
 gb|ACF81142.1| unknown [Zea mays]
 gb|AFW79514.1| putative bZIP transcription factor superfamily protein [Zea mays]
 gb|AIB04994.1| bZIP transcription factor, partial [Zea mays]
Length=329

 Score =   406 bits (1044),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 251/315 (80%), Positives = 274/315 (87%), Gaps = 7/315 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MAD SPRT+TSTD      N G +     G+V SD SDR++D    QKTLRRLAQNREAA
Sbjct  1     MADASPRTETSTDDTD--DNNGLEPGRG-GLVASDSSDRSKDKHGDQKTLRRLAQNREAA  57

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSS DQS SMSGNGALAFD+EY
Sbjct  58    RKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSVDQSHSMSGNGALAFDMEY  117

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR+I+ELR  V++HA D +LR +VD IM+HY++IFR+KG AAKADVFH+LSGM
Sbjct  118   ARWLEEHNRQISELRAGVSAHASDTDLRSVVDKIMSHYDEIFRLKGNAAKADVFHVLSGM  177

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFR SE+LKLL  QLEPLTEQQL  I+NLQQSSQQAEDALSQGMEAL
Sbjct  178   WKTPAERCFLWLGGFRPSEVLKLLSTQLEPLTEQQLSGISNLQQSSQQAEDALSQGMEAL  237

Query  499   QQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QQSLAETLAGSL  SGS+GNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQM RIL
Sbjct  238   QQSLAETLAGSLSSSGSTGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQMQRIL  297

Query  319   TTRQAARAFLGISDY  275
             TTRQ+ARA L ISDY
Sbjct  298   TTRQSARALLVISDY  312



>ref|XP_009120759.1| PREDICTED: transcription factor TGA6-like isoform X1 [Brassica 
rapa]
 emb|CDY50562.1| BnaA01g30760D [Brassica napus]
Length=334

 Score =   406 bits (1043),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 235/314 (75%), Positives = 268/314 (85%), Gaps = 2/314 (1%)
 Frame = -1

Query  1210  MMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSD--GSDRTRDQKTLRRLAQNREAAR  1037
             +MAD S RTD STD DT+ +++G      +  V SD  GS    DQKTLRRLAQNREAAR
Sbjct  4     LMADTSSRTDVSTDGDTDPRDLGSDRGQTMLAVASDSSGSKDKLDQKTLRRLAQNREAAR  63

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S  GNGALAFD E++
Sbjct  64    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHS  123

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE NR++NELR A+N+HAGDAEL IIVD +M HYE++FRIK  AAK DVFH+LSGMW
Sbjct  124   RWLEEKNRQMNELRSALNAHAGDAELLIIVDGVMTHYEELFRIKSNAAKNDVFHLLSGMW  183

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL NQLEP+TE+Q++ +N+LQQ+SQQAEDALSQGME+LQ
Sbjct  184   KTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVMGLNSLQQTSQQAEDALSQGMESLQ  243

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SS NVA+YMGQMAMAMG+LGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  244   QSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMIRVLT  303

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L I DY
Sbjct  304   TRQSARALLAIHDY  317



>ref|NP_001060695.1| Os07g0687700 [Oryza sativa Japonica Group]
 dbj|BAB72062.1| bZIP transcription factor [Oryza sativa]
 dbj|BAC79596.1| bZIP transcription factor [Oryza sativa Japonica Group]
 dbj|BAD30297.1| bZIP transcription factor [Oryza sativa Japonica Group]
 dbj|BAF22609.1| Os07g0687700 [Oryza sativa Japonica Group]
 dbj|BAG94609.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67849.1| hypothetical protein OsJ_25648 [Oryza sativa Japonica Group]
 gb|ADX60219.1| bZIP transcription factor [Oryza sativa Japonica Group]
Length=334

 Score =   406 bits (1043),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 243/318 (76%), Positives = 274/318 (86%), Gaps = 6/318 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSD------RTRDQKTLRRLAQNRE  1046
             MAD S RTDTS   D +DKN   +N H+  ++ S+ SD      +  DQKT+RRLAQNRE
Sbjct  1     MADASSRTDTSIVVDNDDKNHQLENGHSGAVMASNSSDRSDRSDKLMDQKTIRRLAQNRE  60

Query  1045  AARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDV  866
             AARKSRLRKKAYVQQLE+S++KL QLEQELQ+ARQQGIFISSSGDQ+ +MSGNGAL FD+
Sbjct  61    AARKSRLRKKAYVQQLESSKLKLAQLEQELQKARQQGIFISSSGDQTHAMSGNGALTFDL  120

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EY RWLEE N++INELR AVN+HA D++LR+IVD IMAHY+++F++KG AAKADVFHILS
Sbjct  121   EYTRWLEEQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEVFKVKGVAAKADVFHILS  180

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCFLWLGGFR SELLKLL N LEPLTEQQLL +NNLQ+SSQQAEDALSQGME
Sbjct  181   GMWKTPAERCFLWLGGFRPSELLKLLANHLEPLTEQQLLGLNNLQESSQQAEDALSQGME  240

Query  505   ALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             ALQQSLA+TLAGSLG SGSSGNVANYMGQMAMAMGKLGTLE F+ QADNLRQQTL QM R
Sbjct  241   ALQQSLADTLAGSLGSSGSSGNVANYMGQMAMAMGKLGTLENFLCQADNLRQQTLHQMQR  300

Query  325   ILTTRQAARAFLGISDYF  272
             ILT RQA+RA L I DYF
Sbjct  301   ILTIRQASRALLAIHDYF  318



>dbj|BAJ90602.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88453.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score =   405 bits (1042),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 245/317 (77%), Positives = 266/317 (84%), Gaps = 9/317 (3%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQ-NNHALGIVGSDGSDRTR---DQKTLRRLAQNREAA  1040
             MA+ SPRT+TS D D   +N+  +  N AL +             DQKT+RRLAQNREAA
Sbjct  1     MAEASPRTETSDDTD---ENLMLEPGNAALAVASDSSDRSRDRNGDQKTMRRLAQNREAA  57

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSS DQS SMSGNGALAFD EY
Sbjct  58    RKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSADQSHSMSGNGALAFDTEY  117

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR++NELR AVN+HAGD ELR +V+ IM+HY++IF+ KG AAKADVFH+LSGM
Sbjct  118   ARWLEEHNRQVNELRAAVNAHAGDTELRSVVEKIMSHYDEIFKQKGNAAKADVFHVLSGM  177

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFR SELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALSQGMEAL
Sbjct  178   WKTPAERCFLWLGGFRPSELLKLLSTQLEPLTEQQLSGICNLQQSSQQAEDALSQGMEAL  237

Query  499   QQSLAETLA--gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             QQSLAETLA       SGS+GNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTLQQM R
Sbjct  238   QQSLAETLAGSIGSSGSGSTGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLQQMQR  297

Query  325   ILTTRQAARAFLGISDY  275
             ILTTRQ+ARA L ISDY
Sbjct  298   ILTTRQSARALLVISDY  314



>gb|KDO44920.1| hypothetical protein CISIN_1g015258mg [Citrus sinensis]
Length=408

 Score =   408 bits (1049),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 249/322 (77%), Positives = 277/322 (86%), Gaps = 8/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MA+ SP    ++  DTEDKN  F+      +  SD SD+++    DQKTLRRLAQ
Sbjct  74    WGESNMAEASP-ITDTSTDDTEDKNQRFERGQLTAVAASDSSDKSKEKSGDQKTLRRLAQ  132

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS SMSGN A  
Sbjct  133   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSMSGNAA--  190

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDVEY+RWLEEHNR I ELR AVNSHAGD ELR IVD++ +H+++IFR+KG A+KADVFH
Sbjct  191   FDVEYSRWLEEHNRHIVELRAAVNSHAGDTELRTIVDNVTSHFDEIFRLKGIASKADVFH  250

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFRSSELLKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  251   ILSGMWKTPAERCFMWIGGFRSSELLKLLVNQLEPLTEQQLVGIYNLQQSSQQAEDALSQ  310

Query  514   GMEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GM+ALQQSLAETLA  S  PSG+SGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQ
Sbjct  311   GMDALQQSLAETLANGSPSPSGTSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQ  370

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQ+ARA L I+DYF
Sbjct  371   QMHRILTTRQSARALLAINDYF  392



>ref|XP_011075858.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X2 [Sesamum 
indicum]
Length=285

 Score =   403 bits (1036),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 252/312 (81%), Positives = 258/312 (83%), Gaps = 43/312 (14%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKSR  1028
             MAD SPRTDTSTDADTEDKN+ FQNN    IV SDGSD++RDQKTLRRLAQNREAARKSR
Sbjct  1     MADASPRTDTSTDADTEDKNLRFQNNQLQAIVASDGSDKSRDQKTLRRLAQNREAARKSR  60

Query  1027  LRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWL  848
             LRKKAYVQQLE+SRMKLTQLEQELQRARQQGIFISSSGDQSQS+ GNGALAFDVEYARWL
Sbjct  61    LRKKAYVQQLESSRMKLTQLEQELQRARQQGIFISSSGDQSQSIGGNGALAFDVEYARWL  120

Query  847   EEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTP  668
             EEHNRRINELRG                                           MWKTP
Sbjct  121   EEHNRRINELRG-------------------------------------------MWKTP  137

Query  667   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  488
             AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL
Sbjct  138   AERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSL  197

Query  487   AETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  308
             AETLAGSLGPS SSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ
Sbjct  198   AETLAGSLGPSSSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  257

Query  307   AARAFLGISDYF  272
             +ARA L ISDYF
Sbjct  258   SARALLAISDYF  269



>gb|AGI17587.1| transcription factor TGA2 [Gladiolus hybrid cultivar]
Length=431

 Score =   408 bits (1049),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 250/322 (78%), Positives = 275/322 (85%), Gaps = 5/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD SPRTDTSTD DT++KN  F+      +  SD SDR++    DQKTLRRLAQ
Sbjct  94    WGESTMADASPRTDTSTDVDTDEKNQMFEQGQVAVVAASDSSDRSKEKTGDQKTLRRLAQ  153

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFIS+SGDQS SMSGNGALA
Sbjct  154   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISNSGDQSHSMSGNGALA  213

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD EY RWLE+HNR+INELR AVN+HA D + R IVD +MAHY DIF++K  AAKADVFH
Sbjct  214   FDAEYGRWLEDHNRQINELRAAVNAHASDNDPRAIVDGVMAHYADIFKLKSTAAKADVFH  273

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             +LSGMWKTPAERCF+WLGGFRSSELLKLL  QLEPLTEQQL+ I NLQQSSQQAEDALSQ
Sbjct  274   MLSGMWKTPAERCFMWLGGFRSSELLKLLATQLEPLTEQQLVGICNLQQSSQQAEDALSQ  333

Query  514   GMEALQQSLAETLAgslgps-gssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSL+ETL+ +   S G+SGNVANYMGQMAMAMGKLGTLE F+ QADNLR QTLQ
Sbjct  334   GMEALQQSLSETLSSASPASGGTSGNVANYMGQMAMAMGKLGTLESFLCQADNLRLQTLQ  393

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHRILTTRQAARA L I+DYF
Sbjct  394   QMHRILTTRQAARALLAINDYF  415



>ref|XP_006658160.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006658161.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Oryza 
brachyantha]
Length=334

 Score =   404 bits (1039),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 243/318 (76%), Positives = 273/318 (86%), Gaps = 6/318 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSD------RTRDQKTLRRLAQNRE  1046
             MAD S RTDTS   D +DKN   +N  +  ++ S+ SD      +  DQKT+RRLAQNRE
Sbjct  1     MADASSRTDTSIVVDNDDKNHQLENGQSGAVMASNSSDRSDRSDKPMDQKTMRRLAQNRE  60

Query  1045  AARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDV  866
             AARKSRLRKKAYVQQLE+S++KL QLEQELQ+ARQQGIFISSSGDQ+ +MSGNGAL FD+
Sbjct  61    AARKSRLRKKAYVQQLESSKLKLAQLEQELQKARQQGIFISSSGDQTHAMSGNGALTFDL  120

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EY RWLEE N++INELR AVN+HA D++LR+IVD IMAHY++IF++KG AAKADVFHILS
Sbjct  121   EYTRWLEEQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFKVKGTAAKADVFHILS  180

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCFLWLGGFR SELLKLL N LEPLTEQQLL +NNLQ+SSQQAEDALSQGME
Sbjct  181   GMWKTPAERCFLWLGGFRPSELLKLLANHLEPLTEQQLLGLNNLQESSQQAEDALSQGME  240

Query  505   ALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             ALQQSLA+TLAGSLG SGSSGNVANYMGQMAMAMGKLGTLE F+ QADNLRQQTL QM R
Sbjct  241   ALQQSLADTLAGSLGSSGSSGNVANYMGQMAMAMGKLGTLENFLCQADNLRQQTLHQMQR  300

Query  325   ILTTRQAARAFLGISDYF  272
             ILT RQA+RA L I DYF
Sbjct  301   ILTIRQASRALLAIHDYF  318



>ref|XP_003624994.1| TGA transcription factor [Medicago truncatula]
Length=395

 Score =   407 bits (1045),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 247/318 (78%), Positives = 273/318 (86%), Gaps = 9/318 (3%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREA  1043
             W    MA+ S   DTSTD DTEDKN   +   +     S+ S    DQKTLRRLAQNREA
Sbjct  70    WGESNMAEGS--ADTSTD-DTEDKNQMPERGES-----SERSKDKSDQKTLRRLAQNREA  121

Query  1042  ARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVE  863
             ARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISS+G+Q+ SMSGNGA+AFD E
Sbjct  122   ARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSTGEQTHSMSGNGAMAFDAE  181

Query  862   YARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSG  683
             YARWLEEHNR+ NELR A+NSHAGD ELR IVD+ M  +EDI+R+KG AAKADVFHILSG
Sbjct  182   YARWLEEHNRQTNELRAAINSHAGDIELRTIVDNFMTQFEDIYRLKGVAAKADVFHILSG  241

Query  682   MWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEA  503
             MWKTPAERCF+W+GGFRSSELLKLL++ LEPLTEQQL+ I NLQQSSQQAEDALSQGM+A
Sbjct  242   MWKTPAERCFMWIGGFRSSELLKLLVSHLEPLTEQQLMGIYNLQQSSQQAEDALSQGMDA  301

Query  502   LQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             LQQSL+ETLA  S  PSG+SGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQM R
Sbjct  302   LQQSLSETLANGSPNPSGASGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMLR  361

Query  325   ILTTRQAARAFLGISDYF  272
             ILTTRQ+ARA L ISDYF
Sbjct  362   ILTTRQSARALLAISDYF  379



>gb|AFK49203.1| unknown [Lotus japonicus]
Length=461

 Score =   409 bits (1050),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 247/318 (78%), Positives = 271/318 (85%), Gaps = 10/318 (3%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREA  1043
             W      D SP   TSTD DT+DKN   +   +     SD S    DQKTLRRLAQNREA
Sbjct  137   WGESNTGDASP---TSTD-DTDDKNQMVERGES-----SDRSKDKTDQKTLRRLAQNREA  187

Query  1042  ARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVE  863
             ARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISS+G+Q+ SMSGNGA+AFDVE
Sbjct  188   ARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSTGEQAHSMSGNGAIAFDVE  247

Query  862   YARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSG  683
             YARWLEEHNR  NELR A+NSHAGD ELR IVD+ M  ++D+FR+KG AAKADVFHILSG
Sbjct  248   YARWLEEHNRHTNELRAAINSHAGDIELRTIVDNFMTQFDDLFRLKGIAAKADVFHILSG  307

Query  682   MWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEA  503
             MWKTPAERCF+W+GGFRSSE+LKLL+NQLEPLTEQQL+ I NLQQSSQQAEDALSQGM+A
Sbjct  308   MWKTPAERCFMWIGGFRSSEILKLLVNQLEPLTEQQLMGIYNLQQSSQQAEDALSQGMDA  367

Query  502   LQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             LQQSL+ETLA  S  PSGSSGNVANYMGQMAMAMGKLGTL GF+RQADNLRQQTLQQM R
Sbjct  368   LQQSLSETLANGSPNPSGSSGNVANYMGQMAMAMGKLGTLAGFLRQADNLRQQTLQQMLR  427

Query  325   ILTTRQAARAFLGISDYF  272
             ILTTRQ+ARA L ISDYF
Sbjct  428   ILTTRQSARALLAISDYF  445



>ref|XP_002457410.1| hypothetical protein SORBIDRAFT_03g006790 [Sorghum bicolor]
 gb|EES02530.1| hypothetical protein SORBIDRAFT_03g006790 [Sorghum bicolor]
Length=330

 Score =   403 bits (1036),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 250/315 (79%), Positives = 271/315 (86%), Gaps = 6/315 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MAD SPRT+TSTD      N G +       V SD SDR++D    QKTLRRLAQNREAA
Sbjct  1     MADASPRTETSTDDTD--DNHGLEPGPGALGVASDSSDRSKDKHGDQKTLRRLAQNREAA  58

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSS DQS SMSGNGALAFD+EY
Sbjct  59    RKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSVDQSHSMSGNGALAFDMEY  118

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR+I+ELR  V++HA D +LR +VD IM+HY++IFR+KG AAKADVFH+LSGM
Sbjct  119   ARWLEEHNRQISELRAGVSAHASDTDLRSVVDKIMSHYDEIFRLKGNAAKADVFHVLSGM  178

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFR SE+LKLL  QLEPLTEQQL  I NLQQSSQQAEDALSQGMEAL
Sbjct  179   WKTPAERCFLWLGGFRPSEVLKLLSTQLEPLTEQQLSGIGNLQQSSQQAEDALSQGMEAL  238

Query  499   QQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QQSLAETLAGSL  SGS+GNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQM RIL
Sbjct  239   QQSLAETLAGSLSSSGSTGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQMQRIL  298

Query  319   TTRQAARAFLGISDY  275
             TTRQ+ARA L ISDY
Sbjct  299   TTRQSARALLVISDY  313



>ref|XP_010904691.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Elaeis 
guineensis]
Length=429

 Score =   407 bits (1045),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 269/332 (81%), Positives = 287/332 (86%), Gaps = 4/332 (1%)
 Frame = -1

Query  1255  LI*SYIWKIGIW*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---  1085
             L+ S    I  W    MAD SPRTDTSTD DT+DKN   +   A     SD SD+++   
Sbjct  82    LVSSSSGHIENWGESTMADTSPRTDTSTDVDTDDKNQRLEQGQAAIAAASDSSDKSKDKL  141

Query  1084  DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqs  905
             DQKTLRRLAQNREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSSGDQS
Sbjct  142   DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSGDQS  201

Query  904   qsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIK  725
              SM GNGALAFD+EYARWLEEHNR+INELR AVNSHA D +LR IVDSIMAHY++IFR+K
Sbjct  202   HSMGGNGALAFDMEYARWLEEHNRQINELRAAVNSHASDNDLRTIVDSIMAHYDEIFRLK  261

Query  724   GEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQS  545
             G AAKADVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL NQLEPLTEQQL+ I NLQQS
Sbjct  262   GVAAKADVFHMLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPLTEQQLVGICNLQQS  321

Query  544   SQQAEDALSQGMEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQ  368
             SQQAEDALSQGMEALQQSLAETLA  SLGP+GSSGNVANYMGQMAMAMGKLGTLE F+RQ
Sbjct  322   SQQAEDALSQGMEALQQSLAETLASGSLGPAGSSGNVANYMGQMAMAMGKLGTLESFLRQ  381

Query  367   ADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             ADNLRQQTLQQM RILTTRQ+ARA L I DYF
Sbjct  382   ADNLRQQTLQQMIRILTTRQSARALLAIHDYF  413



>ref|XP_010904690.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Elaeis 
guineensis]
Length=468

 Score =   408 bits (1049),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 267/332 (80%), Positives = 285/332 (86%), Gaps = 4/332 (1%)
 Frame = -1

Query  1255  LI*SYIWKIGIW*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---  1085
             L+ S    I  W    MAD SPRTDTSTD DT+DKN   +   A     SD SD+++   
Sbjct  121   LVSSSSGHIENWGESTMADTSPRTDTSTDVDTDDKNQRLEQGQAAIAAASDSSDKSKDKL  180

Query  1084  DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqs  905
             DQKTLRRLAQNREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSSGDQS
Sbjct  181   DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSGDQS  240

Query  904   qsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIK  725
              SM GNGALAFD+EYARWLEEHNR+INELR AVNSHA D +LR IVDSIMAHY++IFR+K
Sbjct  241   HSMGGNGALAFDMEYARWLEEHNRQINELRAAVNSHASDNDLRTIVDSIMAHYDEIFRLK  300

Query  724   GEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQS  545
             G AAKADVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL NQLEPLTEQQL+ I NLQQS
Sbjct  301   GVAAKADVFHMLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPLTEQQLVGICNLQQS  360

Query  544   SQQAEDALSQGMEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQ  368
             SQQAEDALSQGMEALQQSLAETLA    GP+GSSGNVANYMGQMAMAMGKLGTLE F+RQ
Sbjct  361   SQQAEDALSQGMEALQQSLAETLASGSLGPAGSSGNVANYMGQMAMAMGKLGTLESFLRQ  420

Query  367   ADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             ADNLRQQTLQQM RILTTRQ+ARA L I DYF
Sbjct  421   ADNLRQQTLQQMIRILTTRQSARALLAIHDYF  452



>gb|AES81212.2| leucine zipper transcription factor [Medicago truncatula]
Length=423

 Score =   406 bits (1043),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 247/318 (78%), Positives = 273/318 (86%), Gaps = 9/318 (3%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREA  1043
             W    MA+ S   DTSTD DTEDKN   +   +     S+ S    DQKTLRRLAQNREA
Sbjct  98    WGESNMAEGS--ADTSTD-DTEDKNQMPERGES-----SERSKDKSDQKTLRRLAQNREA  149

Query  1042  ARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVE  863
             ARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISS+G+Q+ SMSGNGA+AFD E
Sbjct  150   ARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSTGEQTHSMSGNGAMAFDAE  209

Query  862   YARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSG  683
             YARWLEEHNR+ NELR A+NSHAGD ELR IVD+ M  +EDI+R+KG AAKADVFHILSG
Sbjct  210   YARWLEEHNRQTNELRAAINSHAGDIELRTIVDNFMTQFEDIYRLKGVAAKADVFHILSG  269

Query  682   MWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEA  503
             MWKTPAERCF+W+GGFRSSELLKLL++ LEPLTEQQL+ I NLQQSSQQAEDALSQGM+A
Sbjct  270   MWKTPAERCFMWIGGFRSSELLKLLVSHLEPLTEQQLMGIYNLQQSSQQAEDALSQGMDA  329

Query  502   LQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             LQQSL+ETLA  S  PSG+SGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQM R
Sbjct  330   LQQSLSETLANGSPNPSGASGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMLR  389

Query  325   ILTTRQAARAFLGISDYF  272
             ILTTRQ+ARA L ISDYF
Sbjct  390   ILTTRQSARALLAISDYF  407



>ref|XP_008651318.1| PREDICTED: uncharacterized protein LOC100279481 isoform X3 [Zea 
mays]
 ref|XP_008651319.1| PREDICTED: uncharacterized protein LOC100279481 isoform X3 [Zea 
mays]
 ref|XP_008651320.1| PREDICTED: uncharacterized protein LOC100279481 isoform X3 [Zea 
mays]
 gb|ACN26283.1| unknown [Zea mays]
 gb|AFU81600.1| bZIP-type transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA64199.1| TPA: putative bZIP transcription factor superfamily protein isoform 
1 [Zea mays]
 tpg|DAA64200.1| TPA: putative bZIP transcription factor superfamily protein isoform 
2 [Zea mays]
 tpg|DAA64201.1| TPA: putative bZIP transcription factor superfamily protein isoform 
3 [Zea mays]
 tpg|DAA64202.1| TPA: putative bZIP transcription factor superfamily protein isoform 
4 [Zea mays]
Length=333

 Score =   402 bits (1034),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 245/317 (77%), Positives = 272/317 (86%), Gaps = 5/317 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGI-----VGSDGSDRTRDQKTLRRLAQNREA  1043
             MAD S RTDTS   D  DKN   +N     +       SD SD+  DQKT+RRLAQNREA
Sbjct  1     MADASSRTDTSIVLDDNDKNHRMENGSGAVVPSNSSDRSDRSDKPLDQKTMRRLAQNREA  60

Query  1042  ARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVE  863
             ARKSRLRKKAYVQQLE+S++KL QLEQELQ+ARQQGIFISSSGDQ+ +MSGNGAL FD+E
Sbjct  61    ARKSRLRKKAYVQQLESSKLKLAQLEQELQKARQQGIFISSSGDQTHAMSGNGALTFDIE  120

Query  862   YARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSG  683
             YARWLE+ N++INELR AVN+HA D++LR+IVD IMAHY++IF++KG AAKADVFHILSG
Sbjct  121   YARWLEDQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFKVKGVAAKADVFHILSG  180

Query  682   MWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEA  503
             MWKTPAERCFLWLGGFR SELLKLL N LEPLTEQQ+L + NLQQSSQQAEDALSQGMEA
Sbjct  181   MWKTPAERCFLWLGGFRPSELLKLLANHLEPLTEQQMLGLTNLQQSSQQAEDALSQGMEA  240

Query  502   LQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             LQQSLAETLAGSLGP+GSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTL QM RI
Sbjct  241   LQQSLAETLAGSLGPAGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLHQMQRI  300

Query  322   LTTRQAARAFLGISDYF  272
             LT RQA+RA L I DYF
Sbjct  301   LTIRQASRALLAIHDYF  317



>gb|AAT28675.1| bZIP transcription factor [Oryza sativa Japonica Group]
Length=473

 Score =   408 bits (1048),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 249/321 (78%), Positives = 275/321 (86%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQ---KTLRRLAQN  1052
             W    +AD SPRTDTSTD DT+++N  F+         SD SDR++D+   KTLRRLAQN
Sbjct  137   WGESTIADTSPRTDTSTDPDTDERNQMFEQGQLAAPTASDSSDRSKDKLDHKTLRRLAQN  196

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAY+Q LE+SR+KLTQ+EQELQRARQQGIFIS+S DQS S SGNGALAF
Sbjct  197   REAARKSRLRKKAYIQNLESSRLKLTQIEQELQRARQQGIFISTSSDQSHSASGNGALAF  256

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D+EYARWLEEHN+ INELR AVN+HAGD +L+  VDSIMAHY +IF++KG AAKADVFH+
Sbjct  257   DMEYARWLEEHNKHINELRAAVNAHAGDNDLKSTVDSIMAHYNEIFKLKGVAAKADVFHV  316

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCF+WLGGFRSSELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALSQG
Sbjct  317   LSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTEQQLAGIANLQQSSQQAEDALSQG  376

Query  511   MEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETLA    GP+GSSGNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQ
Sbjct  377   MEALQQSLAETLASGSLGPAGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQ  436

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L ISDYF
Sbjct  437   MQRILTTRQSARALLAISDYF  457



>ref|XP_003624993.1| TGA transcription factor [Medicago truncatula]
 gb|AES81211.1| leucine zipper transcription factor [Medicago truncatula]
Length=452

 Score =   407 bits (1045),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 247/318 (78%), Positives = 273/318 (86%), Gaps = 9/318 (3%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREA  1043
             W    MA+ S   DTSTD DTEDKN   +   +     S+ S    DQKTLRRLAQNREA
Sbjct  127   WGESNMAEGS--ADTSTD-DTEDKNQMPERGES-----SERSKDKSDQKTLRRLAQNREA  178

Query  1042  ARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVE  863
             ARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISS+G+Q+ SMSGNGA+AFD E
Sbjct  179   ARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSTGEQTHSMSGNGAMAFDAE  238

Query  862   YARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSG  683
             YARWLEEHNR+ NELR A+NSHAGD ELR IVD+ M  +EDI+R+KG AAKADVFHILSG
Sbjct  239   YARWLEEHNRQTNELRAAINSHAGDIELRTIVDNFMTQFEDIYRLKGVAAKADVFHILSG  298

Query  682   MWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEA  503
             MWKTPAERCF+W+GGFRSSELLKLL++ LEPLTEQQL+ I NLQQSSQQAEDALSQGM+A
Sbjct  299   MWKTPAERCFMWIGGFRSSELLKLLVSHLEPLTEQQLMGIYNLQQSSQQAEDALSQGMDA  358

Query  502   LQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             LQQSL+ETLA  S  PSG+SGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQM R
Sbjct  359   LQQSLSETLANGSPNPSGASGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMLR  418

Query  325   ILTTRQAARAFLGISDYF  272
             ILTTRQ+ARA L ISDYF
Sbjct  419   ILTTRQSARALLAISDYF  436



>ref|XP_006288172.1| hypothetical protein CARUB_v10001409mg [Capsella rubella]
 ref|XP_006288173.1| hypothetical protein CARUB_v10001409mg [Capsella rubella]
 gb|EOA21070.1| hypothetical protein CARUB_v10001409mg [Capsella rubella]
 gb|EOA21071.1| hypothetical protein CARUB_v10001409mg [Capsella rubella]
Length=330

 Score =   402 bits (1033),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 241/315 (77%), Positives = 271/315 (86%), Gaps = 4/315 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             M D SPRTD STD DT+  ++G +   A     SD SDR++   DQKTLRRLAQNREAAR
Sbjct  1     MGDTSPRTDASTDDDTDHPDLGSEGALA-NTAASDSSDRSKGKMDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISS+GDQ+ S  GNGALAFD E++
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSTGDQAHSTGGNGALAFDAEHS  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N+++NELR A+N+HAGDAELR IVD +MAHYE++FRIK  AAK DVFH+LSGMW
Sbjct  120   RWLEEKNKQMNELRSALNAHAGDAELRTIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL NQLEP+TE+QL  INNLQQ+SQQAEDALSQGME+LQ
Sbjct  180   KTPAERCFLWLGGFRSSELLKLLANQLEPMTERQLGGINNLQQTSQQAEDALSQGMESLQ  239

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SSGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  240   QSLADTLSNGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLT  299

Query  316   TRQAARAFLGISDYF  272
             TRQ+ARA L I DYF
Sbjct  300   TRQSARALLAIHDYF  314



>ref|XP_010230791.1| PREDICTED: transcription factor HBP-1b(c38) [Brachypodium distachyon]
Length=329

 Score =   402 bits (1033),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 246/315 (78%), Positives = 273/315 (87%), Gaps = 7/315 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MA+VSPRTDTSTD   E+  +       + +V SD SDR+RD    QKT+RRLAQNREAA
Sbjct  1     MAEVSPRTDTSTDDTDENHTL---EPGQVALVVSDSSDRSRDKNGDQKTMRRLAQNREAA  57

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSS DQS S SGNGA+AFD+EY
Sbjct  58    RKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSADQSHSTSGNGAIAFDMEY  117

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             +RWLEEHNR++NELR AVN+HA D +L  +V+ IM+HYE+I++ KG AAKADVFH+LSGM
Sbjct  118   SRWLEEHNRQVNELRAAVNAHASDNDLHSVVEKIMSHYEEIYKQKGNAAKADVFHVLSGM  177

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFR SE+LKLL  QLEPLTEQQL  I NLQ SSQQAEDALSQGMEAL
Sbjct  178   WKTPAERCFLWLGGFRPSEVLKLLSTQLEPLTEQQLSGICNLQHSSQQAEDALSQGMEAL  237

Query  499   QQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QQSLAETLAGS+G SGS+GNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTLQQM RIL
Sbjct  238   QQSLAETLAGSIGTSGSTGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLQQMQRIL  297

Query  319   TTRQAARAFLGISDY  275
             TTRQ+ARA L ISDY
Sbjct  298   TTRQSARALLVISDY  312



>ref|XP_004958748.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X3 [Setaria 
italica]
Length=342

 Score =   402 bits (1034),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 247/326 (76%), Positives = 271/326 (83%), Gaps = 14/326 (4%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSD--------------GSDRTRDQKTL  1070
             MAD S RTDTST  D  DKN   ++   L +                   SD+  DQKTL
Sbjct  1     MADASSRTDTSTVLDDNDKNQRIRSTKHLQMENGQIMAAAPSNSSDRSDRSDKPLDQKTL  60

Query  1069  RRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsg  890
             RRLAQNREAARKSRLRKKAYVQQLE+S++KL QLEQELQ+ARQQGIFISSSGDQ+ +MSG
Sbjct  61    RRLAQNREAARKSRLRKKAYVQQLESSKLKLAQLEQELQKARQQGIFISSSGDQTHAMSG  120

Query  889   nGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAK  710
             NGAL FD+EY RWLEE N++INELR AVN+HA D++LR+IVD IMAHY++IF++KG AAK
Sbjct  121   NGALTFDIEYTRWLEEQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFKVKGVAAK  180

Query  709   ADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAE  530
             ADVFHILSGMWKTPAERCFLWLGGFR SELLKLL N LEPLTEQQLL + NLQQSSQQAE
Sbjct  181   ADVFHILSGMWKTPAERCFLWLGGFRPSELLKLLANHLEPLTEQQLLGLTNLQQSSQQAE  240

Query  529   DALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQ  350
             DALSQGMEALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQ
Sbjct  241   DALSQGMEALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQ  300

Query  349   QTLQQMHRILTTRQAARAFLGISDYF  272
             QTL QM RILT RQA+RA L I DYF
Sbjct  301   QTLHQMQRILTIRQASRALLAIHDYF  326



>gb|EEC71673.1| hypothetical protein OsI_04142 [Oryza sativa Indica Group]
Length=473

 Score =   407 bits (1046),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 249/321 (78%), Positives = 275/321 (86%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQ---KTLRRLAQN  1052
             W    +AD SPRTDTSTD DT+++N  F+         SD SDR++D+   KTLRRLAQN
Sbjct  137   WGESTIADTSPRTDTSTDPDTDERNQMFEQGQLAAPTASDSSDRSKDKLDHKTLRRLAQN  196

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAY+Q LE+SR+KLTQ+EQELQRARQQGIFIS+S DQS S SGNGALAF
Sbjct  197   REAARKSRLRKKAYIQNLESSRLKLTQIEQELQRARQQGIFISTSSDQSHSASGNGALAF  256

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D+EYARWLEEHN+ INELR AVN+HAGD +L+  VDSIMAHY +IF++KG AAKADVFH+
Sbjct  257   DMEYARWLEEHNKHINELRAAVNAHAGDNDLKSTVDSIMAHYNEIFKLKGVAAKADVFHV  316

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCF+WLGGFRSSELLKLL  QLEPLTEQQL  I NLQQSSQQAEDALSQG
Sbjct  317   LSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTEQQLAGIANLQQSSQQAEDALSQG  376

Query  511   MEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETLA    GP+GSSGNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQ
Sbjct  377   MEALQQSLAETLASGSLGPAGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQ  436

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L ISDYF
Sbjct  437   MQRILTTRQSARALLAISDYF  457



>gb|EEC82717.1| hypothetical protein OsI_27401 [Oryza sativa Indica Group]
Length=334

 Score =   402 bits (1033),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 242/318 (76%), Positives = 273/318 (86%), Gaps = 6/318 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSD------RTRDQKTLRRLAQNRE  1046
             MAD S RTDTS   D +DKN   +N H+  ++ S+ SD      +  DQKT+RRLAQNRE
Sbjct  1     MADASSRTDTSIVVDNDDKNHQLENGHSGAVMASNSSDRSDRSDKLMDQKTMRRLAQNRE  60

Query  1045  AARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDV  866
             AARKSRLRKKAYVQQLE+S++KL QLEQELQ+ARQQGIFISSSGDQ+ +MSGNGAL FD+
Sbjct  61    AARKSRLRKKAYVQQLESSKLKLAQLEQELQKARQQGIFISSSGDQTHAMSGNGALTFDL  120

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EY RWLEE N++INELR AVN+HA D++LR+IVD IMAHY+++F++KG AAKADVFHILS
Sbjct  121   EYTRWLEEQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEVFKVKGVAAKADVFHILS  180

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCFLWLGGFR SELLKLL N LEPLTEQQLL +NNLQ+SSQQAEDALSQGME
Sbjct  181   GMWKTPAERCFLWLGGFRPSELLKLLANHLEPLTEQQLLGLNNLQESSQQAEDALSQGME  240

Query  505   ALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             ALQQSLA+TLAGSL  SGSSGNVANYMGQMAMAMGKLGTLE F+ QADNLRQQTL QM R
Sbjct  241   ALQQSLADTLAGSLASSGSSGNVANYMGQMAMAMGKLGTLENFLCQADNLRQQTLHQMQR  300

Query  325   ILTTRQAARAFLGISDYF  272
             ILT RQA+RA L I DYF
Sbjct  301   ILTIRQASRALLAIHDYF  318



>gb|EEE54337.1| hypothetical protein OsJ_01313 [Oryza sativa Japonica Group]
Length=371

 Score =   403 bits (1036),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 242/287 (84%), Positives = 259/287 (90%), Gaps = 4/287 (1%)
 Frame = -1

Query  1123  LGIVGSDGSDRTRD----QKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqel  956
             L +  +  SDR++D    QKTLRRLAQNREAARKSRLRKKAYVQQLENSR+KLTQLEQEL
Sbjct  68    LALAAASDSDRSKDKHEDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQEL  127

Query  955   qrarqqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELR  776
             QRARQQGIFISSS DQ+ SMSGNGALAFD+EYARWLEEHNR+INELR AVN+HAGD ELR
Sbjct  128   QRARQQGIFISSSVDQTHSMSGNGALAFDMEYARWLEEHNRQINELRSAVNAHAGDNELR  187

Query  775   IIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQL  596
              +VD IM+HYE+IF+ KG AAKADVFH+LSGMWKTPAERCFLWLGGFR SELLKLL  QL
Sbjct  188   GVVDKIMSHYEEIFKQKGNAAKADVFHVLSGMWKTPAERCFLWLGGFRPSELLKLLSTQL  247

Query  595   EPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQM  416
             EPLTEQQL  I NLQQSSQQAEDALSQGMEALQQSLAETLAGSLG SGS+GNVANYMGQM
Sbjct  248   EPLTEQQLSGIANLQQSSQQAEDALSQGMEALQQSLAETLAGSLGSSGSTGNVANYMGQM  307

Query  415   AMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDY  275
             AMAMGKLGTLE F+RQADNLRQQTLQQM RILTTRQ+ARA L ISDY
Sbjct  308   AMAMGKLGTLENFLRQADNLRQQTLQQMQRILTTRQSARALLVISDY  354



>gb|EEC70410.1| hypothetical protein OsI_01405 [Oryza sativa Indica Group]
Length=371

 Score =   403 bits (1036),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 242/287 (84%), Positives = 259/287 (90%), Gaps = 4/287 (1%)
 Frame = -1

Query  1123  LGIVGSDGSDRTRD----QKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqel  956
             L +  +  SDR++D    QKTLRRLAQNREAARKSRLRKKAYVQQLENSR+KLTQLEQEL
Sbjct  68    LALAAASDSDRSKDKHEDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQEL  127

Query  955   qrarqqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELR  776
             QRARQQGIFISSS DQ+ SMSGNGALAFD+EYARWLEEHNR+INELR AVN+HAGD ELR
Sbjct  128   QRARQQGIFISSSVDQTHSMSGNGALAFDMEYARWLEEHNRQINELRSAVNAHAGDNELR  187

Query  775   IIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQL  596
              +VD IM+HYE+IF+ KG AAKADVFH+LSGMWKTPAERCFLWLGGFR SELLKLL  QL
Sbjct  188   GVVDKIMSHYEEIFKQKGNAAKADVFHVLSGMWKTPAERCFLWLGGFRPSELLKLLSTQL  247

Query  595   EPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQM  416
             EPLTEQQL  I NLQQSSQQAEDALSQGMEALQQSLAETLAGSLG SGS+GNVANYMGQM
Sbjct  248   EPLTEQQLSGIANLQQSSQQAEDALSQGMEALQQSLAETLAGSLGSSGSTGNVANYMGQM  307

Query  415   AMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDY  275
             AMAMGKLGTLE F+RQADNLRQQTLQQM RILTTRQ+ARA L ISDY
Sbjct  308   AMAMGKLGTLENFLRQADNLRQQTLQQMQRILTTRQSARALLVISDY  354



>ref|XP_004970302.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X1 [Setaria 
italica]
 ref|XP_004970303.1| PREDICTED: transcription factor HBP-1b(c1)-like isoform X2 [Setaria 
italica]
Length=473

 Score =   406 bits (1044),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 253/321 (79%), Positives = 280/321 (87%), Gaps = 5/321 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SP TDTSTD DT+++N  F+     G   SD SD++RD   QKTLRRLAQN
Sbjct  138   WGESAMAD-SPMTDTSTDPDTDERNQMFEQGLVAGPTASDSSDKSRDKLDQKTLRRLAQN  196

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAY+Q LE+SR+KLTQLEQELQRARQQGIFIS+SGDQ QS SGNGALAF
Sbjct  197   REAARKSRLRKKAYIQNLESSRLKLTQLEQELQRARQQGIFISTSGDQPQSTSGNGALAF  256

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D+EYARWLEEHN+ +NELR AVN+HAGD +LR IVDSIMAHY++IFR+KG AAKADVFH+
Sbjct  257   DMEYARWLEEHNKHVNELRAAVNAHAGDNDLRGIVDSIMAHYDEIFRLKGVAAKADVFHV  316

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCF+WLGGFRSSELLKLL  QLEPLT+QQL+ I+NLQQSSQQAEDALSQG
Sbjct  317   LSGMWKTPAERCFMWLGGFRSSELLKLLAGQLEPLTDQQLVGISNLQQSSQQAEDALSQG  376

Query  511   MEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETLA    GP+GSSGNVA+YMGQMAMAMGKLGTLE F+RQADNLR QTLQQ
Sbjct  377   MEALQQSLAETLASGSLGPAGSSGNVASYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQ  436

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L ISDYF
Sbjct  437   MQRILTTRQSARALLAISDYF  457



>gb|ADW40546.1| bZIP transcription factor [Saccharum hybrid cultivar Q117]
Length=331

 Score =   401 bits (1030),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 249/312 (80%), Positives = 276/312 (88%), Gaps = 4/312 (1%)
 Frame = -1

Query  1195  SPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAARKSRL  1025
             SP TDTSTD DT+++N  F+         SD SD++RD   QKTLRRLAQNREAARKSRL
Sbjct  4     SPMTDTSTDPDTDERNQMFEQGLVPVPTASDSSDKSRDKLDQKTLRRLAQNREAARKSRL  63

Query  1024  RKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLE  845
             RKKAY+Q LE+SR+KLTQLEQELQRARQQGIFIS+SGDQ+QS SGNGALAFD+EYARWLE
Sbjct  64    RKKAYIQNLESSRLKLTQLEQELQRARQQGIFISTSGDQAQSTSGNGALAFDMEYARWLE  123

Query  844   EHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPA  665
             EHN+ +NELR AVN+HAGD +LR IVDSIMAHY++IFR+KG AAKADVFH+LSGMWKTPA
Sbjct  124   EHNKHVNELRAAVNAHAGDNDLRGIVDSIMAHYDEIFRLKGVAAKADVFHVLSGMWKTPA  183

Query  664   ERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLA  485
             ERCF+WLGGFRSSELLKLL   LEPLT+QQL+ I+NLQQSSQQAEDALSQGMEALQQSLA
Sbjct  184   ERCFMWLGGFRSSELLKLLAXHLEPLTDQQLIGISNLQQSSQQAEDALSQGMEALQQSLA  243

Query  484   ETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  308
             ETLA  SLGP+G SGNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQM RILTTRQ
Sbjct  244   ETLASGSLGPAGPSGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQMQRILTTRQ  303

Query  307   AARAFLGISDYF  272
             +ARA L ISDYF
Sbjct  304   SARALLAISDYF  315



>ref|XP_010673023.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
isoform X3 [Beta vulgaris subsp. vulgaris]
Length=332

 Score =   401 bits (1030),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 245/317 (77%), Positives = 272/317 (86%), Gaps = 6/317 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQNREAA  1040
             MAD SPRTDTSTD   + +N   +  H      SD S+R++    DQK+LRRLAQNREAA
Sbjct  1     MADASPRTDTSTDDTED-RNPLLEAGHINSKAASDSSERSKEKVTDQKSLRRLAQNREAA  59

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFIS++GDQS  + GNGALAFD EY
Sbjct  60    RKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISNAGDQSHGLGGNGALAFDAEY  119

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEE NR INELR AVNSHA D EL+ +V S+ AH+++IFR+KG AAKADVFHILSGM
Sbjct  120   ARWLEEQNRMINELRTAVNSHASDTELQTVVKSVAAHFDEIFRLKGVAAKADVFHILSGM  179

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCF+W+GGFR SELLKLL+NQLEPLTEQQL+ I NLQQSSQQAE+ALSQGMEAL
Sbjct  180   WKTPAERCFMWIGGFRPSELLKLLVNQLEPLTEQQLVNIYNLQQSSQQAEEALSQGMEAL  239

Query  499   QQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRI  323
             QQSLAETLA  + G +GSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQMH I
Sbjct  240   QQSLAETLANGTAGSTGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMHLI  299

Query  322   LTTRQAARAFLGISDYF  272
             LTTRQ+ARA L I DYF
Sbjct  300   LTTRQSARAILSIHDYF  316



>ref|NP_001030678.1| transcription factor TGA6 [Arabidopsis thaliana]
 gb|AEE75175.1| transcription factor TGA6 [Arabidopsis thaliana]
Length=355

 Score =   402 bits (1032),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 240/338 (71%), Positives = 275/338 (81%), Gaps = 27/338 (8%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHAL--------------GIV----------GSDG  1100
             MAD S RTD STD DT+ +++GF   + +              GI+           SD 
Sbjct  1     MADTSSRTDVSTDGDTDHRDLGFYYLYNVTPGRLVPESLGKTWGILPSDRGHMHAAASDS  60

Query  1099  SDRTRD---QKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgif  929
             SDR++D   QKTLRRLAQNREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+F
Sbjct  61    SDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVF  120

Query  928   isssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAH  749
             ISSSGDQ+ S  GNGALAFD E++RWLEE NR++NELR A+N+HAGD ELRIIVD +MAH
Sbjct  121   ISSSGDQAHSTGGNGALAFDAEHSRWLEEKNRQMNELRSALNAHAGDTELRIIVDGVMAH  180

Query  748   YEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLL  569
             YE++FRIK  AAK DVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL NQLEP+TE+Q++
Sbjct  181   YEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVM  240

Query  568   AINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGT  389
              IN+LQQ+SQQAEDALSQGME+LQQSLA+TL+     S SS NVA+YMGQMAMAMG+LGT
Sbjct  241   GINSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGT  300

Query  388   LEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDY  275
             LEGFIRQADNLR QTLQQM R+LTTRQ+ARA L I DY
Sbjct  301   LEGFIRQADNLRLQTLQQMLRVLTTRQSARALLAIHDY  338



>ref|XP_008443255.1| PREDICTED: transcription factor HBP-1b(c38)-like [Cucumis melo]
Length=468

 Score =   405 bits (1042),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 236/296 (80%), Positives = 263/296 (89%), Gaps = 3/296 (1%)
 Frame = -1

Query  1156  DKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKL  977
             DK+ G  N+ A+    +   ++T DQKTLRRLAQNREAARKSRLRKKAYVQQLE+SR+KL
Sbjct  159   DKDQG--NSPAVYDSSNKSKEKTADQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKL  216

Query  976   TqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSH  797
             TQLEQELQRARQQGIFIS+SGDQ+ SMSGNGALAFDVEY+RWLEEHNR +NELR AVNSH
Sbjct  217   TQLEQELQRARQQGIFISNSGDQAHSMSGNGALAFDVEYSRWLEEHNRLMNELRAAVNSH  276

Query  796   AGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELL  617
             AGD ELR IVD++   ++DIFR+KG AAKADVFHILSGMWKTPAERCFLW+GGFRSSE+L
Sbjct  277   AGDTELRTIVDNVTTQFDDIFRLKGIAAKADVFHILSGMWKTPAERCFLWIGGFRSSEIL  336

Query  616   KLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsg-ssGN  440
             KLL+NQLEPL EQQL+ I NLQQ SQQAEDALSQGM+ALQQSLAETLA +   +  SSGN
Sbjct  337   KLLVNQLEPLAEQQLMGICNLQQLSQQAEDALSQGMDALQQSLAETLASATPATSGSSGN  396

Query  439   VANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             VANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQMHRILTTRQ+ARA L I+DYF
Sbjct  397   VANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMHRILTTRQSARALLAINDYF  452



>emb|CDY52616.1| BnaCnng22950D [Brassica napus]
Length=333

 Score =   400 bits (1029),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 232/313 (74%), Positives = 267/313 (85%), Gaps = 1/313 (0%)
 Frame = -1

Query  1210  MMADVSPRTDTSTDADTEDKNMGFQNNHALGIVG-SDGSDRTRDQKTLRRLAQNREAARK  1034
             +MAD S RTD STD DT+ +++  +    L +   S GS    DQKTLRRLAQNREAARK
Sbjct  4     LMADTSSRTDVSTDGDTDPRDLSDRGQTMLAVASDSSGSKDKLDQKTLRRLAQNREAARK  63

Query  1033  SRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYAR  854
             SRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S  GNGALAFD E++R
Sbjct  64    SRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHSR  123

Query  853   WLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWK  674
             WLEE NR++NELR A+N+HAGDAEL II+D +M HYE++FRIK  AAK DVFH+LSGMWK
Sbjct  124   WLEEKNRQMNELRSALNAHAGDAELLIILDGVMTHYEELFRIKSNAAKNDVFHLLSGMWK  183

Query  673   TPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQ  494
             TPAERCFLWLGGFRSSELLKLL NQLEP+TE+Q++ +N+LQQ+SQQAEDALSQGME+LQQ
Sbjct  184   TPAERCFLWLGGFRSSELLKLLANQLEPVTERQVMGLNSLQQTSQQAEDALSQGMESLQQ  243

Query  493   SLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTT  314
             SLA+TL+     S SS NVA+YMGQMAMAMG+LGTLEGFIRQADNLR QTLQQM R+LTT
Sbjct  244   SLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMIRVLTT  303

Query  313   RQAARAFLGISDY  275
             RQ+ARA L I DY
Sbjct  304   RQSARALLAIHDY  316



>emb|CDX98971.1| BnaC09g48640D [Brassica napus]
Length=328

 Score =   400 bits (1028),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 232/314 (74%), Positives = 269/314 (86%), Gaps = 6/314 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             MAD+SP TD STD D   +++G +         SD S+R++   DQKT+RRLAQNREAAR
Sbjct  1     MADMSPITDVSTDGD---RDLGSEGALVNNTAASDSSERSKNKLDQKTVRRLAQNREAAR  57

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISS+GDQ+ S  GNGALAFD EY+
Sbjct  58    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSTGDQAHSTGGNGALAFDAEYS  117

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N+R+NELR A+N+HAGD EL IIVD +MAHYE++FRIK  AAK DVFH+L GMW
Sbjct  118   RWLEEKNKRMNELRSALNAHAGDGELLIIVDGVMAHYEELFRIKSNAAKNDVFHLLYGMW  177

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSE+LKLL+NQLEP+TE+Q++ IN+LQ++SQQAEDALSQGME+LQ
Sbjct  178   KTPAERCFLWLGGFRSSEILKLLVNQLEPMTERQVMGINSLQETSQQAEDALSQGMESLQ  237

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SSGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  238   QSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLT  297

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L I DY
Sbjct  298   TRQSARALLAIHDY  311



>ref|XP_010464979.1| PREDICTED: transcription factor TGA6 isoform X1 [Camelina sativa]
 ref|XP_010464980.1| PREDICTED: transcription factor TGA6 isoform X1 [Camelina sativa]
 ref|XP_010464981.1| PREDICTED: transcription factor TGA6 isoform X1 [Camelina sativa]
 ref|XP_010464982.1| PREDICTED: transcription factor TGA6 isoform X1 [Camelina sativa]
Length=337

 Score =   400 bits (1029),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 234/320 (73%), Positives = 269/320 (84%), Gaps = 9/320 (3%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAAR  1037
             MAD S RTD STD DT+ ++ G +    +    SD SDR++D   QKTLRRLAQNREAAR
Sbjct  1     MADTSSRTDVSTDGDTDHRDQGSERGQMMLAAASDSSDRSKDKLDQKTLRRLAQNREAAR  60

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S  GNGALAFD E++
Sbjct  61    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHS  120

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N+++NELR A+N+HAGD ELR IVD +MAHYE++FRIK  AAK DVFH+LSGMW
Sbjct  121   RWLEEKNKQMNELRSALNAHAGDTELRTIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMW  180

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL NQLEP+TE+Q++ +N+LQQ+SQQAEDALSQGME+LQ
Sbjct  181   KTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVMGLNSLQQTSQQAEDALSQGMESLQ  240

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIR------QADNLRQQTLQQ  335
             QSLA+TL+     S SS NVA+YMGQMAMAMG+LGTLEGFIR      QADNLR QTLQQ
Sbjct  241   QSLADTLSSGTLGSTSSDNVASYMGQMAMAMGQLGTLEGFIRQGISWWQADNLRLQTLQQ  300

Query  334   MHRILTTRQAARAFLGISDY  275
             M R+LTTRQ+ARA L I DY
Sbjct  301   MLRVLTTRQSARALLAIHDY  320



>ref|XP_010228694.1| PREDICTED: transcription factor TGA2-like isoform X2 [Brachypodium 
distachyon]
Length=314

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 234/279 (84%), Positives = 257/279 (92%), Gaps = 0/279 (0%)
 Frame = -1

Query  1108  SDGSDRTRDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgif  929
             SD SDR  DQK LRRLAQNREAARKSRLRKKAYVQQLE+S++KL  LEQELQ+ARQQGIF
Sbjct  20    SDRSDRPMDQKVLRRLAQNREAARKSRLRKKAYVQQLESSKLKLASLEQELQKARQQGIF  79

Query  928   isssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAH  749
             ISSSGDQ+ +MSGNGA+ FD+EY RWLEE N++INELR AVN+HA D++LR+IVD IMAH
Sbjct  80    ISSSGDQTHAMSGNGAMTFDLEYTRWLEEQNKQINELRTAVNAHASDSDLRLIVDGIMAH  139

Query  748   YEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLL  569
             Y++IF++KG AAKADVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQLL
Sbjct  140   YDEIFKLKGAAAKADVFHMLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLL  199

Query  568   AINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGT  389
              ++NLQQSSQQAEDALSQGMEALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGT
Sbjct  200   GLSNLQQSSQQAEDALSQGMEALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGT  259

Query  388   LEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             LE F+RQADNLRQQTL QM RILT RQAARA L I DYF
Sbjct  260   LENFLRQADNLRQQTLHQMQRILTIRQAARALLAIHDYF  298



>ref|XP_010228695.1| PREDICTED: transcription factor TGA2-like isoform X3 [Brachypodium 
distachyon]
Length=312

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 234/279 (84%), Positives = 257/279 (92%), Gaps = 0/279 (0%)
 Frame = -1

Query  1108  SDGSDRTRDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgif  929
             SD SDR  DQK LRRLAQNREAARKSRLRKKAYVQQLE+S++KL  LEQELQ+ARQQGIF
Sbjct  18    SDRSDRPMDQKVLRRLAQNREAARKSRLRKKAYVQQLESSKLKLASLEQELQKARQQGIF  77

Query  928   isssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAH  749
             ISSSGDQ+ +MSGNGA+ FD+EY RWLEE N++INELR AVN+HA D++LR+IVD IMAH
Sbjct  78    ISSSGDQTHAMSGNGAMTFDLEYTRWLEEQNKQINELRTAVNAHASDSDLRLIVDGIMAH  137

Query  748   YEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLL  569
             Y++IF++KG AAKADVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQLL
Sbjct  138   YDEIFKLKGAAAKADVFHMLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLL  197

Query  568   AINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGT  389
              ++NLQQSSQQAEDALSQGMEALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGT
Sbjct  198   GLSNLQQSSQQAEDALSQGMEALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGT  257

Query  388   LEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             LE F+RQADNLRQQTL QM RILT RQAARA L I DYF
Sbjct  258   LENFLRQADNLRQQTLHQMQRILTIRQAARALLAIHDYF  296



>ref|XP_009122312.1| PREDICTED: transcription factor TGA2 [Brassica rapa]
 ref|XP_009122313.1| PREDICTED: transcription factor TGA2 [Brassica rapa]
 ref|XP_009122314.1| PREDICTED: transcription factor TGA2 [Brassica rapa]
 ref|XP_009122315.1| PREDICTED: transcription factor TGA2 [Brassica rapa]
Length=327

 Score =   399 bits (1026),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 235/314 (75%), Positives = 269/314 (86%), Gaps = 7/314 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             MAD+SP TD STD D +  + G   N A     SD S+R++   DQKT+RRLAQNREAAR
Sbjct  1     MADMSPLTDVSTDGDRDLGSEGALVNTA----ASDSSERSKNKLDQKTVRRLAQNREAAR  56

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S  GNGALAFD EY+
Sbjct  57    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEYS  116

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N+R+NELR A+N+HAGD EL IIVD +MAHYE++FRIK  AAK DVFH+L GMW
Sbjct  117   RWLEEKNKRMNELRSALNAHAGDGELLIIVDGVMAHYEELFRIKSNAAKNDVFHLLYGMW  176

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSE+LKLL+NQLEP+TE+Q++ IN+LQ++SQQAEDALSQGME+LQ
Sbjct  177   KTPAERCFLWLGGFRSSEILKLLVNQLEPMTERQVMGINSLQETSQQAEDALSQGMESLQ  236

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SSGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  237   QSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLT  296

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L I DY
Sbjct  297   TRQSARALLAIHDY  310



>ref|XP_010423270.1| PREDICTED: transcription factor TGA2 [Camelina sativa]
 ref|XP_010423271.1| PREDICTED: transcription factor TGA2 [Camelina sativa]
 ref|XP_010452643.1| PREDICTED: transcription factor TGA2 [Camelina sativa]
 ref|XP_010452644.1| PREDICTED: transcription factor TGA2 [Camelina sativa]
 ref|XP_010491277.1| PREDICTED: transcription factor TGA2 [Camelina sativa]
 ref|XP_010491278.1| PREDICTED: transcription factor TGA2 [Camelina sativa]
 ref|XP_010491279.1| PREDICTED: transcription factor TGA2 [Camelina sativa]
 ref|XP_010491280.1| PREDICTED: transcription factor TGA2 [Camelina sativa]
 ref|XP_010491282.1| PREDICTED: transcription factor TGA2 [Camelina sativa]
 ref|XP_010491283.1| PREDICTED: transcription factor TGA2 [Camelina sativa]
Length=330

 Score =   399 bits (1026),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 242/315 (77%), Positives = 273/315 (87%), Gaps = 4/315 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             MAD SPRTD STD DT+  ++G +   A     SD SDR++   DQKTLRRLAQNREAAR
Sbjct  1     MADTSPRTDVSTDDDTDHPDLGSEGALA-NTAASDSSDRSKGKMDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISS+GDQ+ S  GNGALAFD E++
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSTGDQAHSTGGNGALAFDAEHS  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N+++NELR A+N+HAGDAELR IVD +MAHYE++FRIK  AAK DVFH+LSGMW
Sbjct  120   RWLEEKNKQMNELRSALNAHAGDAELRTIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL NQLEP+TE+QL+ INNLQQ+SQQAEDALSQGME+LQ
Sbjct  180   KTPAERCFLWLGGFRSSELLKLLANQLEPMTERQLVGINNLQQTSQQAEDALSQGMESLQ  239

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SSGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  240   QSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLT  299

Query  316   TRQAARAFLGISDYF  272
             TRQ+ARA L I DYF
Sbjct  300   TRQSARALLAIHDYF  314



>ref|NP_196312.1| transcription factor TGA2 [Arabidopsis thaliana]
 ref|NP_974744.1| transcription factor TGA2 [Arabidopsis thaliana]
 ref|NP_001031845.1| transcription factor TGA2 [Arabidopsis thaliana]
 ref|NP_001078539.1| transcription factor TGA2 [Arabidopsis thaliana]
 sp|P43273.1|TGA2_ARATH RecName: Full=Transcription factor TGA2; AltName: Full=HBP-1b 
homolog; Short=AHBP-1b; AltName: Full=bZIP transcription factor 
20; Short=AtbZIP20 [Arabidopsis thaliana]
 dbj|BAA00933.1| AHBP-1b [Arabidopsis thaliana]
 dbj|BAB11153.1| transcription factor HBP-1b homolog [Arabidopsis thaliana]
 dbj|BAC42338.1| putative bZip transcription factor AtbZip20/tga2 [Arabidopsis 
thaliana]
 gb|AAP04119.1| putative bZIP transcription factor, HBP-1b homolog [Arabidopsis 
thaliana]
 gb|ABR46117.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46118.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46119.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46120.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46121.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46122.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46123.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46124.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46125.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46127.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46128.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46129.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46130.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46133.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46134.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46135.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46136.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|AED91085.1| transcription factor TGA2 [Arabidopsis thaliana]
 gb|AED91086.1| transcription factor TGA2 [Arabidopsis thaliana]
 gb|AED91087.1| transcription factor TGA2 [Arabidopsis thaliana]
 gb|AED91088.1| transcription factor TGA2 [Arabidopsis thaliana]
Length=330

 Score =   399 bits (1025),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 240/315 (76%), Positives = 273/315 (87%), Gaps = 4/315 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             MAD SPRTD STD DT+  ++G +    +    SD SDR++   DQKTLRRLAQNREAAR
Sbjct  1     MADTSPRTDVSTDDDTDHPDLGSEGA-LVNTAASDSSDRSKGKMDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FIS +GDQ+ S  GNGALAFD E++
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISGTGDQAHSTGGNGALAFDAEHS  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N+++NELR A+N+HAGD+ELRIIVD +MAHYE++FRIK  AAK DVFH+LSGMW
Sbjct  120   RWLEEKNKQMNELRSALNAHAGDSELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL NQLEP+TE+QL+ INNLQQ+SQQAEDALSQGME+LQ
Sbjct  180   KTPAERCFLWLGGFRSSELLKLLANQLEPMTERQLMGINNLQQTSQQAEDALSQGMESLQ  239

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SSGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  240   QSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLT  299

Query  316   TRQAARAFLGISDYF  272
             TRQ+ARA L I DYF
Sbjct  300   TRQSARALLAIHDYF  314



>gb|ABR46126.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46131.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
 gb|ABR46132.1| bZIP transcription factor TGA2 [Arabidopsis thaliana]
Length=330

 Score =   399 bits (1025),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 240/315 (76%), Positives = 273/315 (87%), Gaps = 4/315 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             MAD SPRTD STD DT+  ++G +    +    SD SDR++   DQKTLRRLAQNREAAR
Sbjct  1     MADTSPRTDVSTDDDTDHPDLGSEGA-LVNTAASDSSDRSKGKMDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FIS +GDQ+ S  GNGALAFD E++
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISGTGDQAHSTGGNGALAFDAEHS  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N+++NELR A+N+HAGD+ELRIIVD +MAHYE++FRIK  AAK DVFH+LSGMW
Sbjct  120   RWLEEKNKQMNELRSALNAHAGDSELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKLL NQLEP+TE+QL+ INNLQQ+SQQAEDALSQGME+LQ
Sbjct  180   KTPAERCFLWLGGFRSSELLKLLANQLEPMTERQLIGINNLQQTSQQAEDALSQGMESLQ  239

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SSGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  240   QSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLT  299

Query  316   TRQAARAFLGISDYF  272
             TRQ+ARA L I DYF
Sbjct  300   TRQSARALLAIHDYF  314



>emb|CDX70053.1| BnaA10g24020D [Brassica napus]
Length=327

 Score =   399 bits (1025),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 234/314 (75%), Positives = 269/314 (86%), Gaps = 7/314 (2%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             MAD+SP TD STD D +  + G   N A     SD S+R++   DQKT+RRLAQNREAAR
Sbjct  1     MADMSPLTDVSTDGDRDLGSEGALVNTA----ASDSSERSKNKLDQKTVRRLAQNREAAR  56

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S  GNGALAFD EY+
Sbjct  57    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEYS  116

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RWLEE N+R+NE+R A+N+HAGD EL IIVD +MAHYE++FRIK  AAK DVFH+L GMW
Sbjct  117   RWLEEKNKRMNEMRSALNAHAGDGELLIIVDGVMAHYEELFRIKSNAAKNDVFHLLYGMW  176

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSE+LKLL+NQLEP+TE+Q++ IN+LQ++SQQAEDALSQGME+LQ
Sbjct  177   KTPAERCFLWLGGFRSSEILKLLVNQLEPMTERQVMGINSLQETSQQAEDALSQGMESLQ  236

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SSGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QTLQQM R+LT
Sbjct  237   QSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLT  296

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L I DY
Sbjct  297   TRQSARALLAIHDY  310



>ref|XP_010036354.1| PREDICTED: transcription factor TGA2-like isoform X1 [Eucalyptus 
grandis]
Length=450

 Score =   403 bits (1036),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 245/322 (76%), Positives = 274/322 (85%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD SPRTD+S+D   + +N   +   +  +  SD S R++    DQKTLRRLAQ
Sbjct  114   WGDSNMADTSPRTDSSSDDTDD-RNQRLEAGPSAALGASDSSGRSKEKAVDQKTLRRLAQ  172

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS S +GNGA+A
Sbjct  173   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSSNGNGAMA  232

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDVEYARWLEE NR INELR AVNSH GD ELRIIVD++  H++DI+R+K  AAKADVFH
Sbjct  233   FDVEYARWLEEQNRHINELRSAVNSHVGDTELRIIVDNVTTHFDDIYRLKDTAAKADVFH  292

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCFLWLGGFRSSELLKLLI+QLEPLT+QQ++ + NLQQ+SQQAEDALSQ
Sbjct  293   ILSGMWKTPAERCFLWLGGFRSSELLKLLISQLEPLTDQQMMGLYNLQQTSQQAEDALSQ  352

Query  514   GMEALQQSLAETLAgslg-psgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA S    + SSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTL 
Sbjct  353   GMEALQQSLAETLANSPPGSTESSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLL  412

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHR+LTTRQ+ARA L I DYF
Sbjct  413   QMHRLLTTRQSARALLAIHDYF  434



>ref|XP_010036355.1| PREDICTED: transcription factor TGA2-like isoform X2 [Eucalyptus 
grandis]
Length=449

 Score =   403 bits (1035),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 245/322 (76%), Positives = 274/322 (85%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD SPRTD+S+D   + +N   +   +  +  SD S R++    DQKTLRRLAQ
Sbjct  113   WGDSNMADTSPRTDSSSDDTDD-RNQRLEAGPSAALGASDSSGRSKEKAVDQKTLRRLAQ  171

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQS S +GNGA+A
Sbjct  172   NREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQSHSSNGNGAMA  231

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FDVEYARWLEE NR INELR AVNSH GD ELRIIVD++  H++DI+R+K  AAKADVFH
Sbjct  232   FDVEYARWLEEQNRHINELRSAVNSHVGDTELRIIVDNVTTHFDDIYRLKDTAAKADVFH  291

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCFLWLGGFRSSELLKLLI+QLEPLT+QQ++ + NLQQ+SQQAEDALSQ
Sbjct  292   ILSGMWKTPAERCFLWLGGFRSSELLKLLISQLEPLTDQQMMGLYNLQQTSQQAEDALSQ  351

Query  514   GMEALQQSLAETLAgslg-psgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA S    + SSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTL 
Sbjct  352   GMEALQQSLAETLANSPPGSTESSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLL  411

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMHR+LTTRQ+ARA L I DYF
Sbjct  412   QMHRLLTTRQSARALLAIHDYF  433



>gb|KGN59439.1| hypothetical protein Csa_3G819960 [Cucumis sativus]
Length=468

 Score =   403 bits (1035),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 235/296 (79%), Positives = 263/296 (89%), Gaps = 3/296 (1%)
 Frame = -1

Query  1156  DKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKL  977
             DK+ G  N+ A+    +   ++T DQKTLRRLAQNREAARKSRLRKKAYVQQLE+SR+KL
Sbjct  159   DKDQG--NSLAVYDSSNKSKEKTADQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKL  216

Query  976   TqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSH  797
             TQLEQELQRARQQGIFIS+SGDQ+ SMSGNGALAFDVEY+RWLEEHNR +NELR AVNSH
Sbjct  217   TQLEQELQRARQQGIFISNSGDQAHSMSGNGALAFDVEYSRWLEEHNRLMNELRAAVNSH  276

Query  796   AGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELL  617
             AGD ELR IVD++   ++DIFR+KG AAKADVFHILSGMWKTPAERCFLW+GGFRSSE+L
Sbjct  277   AGDTELRTIVDNVTTQFDDIFRLKGIAAKADVFHILSGMWKTPAERCFLWIGGFRSSEIL  336

Query  616   KLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsg-ssGN  440
             KLL++QLEPL EQQL+ I NLQQ SQQAEDALSQGM+ALQQSLAETLA +   +  SSGN
Sbjct  337   KLLVSQLEPLAEQQLMGICNLQQLSQQAEDALSQGMDALQQSLAETLASATPATSGSSGN  396

Query  439   VANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             VANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQMHRILTTRQ+ARA L I+DYF
Sbjct  397   VANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMHRILTTRQSARALLAINDYF  452



>ref|XP_007162093.1| hypothetical protein PHAVU_001G123300g [Phaseolus vulgaris]
 gb|AAK84890.1|AF402609_1 TGA-type basic leucine zipper protein TGA2.2 [Phaseolus vulgaris]
 gb|ESW34087.1| hypothetical protein PHAVU_001G123300g [Phaseolus vulgaris]
Length=460

 Score =   402 bits (1034),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 251/318 (79%), Positives = 274/318 (86%), Gaps = 7/318 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREA  1043
             W    MAD SPRTDTSTD   +   +  +         SD S    DQKTLRRLAQNREA
Sbjct  133   WGETNMADASPRTDTSTDDTEDKNQLPERGE------SSDRSKDKSDQKTLRRLAQNREA  186

Query  1042  ARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVE  863
             ARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISS+GDQ+QSMSGNGA+AFDVE
Sbjct  187   ARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSTGDQAQSMSGNGAMAFDVE  246

Query  862   YARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSG  683
             YARWLEEHNR+ NELR A+NSHAGD ELR IVD+ MA ++DIFR+KG AAKADVFHILSG
Sbjct  247   YARWLEEHNRQTNELRAAINSHAGDIELRTIVDNFMAQFDDIFRLKGIAAKADVFHILSG  306

Query  682   MWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEA  503
             MWKTPAERCF+W+GGFRSSELLKLL++ LEPLTEQQL+ I NLQQSSQQAEDALSQGM+A
Sbjct  307   MWKTPAERCFMWIGGFRSSELLKLLVSHLEPLTEQQLMGIYNLQQSSQQAEDALSQGMDA  366

Query  502   LQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHR  326
             LQQSL+ETLA GS   SGSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQM R
Sbjct  367   LQQSLSETLANGSPSSSGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMLR  426

Query  325   ILTTRQAARAFLGISDYF  272
             ILTTRQ+ARA L ISDYF
Sbjct  427   ILTTRQSARALLAISDYF  444



>ref|XP_004136637.1| PREDICTED: TGACG-sequence-specific DNA-binding protein TGA-2.1-like 
[Cucumis sativus]
Length=470

 Score =   403 bits (1035),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 235/296 (79%), Positives = 263/296 (89%), Gaps = 3/296 (1%)
 Frame = -1

Query  1156  DKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKL  977
             DK+ G  N+ A+    +   ++T DQKTLRRLAQNREAARKSRLRKKAYVQQLE+SR+KL
Sbjct  161   DKDQG--NSLAVYDSSNKSKEKTADQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKL  218

Query  976   TqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSH  797
             TQLEQELQRARQQGIFIS+SGDQ+ SMSGNGALAFDVEY+RWLEEHNR +NELR AVNSH
Sbjct  219   TQLEQELQRARQQGIFISNSGDQAHSMSGNGALAFDVEYSRWLEEHNRLMNELRAAVNSH  278

Query  796   AGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELL  617
             AGD ELR IVD++   ++DIFR+KG AAKADVFHILSGMWKTPAERCFLW+GGFRSSE+L
Sbjct  279   AGDTELRTIVDNVTTQFDDIFRLKGIAAKADVFHILSGMWKTPAERCFLWIGGFRSSEIL  338

Query  616   KLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsg-ssGN  440
             KLL++QLEPL EQQL+ I NLQQ SQQAEDALSQGM+ALQQSLAETLA +   +  SSGN
Sbjct  339   KLLVSQLEPLAEQQLMGICNLQQLSQQAEDALSQGMDALQQSLAETLASATPATSGSSGN  398

Query  439   VANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             VANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQMHRILTTRQ+ARA L I+DYF
Sbjct  399   VANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMHRILTTRQSARALLAINDYF  454



>ref|XP_010673021.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=449

 Score =   402 bits (1032),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 246/322 (76%), Positives = 273/322 (85%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD SPRTDTSTD   + +N   +  H      SD S+R++    DQK+LRRLAQ
Sbjct  113   WAESNMADASPRTDTSTDDTED-RNPLLEAGHINSKAASDSSERSKEKVTDQKSLRRLAQ  171

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFIS++GDQS  + GNGALA
Sbjct  172   NREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISNAGDQSHGLGGNGALA  231

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD EYARWLEE NR INELR AVNSHA D EL+ +V S+ AH+++IFR+KG AAKADVFH
Sbjct  232   FDAEYARWLEEQNRMINELRTAVNSHASDTELQTVVKSVAAHFDEIFRLKGVAAKADVFH  291

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFR SELLKLL+NQLEPLTEQQL+ I NLQQSSQQAE+ALSQ
Sbjct  292   ILSGMWKTPAERCFMWIGGFRPSELLKLLVNQLEPLTEQQLVNIYNLQQSSQQAEEALSQ  351

Query  514   GMEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA  + G +GSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQ
Sbjct  352   GMEALQQSLAETLANGTAGSTGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQ  411

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMH ILTTRQ+ARA L I DYF
Sbjct  412   QMHLILTTRQSARAILSIHDYF  433



>ref|XP_010673022.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=426

 Score =   401 bits (1030),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 246/322 (76%), Positives = 273/322 (85%), Gaps = 6/322 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR----DQKTLRRLAQ  1055
             W    MAD SPRTDTSTD   + +N   +  H      SD S+R++    DQK+LRRLAQ
Sbjct  90    WAESNMADASPRTDTSTDDTED-RNPLLEAGHINSKAASDSSERSKEKVTDQKSLRRLAQ  148

Query  1054  NREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALA  875
             NREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFIS++GDQS  + GNGALA
Sbjct  149   NREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISNAGDQSHGLGGNGALA  208

Query  874   FDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFH  695
             FD EYARWLEE NR INELR AVNSHA D EL+ +V S+ AH+++IFR+KG AAKADVFH
Sbjct  209   FDAEYARWLEEQNRMINELRTAVNSHASDTELQTVVKSVAAHFDEIFRLKGVAAKADVFH  268

Query  694   ILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQ  515
             ILSGMWKTPAERCF+W+GGFR SELLKLL+NQLEPLTEQQL+ I NLQQSSQQAE+ALSQ
Sbjct  269   ILSGMWKTPAERCFMWIGGFRPSELLKLLVNQLEPLTEQQLVNIYNLQQSSQQAEEALSQ  328

Query  514   GMEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQ  338
             GMEALQQSLAETLA  + G +GSSGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQ
Sbjct  329   GMEALQQSLAETLANGTAGSTGSSGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQ  388

Query  337   QMHRILTTRQAARAFLGISDYF  272
             QMH ILTTRQ+ARA L I DYF
Sbjct  389   QMHLILTTRQSARAILSIHDYF  410



>ref|XP_003562427.1| PREDICTED: transcription factor HBP-1b(c38) [Brachypodium distachyon]
Length=340

 Score =   397 bits (1021),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 243/324 (75%), Positives = 270/324 (83%), Gaps = 12/324 (4%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSD------RTRDQKTLRRLAQNRE  1046
             MAD S RTDTST  D   KN   +   +  ++ S+ SD      +  DQKTLRRLAQNRE
Sbjct  1     MADASSRTDTSTVVDNHSKNHRLEQGQSGALMASNSSDRSDRSDKPLDQKTLRRLAQNRE  60

Query  1045  AARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDV  866
             AARKSRLRKK+YVQQLE+S++KL QLEQELQ+ARQQGIFISSSGDQ+ +MSGNGAL FD+
Sbjct  61    AARKSRLRKKSYVQQLESSKLKLAQLEQELQKARQQGIFISSSGDQTHAMSGNGALTFDI  120

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EY RWLEE N++INELR AVN+HA D++LR+IVD IMAHY++IF++KG AAKADVFHILS
Sbjct  121   EYTRWLEEQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFKVKGVAAKADVFHILS  180

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCFLWLGGFR SELLKLL N LEPLTEQQLL + NLQQSSQQAEDALSQGME
Sbjct  181   GMWKTPAERCFLWLGGFRPSELLKLLANHLEPLTEQQLLGLTNLQQSSQQAEDALSQGME  240

Query  505   ALQQSLAETLA------gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQT  344
             ALQQSLAETLA      GS G SGSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQT
Sbjct  241   ALQQSLAETLAGSLGTSGSSGSSGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQT  300

Query  343   LQQMHRILTTRQAARAFLGISDYF  272
             L QM RILT RQA+RA L I DYF
Sbjct  301   LHQMQRILTIRQASRALLAIHDYF  324



>ref|NP_001105448.1| octopine synthase binding factor3 [Zea mays]
 emb|CAA48904.1| ocs-element binding factor 3.2 [Zea mays]
Length=468

 Score =   401 bits (1031),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 251/321 (78%), Positives = 278/321 (87%), Gaps = 5/321 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SP TDTSTD DT+++N  F+         SD SD++RD   QKTLRRLAQN
Sbjct  133   WGESAMAD-SPMTDTSTDPDTDERNQMFEQGLVAVPTASDSSDKSRDKLDQKTLRRLAQN  191

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAY+Q LE+SR+KLTQLEQELQRARQQGIFIS+SGDQ QS SGNGALAF
Sbjct  192   REAARKSRLRKKAYIQNLESSRLKLTQLEQELQRARQQGIFISTSGDQPQSTSGNGALAF  251

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D+EYARWLEEHN+ +NELR AVN+HAGD +LR IVDSIM HY++IF++KG AAKADVFH+
Sbjct  252   DMEYARWLEEHNKHVNELRAAVNAHAGDNDLRCIVDSIMVHYDEIFKLKGVAAKADVFHV  311

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCF+WLGGFRSSELLKLL   LEPLT+QQL+ I+NLQQSSQQAEDALSQG
Sbjct  312   LSGMWKTPAERCFMWLGGFRSSELLKLLAGHLEPLTDQQLVGISNLQQSSQQAEDALSQG  371

Query  511   MEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETLA  SLGP+G SGNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQ
Sbjct  372   MEALQQSLAETLASGSLGPAGPSGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQ  431

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L ISDYF
Sbjct  432   MQRILTTRQSARALLAISDYF  452



>ref|XP_006826801.1| hypothetical protein AMTR_s00010p00030830 [Amborella trichopoda]
 gb|ERM94038.1| hypothetical protein AMTR_s00010p00030830 [Amborella trichopoda]
Length=445

 Score =   400 bits (1027),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 245/319 (77%), Positives = 273/319 (86%), Gaps = 2/319 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGS-DRTRDQKTLRRLAQNRE  1046
             W    MAD SPRTDTSTD DT++KN  F           D S D+T DQKTLRRLAQNRE
Sbjct  111   WGDSGMADTSPRTDTSTDVDTDEKNQQFLEGQRASSDSLDRSKDKTGDQKTLRRLAQNRE  170

Query  1045  AARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDV  866
             AARKSRLRKKAYVQQLE SR+KL QLEQELQRARQQGIFI+ +GDQ+ SM GNGALAFD+
Sbjct  171   AARKSRLRKKAYVQQLETSRLKLQQLEQELQRARQQGIFIAGAGDQNHSMGGNGALAFDM  230

Query  865   EYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILS  686
             EYARWL+EH R+IN+LR A+NSH G+ ELRI+VD++M HY++IFRIKG   K+DVFH+LS
Sbjct  231   EYARWLDEHQRQINDLRSAMNSHVGENELRILVDAVMQHYDEIFRIKGTGTKSDVFHMLS  290

Query  685   GMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGME  506
             GMWKTPAERCF+WLGGFRSSELLK+L++ LEPLTEQQL+ I NLQQSSQQAEDALSQGME
Sbjct  291   GMWKTPAERCFMWLGGFRSSELLKILLSHLEPLTEQQLMGICNLQQSSQQAEDALSQGME  350

Query  505   ALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMH  329
             ALQQSLAETLA    GP GSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTLQQ+H
Sbjct  351   ALQQSLAETLASGSLGPPGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLQQLH  410

Query  328   RILTTRQAARAFLGISDYF  272
             RILTTRQ+ARA L ISDYF
Sbjct  411   RILTTRQSARALLAISDYF  429



>gb|ACN31945.1| unknown [Zea mays]
 gb|AFW84810.1| putative bZIP transcription factor superfamily protein [Zea mays]
Length=469

 Score =   400 bits (1028),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 247/312 (79%), Positives = 274/312 (88%), Gaps = 4/312 (1%)
 Frame = -1

Query  1195  SPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAARKSRL  1025
             SP TDTSTD DT+++N  F+         SD SD++RD   QKTLRRLAQNREAARKSRL
Sbjct  142   SPMTDTSTDPDTDERNQMFEQGLVAVPTASDSSDKSRDKLDQKTLRRLAQNREAARKSRL  201

Query  1024  RKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLE  845
             RKKAY+Q LE+SR+KLTQLEQELQRARQQGIFIS+SGDQ QS SGNGALAFD+EYARWLE
Sbjct  202   RKKAYIQNLESSRLKLTQLEQELQRARQQGIFISTSGDQPQSTSGNGALAFDMEYARWLE  261

Query  844   EHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPA  665
             EHN+ +NELR AVN+HAGD +LR IVDSIM HY++IF++KG AAKADVFH+LSGMWKTPA
Sbjct  262   EHNKHVNELRAAVNAHAGDNDLRCIVDSIMVHYDEIFKLKGVAAKADVFHVLSGMWKTPA  321

Query  664   ERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLA  485
             ERCF+WLGGFRSSELLKLL   LEPLT+QQL+ I+NLQQSSQQAEDALSQGMEALQQSLA
Sbjct  322   ERCFMWLGGFRSSELLKLLAGHLEPLTDQQLVGISNLQQSSQQAEDALSQGMEALQQSLA  381

Query  484   ETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  308
             ETLA  SLGP+G SGNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQM RILTTRQ
Sbjct  382   ETLASGSLGPAGPSGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQMQRILTTRQ  441

Query  307   AARAFLGISDYF  272
             +ARA L ISDYF
Sbjct  442   SARALLAISDYF  453



>ref|XP_008786824.1| PREDICTED: transcription factor TGA2-like isoform X2 [Phoenix 
dactylifera]
Length=468

 Score =   400 bits (1028),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 260/321 (81%), Positives = 280/321 (87%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQN  1052
             W    MAD SPRTDTSTD DT+DK+   +   A     SD SD+++   DQKTLRRLAQN
Sbjct  132   WGESTMADTSPRTDTSTDVDTDDKSQRLEQGQAAIAAASDSSDKSKDKMDQKTLRRLAQN  191

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSSGDQS SM GNGALAF
Sbjct  192   REAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSGDQSHSMGGNGALAF  251

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D+EYARWLEEHNR+INELR AVNSHA D +LR IVDSIMAHY++IFR+K  AAKADVFH+
Sbjct  252   DMEYARWLEEHNRQINELRAAVNSHASDNDLRTIVDSIMAHYDEIFRLKSVAAKADVFHM  311

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL +QLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  312   LSGMWKTPAERCFLWLGGFRSSELLKLLASQLEPLTEQQLMGICNLQQSSQQAEDALSQG  371

Query  511   MEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETL+    GP+GSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTLQQ
Sbjct  372   MEALQQSLAETLSSGSLGPAGSSGNVANYMGQMAMAMGKLGTLESFLRQADNLRQQTLQQ  431

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L I DYF
Sbjct  432   MIRILTTRQSARALLAIHDYF  452



>ref|XP_008786823.1| PREDICTED: transcription factor TGA2-like isoform X1 [Phoenix 
dactylifera]
Length=470

 Score =   400 bits (1027),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 260/321 (81%), Positives = 280/321 (87%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQN  1052
             W    MAD SPRTDTSTD DT+DK+   +   A     SD SD+++   DQKTLRRLAQN
Sbjct  134   WGESTMADTSPRTDTSTDVDTDDKSQRLEQGQAAIAAASDSSDKSKDKMDQKTLRRLAQN  193

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSSGDQS SM GNGALAF
Sbjct  194   REAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSGDQSHSMGGNGALAF  253

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D+EYARWLEEHNR+INELR AVNSHA D +LR IVDSIMAHY++IFR+K  AAKADVFH+
Sbjct  254   DMEYARWLEEHNRQINELRAAVNSHASDNDLRTIVDSIMAHYDEIFRLKSVAAKADVFHM  313

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL +QLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  314   LSGMWKTPAERCFLWLGGFRSSELLKLLASQLEPLTEQQLMGICNLQQSSQQAEDALSQG  373

Query  511   MEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETL+    GP+GSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTLQQ
Sbjct  374   MEALQQSLAETLSSGSLGPAGSSGNVANYMGQMAMAMGKLGTLESFLRQADNLRQQTLQQ  433

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L I DYF
Sbjct  434   MIRILTTRQSARALLAIHDYF  454



>ref|XP_006644065.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Oryza 
brachyantha]
Length=323

 Score =   394 bits (1012),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 249/315 (79%), Positives = 268/315 (85%), Gaps = 13/315 (4%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MAD+SPRTDTSTD      N   +   A  +  SD SDR++D    QKTLRRLAQNREAA
Sbjct  1     MADMSPRTDTSTDDTD--DNHMLEPGQAALVAASDSSDRSKDKHEDQKTLRRLAQNREAA  58

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSS DQ+ SMSGNGALAFD+EY
Sbjct  59    RKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSVDQTHSMSGNGALAFDMEY  118

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR+INELR AVN+HA D ELR +VD IM+HYE+IF+ KG AAKADVFH+LSGM
Sbjct  119   ARWLEEHNRQINELRSAVNAHASDNELRAVVDKIMSHYEEIFKQKGSAAKADVFHVLSGM  178

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFR SELLKLL  QLEPLTEQQL  I+NLQQSSQQAEDALSQGMEAL
Sbjct  179   WKTPAERCFLWLGGFRPSELLKLLSTQLEPLTEQQLSGISNLQQSSQQAEDALSQGMEAL  238

Query  499   QQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QQSLAETLAGSLG SGS+GNVANYMGQMAMAMGKLGTLE F+R       QTLQQM RIL
Sbjct  239   QQSLAETLAGSLGSSGSTGNVANYMGQMAMAMGKLGTLENFLR-------QTLQQMQRIL  291

Query  319   TTRQAARAFLGISDY  275
             TTRQ+ARA L ISDY
Sbjct  292   TTRQSARALLVISDY  306



>ref|XP_010464987.1| PREDICTED: transcription factor TGA6 isoform X5 [Camelina sativa]
Length=356

 Score =   394 bits (1013),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 239/339 (71%), Positives = 273/339 (81%), Gaps = 28/339 (8%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMG--FQNNH-----ALGIVG------------------SD  1103
             MAD S RTD STD DT+ ++ G  F  N      A G +G                  SD
Sbjct  1     MADTSSRTDVSTDGDTDHRDQGVYFLENVTRGRLAPGSLGKTWDDLPSERGQMMLAAASD  60

Query  1102  GSDRTRD---QKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgi  932
              SDR++D   QKTLRRLAQNREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+
Sbjct  61    SSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGV  120

Query  931   fisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMA  752
             FISSSGDQ+ S  GNGALAFD E++RWLEE N+++NELR A+N+HAGD ELR IVD +MA
Sbjct  121   FISSSGDQAHSTGGNGALAFDAEHSRWLEEKNKQMNELRSALNAHAGDTELRTIVDGVMA  180

Query  751   HYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQL  572
             HYE++FRIK  AAK DVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL NQLEP+TE+Q+
Sbjct  181   HYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQV  240

Query  571   LAINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLG  392
             + +N+LQQ+SQQAEDALSQGME+LQQSLA+TL+     S SS NVA+YMGQMAMAMG+LG
Sbjct  241   MGLNSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSTSSDNVASYMGQMAMAMGQLG  300

Query  391   TLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDY  275
             TLEGFIRQADNLR QTLQQM R+LTTRQ+ARA L I DY
Sbjct  301   TLEGFIRQADNLRLQTLQQMLRVLTTRQSARALLAIHDY  339



>ref|XP_010486922.1| PREDICTED: transcription factor TGA6 isoform X3 [Camelina sativa]
Length=356

 Score =   394 bits (1013),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 237/339 (70%), Positives = 270/339 (80%), Gaps = 28/339 (8%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMG--FQNNHALG-----------------------IVGSD  1103
             MAD S RTD STD DT+ ++ G  F  N   G                          SD
Sbjct  1     MADTSSRTDVSTDGDTDHRDQGLYFLENVTRGKLEPGSLGKTWDDLPSERGQMMLAAASD  60

Query  1102  GSDRTRD---QKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgi  932
              SDR++D   QKTLRRLAQNREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+
Sbjct  61    SSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGV  120

Query  931   fisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMA  752
             FISSSGDQ+ S  GNGALAFD E++RWLEE N+++NELR A+N+HAGD ELR IVD +MA
Sbjct  121   FISSSGDQAHSTGGNGALAFDAEHSRWLEEKNKQMNELRSALNAHAGDTELRTIVDGVMA  180

Query  751   HYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQL  572
             HYE++FRIK  AAK DVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL NQLEP+TE+Q+
Sbjct  181   HYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQV  240

Query  571   LAINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLG  392
             + +N+LQQ+SQQAEDALSQGME+LQQSLA+TL+     S SS NVA+YMGQMAMAMG+LG
Sbjct  241   MGLNSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSTSSDNVASYMGQMAMAMGQLG  300

Query  391   TLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDY  275
             TLEGFIRQADNLR QTLQQM R+LTTRQ+ARA L I DY
Sbjct  301   TLEGFIRQADNLRLQTLQQMLRVLTTRQSARALLAIHDY  339



>ref|XP_010498804.1| PREDICTED: transcription factor TGA6-like isoform X4 [Camelina 
sativa]
Length=356

 Score =   394 bits (1013),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 237/339 (70%), Positives = 271/339 (80%), Gaps = 28/339 (8%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMG--FQNNHALGIV-----------------------GSD  1103
             MAD S RTD STD DT+ ++ G  F  N   G +                        SD
Sbjct  1     MADTSSRTDVSTDGDTDHRDQGLYFLENVTRGKLEPGSLGKTWDDLPSERGQMMLAAASD  60

Query  1102  GSDRTRD---QKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgi  932
              SDR++D   QKTLRRLAQNREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+
Sbjct  61    SSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGV  120

Query  931   fisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMA  752
             FISSSGDQ+ S  GNGALAFD E++RWLEE N+++NELR A+N+HAGD ELR IVD +MA
Sbjct  121   FISSSGDQAHSTGGNGALAFDAEHSRWLEEKNKQMNELRSALNAHAGDTELRTIVDGVMA  180

Query  751   HYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQL  572
             HYE++FRIK  AAK DVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL NQLEP+TE+Q+
Sbjct  181   HYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQV  240

Query  571   LAINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLG  392
             + +N+LQQ+SQQAEDALSQGME+LQQSLA+TL+     S SS NVA+YMGQMAMAMG+LG
Sbjct  241   MGLNSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSTSSDNVASYMGQMAMAMGQLG  300

Query  391   TLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDY  275
             TLEGFIRQADNLR QTLQQM R+LTTRQ+ARA L I DY
Sbjct  301   TLEGFIRQADNLRLQTLQQMLRVLTTRQSARALLAIHDY  339



>ref|XP_008651314.1| PREDICTED: uncharacterized protein LOC100279481 isoform X2 [Zea 
mays]
 ref|XP_008651315.1| PREDICTED: uncharacterized protein LOC100279481 isoform X2 [Zea 
mays]
 ref|XP_008651316.1| PREDICTED: uncharacterized protein LOC100279481 isoform X2 [Zea 
mays]
 ref|XP_008651317.1| PREDICTED: uncharacterized protein LOC100279481 isoform X2 [Zea 
mays]
Length=360

 Score =   394 bits (1013),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 247/344 (72%), Positives = 275/344 (80%), Gaps = 32/344 (9%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKN-------------------------MGFQNNHALGIV---  1112
             MAD S RTDTS   D  DKN                         + +Q  +  G V   
Sbjct  1     MADASSRTDTSIVLDDNDKNHRVFVGYDQTISTNFEQAFLQLVLPLAYQMENGSGAVVPS  60

Query  1111  ----GSDGSDRTRDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrar  944
                  SD SD+  DQKT+RRLAQNREAARKSRLRKKAYVQQLE+S++KL QLEQELQ+AR
Sbjct  61    NSSDRSDRSDKPLDQKTMRRLAQNREAARKSRLRKKAYVQQLESSKLKLAQLEQELQKAR  120

Query  943   qqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVD  764
             QQGIFISSSGDQ+ +MSGNGAL FD+EYARWLE+ N++INELR AVN+HA D++LR+IVD
Sbjct  121   QQGIFISSSGDQTHAMSGNGALTFDIEYARWLEDQNKQINELRTAVNAHASDSDLRLIVD  180

Query  763   SIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLT  584
              IMAHY++IF++KG AAKADVFHILSGMWKTPAERCFLWLGGFR SELLKLL N LEPLT
Sbjct  181   GIMAHYDEIFKVKGVAAKADVFHILSGMWKTPAERCFLWLGGFRPSELLKLLANHLEPLT  240

Query  583   EQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAM  404
             EQQ+L + NLQQSSQQAEDALSQGMEALQQSLAETLAGSLGP+GSSGNVANYMGQMAMAM
Sbjct  241   EQQMLGLTNLQQSSQQAEDALSQGMEALQQSLAETLAGSLGPAGSSGNVANYMGQMAMAM  300

Query  403   GKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             GKLGTLE F+RQADNLRQQTL QM RILT RQA+RA L I DYF
Sbjct  301   GKLGTLENFLRQADNLRQQTLHQMQRILTIRQASRALLAIHDYF  344



>gb|ACU20527.1| unknown [Glycine max]
Length=425

 Score =   396 bits (1018),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 235/293 (80%), Positives = 258/293 (88%), Gaps = 5/293 (2%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQN  1052
             W    MAD SPRTD STD DT+DKN  F  N AL  V SD SDR++D   QKTLRRLAQN
Sbjct  134   WEESTMADASPRTDISTDGDTDDKNHPFDRNQALTAV-SDSSDRSKDKSDQKTLRRLAQN  192

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ+ ++SGNGA+ F
Sbjct  193   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQAHTLSGNGAMQF  252

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D EYARWLEE NR+INELR AVNSHA D ELR+IVD I+AHY++IFR+KG AAKADVFH+
Sbjct  253   DAEYARWLEEQNRQINELRAAVNSHASDTELRMIVDGILAHYDEIFRLKGVAAKADVFHL  312

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL++QLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  313   LSGMWKTPAERCFLWLGGFRSSELLKLLVSQLEPLTEQQLMGITNLQQSSQQAEDALSQG  372

Query  511   MEALQQSLAETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNL  356
             MEALQQSLAETL+  +   SGSSGNVA+YMGQMAMAMGKLGTLEGFI+QADNL
Sbjct  373   MEALQQSLAETLSTGAPASSGSSGNVASYMGQMAMAMGKLGTLEGFIQQADNL  425



>ref|XP_004162630.1| PREDICTED: LOW QUALITY PROTEIN: TGACG-sequence-specific DNA-binding 
protein TGA-2.1-like [Cucumis sativus]
Length=471

 Score =   398 bits (1023),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 235/297 (79%), Positives = 263/297 (89%), Gaps = 4/297 (1%)
 Frame = -1

Query  1156  DKNMGFQNNHALGIVGSDGSDRTRDQKTLRRLAQNREAARKSRLRKK-AYVQQLENSRMK  980
             DK+ G  N+ A+    +   ++T DQKTLRRLAQNREAARKSRLRKK AYVQQLE+SR+K
Sbjct  161   DKDQG--NSLAVYDSSNKSKEKTADQKTLRRLAQNREAARKSRLRKKXAYVQQLESSRLK  218

Query  979   LTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNS  800
             LTQLEQELQRARQQGIFIS+SGDQ+ SMSGNGALAFDVEY+RWLEEHNR +NELR AVNS
Sbjct  219   LTQLEQELQRARQQGIFISNSGDQAHSMSGNGALAFDVEYSRWLEEHNRLMNELRAAVNS  278

Query  799   HAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSEL  620
             HAGD ELR IVD++   ++DIFR+KG AAKADVFHILSGMWKTPAERCFLW+GGFRSSE+
Sbjct  279   HAGDTELRTIVDNVTTQFDDIFRLKGIAAKADVFHILSGMWKTPAERCFLWIGGFRSSEI  338

Query  619   LKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsg-ssG  443
             LKLL++QLEPL EQQL+ I NLQQ SQQAEDALSQGM+ALQQSLAETLA +   +  SSG
Sbjct  339   LKLLVSQLEPLAEQQLMGICNLQQLSQQAEDALSQGMDALQQSLAETLASATPATSGSSG  398

Query  442   NVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             NVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQMHRILTTRQ+ARA L I+DYF
Sbjct  399   NVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMHRILTTRQSARALLAINDYF  455



>gb|AFO63289.1| bZIP10 [Tamarix hispida]
Length=454

 Score =   397 bits (1019),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 235/298 (79%), Positives = 260/298 (87%), Gaps = 5/298 (2%)
 Frame = -1

Query  1153  KNMGFQNNHALGIVGSDGS-DRTRDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKL  977
             K+ G Q N A+     DGS ++  DQKTLRRLAQNREAARKSRLRKKAYVQQLENSR+KL
Sbjct  142   KSGGGQIN-AMSADSGDGSKEKNLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKL  200

Query  976   TqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSH  797
             TQLEQELQRARQQGIFI+SSGDQS S  G GA+AFD EYARWLEE NR +NELR AVNSH
Sbjct  201   TQLEQELQRARQQGIFITSSGDQSHSTGGTGAMAFDAEYARWLEEENRLVNELRAAVNSH  260

Query  796   AGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELL  617
             A D ELR +V++ + H++DIFR+KG AAK DVFHILSGMWKTPAERCF+W+GGFRSSELL
Sbjct  261   ASDTELRTVVENAITHFDDIFRMKGVAAKTDVFHILSGMWKTPAERCFMWIGGFRSSELL  320

Query  616   KLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAg---slgpsgss  446
             KLL+NQLEPLTEQQ++ I NLQ SSQQAEDALSQGMEALQQSLAETLA    + G SGSS
Sbjct  321   KLLVNQLEPLTEQQVMNIYNLQHSSQQAEDALSQGMEALQQSLAETLASGTPAAGASGSS  380

Query  445   GNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             GNVANYMGQMA+AMGKLGTLEGF+RQADNLRQQTLQQMHRILTTRQ+ARA L I+DYF
Sbjct  381   GNVANYMGQMAVAMGKLGTLEGFLRQADNLRQQTLQQMHRILTTRQSARALLAINDYF  438



>gb|KHN08879.1| Transcription factor HBP-1b(c1) [Glycine soja]
Length=423

 Score =   395 bits (1016),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 236/280 (84%), Positives = 257/280 (92%), Gaps = 1/280 (0%)
 Frame = -1

Query  1108  SDGSDRTRDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgif  929
             S GS    DQKTLRRLAQNREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIF
Sbjct  128   SSGSKDKSDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIF  187

Query  928   isssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAH  749
             ISS+GDQ+QSMSGNGA+AFDVEYARWLEEHNR+ NELR A+NSHAGD ELR IVD+ M  
Sbjct  188   ISSTGDQAQSMSGNGAMAFDVEYARWLEEHNRQTNELRAAINSHAGDIELRTIVDNFMTQ  247

Query  748   YEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLL  569
             ++DIFR+KG AAKADVFHILSGMWKTPAERCF+W+GGFRSSELLKLL +QLEPLTEQQL+
Sbjct  248   FDDIFRLKGIAAKADVFHILSGMWKTPAERCFMWIGGFRSSELLKLLESQLEPLTEQQLM  307

Query  568   AINNLQQSSQQAEDALSQGMEALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLG  392
              I NLQQSSQQAEDALSQGM+ALQQSL+ETLA GS   SGSSGNVA+YMGQMAMAMGKLG
Sbjct  308   GIYNLQQSSQQAEDALSQGMDALQQSLSETLANGSPSTSGSSGNVASYMGQMAMAMGKLG  367

Query  391   TLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             TL+GF+RQADNLRQQTLQQM RILTTRQ+ARA L ISDYF
Sbjct  368   TLDGFLRQADNLRQQTLQQMLRILTTRQSARALLAISDYF  407



>ref|XP_006603764.1| PREDICTED: bZIP transcription factor bZIP96 isoform X3 [Glycine 
max]
 ref|XP_006603765.1| PREDICTED: bZIP transcription factor bZIP96 isoform X4 [Glycine 
max]
 ref|XP_006603766.1| PREDICTED: bZIP transcription factor bZIP96 isoform X5 [Glycine 
max]
Length=459

 Score =   396 bits (1018),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 236/280 (84%), Positives = 257/280 (92%), Gaps = 1/280 (0%)
 Frame = -1

Query  1108  SDGSDRTRDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgif  929
             S GS    DQKTLRRLAQNREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIF
Sbjct  164   SSGSKDKSDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIF  223

Query  928   isssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAH  749
             ISS+GDQ+QSMSGNGA+AFDVEYARWLEEHNR+ NELR A+NSHAGD ELR IVD+ M  
Sbjct  224   ISSTGDQAQSMSGNGAMAFDVEYARWLEEHNRQTNELRAAINSHAGDIELRTIVDNFMTQ  283

Query  748   YEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLL  569
             ++DIFR+KG AAKADVFHILSGMWKTPAERCF+W+GGFRSSELLKLL +QLEPLTEQQL+
Sbjct  284   FDDIFRLKGIAAKADVFHILSGMWKTPAERCFMWIGGFRSSELLKLLESQLEPLTEQQLM  343

Query  568   AINNLQQSSQQAEDALSQGMEALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLG  392
              I NLQQSSQQAEDALSQGM+ALQQSL+ETLA GS   SGSSGNVA+YMGQMAMAMGKLG
Sbjct  344   GIYNLQQSSQQAEDALSQGMDALQQSLSETLANGSPSTSGSSGNVASYMGQMAMAMGKLG  403

Query  391   TLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             TL+GF+RQADNLRQQTLQQM RILTTRQ+ARA L ISDYF
Sbjct  404   TLDGFLRQADNLRQQTLQQMLRILTTRQSARALLAISDYF  443



>ref|XP_006603762.1| PREDICTED: bZIP transcription factor bZIP96 isoform X1 [Glycine 
max]
 ref|XP_006603763.1| PREDICTED: bZIP transcription factor bZIP96 isoform X2 [Glycine 
max]
Length=461

 Score =   396 bits (1018),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 236/280 (84%), Positives = 257/280 (92%), Gaps = 1/280 (0%)
 Frame = -1

Query  1108  SDGSDRTRDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgif  929
             S GS    DQKTLRRLAQNREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIF
Sbjct  166   SSGSKDKSDQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIF  225

Query  928   isssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAH  749
             ISS+GDQ+QSMSGNGA+AFDVEYARWLEEHNR+ NELR A+NSHAGD ELR IVD+ M  
Sbjct  226   ISSTGDQAQSMSGNGAMAFDVEYARWLEEHNRQTNELRAAINSHAGDIELRTIVDNFMTQ  285

Query  748   YEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLL  569
             ++DIFR+KG AAKADVFHILSGMWKTPAERCF+W+GGFRSSELLKLL +QLEPLTEQQL+
Sbjct  286   FDDIFRLKGIAAKADVFHILSGMWKTPAERCFMWIGGFRSSELLKLLESQLEPLTEQQLM  345

Query  568   AINNLQQSSQQAEDALSQGMEALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLG  392
              I NLQQSSQQAEDALSQGM+ALQQSL+ETLA GS   SGSSGNVA+YMGQMAMAMGKLG
Sbjct  346   GIYNLQQSSQQAEDALSQGMDALQQSLSETLANGSPSTSGSSGNVASYMGQMAMAMGKLG  405

Query  391   TLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             TL+GF+RQADNLRQQTLQQM RILTTRQ+ARA L ISDYF
Sbjct  406   TLDGFLRQADNLRQQTLQQMLRILTTRQSARALLAISDYF  445



>ref|XP_004967674.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Setaria 
italica]
Length=323

 Score =   390 bits (1003),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 245/315 (78%), Positives = 266/315 (84%), Gaps = 13/315 (4%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MADVSPRT+TSTD      N G +      +  SD SDR++D    QKTLRRLAQNREAA
Sbjct  1     MADVSPRTETSTDDTD--DNHGLEPGPGALVAASDSSDRSKDKHEDQKTLRRLAQNREAA  58

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSS DQS SMSGNGALAFD+EY
Sbjct  59    RKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSVDQSHSMSGNGALAFDMEY  118

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR+I+ELR  V +HA D++LR +VD IM+HY++IFR+KG AAKADVFH+LSGM
Sbjct  119   ARWLEEHNRQISELRAGVTAHASDSDLRSVVDKIMSHYDEIFRLKGNAAKADVFHVLSGM  178

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFR SE+LKLL  QLEPLTEQQL  I NLQQSSQQAEDALSQGMEAL
Sbjct  179   WKTPAERCFLWLGGFRPSEVLKLLSTQLEPLTEQQLSGIGNLQQSSQQAEDALSQGMEAL  238

Query  499   QQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QQSLAETLAGSL  SGS+GNVANYMGQMAMAMGKLGTLE F+R       QTLQQM RIL
Sbjct  239   QQSLAETLAGSLSSSGSTGNVANYMGQMAMAMGKLGTLENFLR-------QTLQQMQRIL  291

Query  319   TTRQAARAFLGISDY  275
             TTRQAARA L ISDY
Sbjct  292   TTRQAARALLVISDY  306



>tpg|DAA57189.1| TPA: LOW QUALITY PROTEIN: putative bZIP transcription factor 
superfamily protein, partial [Zea mays]
Length=329

 Score =   390 bits (1003),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 240/312 (77%), Positives = 271/312 (87%), Gaps = 4/312 (1%)
 Frame = -1

Query  1195  SPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAARKSRL  1025
             SP TDTSTD DT+++N  F+         SD SD++RD   QKTLRRLAQNREAARKSRL
Sbjct  4     SPMTDTSTDPDTDERNQMFEQGLVAVPTASDSSDKSRDKLDQKTLRRLAQNREAARKSRL  63

Query  1024  RKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLE  845
             RKKAY+Q LE+SR+KLTQLEQEL + RQQGIFIS+SGDQ QS SGNGALAFD+EYARWLE
Sbjct  64    RKKAYIQNLESSRLKLTQLEQELHQTRQQGIFISTSGDQPQSTSGNGALAFDMEYARWLE  123

Query  844   EHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPA  665
             EHN+ +NELR AVN+HAGD +LR IV S+MAHY++ FR+KG AA++DVFH+LSGMWKTPA
Sbjct  124   EHNKHVNELRLAVNAHAGDNDLRGIVGSVMAHYDEFFRLKGVAARSDVFHVLSGMWKTPA  183

Query  664   ERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLA  485
             ERCF+WLGGFRSSE+LKLL   LEPLT+QQL+ I+NLQQSSQQAEDALSQGMEALQQSLA
Sbjct  184   ERCFMWLGGFRSSEVLKLLAGHLEPLTDQQLVGISNLQQSSQQAEDALSQGMEALQQSLA  243

Query  484   ETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  308
             ETLA  SLGP+G SGNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQM RILTTRQ
Sbjct  244   ETLASGSLGPAGPSGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQMQRILTTRQ  303

Query  307   AARAFLGISDYF  272
             +ARA L ISDYF
Sbjct  304   SARALLAISDYF  315



>ref|XP_010922090.1| PREDICTED: transcription factor HBP-1b(c38)-like [Elaeis guineensis]
Length=466

 Score =   395 bits (1016),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 261/332 (79%), Positives = 282/332 (85%), Gaps = 4/332 (1%)
 Frame = -1

Query  1255  LI*SYIWKIGIW*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---  1085
             L+ S    I  W    M D SP+TDTSTD DT+DKN   +   A     SD SD+++   
Sbjct  119   LVSSSSGHIENWGESTMGDASPKTDTSTDVDTDDKNQRLEKGQAAVAAASDSSDKSKDKL  178

Query  1084  DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqs  905
             DQKTLRRLAQNREAARKSRLRKKAYVQQLE+SR+KL QLEQELQRARQQGIFISSSGDQS
Sbjct  179   DQKTLRRLAQNREAARKSRLRKKAYVQQLESSRLKLNQLEQELQRARQQGIFISSSGDQS  238

Query  904   qsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIK  725
              SM GNGALAFD+EYARWLEEH+R+INELR AVNSHA D +LR IVDSIMAHY++IFR+K
Sbjct  239   HSMGGNGALAFDMEYARWLEEHHRQINELRAAVNSHASDNDLRAIVDSIMAHYDEIFRLK  298

Query  724   GEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQS  545
               AAKADVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL NQLEPLTEQQL+ I NLQQS
Sbjct  299   SVAAKADVFHMLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPLTEQQLVGICNLQQS  358

Query  544   SQQAEDALSQGMEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQ  368
             SQQAEDALSQGMEALQQSLAETLA    GP+GSSGNVANYMGQMAMAMGKLGTLE F+RQ
Sbjct  359   SQQAEDALSQGMEALQQSLAETLASGSLGPTGSSGNVANYMGQMAMAMGKLGTLENFLRQ  418

Query  367   ADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             ADNLRQQTLQQM RILTTRQ+ARA L I DYF
Sbjct  419   ADNLRQQTLQQMLRILTTRQSARALLAIHDYF  450



>ref|NP_001105735.1| LOC542756 [Zea mays]
 emb|CAA48905.1| ocs-element binding factor 3.1 [Zea mays]
Length=331

 Score =   390 bits (1003),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 240/312 (77%), Positives = 271/312 (87%), Gaps = 4/312 (1%)
 Frame = -1

Query  1195  SPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAARKSRL  1025
             SP TDTSTD DT+++N  F+         SD SD++RD   QKTLRRLAQNREAARKSRL
Sbjct  4     SPMTDTSTDPDTDERNQMFEQGLVAVPTASDSSDKSRDKLDQKTLRRLAQNREAARKSRL  63

Query  1024  RKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLE  845
             RKKAY+Q LE+SR+KLTQLEQEL + RQQGIFIS+SGDQ QS SGNGALAFD+EYARWLE
Sbjct  64    RKKAYIQNLESSRLKLTQLEQELHQTRQQGIFISTSGDQPQSTSGNGALAFDMEYARWLE  123

Query  844   EHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPA  665
             EHN+ +NELR AVN+HAGD +LR IV S+MAHY++ FR+KG AA++DVFH+LSGMWKTPA
Sbjct  124   EHNKHVNELRLAVNAHAGDNDLRGIVGSVMAHYDEFFRLKGVAARSDVFHVLSGMWKTPA  183

Query  664   ERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLA  485
             ERCF+WLGGFRSSE+LKLL   LEPLT+QQL+ I+NLQQSSQQAEDALSQGMEALQQSLA
Sbjct  184   ERCFMWLGGFRSSEVLKLLAGHLEPLTDQQLVGISNLQQSSQQAEDALSQGMEALQQSLA  243

Query  484   ETLAg-slgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  308
             ETLA  SLGP+G SGNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQM RILTTRQ
Sbjct  244   ETLASGSLGPAGPSGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQMQRILTTRQ  303

Query  307   AARAFLGISDYF  272
             +ARA L ISDYF
Sbjct  304   SARALLAISDYF  315



>gb|EYU18627.1| hypothetical protein MIMGU_mgv1a006504mg [Erythranthe guttata]
Length=441

 Score =   394 bits (1012),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 242/359 (67%), Positives = 283/359 (79%), Gaps = 8/359 (2%)
 Frame = -1

Query  1339  LYICRLQRRVAGENSSFVLYKEHTVMQILI*SYIWKIGIW*YPMMADVSPRTDTSTDADT  1160
             ++   +  ++ G +     + + T    L+ S   +   W    +A+ S RTDTSTD DT
Sbjct  72    VFNPTVNSQIVGPDPQSSAFNKGTPQPNLVSSSGVRQENWGESNVAESSSRTDTSTDLDT  131

Query  1159  EDKNMGFQNNHALGIVGSDGS-DRTRDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRM  983
             +DKN  F+   +     SD S ++  DQK LRRLAQNREAARKSRLRKKAYVQQLENSR+
Sbjct  132   DDKNQKFETGQS-----SDKSKEKAPDQKMLRRLAQNREAARKSRLRKKAYVQQLENSRL  186

Query  982   KLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVN  803
             KLTQLEQELQRARQQG+++SS GDQS S S NGALAFDVEY RW+EE NR+INELR AVN
Sbjct  187   KLTQLEQELQRARQQGVYVSSIGDQSHSASANGALAFDVEYGRWMEEQNRQINELRAAVN  246

Query  802   SHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSE  623
             SHAGD ELR +V+++ AH+ DIFR+KG AAKAD FH+LSGMWKTPAERCF+W+GGFR SE
Sbjct  247   SHAGDTELRSVVETVTAHFNDIFRLKGNAAKADAFHMLSGMWKTPAERCFMWIGGFRPSE  306

Query  622   LLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAgsl--gpsgs  449
             LLKLL+NQLEPLTE Q+  + NL++SSQQAEDALSQGM+ALQQSLAETLA        G 
Sbjct  307   LLKLLVNQLEPLTEHQVTGMYNLRESSQQAEDALSQGMDALQQSLAETLASGSVGPTEGP  366

Query  448   sGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             SGNVANYMGQMAMAMGKLGTLEGF+RQADNLRQQTLQQMHRILTTRQ+ARA L I+DYF
Sbjct  367   SGNVANYMGQMAMAMGKLGTLEGFLRQADNLRQQTLQQMHRILTTRQSARALLLINDYF  425



>ref|NP_196313.1| OCS-element binding factor 5 [Arabidopsis thaliana]
 ref|NP_974745.1| OCS-element binding factor 5 [Arabidopsis thaliana]
 sp|Q39163.2|TGA5_ARATH RecName: Full=Transcription factor TGA5; AltName: Full=Ocs element-binding 
factor 5; Short=OBF5; AltName: Full=bZIP transcription 
factor 26; Short=AtbZIP26 [Arabidopsis thaliana]
 dbj|BAB11154.1| transcription factor HBP-1b [Arabidopsis thaliana]
 gb|AAL24218.1| AT5g06960/MOJ9_13 [Arabidopsis thaliana]
 gb|AAN28803.1| At5g06960/MOJ9_13 [Arabidopsis thaliana]
 gb|AED91089.1| OCS-element binding factor 5 [Arabidopsis thaliana]
 gb|AED91090.1| OCS-element binding factor 5 [Arabidopsis thaliana]
Length=330

 Score =   389 bits (1000),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 236/314 (75%), Positives = 269/314 (86%), Gaps = 4/314 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             M D SPRT  STD DT+  N+ F   H LGI  SD SDR++   DQKTLRRLAQNREAAR
Sbjct  1     MGDTSPRTSVSTDGDTDHNNLMFDEGH-LGIGASDSSDRSKSKMDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S +G+GA+AFDVEY 
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTAGDGAMAFDVEYR  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RW E+ NR++ EL  A++SHA D+ELRIIVD ++AHYE+++RIKG AAK+DVFH+LSGMW
Sbjct  120   RWQEDKNRQMKELSSAIDSHATDSELRIIVDGVIAHYEELYRIKGNAAKSDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKL+ +QLEPLTEQQ L INNLQQSSQQAEDALSQGM+ LQ
Sbjct  180   KTPAERCFLWLGGFRSSELLKLIASQLEPLTEQQSLDINNLQQSSQQAEDALSQGMDNLQ  239

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SSGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QT QQM R+LT
Sbjct  240   QSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTYQQMVRLLT  299

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L + +Y
Sbjct  300   TRQSARALLAVHNY  313



>ref|XP_008654394.1| PREDICTED: putative bZIP transcription factor superfamily protein 
isoform X1 [Zea mays]
 gb|ACG34541.1| transcription factor HBP-1b [Zea mays]
 gb|AFW79513.1| putative bZIP transcription factor superfamily protein [Zea mays]
Length=322

 Score =   389 bits (999),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 245/315 (78%), Positives = 268/315 (85%), Gaps = 14/315 (4%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD----QKTLRRLAQNREAA  1040
             MAD SPRT+TSTD      N G +     G+V SD SDR++D    QKTLRRLAQNREAA
Sbjct  1     MADASPRTETSTDDTD--DNNGLEPGRG-GLVASDSSDRSKDKHGDQKTLRRLAQNREAA  57

Query  1039  RKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEY  860
             RKSRLRKKAYVQQLENSR+KLTQLEQELQRARQQGIFISSS DQS SMSGNGALAFD+EY
Sbjct  58    RKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGIFISSSVDQSHSMSGNGALAFDMEY  117

Query  859   ARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGM  680
             ARWLEEHNR+I+ELR  V++HA D +LR +VD IM+HY++IFR+KG AAKADVFH+LSGM
Sbjct  118   ARWLEEHNRQISELRAGVSAHASDTDLRSVVDKIMSHYDEIFRLKGNAAKADVFHVLSGM  177

Query  679   WKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEAL  500
             WKTPAERCFLWLGGFR SE+LKLL  QLEPLTEQQL  I+NLQQSSQQAEDALSQGMEAL
Sbjct  178   WKTPAERCFLWLGGFRPSEVLKLLSTQLEPLTEQQLSGISNLQQSSQQAEDALSQGMEAL  237

Query  499   QQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRIL  320
             QQSLAETLAGSL  SGS+GNVANYMGQMAMAMGKLGTLE F+R       QTLQQM RIL
Sbjct  238   QQSLAETLAGSLSSSGSTGNVANYMGQMAMAMGKLGTLENFLR-------QTLQQMQRIL  290

Query  319   TTRQAARAFLGISDY  275
             TTRQ+ARA L ISDY
Sbjct  291   TTRQSARALLVISDY  305



>ref|XP_010491292.1| PREDICTED: transcription factor TGA5 [Camelina sativa]
 ref|XP_010491293.1| PREDICTED: transcription factor TGA5 [Camelina sativa]
Length=330

 Score =   389 bits (998),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 236/314 (75%), Positives = 267/314 (85%), Gaps = 4/314 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             M D SPRT  STD DT+  N+ F   H LGI  SD SDR++   DQKTLRRLAQNREAAR
Sbjct  1     MGDTSPRTSVSTDGDTDHNNLMFDEGH-LGIGASDSSDRSKSKMDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S +G+GA+AFDVEY 
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTAGDGAMAFDVEYR  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RW E+ NR++ EL  A++SHA DAELRIIVD ++AHYE+++RIK  AAK DVFH+LSGMW
Sbjct  120   RWQEDKNRQMKELSAALDSHASDAELRIIVDGVIAHYEELYRIKSNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKL+ NQLEPLTEQQ L INNLQQSSQQAEDALSQGM+ LQ
Sbjct  180   KTPAERCFLWLGGFRSSELLKLIANQLEPLTEQQSLDINNLQQSSQQAEDALSQGMDNLQ  239

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S +SGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QT QQM R+LT
Sbjct  240   QSLADTLSSGTLGSSTSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTYQQMVRLLT  299

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L + +Y
Sbjct  300   TRQSARALLAVHNY  313



>ref|XP_008651325.1| PREDICTED: uncharacterized protein LOC100279481 isoform X7 [Zea 
mays]
Length=311

 Score =   387 bits (995),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 227/271 (84%), Positives = 251/271 (93%), Gaps = 0/271 (0%)
 Frame = -1

Query  1084  DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqs  905
             DQKT+RRLAQNREAARKSRLRKKAYVQQLE+S++KL QLEQELQ+ARQQGIFISSSGDQ+
Sbjct  25    DQKTMRRLAQNREAARKSRLRKKAYVQQLESSKLKLAQLEQELQKARQQGIFISSSGDQT  84

Query  904   qsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIK  725
              +MSGNGAL FD+EYARWLE+ N++INELR AVN+HA D++LR+IVD IMAHY++IF++K
Sbjct  85    HAMSGNGALTFDIEYARWLEDQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFKVK  144

Query  724   GEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQS  545
             G AAKADVFHILSGMWKTPAERCFLWLGGFR SELLKLL N LEPLTEQQ+L + NLQQS
Sbjct  145   GVAAKADVFHILSGMWKTPAERCFLWLGGFRPSELLKLLANHLEPLTEQQMLGLTNLQQS  204

Query  544   SQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQA  365
             SQQAEDALSQGMEALQQSLAETLAGSLGP+GSSGNVANYMGQMAMAMGKLGTLE F+RQA
Sbjct  205   SQQAEDALSQGMEALQQSLAETLAGSLGPAGSSGNVANYMGQMAMAMGKLGTLENFLRQA  264

Query  364   DNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             DNLRQQTL QM RILT RQA+RA L I DYF
Sbjct  265   DNLRQQTLHQMQRILTIRQASRALLAIHDYF  295



>dbj|BAJ95134.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   389 bits (998),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 232/320 (73%), Positives = 264/320 (83%), Gaps = 8/320 (3%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSD-------RTRDQKTLRRLAQNR  1049
             MAD S RTD ST  D + K    +   + G + +  S        +  DQKTLRRLAQNR
Sbjct  1     MADASSRTDNSTVVDNDGKIYRLEQGQSGGAIMASNSSDRSDRSDKPLDQKTLRRLAQNR  60

Query  1048  EAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFD  869
             EAARKSRLRKK+YVQQLE+S++KL QLEQELQ+ARQQGIFISSSGDQ+ +MSGNGA+ FD
Sbjct  61    EAARKSRLRKKSYVQQLESSKLKLAQLEQELQKARQQGIFISSSGDQTHAMSGNGAMTFD  120

Query  868   VEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHIL  689
             +EY RWLE+ N++INELR AVN+HA D++LR+IVD IM+HY++IF++KG AAKADVFHIL
Sbjct  121   LEYTRWLEDQNKQINELRTAVNAHASDSDLRLIVDGIMSHYDEIFKVKGVAAKADVFHIL  180

Query  688   SGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGM  509
             SGMWKTPAERCFLWLGGFR SELLKLL+N L PLTEQQ+L + NLQQSSQQAEDALSQGM
Sbjct  181   SGMWKTPAERCFLWLGGFRPSELLKLLVNHLGPLTEQQMLGLTNLQQSSQQAEDALSQGM  240

Query  508   EALQQSLAETLA-gslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQM  332
             EALQQSLAETLA      SGSSGNVANYMGQMAMAMGKLGTLE F+RQADNLRQQTL QM
Sbjct  241   EALQQSLAETLAGSLGSSSGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLHQM  300

Query  331   HRILTTRQAARAFLGISDYF  272
              RILT RQA+RA L I DYF
Sbjct  301   QRILTIRQASRALLAIHDYF  320



>ref|XP_008651324.1| PREDICTED: uncharacterized protein LOC100279481 isoform X6 [Zea 
mays]
 tpg|DAA64204.1| TPA: putative bZIP transcription factor superfamily protein [Zea 
mays]
Length=324

 Score =   387 bits (995),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 227/271 (84%), Positives = 251/271 (93%), Gaps = 0/271 (0%)
 Frame = -1

Query  1084  DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqs  905
             DQKT+RRLAQNREAARKSRLRKKAYVQQLE+S++KL QLEQELQ+ARQQGIFISSSGDQ+
Sbjct  38    DQKTMRRLAQNREAARKSRLRKKAYVQQLESSKLKLAQLEQELQKARQQGIFISSSGDQT  97

Query  904   qsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIK  725
              +MSGNGAL FD+EYARWLE+ N++INELR AVN+HA D++LR+IVD IMAHY++IF++K
Sbjct  98    HAMSGNGALTFDIEYARWLEDQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFKVK  157

Query  724   GEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQS  545
             G AAKADVFHILSGMWKTPAERCFLWLGGFR SELLKLL N LEPLTEQQ+L + NLQQS
Sbjct  158   GVAAKADVFHILSGMWKTPAERCFLWLGGFRPSELLKLLANHLEPLTEQQMLGLTNLQQS  217

Query  544   SQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQA  365
             SQQAEDALSQGMEALQQSLAETLAGSLGP+GSSGNVANYMGQMAMAMGKLGTLE F+RQA
Sbjct  218   SQQAEDALSQGMEALQQSLAETLAGSLGPAGSSGNVANYMGQMAMAMGKLGTLENFLRQA  277

Query  364   DNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             DNLRQQTL QM RILT RQA+RA L I DYF
Sbjct  278   DNLRQQTLHQMQRILTIRQASRALLAIHDYF  308



>ref|XP_008446977.1| PREDICTED: transcription factor TGA2-like isoform X2 [Cucumis 
melo]
 ref|XP_008446978.1| PREDICTED: transcription factor TGA2-like isoform X2 [Cucumis 
melo]
Length=325

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 230/273 (84%), Positives = 251/273 (92%), Gaps = 1/273 (0%)
 Frame = -1

Query  1087  RDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdq  908
             R    +RRLAQNREAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFISSSGDQ
Sbjct  37    RKISLIRRLAQNREAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISSSGDQ  96

Query  907   sqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRI  728
             + SM+GNGA+AFDVEYARWLEE N++INELR AVNSHA D ELR+IVD I+AHY+++FR+
Sbjct  97    AHSMAGNGAMAFDVEYARWLEEQNKQINELRAAVNSHASDTELRMIVDGILAHYDEVFRL  156

Query  727   KGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQ  548
             KG AAKADVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ I+NLQQ
Sbjct  157   KGVAAKADVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGISNLQQ  216

Query  547   SSQQAEDALSQGMEALQQSLAE-TLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIR  371
             SSQQ EDALSQGMEALQQSLAE   +GSLG S +SGNVANYMGQMA AMGKLGTLEGFIR
Sbjct  217   SSQQTEDALSQGMEALQQSLAETLSSGSLGSSNTSGNVANYMGQMATAMGKLGTLEGFIR  276

Query  370   QADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             QADNLRQQTLQQMHRILTTRQ+ARA L I DYF
Sbjct  277   QADNLRQQTLQQMHRILTTRQSARALLAIHDYF  309



>ref|XP_008651323.1| PREDICTED: uncharacterized protein LOC100279481 isoform X5 [Zea 
mays]
Length=326

 Score =   387 bits (995),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 227/271 (84%), Positives = 251/271 (93%), Gaps = 0/271 (0%)
 Frame = -1

Query  1084  DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqs  905
             DQKT+RRLAQNREAARKSRLRKKAYVQQLE+S++KL QLEQELQ+ARQQGIFISSSGDQ+
Sbjct  40    DQKTMRRLAQNREAARKSRLRKKAYVQQLESSKLKLAQLEQELQKARQQGIFISSSGDQT  99

Query  904   qsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIK  725
              +MSGNGAL FD+EYARWLE+ N++INELR AVN+HA D++LR+IVD IMAHY++IF++K
Sbjct  100   HAMSGNGALTFDIEYARWLEDQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFKVK  159

Query  724   GEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQS  545
             G AAKADVFHILSGMWKTPAERCFLWLGGFR SELLKLL N LEPLTEQQ+L + NLQQS
Sbjct  160   GVAAKADVFHILSGMWKTPAERCFLWLGGFRPSELLKLLANHLEPLTEQQMLGLTNLQQS  219

Query  544   SQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQA  365
             SQQAEDALSQGMEALQQSLAETLAGSLGP+GSSGNVANYMGQMAMAMGKLGTLE F+RQA
Sbjct  220   SQQAEDALSQGMEALQQSLAETLAGSLGPAGSSGNVANYMGQMAMAMGKLGTLENFLRQA  279

Query  364   DNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             DNLRQQTL QM RILT RQA+RA L I DYF
Sbjct  280   DNLRQQTLHQMQRILTIRQASRALLAIHDYF  310



>ref|XP_006407352.1| hypothetical protein EUTSA_v10021187mg [Eutrema salsugineum]
 gb|ESQ48805.1| hypothetical protein EUTSA_v10021187mg [Eutrema salsugineum]
Length=311

 Score =   387 bits (993),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 225/283 (80%), Positives = 253/283 (89%), Gaps = 3/283 (1%)
 Frame = -1

Query  1114  VGSDGSDRTRD---QKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrar  944
               SD SDR++D   QKTLRRLAQNREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRAR
Sbjct  12    AASDSSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRAR  71

Query  943   qqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVD  764
             QQG+FISSSGDQ+ S SGNGALAFD E++RWLEE NR++NELR A+N+HAGD ELRIIVD
Sbjct  72    QQGVFISSSGDQAHSTSGNGALAFDAEHSRWLEEKNRQMNELRSALNAHAGDTELRIIVD  131

Query  763   SIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLT  584
              +MAHYE++FRIK  AAK DVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL NQLEP+T
Sbjct  132   GVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMT  191

Query  583   EQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAM  404
             E+Q++ IN+LQQ+SQQAEDALSQGME+LQQSLA+TL+     S SS NVA+YMGQMAMAM
Sbjct  192   ERQVMGINSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSDNVASYMGQMAMAM  251

Query  403   GKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDY  275
             G+LGTLEGFIRQADNLR QTLQQM R+LTTRQ+ARA L I DY
Sbjct  252   GQLGTLEGFIRQADNLRLQTLQQMIRVLTTRQSARALLAIHDY  294



>ref|XP_008651321.1| PREDICTED: uncharacterized protein LOC100279481 isoform X4 [Zea 
mays]
 ref|XP_008651322.1| PREDICTED: uncharacterized protein LOC100279481 isoform X4 [Zea 
mays]
Length=326

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 227/271 (84%), Positives = 251/271 (93%), Gaps = 0/271 (0%)
 Frame = -1

Query  1084  DQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqs  905
             DQKT+RRLAQNREAARKSRLRKKAYVQQLE+S++KL QLEQELQ+ARQQGIFISSSGDQ+
Sbjct  40    DQKTMRRLAQNREAARKSRLRKKAYVQQLESSKLKLAQLEQELQKARQQGIFISSSGDQT  99

Query  904   qsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIK  725
              +MSGNGAL FD+EYARWLE+ N++INELR AVN+HA D++LR+IVD IMAHY++IF++K
Sbjct  100   HAMSGNGALTFDIEYARWLEDQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIFKVK  159

Query  724   GEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQS  545
             G AAKADVFHILSGMWKTPAERCFLWLGGFR SELLKLL N LEPLTEQQ+L + NLQQS
Sbjct  160   GVAAKADVFHILSGMWKTPAERCFLWLGGFRPSELLKLLANHLEPLTEQQMLGLTNLQQS  219

Query  544   SQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQA  365
             SQQAEDALSQGMEALQQSLAETLAGSLGP+GSSGNVANYMGQMAMAMGKLGTLE F+RQA
Sbjct  220   SQQAEDALSQGMEALQQSLAETLAGSLGPAGSSGNVANYMGQMAMAMGKLGTLENFLRQA  279

Query  364   DNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             DNLRQQTL QM RILT RQA+RA L I DYF
Sbjct  280   DNLRQQTLHQMQRILTIRQASRALLAIHDYF  310



>ref|XP_006407351.1| hypothetical protein EUTSA_v10021187mg [Eutrema salsugineum]
 gb|ESQ48804.1| hypothetical protein EUTSA_v10021187mg [Eutrema salsugineum]
Length=303

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 225/283 (80%), Positives = 253/283 (89%), Gaps = 3/283 (1%)
 Frame = -1

Query  1114  VGSDGSDRTRD---QKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrar  944
               SD SDR++D   QKTLRRLAQNREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRAR
Sbjct  4     AASDSSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRAR  63

Query  943   qqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVD  764
             QQG+FISSSGDQ+ S SGNGALAFD E++RWLEE NR++NELR A+N+HAGD ELRIIVD
Sbjct  64    QQGVFISSSGDQAHSTSGNGALAFDAEHSRWLEEKNRQMNELRSALNAHAGDTELRIIVD  123

Query  763   SIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLT  584
              +MAHYE++FRIK  AAK DVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL NQLEP+T
Sbjct  124   GVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMT  183

Query  583   EQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAM  404
             E+Q++ IN+LQQ+SQQAEDALSQGME+LQQSLA+TL+     S SS NVA+YMGQMAMAM
Sbjct  184   ERQVMGINSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSDNVASYMGQMAMAM  243

Query  403   GKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDY  275
             G+LGTLEGFIRQADNLR QTLQQM R+LTTRQ+ARA L I DY
Sbjct  244   GQLGTLEGFIRQADNLRLQTLQQMIRVLTTRQSARALLAIHDY  286



>ref|XP_002871243.1| ocs-element binding factor 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47502.1| ocs-element binding factor 5 [Arabidopsis lyrata subsp. lyrata]
Length=330

 Score =   387 bits (994),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 236/314 (75%), Positives = 267/314 (85%), Gaps = 4/314 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             M D SPRT  STD +T+  N+ F   H LGI  SD SDR++   DQKTLRRLAQNREAAR
Sbjct  1     MGDTSPRTSVSTDGETDHNNLMFDEGH-LGIGASDSSDRSKSKMDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S +G+GA+AFD EY 
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTTGDGAMAFDAEYR  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RW E+ NR++ EL  A++SHA D+ELRIIVD ++AHYE+++RIKG AAK DVFH+LSGMW
Sbjct  120   RWQEDKNRQMKELSSALDSHATDSELRIIVDGVIAHYEELYRIKGNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKL+ NQLEPLTEQQ L INNLQQSSQQAEDALSQGM+ LQ
Sbjct  180   KTPAERCFLWLGGFRSSELLKLIANQLEPLTEQQSLDINNLQQSSQQAEDALSQGMDNLQ  239

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SSGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QT QQM RILT
Sbjct  240   QSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTYQQMVRILT  299

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L + +Y
Sbjct  300   TRQSARALLAVHNY  313



>ref|XP_008655435.1| PREDICTED: octopine synthase binding factor3 isoform X2 [Zea 
mays]
Length=526

 Score =   394 bits (1012),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 242/310 (78%), Positives = 270/310 (87%), Gaps = 4/310 (1%)
 Frame = -1

Query  1195  SPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAARKSRL  1025
             SP TDTSTD DT+++N  F+         SD SD++RD   QKTLRRLAQNREAARKSRL
Sbjct  142   SPMTDTSTDPDTDERNQMFEQGLVAVPTASDSSDKSRDKLDQKTLRRLAQNREAARKSRL  201

Query  1024  RKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLE  845
             RKKAY+Q LE+SR+KLTQLEQELQRARQQGIFIS+SGDQ QS SGNGALAFD+EYARWLE
Sbjct  202   RKKAYIQNLESSRLKLTQLEQELQRARQQGIFISTSGDQPQSTSGNGALAFDMEYARWLE  261

Query  844   EHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPA  665
             EHN+ +NELR AVN+HAGD +LR IVDSIM HY++IF++KG AAKADVFH+LSGMWKTPA
Sbjct  262   EHNKHVNELRAAVNAHAGDNDLRCIVDSIMVHYDEIFKLKGVAAKADVFHVLSGMWKTPA  321

Query  664   ERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLA  485
             ERCF+WLGGFRSSELLKLL   LEPLT+QQL+ I+NLQQSSQQAEDALSQGMEALQQSLA
Sbjct  322   ERCFMWLGGFRSSELLKLLAGHLEPLTDQQLVGISNLQQSSQQAEDALSQGMEALQQSLA  381

Query  484   ETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  308
             ETLA    GP+G SGNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQM RILTTRQ
Sbjct  382   ETLASGSLGPAGPSGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQMQRILTTRQ  441

Query  307   AARAFLGISD  278
             +ARA L IS+
Sbjct  442   SARALLAISN  451



>ref|NP_001078141.1| transcription factor TGA6 [Arabidopsis thaliana]
 gb|AEE75176.1| transcription factor TGA6 [Arabidopsis thaliana]
Length=303

 Score =   386 bits (991),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 224/283 (79%), Positives = 252/283 (89%), Gaps = 3/283 (1%)
 Frame = -1

Query  1114  VGSDGSDRTRD---QKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrar  944
               SD SDR++D   QKTLRRLAQNREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRAR
Sbjct  4     AASDSSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRAR  63

Query  943   qqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVD  764
             QQG+FISSSGDQ+ S  GNGALAFD E++RWLEE NR++NELR A+N+HAGD ELRIIVD
Sbjct  64    QQGVFISSSGDQAHSTGGNGALAFDAEHSRWLEEKNRQMNELRSALNAHAGDTELRIIVD  123

Query  763   SIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLT  584
              +MAHYE++FRIK  AAK DVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL NQLEP+T
Sbjct  124   GVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMT  183

Query  583   EQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAM  404
             E+Q++ IN+LQQ+SQQAEDALSQGME+LQQSLA+TL+     S SS NVA+YMGQMAMAM
Sbjct  184   ERQVMGINSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSDNVASYMGQMAMAM  243

Query  403   GKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDY  275
             G+LGTLEGFIRQADNLR QTLQQM R+LTTRQ+ARA L I DY
Sbjct  244   GQLGTLEGFIRQADNLRLQTLQQMLRVLTTRQSARALLAIHDY  286



>ref|XP_010423272.1| PREDICTED: transcription factor TGA5-like isoform X1 [Camelina 
sativa]
 ref|XP_010423273.1| PREDICTED: transcription factor TGA5-like isoform X1 [Camelina 
sativa]
 ref|XP_010423274.1| PREDICTED: transcription factor TGA5-like isoform X1 [Camelina 
sativa]
Length=330

 Score =   387 bits (993),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 237/314 (75%), Positives = 266/314 (85%), Gaps = 4/314 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             M D SPRT  STD DT+  N+ F   H LGI  SD SDR++   DQKTLRRLAQNREAAR
Sbjct  1     MGDTSPRTSVSTDGDTDHNNLMFDEGH-LGIGASDSSDRSKSKMDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S +G+GA+AFDVEY 
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTAGDGAMAFDVEYR  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RW E+ NR++ EL  A++SHA DAELRIIVD  +AHYE+++RIK  AAK DVFH+LSGMW
Sbjct  120   RWQEDKNRQMKELSAALDSHASDAELRIIVDGAIAHYEELYRIKSNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKL+ NQLEPLTEQQ L INNLQQSSQQAEDALSQGM+ LQ
Sbjct  180   KTPAERCFLWLGGFRSSELLKLIANQLEPLTEQQSLDINNLQQSSQQAEDALSQGMDNLQ  239

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SSGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QT QQM R+LT
Sbjct  240   QSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTYQQMVRLLT  299

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L + +Y
Sbjct  300   TRQSARALLAVHNY  313



>gb|ACF79461.1| unknown [Zea mays]
Length=465

 Score =   391 bits (1005),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 238/312 (76%), Positives = 269/312 (86%), Gaps = 4/312 (1%)
 Frame = -1

Query  1195  SPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTRD---QKTLRRLAQNREAARKSRL  1025
             SP TDTSTD DT+++N  F+         SD SD++RD   QKTLRRLAQNREAARKSRL
Sbjct  138   SPMTDTSTDPDTDERNQMFEQGLVAVPTASDSSDKSRDKLDQKTLRRLAQNREAARKSRL  197

Query  1024  RKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYARWLE  845
             RKKAY+Q LE+SR+KLTQLEQEL + RQQGIFIS+SGDQ QS SGNGALAFD+EYARWLE
Sbjct  198   RKKAYIQNLESSRLKLTQLEQELHQTRQQGIFISTSGDQPQSTSGNGALAFDMEYARWLE  257

Query  844   EHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMWKTPA  665
             EHN+ +NELR AVN+HAGD +LR IV S+MAHY++ FR+KG AA++DVFH+LSGMWKTPA
Sbjct  258   EHNKHVNELRLAVNAHAGDNDLRGIVGSVMAHYDEFFRLKGVAARSDVFHVLSGMWKTPA  317

Query  664   ERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQQSLA  485
             ERCF+WLGGFRSSE+LKLL   LEPLT+QQL+ I+NLQQSSQQAEDALSQGMEALQQSLA
Sbjct  318   ERCFMWLGGFRSSEVLKLLAGHLEPLTDQQLVGISNLQQSSQQAEDALSQGMEALQQSLA  377

Query  484   ETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQ  308
             ETLA    GP+G SGNVANYMGQMAMAMGKLGTLE F+RQADNLR QTLQQM RILTTRQ
Sbjct  378   ETLASGSLGPAGPSGNVANYMGQMAMAMGKLGTLENFLRQADNLRLQTLQQMQRILTTRQ  437

Query  307   AARAFLGISDYF  272
             +ARA L ISDYF
Sbjct  438   SARALLAISDYF  449



>ref|NP_001137124.1| uncharacterized protein LOC100217305 [Zea mays]
 ref|XP_008658212.1| PREDICTED: uncharacterized protein LOC100217305 isoform X1 [Zea 
mays]
 gb|ACF83315.1| unknown [Zea mays]
 gb|AFW88529.1| putative bZIP transcription factor superfamily protein [Zea mays]
Length=305

 Score =   385 bits (990),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 228/274 (83%), Positives = 252/274 (92%), Gaps = 0/274 (0%)
 Frame = -1

Query  1093  RTRDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssg  914
             +  DQK LRRLAQNREAARKSRLRKKAYVQQLE+S++KL  LEQELQ+ARQQGIFISSSG
Sbjct  16    KPMDQKVLRRLAQNREAARKSRLRKKAYVQQLESSKLKLASLEQELQKARQQGIFISSSG  75

Query  913   dqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIF  734
             DQ+ +MSGNGA+ FD+EY+RW EE N++INELR AVN+HA D++LR+IVD IMAHY++IF
Sbjct  76    DQTHTMSGNGAMTFDLEYSRWQEEQNKQINELRTAVNAHASDSDLRLIVDGIMAHYDEIF  135

Query  733   RIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNL  554
             R+KG AAKADVFHILSGMWKT AERCFLWLGGFRSSELLKLL+NQLEPLTEQQL+ ++NL
Sbjct  136   RLKGIAAKADVFHILSGMWKTSAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGLSNL  195

Query  553   QQSSQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFI  374
             QQSSQQAEDALSQGMEALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLE F+
Sbjct  196   QQSSQQAEDALSQGMEALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLENFL  255

Query  373   RQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             RQADNLRQQTL QM RILT RQAARA L I DYF
Sbjct  256   RQADNLRQQTLHQMQRILTIRQAARALLAIHDYF  289



>ref|XP_008788486.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X1 [Phoenix 
dactylifera]
Length=470

 Score =   391 bits (1005),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 255/321 (79%), Positives = 277/321 (86%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQN  1052
             W    MAD SP+TDTSTD DT+DKN   +   A     SD SD+++   DQKTLRRLAQN
Sbjct  134   WGESTMADASPKTDTSTDVDTDDKNQRLEKGQAALAAASDSSDKSKDKLDQKTLRRLAQN  193

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFIS SGDQ+ SM GNGALAF
Sbjct  194   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISGSGDQTHSMGGNGALAF  253

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D+EYARWLEE +R+INELR AVNSHA D +LR IVDSIMAHY++IFR+K  AAKADVFH+
Sbjct  254   DMEYARWLEEQHRQINELRAAVNSHASDNDLRAIVDSIMAHYDEIFRLKSVAAKADVFHM  313

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL +QLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  314   LSGMWKTPAERCFLWLGGFRSSELLKLLASQLEPLTEQQLVGICNLQQSSQQAEDALSQG  373

Query  511   MEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETLA    GP+GSSGNVANYMGQMAMAMGKLGTLE F+ QADNLRQQTLQQ
Sbjct  374   MEALQQSLAETLASGSLGPTGSSGNVANYMGQMAMAMGKLGTLENFLHQADNLRQQTLQQ  433

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L I DYF
Sbjct  434   MLRILTTRQSARALLAIHDYF  454



>gb|ACF80806.1| unknown [Zea mays]
Length=396

 Score =   389 bits (998),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 226/285 (79%), Positives = 253/285 (89%), Gaps = 4/285 (1%)
 Frame = -1

Query  1114  VGSDGSDRTRD---QKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrar  944
               SD SD++RD   QKTLRRLAQNREAARKSRLRKKAY+Q LE+SR+KLTQLEQEL + R
Sbjct  96    TASDSSDKSRDKLDQKTLRRLAQNREAARKSRLRKKAYIQNLESSRLKLTQLEQELHQTR  155

Query  943   qqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVD  764
             QQGIFIS+SGDQ QS SGNGALAFD+EYARWLEEHN+ +NELR AVN+HAGD +LR IV 
Sbjct  156   QQGIFISTSGDQPQSTSGNGALAFDMEYARWLEEHNKHVNELRLAVNAHAGDNDLRGIVG  215

Query  763   SIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLT  584
             S+MAHY++ FR+KG AA++DVFH+LSGMWKTPAERCF+WLGGFRSSE+LKLL   LEPLT
Sbjct  216   SVMAHYDEFFRLKGVAARSDVFHVLSGMWKTPAERCFMWLGGFRSSEVLKLLAGHLEPLT  275

Query  583   EQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMA  407
             +QQL+ I+NLQQSSQQAEDALSQGMEALQQSLAETLA    GP+G SGNVANYMGQMAMA
Sbjct  276   DQQLVGISNLQQSSQQAEDALSQGMEALQQSLAETLASGSLGPAGPSGNVANYMGQMAMA  335

Query  406   MGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDYF  272
             MGKLGTLE F+RQADNLR QTLQQM RILTTRQ+ARA L ISDYF
Sbjct  336   MGKLGTLENFLRQADNLRLQTLQQMQRILTTRQSARALLAISDYF  380



>ref|XP_006288178.1| hypothetical protein CARUB_v10001413mg [Capsella rubella]
 gb|EOA21076.1| hypothetical protein CARUB_v10001413mg [Capsella rubella]
Length=330

 Score =   385 bits (990),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 236/314 (75%), Positives = 265/314 (84%), Gaps = 4/314 (1%)
 Frame = -1

Query  1207  MADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQNREAAR  1037
             M D SPRT  STD DT+  N+ F   H LGI  SD SDR++   DQKTLRRLAQNREAAR
Sbjct  1     MGDTSPRTSVSTDGDTDHNNLMFDEGH-LGIGASDSSDRSKSKMDQKTLRRLAQNREAAR  59

Query  1036  KSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAFDVEYA  857
             KSRLRKKAYVQQLENSR+KLTQLEQELQRARQQG+FISSSGDQ+ S +G+GA+AFDVEY 
Sbjct  60    KSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTAGDGAMAFDVEYR  119

Query  856   RWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHILSGMW  677
             RW E+ NR++ EL  A++SHA DAELRIIVD ++AHYE+++RIK  AAK DVFH+LSGMW
Sbjct  120   RWQEDKNRQMKELSAALDSHASDAELRIIVDGVIAHYEELYRIKSNAAKNDVFHLLSGMW  179

Query  676   KTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQGMEALQ  497
             KTPAERCFLWLGGFRSSELLKL+ NQLEPLTEQQ L IN LQQSSQQAEDALSQGM+ LQ
Sbjct  180   KTPAERCFLWLGGFRSSELLKLIANQLEPLTEQQSLDINKLQQSSQQAEDALSQGMDNLQ  239

Query  496   QSLAETLAgslgpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILT  317
             QSLA+TL+     S SSGNVA+YMGQMAMAMGKLGTLEGFIRQADNLR QT QQM R LT
Sbjct  240   QSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTYQQMVRTLT  299

Query  316   TRQAARAFLGISDY  275
             TRQ+ARA L + +Y
Sbjct  300   TRQSARALLAVHNY  313



>ref|XP_008788487.1| PREDICTED: transcription factor HBP-1b(c38)-like isoform X2 [Phoenix 
dactylifera]
Length=468

 Score =   390 bits (1003),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 255/321 (79%), Positives = 277/321 (86%), Gaps = 4/321 (1%)
 Frame = -1

Query  1222  W*YPMMADVSPRTDTSTDADTEDKNMGFQNNHALGIVGSDGSDRTR---DQKTLRRLAQN  1052
             W    MAD SP+TDTSTD DT+DKN   +   A     SD SD+++   DQKTLRRLAQN
Sbjct  132   WGESTMADASPKTDTSTDVDTDDKNQRLEKGQAALAAASDSSDKSKDKLDQKTLRRLAQN  191

Query  1051  REAARKSRLRKKAYVQQLENSRMKLTqleqelqrarqqgifisssgdqsqsmsgnGALAF  872
             REAARKSRLRKKAYVQQLE+SR+KLTQLEQELQRARQQGIFIS SGDQ+ SM GNGALAF
Sbjct  192   REAARKSRLRKKAYVQQLESSRLKLTQLEQELQRARQQGIFISGSGDQTHSMGGNGALAF  251

Query  871   DVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVDSIMAHYEDIFRIKGEAAKADVFHI  692
             D+EYARWLEE +R+INELR AVNSHA D +LR IVDSIMAHY++IFR+K  AAKADVFH+
Sbjct  252   DMEYARWLEEQHRQINELRAAVNSHASDNDLRAIVDSIMAHYDEIFRLKSVAAKADVFHM  311

Query  691   LSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLTEQQLLAINNLQQSSQQAEDALSQG  512
             LSGMWKTPAERCFLWLGGFRSSELLKLL +QLEPLTEQQL+ I NLQQSSQQAEDALSQG
Sbjct  312   LSGMWKTPAERCFLWLGGFRSSELLKLLASQLEPLTEQQLVGICNLQQSSQQAEDALSQG  371

Query  511   MEALQQSLAETLAgsl-gpsgssGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQ  335
             MEALQQSLAETLA    GP+GSSGNVANYMGQMAMAMGKLGTLE F+ QADNLRQQTLQQ
Sbjct  372   MEALQQSLAETLASGSLGPTGSSGNVANYMGQMAMAMGKLGTLENFLHQADNLRQQTLQQ  431

Query  334   MHRILTTRQAARAFLGISDYF  272
             M RILTTRQ+ARA L I DYF
Sbjct  432   MLRILTTRQSARALLAIHDYF  452



>ref|NP_974293.1| transcription factor TGA6 [Arabidopsis thaliana]
 gb|AEE75174.1| transcription factor TGA6 [Arabidopsis thaliana]
Length=324

 Score =   385 bits (989),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 224/283 (79%), Positives = 252/283 (89%), Gaps = 3/283 (1%)
 Frame = -1

Query  1114  VGSDGSDRTRD---QKTLRRLAQNREAARKSRLRKKAYVQQLENSRMKLTqleqelqrar  944
               SD SDR++D   QKTLRRLAQNREAARKSRLRKKAYVQQLENSR+KLTQLEQELQRAR
Sbjct  25    AASDSSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRAR  84

Query  943   qqgifisssgdqsqsmsgnGALAFDVEYARWLEEHNRRINELRGAVNSHAGDAELRIIVD  764
             QQG+FISSSGDQ+ S  GNGALAFD E++RWLEE NR++NELR A+N+HAGD ELRIIVD
Sbjct  85    QQGVFISSSGDQAHSTGGNGALAFDAEHSRWLEEKNRQMNELRSALNAHAGDTELRIIVD  144

Query  763   SIMAHYEDIFRIKGEAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLINQLEPLT  584
              +MAHYE++FRIK  AAK DVFH+LSGMWKTPAERCFLWLGGFRSSELLKLL NQLEP+T
Sbjct  145   GVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMT  204

Query  583   EQQLLAINNLQQSSQQAEDALSQGMEALQQSLAETLAgslgpsgssGNVANYMGQMAMAM  404
             E+Q++ IN+LQQ+SQQAEDALSQGME+LQQSLA+TL+     S SS NVA+YMGQMAMAM
Sbjct  205   ERQVMGINSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSDNVASYMGQMAMAM  264

Query  403   GKLGTLEGFIRQADNLRQQTLQQMHRILTTRQAARAFLGISDY  275
             G+LGTLEGFIRQADNLR QTLQQM R+LTTRQ+ARA L I DY
Sbjct  265   GQLGTLEGFIRQADNLRLQTLQQMLRVLTTRQSARALLAIHDY  307



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4401111831648