BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23697_g2_i1 len=4226 path=[10561:0-1871 1898:1872-1906
1933:1907-2426 16425:2427-2450 2477:2451-2720 2747:2721-2740
2767:2741-2766 2793:2767-2878 2905:2879-3168 3195:3169-3304
3331:3305-3345 3372:3346-3412 3439:3413-3454 3481:3455-3844
3871:3845-3847 3874:3848-3871 14744:3872-4225]

Length=4226
                                                                      Score     E

ref|XP_006352810.1|  PREDICTED: uncharacterized protein LOC102580...   1956   0.0      
ref|XP_004242314.1|  PREDICTED: uncharacterized protein LOC101246...   1953   0.0      
ref|XP_006352811.1|  PREDICTED: uncharacterized protein LOC102580...   1950   0.0      
ref|XP_010323025.1|  PREDICTED: uncharacterized protein LOC101246...   1947   0.0      
ref|XP_009797825.1|  PREDICTED: uncharacterized protein LOC104244168   1899   0.0      
ref|XP_009781903.1|  PREDICTED: uncharacterized protein LOC104230...   1897   0.0      
ref|XP_009598050.1|  PREDICTED: uncharacterized protein LOC104093...   1894   0.0      
ref|XP_010323026.1|  PREDICTED: uncharacterized protein LOC101246...   1888   0.0      
ref|XP_009781904.1|  PREDICTED: uncharacterized protein LOC104230...   1886   0.0      
ref|XP_009598052.1|  PREDICTED: uncharacterized protein LOC104093...   1883   0.0      
ref|XP_009781905.1|  PREDICTED: uncharacterized protein LOC104230...   1882   0.0      
ref|XP_009598053.1|  PREDICTED: uncharacterized protein LOC104093...   1880   0.0      
ref|XP_006359390.1|  PREDICTED: uncharacterized protein LOC102597...   1873   0.0      
emb|CDP03506.1|  unnamed protein product                               1858   0.0      
ref|XP_010326579.1|  PREDICTED: uncharacterized protein LOC101250...   1858   0.0      
ref|XP_006359391.1|  PREDICTED: uncharacterized protein LOC102597...   1845   0.0      
ref|XP_004247431.1|  PREDICTED: uncharacterized protein LOC101250...   1833   0.0      
ref|XP_011082476.1|  PREDICTED: uncharacterized protein LOC105165229   1787   0.0      
ref|XP_011079689.1|  PREDICTED: uncharacterized protein LOC105163...   1774   0.0      
ref|XP_011079690.1|  PREDICTED: uncharacterized protein LOC105163...   1754   0.0      
ref|XP_011079691.1|  PREDICTED: uncharacterized protein LOC105163...   1737   0.0      
ref|XP_007050879.1|  AAA-type ATPase family protein isoform 1          1657   0.0      
gb|KHG14286.1|  ATPase family AAA domain-containing protein 1          1637   0.0      
ref|XP_010652173.1|  PREDICTED: uncharacterized protein LOC100260666   1636   0.0      
gb|KDO87278.1|  hypothetical protein CISIN_1g000858mg                  1624   0.0      
ref|XP_006444295.1|  hypothetical protein CICLE_v10018538mg            1623   0.0      
ref|XP_006479928.1|  PREDICTED: uncharacterized protein LOC102620169   1622   0.0      
emb|CBI36835.3|  unnamed protein product                               1621   0.0      
ref|XP_007050880.1|  ATP binding protein, putative isoform 2           1618   0.0      
ref|XP_006444294.1|  hypothetical protein CICLE_v10018538mg            1616   0.0      
ref|XP_008235052.1|  PREDICTED: uncharacterized protein LOC103333915   1613   0.0      
gb|KDO87279.1|  hypothetical protein CISIN_1g000858mg                  1612   0.0      
ref|XP_007143843.1|  hypothetical protein PHAVU_007G106400g            1607   0.0      
ref|XP_008451595.1|  PREDICTED: uncharacterized protein LOC103492...   1586   0.0      
ref|XP_006575111.1|  PREDICTED: uncharacterized protein LOC100801477   1586   0.0      
gb|KHN46575.1|  ATPase family AAA domain-containing protein 1          1584   0.0      
gb|KDO87275.1|  hypothetical protein CISIN_1g000858mg                  1584   0.0      
gb|KHG01617.1|  ATPase family AAA domain-containing protein 1          1577   0.0      
ref|XP_010097306.1|  ATPase family AAA domain-containing protein 1     1577   0.0      
ref|XP_006588596.1|  PREDICTED: uncharacterized protein LOC100794...   1576   0.0      
gb|KDO87276.1|  hypothetical protein CISIN_1g000858mg                  1575   0.0      
ref|XP_004136037.1|  PREDICTED: uncharacterized protein LOC101211144   1575   0.0      
ref|XP_003536887.1|  PREDICTED: uncharacterized protein LOC100794...   1573   0.0      
ref|XP_007201764.1|  hypothetical protein PRUPE_ppa000530mg            1572   0.0      
gb|KDO87280.1|  hypothetical protein CISIN_1g000858mg                  1569   0.0      
gb|KHN03730.1|  ATPase family AAA domain-containing protein 1          1563   0.0      
ref|XP_010259603.1|  PREDICTED: uncharacterized protein LOC104598...   1563   0.0      
gb|KDO87281.1|  hypothetical protein CISIN_1g000858mg                  1561   0.0      
ref|XP_006588597.1|  PREDICTED: uncharacterized protein LOC100794...   1559   0.0      
ref|XP_004495974.1|  PREDICTED: uncharacterized protein LOC101498262   1557   0.0      
gb|KDO87277.1|  hypothetical protein CISIN_1g000858mg                  1553   0.0      
ref|XP_009342111.1|  PREDICTED: uncharacterized protein LOC103934...   1550   0.0      
gb|EYU46684.1|  hypothetical protein MIMGU_mgv1a000404mg               1548   0.0      
ref|XP_008368992.1|  PREDICTED: uncharacterized protein LOC103432...   1546   0.0      
ref|XP_004292654.1|  PREDICTED: uncharacterized protein LOC101311652   1545   0.0      
ref|XP_008451596.1|  PREDICTED: uncharacterized protein LOC103492...   1543   0.0      
ref|XP_009598054.1|  PREDICTED: uncharacterized protein LOC104093...   1540   0.0      
ref|XP_010269522.1|  PREDICTED: uncharacterized protein LOC104606...   1539   0.0      
ref|XP_008386656.1|  PREDICTED: uncharacterized protein LOC103449148   1537   0.0      
ref|XP_009342112.1|  PREDICTED: uncharacterized protein LOC103934...   1535   0.0      
ref|XP_011033559.1|  PREDICTED: uncharacterized protein LOC105132009   1532   0.0      
ref|XP_002301474.2|  AAA-type ATPase family protein                    1530   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP28140.1|  hypothetical protein JCGZ_13911                        1523   0.0      
ref|XP_011008046.1|  PREDICTED: uncharacterized protein LOC105113...   1521   0.0      
gb|KGN44925.1|  hypothetical protein Csa_7G396400                      1521   0.0      
ref|XP_010259604.1|  PREDICTED: uncharacterized protein LOC104598...   1515   0.0      
ref|XP_011008045.1|  PREDICTED: uncharacterized protein LOC105113...   1514   0.0      
ref|XP_006588599.1|  PREDICTED: uncharacterized protein LOC100794...   1514   0.0      
gb|KHN03731.1|  Protein MSP1                                           1513   0.0      
ref|XP_006588598.1|  PREDICTED: uncharacterized protein LOC100794...   1513   0.0      
gb|KDO87285.1|  hypothetical protein CISIN_1g000858mg                  1512   0.0      
ref|XP_006575112.1|  PREDICTED: uncharacterized protein LOC100800...   1509   0.0      
ref|XP_002321014.1|  AAA-type ATPase family protein                    1508   0.0      Populus trichocarpa [western balsam poplar]
gb|KHN46576.1|  Spastin                                                1498   0.0      
ref|XP_009342114.1|  PREDICTED: uncharacterized protein LOC103934...   1493   0.0      
gb|AES61807.2|  P-loop nucleoside triphosphate hydrolase superfam...   1491   0.0      
ref|XP_010269523.1|  PREDICTED: uncharacterized protein LOC104606...   1490   0.0      
ref|XP_009342115.1|  PREDICTED: uncharacterized protein LOC103934...   1485   0.0      
gb|KDO87287.1|  hypothetical protein CISIN_1g000858mg                  1484   0.0      
ref|XP_003591552.1|  Katanin p60 ATPase-containing subunit             1480   0.0      
ref|XP_003591556.1|  Katanin p60 ATPase-containing subunit A-like...   1479   0.0      
ref|XP_008368993.1|  PREDICTED: uncharacterized protein LOC103432...   1479   0.0      
ref|XP_008805743.1|  PREDICTED: uncharacterized protein LOC103718...   1476   0.0      
ref|XP_006575113.1|  PREDICTED: uncharacterized protein LOC100800...   1472   0.0      
gb|KEH43221.1|  P-loop nucleoside triphosphate hydrolase superfam...   1469   0.0      
ref|XP_010931645.1|  PREDICTED: uncharacterized protein LOC105052512   1465   0.0      
ref|XP_006575114.1|  PREDICTED: uncharacterized protein LOC100800...   1465   0.0      
ref|XP_004495973.1|  PREDICTED: uncharacterized protein LOC101497938   1465   0.0      
ref|XP_008800830.1|  PREDICTED: uncharacterized protein LOC103715088   1462   0.0      
ref|XP_006396457.1|  hypothetical protein EUTSA_v10028366mg            1462   0.0      
ref|XP_009414467.1|  PREDICTED: uncharacterized protein LOC103995...   1459   0.0      
ref|XP_010542858.1|  PREDICTED: uncharacterized protein LOC104815...   1459   0.0      
ref|XP_010542859.1|  PREDICTED: uncharacterized protein LOC104815...   1458   0.0      
gb|KDO87282.1|  hypothetical protein CISIN_1g000858mg                  1457   0.0      
ref|XP_010542857.1|  PREDICTED: uncharacterized protein LOC104815...   1457   0.0      
ref|XP_009414468.1|  PREDICTED: uncharacterized protein LOC103995...   1455   0.0      
ref|XP_010914430.1|  PREDICTED: uncharacterized protein LOC105039...   1454   0.0      
ref|XP_009391006.1|  PREDICTED: uncharacterized protein LOC103977266   1443   0.0      
ref|XP_010684533.1|  PREDICTED: uncharacterized protein LOC104899...   1432   0.0      
ref|XP_003591553.1|  Katanin p60 ATPase-containing subunit             1431   0.0      
ref|XP_003591554.1|  Katanin p60 ATPase-containing subunit             1429   0.0      
ref|XP_010684534.1|  PREDICTED: uncharacterized protein LOC104899...   1428   0.0      
ref|XP_009134429.1|  PREDICTED: uncharacterized protein LOC103858761   1422   0.0      
ref|XP_010069946.1|  PREDICTED: uncharacterized protein LOC104456...   1420   0.0      
ref|XP_006418289.1|  hypothetical protein EUTSA_v10006579mg            1419   0.0      
ref|XP_006418290.1|  hypothetical protein EUTSA_v10006579mg            1418   0.0      
ref|NP_567238.2|  AAA-type ATPase family protein                       1411   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422583.1|  PREDICTED: uncharacterized protein LOC104707...   1409   0.0      
ref|XP_009111283.1|  PREDICTED: uncharacterized protein LOC103836743   1409   0.0      
gb|KDO87286.1|  hypothetical protein CISIN_1g000858mg                  1409   0.0      
ref|XP_010429758.1|  PREDICTED: uncharacterized protein LOC104714...   1408   0.0      
gb|AAM13995.1|  unknown protein                                        1408   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422582.1|  PREDICTED: uncharacterized protein LOC104707...   1408   0.0      
ref|XP_010456024.1|  PREDICTED: uncharacterized protein LOC104737...   1405   0.0      
ref|XP_010429750.1|  PREDICTED: uncharacterized protein LOC104714...   1405   0.0      
dbj|BAF02143.1|  hypothetical protein                                  1405   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872834.1|  AAA-type ATPase family protein                    1404   0.0      
ref|XP_006286693.1|  hypothetical protein CARUB_v10002740mg            1402   0.0      
ref|XP_006848423.1|  hypothetical protein AMTR_s00013p00232570         1401   0.0      
gb|KCW58476.1|  hypothetical protein EUGRSUZ_H01157                    1400   0.0      
ref|XP_010556748.1|  PREDICTED: uncharacterized protein LOC104825975   1399   0.0      
ref|XP_007050881.1|  ATP binding protein, putative isoform 3           1392   0.0      
ref|XP_010474879.1|  PREDICTED: uncharacterized protein LOC104754393   1391   0.0      
ref|XP_002892133.1|  AAA-type ATPase family protein                    1387   0.0      
ref|XP_010457286.1|  PREDICTED: uncharacterized protein LOC104738...   1385   0.0      
ref|XP_010069947.1|  PREDICTED: uncharacterized protein LOC104456...   1378   0.0      
ref|NP_171788.3|  AAA-type ATPase family protein                       1378   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY22053.1|  BnaA09g00820D                                         1376   0.0      
gb|KFK42647.1|  hypothetical protein AALP_AA1G022100                   1375   0.0      
gb|KCW58477.1|  hypothetical protein EUGRSUZ_H01157                    1371   0.0      
ref|XP_009119599.1|  PREDICTED: uncharacterized protein LOC103844...   1368   0.0      
ref|XP_010248968.1|  PREDICTED: uncharacterized protein LOC104591...   1367   0.0      
ref|XP_010522784.1|  PREDICTED: uncharacterized protein LOC104801...   1366   0.0      
ref|XP_009144560.1|  PREDICTED: uncharacterized protein LOC103868...   1360   0.0      
ref|XP_009144559.1|  PREDICTED: uncharacterized protein LOC103868...   1360   0.0      
ref|XP_008805744.1|  PREDICTED: uncharacterized protein LOC103718...   1358   0.0      
gb|EYU42216.1|  hypothetical protein MIMGU_mgv1a001073mg               1356   0.0      
gb|KCW58478.1|  hypothetical protein EUGRSUZ_H01157                    1355   0.0      
ref|XP_009119600.1|  PREDICTED: uncharacterized protein LOC103844...   1352   0.0      
ref|XP_010522785.1|  PREDICTED: uncharacterized protein LOC104801...   1344   0.0      
ref|XP_008805746.1|  PREDICTED: uncharacterized protein LOC103718...   1342   0.0      
emb|CDY18129.1|  BnaC05g01520D                                         1340   0.0      
ref|XP_010914432.1|  PREDICTED: uncharacterized protein LOC105039...   1338   0.0      
ref|XP_010248969.1|  PREDICTED: uncharacterized protein LOC104591...   1333   0.0      
ref|XP_010914433.1|  PREDICTED: uncharacterized protein LOC105039...   1324   0.0      
ref|XP_010914431.1|  PREDICTED: uncharacterized protein LOC105039...   1324   0.0      
dbj|BAE99126.1|  hypothetical protein                                  1312   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008677897.1|  PREDICTED: uncharacterized protein LOC103652...   1310   0.0      
emb|CDY50381.1|  BnaCnng19130D                                         1310   0.0      
ref|NP_001117220.2|  AAA-type ATPase family protein                    1309   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004979903.1|  PREDICTED: uncharacterized protein LOC101767...   1306   0.0      
ref|XP_004979901.1|  PREDICTED: uncharacterized protein LOC101767...   1306   0.0      
ref|XP_002511201.1|  ATP binding protein, putative                     1299   0.0      Ricinus communis
gb|EEE52523.1|  hypothetical protein OsJ_34736                         1299   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC68582.1|  hypothetical protein OsI_36923                         1298   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006477013.1|  PREDICTED: uncharacterized protein LOC102607540   1296   0.0      
gb|KDP30932.1|  hypothetical protein JCGZ_11308                        1294   0.0      
gb|KDO52637.1|  hypothetical protein CISIN_1g000823mg                  1294   0.0      
ref|XP_011044169.1|  PREDICTED: uncharacterized protein LOC105139...   1293   0.0      
ref|XP_010248970.1|  PREDICTED: uncharacterized protein LOC104591...   1291   0.0      
ref|XP_010237445.1|  PREDICTED: uncharacterized protein LOC100840...   1291   0.0      
ref|XP_002279926.2|  PREDICTED: uncharacterized protein LOC100266...   1290   0.0      Vitis vinifera
gb|KDO52638.1|  hypothetical protein CISIN_1g000823mg                  1277   0.0      
ref|XP_008239452.1|  PREDICTED: uncharacterized protein LOC103338...   1277   0.0      
ref|XP_010663739.1|  PREDICTED: uncharacterized protein LOC100266...   1276   0.0      
ref|XP_008677898.1|  PREDICTED: uncharacterized protein LOC103652...   1273   0.0      
ref|XP_006663096.1|  PREDICTED: uncharacterized protein LOC102715...   1273   0.0      
ref|XP_002451231.1|  hypothetical protein SORBIDRAFT_05g026170         1270   0.0      Sorghum bicolor [broomcorn]
ref|XP_011044170.1|  PREDICTED: uncharacterized protein LOC105139...   1266   0.0      
ref|XP_009118737.1|  PREDICTED: uncharacterized protein LOC103843724   1266   0.0      
ref|XP_007037954.1|  ATPase family AAA domain-containing protein ...   1265   0.0      
ref|XP_004979902.1|  PREDICTED: uncharacterized protein LOC101767...   1264   0.0      
gb|KDO52636.1|  hypothetical protein CISIN_1g000823mg                  1264   0.0      
ref|XP_004152520.1|  PREDICTED: uncharacterized protein LOC101214766   1263   0.0      
ref|XP_007210914.1|  hypothetical protein PRUPE_ppa000404mg            1263   0.0      
gb|KGN64404.1|  hypothetical protein Csa_1G050430                      1262   0.0      
gb|KFK30845.1|  hypothetical protein AALP_AA6G033000                   1261   0.0      
ref|XP_002318719.2|  hypothetical protein POPTR_0012s09820g            1259   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008374257.1|  PREDICTED: uncharacterized protein LOC103437...   1258   0.0      
ref|XP_004162139.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   1258   0.0      
gb|KHG26242.1|  ATPase family AAA domain-containing protein 1          1256   0.0      
ref|XP_009375222.1|  PREDICTED: uncharacterized protein LOC103964...   1256   0.0      
ref|XP_009375230.1|  PREDICTED: uncharacterized protein LOC103964...   1254   0.0      
ref|XP_009359444.1|  PREDICTED: uncharacterized protein LOC103950...   1254   0.0      
ref|XP_011024039.1|  PREDICTED: uncharacterized protein LOC105125...   1251   0.0      
emb|CDP15013.1|  unnamed protein product                               1251   0.0      
ref|XP_008239453.1|  PREDICTED: uncharacterized protein LOC103338...   1251   0.0      
ref|XP_004160567.1|  PREDICTED: peroxisomal biogenesis factor 6-like   1251   0.0      
ref|XP_010037429.1|  PREDICTED: uncharacterized protein LOC104426170   1250   0.0      
ref|XP_008239454.1|  PREDICTED: uncharacterized protein LOC103338...   1249   0.0      
ref|XP_004297530.1|  PREDICTED: uncharacterized protein LOC101298792   1248   0.0      
ref|XP_010237446.1|  PREDICTED: uncharacterized protein LOC100840...   1246   0.0      
ref|XP_008801074.1|  PREDICTED: uncharacterized protein LOC103715...   1240   0.0      
ref|XP_008439688.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   1238   0.0      
ref|XP_004500646.1|  PREDICTED: uncharacterized protein LOC101496...   1237   0.0      
ref|XP_010921817.1|  PREDICTED: uncharacterized protein LOC105045286   1236   0.0      
ref|XP_002322243.2|  hypothetical protein POPTR_0015s10620g            1236   0.0      Populus trichocarpa [western balsam poplar]
gb|EMS56463.1|  Spastin                                                1236   0.0      
ref|XP_008451597.1|  PREDICTED: uncharacterized protein LOC103492...   1235   0.0      
ref|XP_009359445.1|  PREDICTED: uncharacterized protein LOC103950...   1235   0.0      
gb|EMT09704.1|  Spastin                                                1235   0.0      
ref|XP_011073023.1|  PREDICTED: uncharacterized protein LOC105158089   1234   0.0      
ref|XP_008374258.1|  PREDICTED: uncharacterized protein LOC103437...   1234   0.0      
ref|XP_008374259.1|  PREDICTED: uncharacterized protein LOC103437...   1234   0.0      
ref|XP_011024041.1|  PREDICTED: uncharacterized protein LOC105125...   1233   0.0      
ref|XP_009375223.1|  PREDICTED: uncharacterized protein LOC103964...   1233   0.0      
ref|XP_009359446.1|  PREDICTED: uncharacterized protein LOC103950...   1233   0.0      
ref|XP_010105240.1|  ATPase family AAA domain-containing protein 1-A   1232   0.0      
ref|XP_009375231.1|  PREDICTED: uncharacterized protein LOC103964...   1231   0.0      
ref|XP_006663097.1|  PREDICTED: uncharacterized protein LOC102715...   1231   0.0      
ref|XP_009375232.1|  PREDICTED: uncharacterized protein LOC103964...   1230   0.0      
ref|XP_003523142.1|  PREDICTED: uncharacterized protein LOC100780...   1230   0.0      
gb|KHN31902.1|  ATPase family AAA domain-containing protein 1-A        1229   0.0      
ref|XP_006578701.1|  PREDICTED: uncharacterized protein LOC100780...   1229   0.0      
ref|XP_003526964.1|  PREDICTED: uncharacterized protein LOC100778...   1225   0.0      
gb|KHN23282.1|  ATPase family AAA domain-containing protein 1-A        1224   0.0      
ref|XP_006581871.1|  PREDICTED: uncharacterized protein LOC100778...   1224   0.0      
ref|XP_006581870.1|  PREDICTED: uncharacterized protein LOC100778...   1224   0.0      
ref|XP_006581869.1|  PREDICTED: uncharacterized protein LOC100778...   1224   0.0      
emb|CDY18018.1|  BnaC03g30900D                                         1223   0.0      
gb|AES72347.2|  P-loop nucleoside triphosphate hydrolase superfam...   1222   0.0      
ref|XP_006600805.1|  PREDICTED: uncharacterized protein LOC100816731   1221   0.0      
gb|KHN14100.1|  Spastin                                                1219   0.0      
ref|XP_006579597.1|  PREDICTED: uncharacterized protein LOC100790...   1219   0.0      
ref|XP_004500647.1|  PREDICTED: uncharacterized protein LOC101496...   1218   0.0      
emb|CDX97266.1|  BnaA02g20570D                                         1216   0.0      
gb|EYU43054.1|  hypothetical protein MIMGU_mgv1a022759mg               1214   0.0      
ref|XP_007155538.1|  hypothetical protein PHAVU_003G210300g            1214   0.0      
gb|KCW58479.1|  hypothetical protein EUGRSUZ_H01157                    1214   0.0      
emb|CDX89933.1|  BnaA10g01490D                                         1213   0.0      
ref|XP_007155539.1|  hypothetical protein PHAVU_003G210300g            1210   0.0      
ref|XP_006578702.1|  PREDICTED: uncharacterized protein LOC100780...   1209   0.0      
ref|XP_006579598.1|  PREDICTED: uncharacterized protein LOC100790...   1203   0.0      
gb|KHN34412.1|  Spastin                                                1202   0.0      
emb|CDY32485.1|  BnaA09g51110D                                         1202   0.0      
ref|XP_009589950.1|  PREDICTED: uncharacterized protein LOC104087...   1201   0.0      
ref|XP_009762412.1|  PREDICTED: uncharacterized protein LOC104214...   1201   0.0      
ref|XP_010525327.1|  PREDICTED: uncharacterized protein LOC104803...   1199   0.0      
ref|XP_010319074.1|  PREDICTED: uncharacterized protein LOC101246...   1199   0.0      
ref|XP_003602096.1|  Spastin                                           1198   0.0      
ref|XP_009589949.1|  PREDICTED: uncharacterized protein LOC104087...   1197   0.0      
ref|XP_009762411.1|  PREDICTED: uncharacterized protein LOC104214...   1196   0.0      
ref|XP_010525328.1|  PREDICTED: uncharacterized protein LOC104803...   1195   0.0      
ref|XP_006351505.1|  PREDICTED: uncharacterized protein LOC102596115   1194   0.0      
ref|XP_006578703.1|  PREDICTED: uncharacterized protein LOC100780...   1187   0.0      
ref|XP_006581874.1|  PREDICTED: uncharacterized protein LOC100778...   1180   0.0      
ref|XP_006581873.1|  PREDICTED: uncharacterized protein LOC100778...   1180   0.0      
ref|XP_007137927.1|  hypothetical protein PHAVU_009G167100g            1176   0.0      
ref|XP_008239455.1|  PREDICTED: uncharacterized protein LOC103338...   1172   0.0      
gb|KDO87284.1|  hypothetical protein CISIN_1g000858mg                  1167   0.0      
gb|EPS62683.1|  hypothetical protein M569_12104                        1164   0.0      
ref|XP_010481336.1|  PREDICTED: spastin-like                           1163   0.0      
ref|XP_009411682.1|  PREDICTED: uncharacterized protein LOC103993374   1155   0.0      
ref|XP_009596694.1|  PREDICTED: uncharacterized AAA domain-contai...   1155   0.0      
gb|KDO52640.1|  hypothetical protein CISIN_1g000823mg                  1154   0.0      
emb|CDX90936.1|  BnaA03g26160D                                         1152   0.0      
ref|XP_009382544.1|  PREDICTED: uncharacterized protein LOC103970...   1152   0.0      
ref|XP_010677895.1|  PREDICTED: uncharacterized protein LOC104893491   1149   0.0      
gb|AFW60180.1|  hypothetical protein ZEAMMB73_551737                   1148   0.0      
gb|KDO52639.1|  hypothetical protein CISIN_1g000823mg                  1143   0.0      
ref|XP_009382545.1|  PREDICTED: uncharacterized protein LOC103970...   1140   0.0      
ref|XP_004500648.1|  PREDICTED: uncharacterized protein LOC101496...   1125   0.0      
ref|XP_009589951.1|  PREDICTED: uncharacterized protein LOC104087...   1121   0.0      
ref|XP_010319075.1|  PREDICTED: uncharacterized protein LOC101246...   1119   0.0      
gb|KCW49150.1|  hypothetical protein EUGRSUZ_K02736                    1117   0.0      
ref|XP_006413376.1|  hypothetical protein EUTSA_v10024252mg            1117   0.0      
ref|XP_009762413.1|  PREDICTED: uncharacterized protein LOC104214...   1116   0.0      
ref|XP_006581872.1|  PREDICTED: uncharacterized protein LOC100778...   1115   0.0      
gb|KEH34969.1|  P-loop nucleoside triphosphate hydrolase superfam...   1110   0.0      
gb|KEH34968.1|  P-loop nucleoside triphosphate hydrolase superfam...   1110   0.0      
emb|CDX91317.1|  BnaC02g27280D                                         1092   0.0      
ref|XP_009383916.1|  PREDICTED: uncharacterized protein LOC103971584   1071   0.0      
gb|AAF02877.1|AC009525_11  Unknown protein                             1059   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABA95244.2|  AAA-type ATPase family protein, putative, expressed    1029   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAN75888.1|  hypothetical protein VITISV_023640                    1026   0.0      Vitis vinifera
ref|XP_006347396.1|  PREDICTED: uncharacterized protein LOC102604053   1016   0.0      
gb|KFK29024.1|  hypothetical protein AALP_AA7G078600                   1008   0.0      
gb|KFK29023.1|  hypothetical protein AALP_AA7G078600                   1008   0.0      
emb|CAN71853.1|  hypothetical protein VITISV_007346                    1006   0.0      Vitis vinifera
ref|XP_007050882.1|  ATPase family AAA domain-containing protein ...    989   0.0      
tpg|DAA42397.1|  TPA: hypothetical protein ZEAMMB73_568864              947   0.0      
gb|EEC82665.1|  hypothetical protein OsI_27291                          940   0.0      
ref|XP_004241492.1|  PREDICTED: peroxisome biosynthesis protein P...    930   0.0      
ref|XP_002523054.1|  ATP binding protein, putative                      913   0.0      
ref|XP_010322970.1|  PREDICTED: uncharacterized protein LOC101252297    904   0.0      
gb|KDO87288.1|  hypothetical protein CISIN_1g000858mg                   900   0.0      
ref|XP_010234132.1|  PREDICTED: uncharacterized protein LOC100835916    898   0.0      
ref|XP_010448506.1|  PREDICTED: uncharacterized protein LOC104730...    887   0.0      
ref|XP_006396458.1|  hypothetical protein EUTSA_v10028366mg             880   0.0      
ref|XP_006658955.1|  PREDICTED: uncharacterized protein LOC102705092    884   0.0      
gb|AGT17199.1|  hypothetical protein SHCRBa_098_E22_R_100               884   0.0      
ref|XP_002461189.1|  hypothetical protein SORBIDRAFT_02g042560          880   0.0      
gb|EMS55797.1|  Protein MSP1                                            853   0.0      
gb|EMT05944.1|  ATPase family AAA domain-containing protein 1-A         852   0.0      
gb|EEE67800.1|  hypothetical protein OsJ_25538                          852   0.0      
dbj|BAJ93489.1|  predicted protein                                      864   0.0      
dbj|BAK02823.1|  predicted protein                                      864   0.0      
ref|XP_008386768.1|  PREDICTED: cell division control protein 48 ...    843   0.0      
ref|XP_010436397.1|  PREDICTED: uncharacterized protein LOC104720133    858   0.0      
ref|NP_001060602.1|  Os07g0672500                                       855   0.0      
ref|XP_008366580.1|  PREDICTED: uncharacterized protein LOC103430221    843   0.0      
gb|EEC75238.1|  hypothetical protein OsI_11534                          841   0.0      
ref|XP_002867639.1|  AAA-type ATPase family protein                     850   0.0      
ref|XP_006650067.1|  PREDICTED: peroxisomal biogenesis factor 6-like    837   0.0      
tpg|DAA45314.1|  TPA: hypothetical protein ZEAMMB73_512266              835   0.0      
ref|XP_002465290.1|  hypothetical protein SORBIDRAFT_01g035620          846   0.0      
gb|EEE59044.1|  hypothetical protein OsJ_10811                          843   0.0      
ref|XP_004984416.1|  PREDICTED: uncharacterized protein LOC101773921    842   0.0      
ref|XP_008655542.1|  PREDICTED: uncharacterized protein LOC103634735    833   0.0      
ref|XP_008670651.1|  PREDICTED: uncharacterized protein LOC103647...    830   0.0      
ref|XP_008670652.1|  PREDICTED: uncharacterized protein LOC103647...    830   0.0      
tpg|DAA41724.1|  TPA: hypothetical protein ZEAMMB73_184747              828   0.0      
tpg|DAA41723.1|  TPA: hypothetical protein ZEAMMB73_184747              827   0.0      
tpg|DAA41725.1|  TPA: hypothetical protein ZEAMMB73_184747              826   0.0      
ref|NP_001050084.2|  Os03g0344700                                       809   0.0      
ref|XP_010418193.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisome b...    807   0.0      
ref|NP_194217.2|  P-loop containing nucleoside triphosphate hydro...    808   0.0      
ref|XP_006440093.1|  hypothetical protein CICLE_v100185462mg            783   0.0      
ref|XP_010473425.1|  PREDICTED: uncharacterized protein LOC104752866    801   0.0      
ref|XP_008660163.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    802   0.0      
ref|XP_010448507.1|  PREDICTED: uncharacterized protein LOC104730...    799   0.0      
gb|KDO87289.1|  hypothetical protein CISIN_1g000858mg                   787   0.0      
gb|ABF95891.1|  AAA-type ATPase family protein, putative, expressed     798   0.0      
gb|AFW60181.1|  hypothetical protein ZEAMMB73_551737                    768   0.0      
ref|XP_006283021.1|  hypothetical protein CARUB_v10004013mg             793   0.0      
ref|XP_008366581.1|  PREDICTED: ATP-dependent zinc metalloproteas...    774   0.0      
ref|XP_006307719.1|  hypothetical protein CARUB_v100081071mg            752   0.0      
gb|EMS51930.1|  Protein MSP1                                            769   0.0      
ref|XP_010430250.1|  PREDICTED: uncharacterized protein LOC104714546    762   0.0      
ref|NP_176404.3|  AAA-type ATPase-like protein                          759   0.0      
ref|XP_002886489.1|  AAA-type ATPase family protein                     756   0.0      
gb|EMT13670.1|  Protein MSP1                                            748   0.0      
ref|XP_004964071.1|  PREDICTED: spastin-like                            736   0.0      
gb|KCW58480.1|  hypothetical protein EUGRSUZ_H01157                     716   0.0      
ref|XP_006664619.1|  PREDICTED: fidgetin-like protein 1-like            707   0.0      
ref|XP_002442296.1|  hypothetical protein SORBIDRAFT_08g017577          700   0.0      
ref|XP_007037955.1|  ATPase family AAA domain-containing protein ...    707   0.0      
ref|XP_008341674.1|  PREDICTED: uncharacterized protein LOC103404521    686   0.0      
ref|XP_011098869.1|  PREDICTED: uncharacterized protein LOC105177...    684   0.0      
ref|XP_011098871.1|  PREDICTED: uncharacterized protein LOC105177...    684   0.0      
ref|XP_011098872.1|  PREDICTED: uncharacterized protein LOC105177...    684   0.0      
ref|XP_002967737.1|  hypothetical protein SELMODRAFT_88110              673   0.0      
ref|XP_011098873.1|  PREDICTED: uncharacterized protein LOC105177...    679   0.0      
gb|EMS49758.1|  Spastin                                                 663   0.0      
ref|XP_002964298.1|  hypothetical protein SELMODRAFT_166381             644   0.0      
gb|AAC19276.1|  T14P8.7                                                 621   0.0      
dbj|BAK03805.1|  predicted protein                                      616   0.0      
gb|EMT18432.1|  Spastin                                                 615   0.0      
ref|XP_006303888.1|  hypothetical protein CARUB_v100081070mg            609   0.0      
gb|KFK30840.1|  hypothetical protein AALP_AA6G032400                    630   0.0      
gb|KHG29351.1|  Protein SAP1                                            598   0.0      
gb|AGT16726.1|  hypothetical protein SHCRBa_258_H24_F_50                578   0.0      
ref|XP_008386769.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    584   0.0      
emb|CAB41125.1|  putative protein                                       563   0.0      
ref|XP_002442293.1|  hypothetical protein SORBIDRAFT_08g017570          558   2e-179   
ref|XP_006439446.1|  hypothetical protein CICLE_v10018858mg             557   1e-175   
ref|XP_006476477.1|  PREDICTED: nuclear valosin-containing protei...    554   2e-174   
ref|XP_010448508.1|  PREDICTED: uncharacterized protein LOC104730...    551   5e-173   
ref|XP_008341676.1|  PREDICTED: uncharacterized protein LOC103404522    539   4e-169   
ref|XP_008784537.1|  PREDICTED: uncharacterized protein LOC103703...    527   3e-162   
gb|EYU23405.1|  hypothetical protein MIMGU_mgv1a001595mg                517   3e-161   
ref|XP_002968827.1|  hypothetical protein SELMODRAFT_440620             518   1e-160   
ref|XP_004245559.1|  PREDICTED: nuclear valosin-containing protei...    517   2e-160   
ref|XP_002974147.1|  hypothetical protein SELMODRAFT_442341             517   2e-160   
ref|XP_010917036.1|  PREDICTED: uncharacterized protein LOC105041...    513   2e-159   
ref|XP_006440096.1|  hypothetical protein CICLE_v100185461mg            511   2e-159   
ref|XP_008784529.1|  PREDICTED: uncharacterized protein LOC103703...    520   3e-159   
gb|KHG09264.1|  ATPase family AAA domain-containing protein 1-A         513   4e-159   
ref|XP_007040379.1|  P-loop containing nucleoside triphosphate hy...    513   5e-159   
ref|XP_010251600.1|  PREDICTED: uncharacterized protein LOC104593...    510   1e-158   
ref|XP_010251598.1|  PREDICTED: uncharacterized protein LOC104593...    511   2e-158   
gb|KHG24797.1|  Spastin                                                 509   1e-157   
ref|XP_001757401.1|  predicted protein                                  492   1e-157   
ref|XP_010658526.1|  PREDICTED: calmodulin-interacting protein 11...    509   2e-157   
emb|CBI34411.3|  unnamed protein product                                508   3e-157   
ref|NP_001117544.1|  transcription factor DUO1                          508   3e-157   
ref|XP_011026962.1|  PREDICTED: cell division control protein 48 ...    508   3e-157   
ref|XP_010937058.1|  PREDICTED: uncharacterized protein LOC105056...    513   3e-157   
ref|NP_849842.1|  transcription factor DUO1                             508   4e-157   
ref|XP_010430529.1|  PREDICTED: katanin p60 ATPase-containing sub...    508   4e-157   
ref|NP_564824.1|  transcription factor DUO1                             507   5e-157   
ref|XP_009409440.1|  PREDICTED: spastin isoform X2                      503   6e-157   
ref|XP_009800877.1|  PREDICTED: uncharacterized protein LOC104246700    506   1e-156   
ref|XP_008376661.1|  PREDICTED: uncharacterized protein LOC103439818    506   1e-156   
ref|XP_009626478.1|  PREDICTED: uncharacterized protein LOC104117172    506   1e-156   
ref|XP_009409439.1|  PREDICTED: peroxisome biosynthesis protein P...    506   2e-156   
ref|XP_004234206.1|  PREDICTED: uncharacterized protein LOC101260609    506   2e-156   
ref|XP_010915762.1|  PREDICTED: lon protease homolog, mitochondri...    506   2e-156   
ref|XP_009416408.1|  PREDICTED: ribosome biogenesis ATPase RIX7-l...    502   2e-156   
ref|XP_011003670.1|  PREDICTED: peroxisome biosynthesis protein P...    505   2e-156   
ref|XP_002298002.2|  hypothetical protein POPTR_0001s10050g             506   2e-156   
ref|XP_011073426.1|  PREDICTED: nuclear valosin-containing protei...    505   2e-156   
ref|XP_008792388.1|  PREDICTED: protein SAP1-like isoform X3            501   2e-156   
ref|XP_008792387.1|  PREDICTED: calmodulin-interacting protein 11...    505   2e-156   
ref|XP_009416406.1|  PREDICTED: ribosome biogenesis ATPase RIX7-l...    505   3e-156   
ref|XP_008792386.1|  PREDICTED: calmodulin-interacting protein 11...    505   3e-156   
ref|XP_010937057.1|  PREDICTED: uncharacterized protein LOC105056...    511   4e-156   
ref|XP_002886363.1|  AAA-type ATPase family protein                     504   6e-156   
gb|EYU40052.1|  hypothetical protein MIMGU_mgv1a025345mg                504   6e-156   
ref|XP_010261418.1|  PREDICTED: uncharacterized protein LOC104600...    504   9e-156   
ref|XP_006300734.1|  hypothetical protein CARUB_v10019795mg             504   1e-155   
gb|EYU42577.1|  hypothetical protein MIMGU_mgv1a000780mg                508   1e-155   
ref|XP_006300735.1|  hypothetical protein CARUB_v10019795mg             503   2e-155   
ref|XP_010261423.1|  PREDICTED: uncharacterized protein LOC104600...    503   2e-155   
ref|XP_006391667.1|  hypothetical protein EUTSA_v10023275mg             503   2e-155   
emb|CDY49165.1|  BnaA10g06290D                                          501   2e-155   
ref|XP_006842611.1|  hypothetical protein AMTR_s00077p00173880          503   4e-155   
ref|XP_007220610.1|  hypothetical protein PRUPE_ppa001598mg             501   4e-155   
gb|KDP22199.1|  hypothetical protein JCGZ_26030                         502   4e-155   
ref|XP_006366648.1|  PREDICTED: uncharacterized protein LOC102581738    502   5e-155   
gb|AES94005.2|  P-loop nucleoside triphosphate hydrolase superfam...    502   6e-155   
gb|KDP25362.1|  hypothetical protein JCGZ_20518                         502   7e-155   
ref|XP_006590807.1|  PREDICTED: uncharacterized protein LOC100812...    507   9e-155   
ref|XP_009112803.1|  PREDICTED: peroxisome biosynthesis protein PAS1    501   1e-154   
ref|XP_010418461.1|  PREDICTED: katanin p60 ATPase-containing sub...    501   1e-154   
ref|XP_007131648.1|  hypothetical protein PHAVU_011G030700g             507   1e-154   
ref|XP_010418463.1|  PREDICTED: katanin p60 ATPase-containing sub...    501   1e-154   
ref|XP_010418460.1|  PREDICTED: katanin p60 ATPase-containing sub...    501   1e-154   
ref|XP_010418458.1|  PREDICTED: katanin p60 ATPase-containing sub...    501   1e-154   
ref|XP_006827127.1|  hypothetical protein AMTR_s00010p00247870          507   1e-154   
ref|XP_010937056.1|  PREDICTED: uncharacterized protein LOC105056...    507   2e-154   
ref|XP_010915761.1|  PREDICTED: lon protease homolog, mitochondri...    501   2e-154   
gb|EPS71448.1|  hypothetical protein M569_03307                         499   2e-154   
ref|XP_010671575.1|  PREDICTED: uncharacterized protein LOC104888335    500   2e-154   
emb|CDY08360.1|  BnaC09g12360D                                          500   3e-154   
ref|XP_011076079.1|  PREDICTED: nuclear valosin-containing protei...    500   3e-154   
emb|CDY38192.1|  BnaA09g11970D                                          500   3e-154   
ref|XP_010507957.1|  PREDICTED: uncharacterized protein LOC104784613    505   3e-154   
ref|XP_010105714.1|  hypothetical protein L484_014202                   499   3e-154   
ref|XP_009368710.1|  PREDICTED: nuclear valosin-containing protei...    500   3e-154   
gb|KEH25715.1|  P-loop nucleoside triphosphate hydrolase superfam...    499   3e-154   
ref|XP_009598009.1|  PREDICTED: probable spastin homolog Bm1_53365      498   4e-154   
ref|XP_010066983.1|  PREDICTED: uncharacterized protein LOC104454...    505   4e-154   
ref|XP_004503659.1|  PREDICTED: fidgetin-like protein 1-like            500   4e-154   
ref|XP_004297746.1|  PREDICTED: uncharacterized protein LOC101293086    505   5e-154   
ref|XP_003533964.1|  PREDICTED: uncharacterized protein LOC100804099    499   6e-154   
ref|XP_010261095.1|  PREDICTED: uncharacterized protein LOC104600...    504   7e-154   
ref|XP_010418462.1|  PREDICTED: katanin p60 ATPase-containing sub...    498   1e-153   
ref|XP_010937055.1|  PREDICTED: uncharacterized protein LOC105056...    504   2e-153   
ref|XP_011084471.1|  PREDICTED: uncharacterized protein LOC105166715    498   2e-153   
ref|XP_009111556.1|  PREDICTED: uncharacterized protein LOC103836977    503   2e-153   
ref|XP_003548135.1|  PREDICTED: spastin-like                            497   2e-153   
ref|XP_008234810.1|  PREDICTED: putative cell division cycle ATPase     497   3e-153   
ref|XP_010473660.1|  PREDICTED: uncharacterized protein LOC104753079    497   3e-153   
emb|CAN73743.1|  hypothetical protein VITISV_026769                     497   3e-153   
ref|XP_009334490.1|  PREDICTED: uncharacterized protein LOC103927306    498   3e-153   
ref|XP_010066982.1|  PREDICTED: uncharacterized protein LOC104454...    503   3e-153   
ref|XP_010533620.1|  PREDICTED: spastin isoform X3                      497   4e-153   
ref|XP_010466131.1|  PREDICTED: uncharacterized protein LOC104746369    502   4e-153   
ref|XP_011007207.1|  PREDICTED: uncharacterized protein LOC105112...    502   4e-153   
ref|XP_002318353.2|  hypothetical protein POPTR_0012s01000g             497   4e-153   
ref|XP_010533618.1|  PREDICTED: spastin isoform X1                      497   4e-153   
ref|XP_010648382.1|  PREDICTED: uncharacterized protein LOC100252...    502   6e-153   
gb|KEH21161.1|  P-loop nucleoside triphosphate hydrolase superfam...    497   7e-153   
ref|XP_010662653.1|  PREDICTED: nuclear valosin-containing protei...    496   7e-153   
ref|XP_010648384.1|  PREDICTED: uncharacterized protein LOC100252...    502   8e-153   
ref|XP_007131649.1|  hypothetical protein PHAVU_011G030700g             503   8e-153   
ref|XP_008805644.1|  PREDICTED: uncharacterized protein LOC103718546    496   1e-152   
gb|AAC19277.1|  T14P8.8                                                 492   1e-152   
ref|XP_002885327.1|  hypothetical protein ARALYDRAFT_479491             501   2e-152   
ref|XP_011022056.1|  PREDICTED: uncharacterized protein LOC105123956    501   2e-152   
ref|XP_011005218.1|  PREDICTED: uncharacterized protein LOC105111534    500   2e-152   
ref|XP_008360307.1|  PREDICTED: uncharacterized protein LOC103424023    495   2e-152   
ref|XP_003611047.1|  Spastin                                            495   3e-152   
ref|XP_002869527.1|  AAA-type ATPase family protein                     491   3e-152   
ref|XP_002306386.2|  hypothetical protein POPTR_0005s09630g             500   3e-152   
ref|XP_006406465.1|  hypothetical protein EUTSA_v10019988mg             499   4e-152   
ref|NP_188608.4|  AAA-type ATPase domain-containing protein             499   4e-152   
ref|XP_011007208.1|  PREDICTED: uncharacterized protein LOC105112...    499   5e-152   
ref|XP_007152107.1|  hypothetical protein PHAVU_004G102900g             493   6e-152   
emb|CDY19639.1|  BnaC09g28950D                                          493   7e-152   
ref|XP_002513623.1|  ATP binding protein, putative                      494   7e-152   
ref|XP_008377677.1|  PREDICTED: uncharacterized protein LOC103440725    494   8e-152   
ref|XP_011007204.1|  PREDICTED: uncharacterized protein LOC105112...    499   1e-151   
dbj|GAM22715.1|  hypothetical protein SAMD00019534_058900               502   1e-151   
ref|XP_002454278.1|  hypothetical protein SORBIDRAFT_04g027890          497   2e-151   
ref|XP_006584739.1|  PREDICTED: uncharacterized AAA domain-contai...    492   2e-151   
gb|KHN19953.1|  Spastin                                                 492   2e-151   
ref|XP_010924776.1|  PREDICTED: peroxisome biosynthesis protein P...    492   2e-151   
ref|XP_010261094.1|  PREDICTED: uncharacterized protein LOC104600...    498   2e-151   
ref|XP_009407782.1|  PREDICTED: uncharacterized protein LOC103990...    497   3e-151   
ref|XP_007038876.1|  P-loop containing nucleoside triphosphate hy...    492   4e-151   
emb|CAB36769.1|  putative protein                                       488   4e-151   
ref|XP_004308033.1|  PREDICTED: uncharacterized protein LOC101302117    491   4e-151   
gb|KHF99854.1|  Spastin                                                 492   4e-151   
ref|XP_009119824.1|  PREDICTED: spastin isoform X4                      487   4e-151   
ref|XP_002509882.1|  ATP binding protein, putative                      490   5e-151   
ref|XP_010676392.1|  PREDICTED: uncharacterized protein LOC104892...    491   5e-151   
ref|XP_004511542.1|  PREDICTED: ribosome biogenesis ATPase RIX7-l...    491   5e-151   
ref|XP_006584736.1|  PREDICTED: uncharacterized AAA domain-contai...    492   6e-151   
ref|XP_010676390.1|  PREDICTED: uncharacterized protein LOC104892...    491   6e-151   
ref|XP_010917020.1|  PREDICTED: uncharacterized protein LOC105041...    491   6e-151   
ref|XP_006584738.1|  PREDICTED: uncharacterized AAA domain-contai...    492   7e-151   
gb|KDP29959.1|  hypothetical protein JCGZ_19116                         496   7e-151   
ref|XP_004511541.1|  PREDICTED: ribosome biogenesis ATPase RIX7-l...    491   7e-151   
ref|XP_003538688.1|  PREDICTED: uncharacterized protein LOC100783137    491   8e-151   
ref|XP_001752282.1|  predicted protein                                  481   9e-151   
ref|XP_009119822.1|  PREDICTED: calmodulin-interacting protein 11...    490   1e-150   
gb|EYU19606.1|  hypothetical protein MIMGU_mgv1a001750mg                488   1e-150   
ref|XP_009119821.1|  PREDICTED: calmodulin-interacting protein 11...    490   1e-150   



>ref|XP_006352810.1| PREDICTED: uncharacterized protein LOC102580303 isoform X1 [Solanum 
tuberosum]
Length=1251

 Score =  1956 bits (5067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 999/1255 (80%), Positives = 1115/1255 (89%), Gaps = 13/1255 (1%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQE  311
             MVETRRSSSSSKRPL SPSSPLPNGKRSKA E+LSST+D +G+KT GAVNESG ESAEQE
Sbjct  1     MVETRRSSSSSKRPLSSPSSPLPNGKRSKAVEALSSTNDTIGQKTQGAVNESGQESAEQE  60

Query  312   IRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGK  491
             +RS DL GAS LKS +A +P K PE  + GEPLVSP+ LG + ID +KVK NGS LNRGK
Sbjct  61    VRSVDLAGASVLKSSDASLPLKSPENQVQGEPLVSPITLGHTVIDAEKVKLNGSTLNRGK  120

Query  492   KRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQ  671
             KRQLKSN+G AWGKL+SQ  QN HV + + T++VGQGRQCD  + DPSVSKSLCNLKHI+
Sbjct  121   KRQLKSNVGVAWGKLISQCSQNPHVVMHRPTYSVGQGRQCDFWIGDPSVSKSLCNLKHIE  180

Query  672   REKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDI  851
             +EKG  ITLLEI+GKKG VQVNGK+YPKNSTVPLN GDE++FGSSG HAYIF+K TN++ 
Sbjct  181   QEKGGFITLLEITGKKGDVQVNGKVYPKNSTVPLNDGDEMVFGSSGDHAYIFEKITNDNK  240

Query  852   SAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCND  1031
             S   +P  VSILEAHSG VKG++ EARSGDPSTVAVASTLASLSN +KE  LLPPS  N 
Sbjct  241   SC--LPRQVSILEAHSGSVKGLHIEARSGDPSTVAVASTLASLSNFQKESSLLPPSSQNG  298

Query  1032  NDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNLNL  1202
              D++Q  EMP LP A G  DKHDLD++MKD S H+++P   L EK+G ISPD+GN+NLNL
Sbjct  299   KDVQQSSEMPRLPAADGVSDKHDLDAEMKDASKHSNLPGVSLCEKTGVISPDTGNENLNL  358

Query  1203  ENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR---ELLKDF  1373
             +NGA+DS + EIGK++G  QELRPL+R+LAGSS  EFDLSG+IS+I+++RR   ELL+D 
Sbjct  359   DNGALDSVNAEIGKISGVAQELRPLLRVLAGSS--EFDLSGSISKILEERRGIRELLRDL  416

Query  1374  DPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFV  1553
             DP I  STRRQAFKD LQQ +LDS +IEVSFE+FPYYLSE TKNVLI+STY+HLKC+KF 
Sbjct  417   DPPILTSTRRQAFKDALQQGVLDSKSIEVSFENFPYYLSETTKNVLISSTYVHLKCHKFT  476

Query  1554  KCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPV  1730
             K A +LPT+CPRILLSGPAGSEIYQETLAKALAKYFG RLL+VDSL+LPGGS AK++D V
Sbjct  477   KYAPDLPTLCPRILLSGPAGSEIYQETLAKALAKYFGVRLLIVDSLLLPGGSIAKDIDSV  536

Query  1731  KEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-  1907
             KE+ KPERT VF+KRAAQ A    NKKPASSVEADITGGS +SS AQ KQEASTASSKN 
Sbjct  537   KESSKPERTSVFSKRAAQVAAQHLNKKPASSVEADITGGSTVSSQAQPKQEASTASSKNY  596

Query  1908  TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGN  2084
             TFK GDRVKYVGPL +GFS LQ P RGP YGY+GKV+LAFE+N  SKIG+RFDRSIPEGN
Sbjct  597   TFKKGDRVKYVGPLQSGFSPLQAPLRGPTYGYRGKVVLAFEDNESSKIGIRFDRSIPEGN  656

Query  2085  DLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKS  2264
             DLGG CEEDHGFFCAADFLRLD+S+ DD+DKLAI+ELFEV S+E K S L+LFVKDIEKS
Sbjct  657   DLGGHCEEDHGFFCAADFLRLDSSNSDDIDKLAIDELFEVASKESKISALVLFVKDIEKS  716

Query  2265  MVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAF  2444
             MVGNPEA++AFK+KLE LPENV+VIAS+TQTD+RKEKSH GG LFTKFGSNQTALLDLAF
Sbjct  717   MVGNPEAYAAFKIKLEHLPENVIVIASHTQTDSRKEKSHTGGLLFTKFGSNQTALLDLAF  776

Query  2445  PDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNA  2624
             PDNFGRLHDRSKETPK +KQLTRLFPNKV IQ+PQDE LLSDWKQQL+RDI T+KSQSN 
Sbjct  777   PDNFGRLHDRSKETPKTLKQLTRLFPNKVTIQLPQDEALLSDWKQQLERDIGTLKSQSNI  836

Query  2625  VNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAIS  2804
              +IRNVLNR+ +DCPD+ETLCIKDQALT+ESVEKI+GWAL HHFMH SES  KE KL IS
Sbjct  837   ASIRNVLNRIGIDCPDLETLCIKDQALTSESVEKIVGWALGHHFMHKSESPVKEAKLVIS  896

Query  2805  SESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALEN  2984
             S SI YG+++ QG+ NETKS+KKSLKDVVTEN+FEK+LLADVIPPSDIGVTF DIGALEN
Sbjct  897   SASISYGVNIFQGIHNETKSLKKSLKDVVTENDFEKRLLADVIPPSDIGVTFGDIGALEN  956

Query  2985  VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINIS  3164
             VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINIS
Sbjct  957   VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINIS  1016

Query  3165  MSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFM  3344
             MSSITSKWFGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFM
Sbjct  1017  MSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFM  1076

Query  3345  VNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEE  3524
             VNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KEE
Sbjct  1077  VNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEE  1136

Query  3525  LAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHN  3704
             L PNVDL+AIANMTEGYSGSDLKNLC+TAAHCPIREILEKEKKEKALA++E+RP+PALH+
Sbjct  1137  LTPNVDLEAIANMTEGYSGSDLKNLCITAAHCPIREILEKEKKEKALAVAESRPVPALHS  1196

Query  3705  SSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             S D+RPLNMDDF+YAHEQVCASVSSES NM ELLQWNELYGEGGSRKKK+LSYFM
Sbjct  1197  SVDVRPLNMDDFKYAHEQVCASVSSESANMNELLQWNELYGEGGSRKKKSLSYFM  1251



>ref|XP_004242314.1| PREDICTED: uncharacterized protein LOC101246936 isoform X1 [Solanum 
lycopersicum]
Length=1251

 Score =  1953 bits (5060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 980/1232 (80%), Positives = 1094/1232 (89%), Gaps = 13/1232 (1%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKL  380
             NGKRSKA E+LSST+D +G+KT GAVNESG ESAEQE+RSADL GAS LKS +A +P K 
Sbjct  24    NGKRSKAVEALSSTNDTIGQKTQGAVNESGQESAEQEVRSADLSGASVLKSSDASLPLKS  83

Query  381   PEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNS  560
             PE  + GEPLVSP+ LG S I+ +KVK NGS LNRGKKRQLKSN+G AWGKL+SQ  QN 
Sbjct  84    PENQVKGEPLVSPITLGHSVINAEKVKLNGSTLNRGKKRQLKSNVGAAWGKLISQCSQNP  143

Query  561   HVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNG  740
             HV +   T++VGQGRQCDL + DPSVSKSLCNLKHI++EKG  ITLLEI+GKKG VQVNG
Sbjct  144   HVVMHHPTYSVGQGRQCDLWIGDPSVSKSLCNLKHIEQEKGGFITLLEITGKKGDVQVNG  203

Query  741   KIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVN  920
             K+YPKNSTVPLN GDE++FGSSG HAYIF+K TN++ S   +P  VSILEAHSG VKG++
Sbjct  204   KVYPKNSTVPLNDGDEMVFGSSGDHAYIFEKITNDNKSC--LPRQVSILEAHSGSVKGLH  261

Query  921   FEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHD  1100
              EARSGDPSTVAVASTLASLSN +KE  LL PS  N  D++Q  E+P LP A G  DKHD
Sbjct  262   IEARSGDPSTVAVASTLASLSNFQKESSLLSPSSQNGKDLQQSSELPRLPAADGVSDKHD  321

Query  1101  LDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQELR  1271
             LD++MKD S+ +++P   L EK+G ISPDSGN+ LNL+NGA+DS D EIGK++G  QELR
Sbjct  322   LDAEMKDASNLSNLPGVSLCEKTGVISPDSGNEKLNLDNGALDSVDAEIGKISGVAQELR  381

Query  1272  PLIRMLAGSSTPEFDLSGNISRIIDQRR---ELLKDFDPLISMSTRRQAFKDGLQQTILD  1442
             PL+R+LAGSS  EFDLSG+IS+I++ RR   ELL+D DP I  STRRQAFKD LQQ ILD
Sbjct  382   PLLRVLAGSS--EFDLSGSISKILEDRRGIRELLRDLDPPILTSTRRQAFKDALQQGILD  439

Query  1443  SNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEI  1622
             S +IEVSFE+FPYYLSE TKNVLI+STY+HLKC+KF+K A +LPT+CPRILLSGPAGSEI
Sbjct  440   SKSIEVSFENFPYYLSETTKNVLISSTYVHLKCHKFIKYAPDLPTLCPRILLSGPAGSEI  499

Query  1623  YQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLR  1799
             YQETLAKALAKYFG RLL+VDSL+LPGGS AK++D VKE+ KPER  VF KRAAQ A L 
Sbjct  500   YQETLAKALAKYFGVRLLIVDSLLLPGGSIAKDIDSVKESSKPERASVFAKRAAQVAALH  559

Query  1800  FNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQT  1973
              NKKPASSVEADITGGS +SSHAQ KQEASTASSKN TFK GDRVKYVGPL +GFS LQ 
Sbjct  560   LNKKPASSVEADITGGSTVSSHAQPKQEASTASSKNYTFKKGDRVKYVGPLQSGFSPLQA  619

Query  1974  PARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDN  2153
             P RGP YGY+GKV+LAFE+N  SKIG+RFDRSIPEGNDLGG CEEDHGFFCAADFLRLD+
Sbjct  620   PLRGPTYGYRGKVVLAFEDNESSKIGIRFDRSIPEGNDLGGRCEEDHGFFCAADFLRLDS  679

Query  2154  SSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVV  2333
             S+ DD+DKLAI+ELFEV S+E K S L+LFVKDIEKSMVGNPEA++AFK+KLE LPENV+
Sbjct  680   SNSDDIDKLAIDELFEVASKESKISALVLFVKDIEKSMVGNPEAYAAFKIKLEHLPENVI  739

Query  2334  VIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTR  2513
             VIAS+TQTD+RKEKSHPGG LFTKFGSNQTALLDLAFPD+FGRLHDRSKETPK +KQLTR
Sbjct  740   VIASHTQTDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRSKETPKTMKQLTR  799

Query  2514  LFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIK  2693
             LFPNKV IQ+PQDE LLSDWKQQL+RDI T+KSQSN V+IRNVLNR+ +DCPD+ETLCIK
Sbjct  800   LFPNKVTIQLPQDEALLSDWKQQLERDIGTLKSQSNIVSIRNVLNRIGIDCPDLETLCIK  859

Query  2694  DQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKK  2873
             DQALT+ESVEKIIGWALSHHFMH +ES  +E KL ISS SI YG+++ QG+ NETKS+KK
Sbjct  860   DQALTSESVEKIIGWALSHHFMHKTESPVEEVKLVISSASISYGVNIFQGIHNETKSLKK  919

Query  2874  SLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQ  3053
             SLKDVVTEN+FEK+LLADVIPPSDIGVTF DIGALENVKDTLKELVMLPLQRPELFCKGQ
Sbjct  920   SLKDVVTENDFEKRLLADVIPPSDIGVTFCDIGALENVKDTLKELVMLPLQRPELFCKGQ  979

Query  3054  LTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLA  3233
             LTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LA
Sbjct  980   LTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLA  1039

Query  3234  SKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRP  3413
             SKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRP
Sbjct  1040  SKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRP  1099

Query  3414  FDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLK  3593
             FDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KEEL PNVDL+AIANMTEGYSGSDLK
Sbjct  1100  FDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEELTPNVDLEAIANMTEGYSGSDLK  1159

Query  3594  NLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASV  3773
             NLCVTAAHCPIREILEKEKKEKALA+S++RP+PALH+S D+RPLN DDF+YAHEQVCASV
Sbjct  1160  NLCVTAAHCPIREILEKEKKEKALAVSDSRPVPALHSSVDVRPLNKDDFKYAHEQVCASV  1219

Query  3774  SSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             SSES NM ELLQWNELYGEGGSRKKK+LSYFM
Sbjct  1220  SSESANMNELLQWNELYGEGGSRKKKSLSYFM  1251



>ref|XP_006352811.1| PREDICTED: uncharacterized protein LOC102580303 isoform X2 [Solanum 
tuberosum]
Length=1249

 Score =  1950 bits (5052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 998/1255 (80%), Positives = 1113/1255 (89%), Gaps = 15/1255 (1%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQE  311
             MVETRRSSSSSKRPL SPSSPLPNGKRSKA E+LSST+D +G+KT GAVNESG ESAEQE
Sbjct  1     MVETRRSSSSSKRPLSSPSSPLPNGKRSKAVEALSSTNDTIGQKTQGAVNESGQESAEQE  60

Query  312   IRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGK  491
             +RS DL GAS LKS +A +P K PE  + GEPLVSP+ LG + ID +KVK NGS LNRGK
Sbjct  61    VRSVDLAGASVLKSSDASLPLKSPENQVQGEPLVSPITLGHTVIDAEKVKLNGSTLNRGK  120

Query  492   KRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQ  671
             KRQLKSN+G AWGKL+SQ  QN HV + + T++VGQGRQCD  + DPSVSKSLCNLKHI+
Sbjct  121   KRQLKSNVGVAWGKLISQCSQNPHVVMHRPTYSVGQGRQCDFWIGDPSVSKSLCNLKHIE  180

Query  672   REKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDI  851
             +EKG  ITLLEI+GKKG VQVNGK+YPKNSTVPLN GDE++FGSSG HAYIF+K TN++ 
Sbjct  181   QEKGGFITLLEITGKKGDVQVNGKVYPKNSTVPLNDGDEMVFGSSGDHAYIFEKITNDNK  240

Query  852   SAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCND  1031
             S   +P  VSILEAHSG VKG++ EARSGDPSTVAVASTLASLSN +KE  LLPPS  N 
Sbjct  241   SC--LPRQVSILEAHSGSVKGLHIEARSGDPSTVAVASTLASLSNFQKESSLLPPSSQNG  298

Query  1032  NDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNLNL  1202
              D++Q  EMP LP A G  DKHDLD++MKD S H+++P   L EK+G ISPD+GN+NLNL
Sbjct  299   KDVQQSSEMPRLPAADGVSDKHDLDAEMKDASKHSNLPGVSLCEKTGVISPDTGNENLNL  358

Query  1203  ENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR---ELLKDF  1373
             +NGA+DS + EIGK++G  QELRPL+R+LAGSS  EFDLSG+IS+I+++RR   ELL+D 
Sbjct  359   DNGALDSVNAEIGKISGVAQELRPLLRVLAGSS--EFDLSGSISKILEERRGIRELLRDL  416

Query  1374  DPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFV  1553
             DP I  STRRQAFKD LQQ +LDS +IEVSFE+FPYYLSE TKNVLI+STY+HLKC+KF 
Sbjct  417   DPPILTSTRRQAFKDALQQGVLDSKSIEVSFENFPYYLSETTKNVLISSTYVHLKCHKFT  476

Query  1554  KCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPV  1730
             K A +LPT+CPRILLSGPAGSEIYQETLAKALAKYFG RLL+VDSL+LPGGS AK++D V
Sbjct  477   KYAPDLPTLCPRILLSGPAGSEIYQETLAKALAKYFGVRLLIVDSLLLPGGSIAKDIDSV  536

Query  1731  KEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-  1907
             KE+ KPERT VF+KRAAQ A    NKKPASSVEADITGGS +SS AQ KQEASTASSKN 
Sbjct  537   KESSKPERTSVFSKRAAQVAAQHLNKKPASSVEADITGGSTVSSQAQPKQEASTASSKNY  596

Query  1908  TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGN  2084
             TFK GDRVKYVGPL +GFS LQ P RGP YGY+GKV+LAFE+N  SKIG+RFDRSIPEGN
Sbjct  597   TFKKGDRVKYVGPLQSGFSPLQAPLRGPTYGYRGKVVLAFEDNESSKIGIRFDRSIPEGN  656

Query  2085  DLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKS  2264
             DLGG CEEDHGFFCAADFLRLD+S+ DD+DKLAI+ELFEV S+E K S L+LFVKDIEKS
Sbjct  657   DLGGHCEEDHGFFCAADFLRLDSSNSDDIDKLAIDELFEVASKESKISALVLFVKDIEKS  716

Query  2265  MVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAF  2444
             MVGNPEA++AFK+KLE LPENV+VIAS+TQTD+RKEKSH GG LFTKFGSNQTALLDLAF
Sbjct  717   MVGNPEAYAAFKIKLEHLPENVIVIASHTQTDSRKEKSHTGGLLFTKFGSNQTALLDLAF  776

Query  2445  PDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNA  2624
             PDNFGRLHDRSKETPK +KQLTRLFPNKV IQ+PQDE LLSDWKQQL+RDI T+KSQSN 
Sbjct  777   PDNFGRLHDRSKETPKTLKQLTRLFPNKVTIQLPQDEALLSDWKQQLERDIGTLKSQSNI  836

Query  2625  VNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAIS  2804
              +IRNVLNR+ +DCPD+ETLCIKDQALT  SVEKI+GWAL HHFMH SES  KE KL IS
Sbjct  837   ASIRNVLNRIGIDCPDLETLCIKDQALT--SVEKIVGWALGHHFMHKSESPVKEAKLVIS  894

Query  2805  SESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALEN  2984
             S SI YG+++ QG+ NETKS+KKSLKDVVTEN+FEK+LLADVIPPSDIGVTF DIGALEN
Sbjct  895   SASISYGVNIFQGIHNETKSLKKSLKDVVTENDFEKRLLADVIPPSDIGVTFGDIGALEN  954

Query  2985  VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINIS  3164
             VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINIS
Sbjct  955   VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINIS  1014

Query  3165  MSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFM  3344
             MSSITSKWFGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFM
Sbjct  1015  MSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFM  1074

Query  3345  VNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEE  3524
             VNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KEE
Sbjct  1075  VNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEE  1134

Query  3525  LAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHN  3704
             L PNVDL+AIANMTEGYSGSDLKNLC+TAAHCPIREILEKEKKEKALA++E+RP+PALH+
Sbjct  1135  LTPNVDLEAIANMTEGYSGSDLKNLCITAAHCPIREILEKEKKEKALAVAESRPVPALHS  1194

Query  3705  SSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             S D+RPLNMDDF+YAHEQVCASVSSES NM ELLQWNELYGEGGSRKKK+LSYFM
Sbjct  1195  SVDVRPLNMDDFKYAHEQVCASVSSESANMNELLQWNELYGEGGSRKKKSLSYFM  1249



>ref|XP_010323025.1| PREDICTED: uncharacterized protein LOC101246936 isoform X2 [Solanum 
lycopersicum]
Length=1249

 Score =  1947 bits (5043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 979/1232 (79%), Positives = 1092/1232 (89%), Gaps = 15/1232 (1%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKL  380
             NGKRSKA E+LSST+D +G+KT GAVNESG ESAEQE+RSADL GAS LKS +A +P K 
Sbjct  24    NGKRSKAVEALSSTNDTIGQKTQGAVNESGQESAEQEVRSADLSGASVLKSSDASLPLKS  83

Query  381   PEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNS  560
             PE  + GEPLVSP+ LG S I+ +KVK NGS LNRGKKRQLKSN+G AWGKL+SQ  QN 
Sbjct  84    PENQVKGEPLVSPITLGHSVINAEKVKLNGSTLNRGKKRQLKSNVGAAWGKLISQCSQNP  143

Query  561   HVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNG  740
             HV +   T++VGQGRQCDL + DPSVSKSLCNLKHI++EKG  ITLLEI+GKKG VQVNG
Sbjct  144   HVVMHHPTYSVGQGRQCDLWIGDPSVSKSLCNLKHIEQEKGGFITLLEITGKKGDVQVNG  203

Query  741   KIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVN  920
             K+YPKNSTVPLN GDE++FGSSG HAYIF+K TN++ S   +P  VSILEAHSG VKG++
Sbjct  204   KVYPKNSTVPLNDGDEMVFGSSGDHAYIFEKITNDNKSC--LPRQVSILEAHSGSVKGLH  261

Query  921   FEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHD  1100
              EARSGDPSTVAVASTLASLSN +KE  LL PS  N  D++Q  E+P LP A G  DKHD
Sbjct  262   IEARSGDPSTVAVASTLASLSNFQKESSLLSPSSQNGKDLQQSSELPRLPAADGVSDKHD  321

Query  1101  LDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQELR  1271
             LD++MKD S+ +++P   L EK+G ISPDSGN+ LNL+NGA+DS D EIGK++G  QELR
Sbjct  322   LDAEMKDASNLSNLPGVSLCEKTGVISPDSGNEKLNLDNGALDSVDAEIGKISGVAQELR  381

Query  1272  PLIRMLAGSSTPEFDLSGNISRIIDQRR---ELLKDFDPLISMSTRRQAFKDGLQQTILD  1442
             PL+R+LAGSS  EFDLSG+IS+I++ RR   ELL+D DP I  STRRQAFKD LQQ ILD
Sbjct  382   PLLRVLAGSS--EFDLSGSISKILEDRRGIRELLRDLDPPILTSTRRQAFKDALQQGILD  439

Query  1443  SNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEI  1622
             S +IEVSFE+FPYYLSE TKNVLI+STY+HLKC+KF+K A +LPT+CPRILLSGPAGSEI
Sbjct  440   SKSIEVSFENFPYYLSETTKNVLISSTYVHLKCHKFIKYAPDLPTLCPRILLSGPAGSEI  499

Query  1623  YQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLR  1799
             YQETLAKALAKYFG RLL+VDSL+LPGGS AK++D VKE+ KPER  VF KRAAQ A L 
Sbjct  500   YQETLAKALAKYFGVRLLIVDSLLLPGGSIAKDIDSVKESSKPERASVFAKRAAQVAALH  559

Query  1800  FNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQT  1973
              NKKPASSVEADITGGS +SSHAQ KQEASTASSKN TFK GDRVKYVGPL +GFS LQ 
Sbjct  560   LNKKPASSVEADITGGSTVSSHAQPKQEASTASSKNYTFKKGDRVKYVGPLQSGFSPLQA  619

Query  1974  PARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDN  2153
             P RGP YGY+GKV+LAFE+N  SKIG+RFDRSIPEGNDLGG CEEDHGFFCAADFLRLD+
Sbjct  620   PLRGPTYGYRGKVVLAFEDNESSKIGIRFDRSIPEGNDLGGRCEEDHGFFCAADFLRLDS  679

Query  2154  SSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVV  2333
             S+ DD+DKLAI+ELFEV S+E K S L+LFVKDIEKSMVGNPEA++AFK+KLE LPENV+
Sbjct  680   SNSDDIDKLAIDELFEVASKESKISALVLFVKDIEKSMVGNPEAYAAFKIKLEHLPENVI  739

Query  2334  VIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTR  2513
             VIAS+TQTD+RKEKSHPGG LFTKFGSNQTALLDLAFPD+FGRLHDRSKETPK +KQLTR
Sbjct  740   VIASHTQTDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRSKETPKTMKQLTR  799

Query  2514  LFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIK  2693
             LFPNKV IQ+PQDE LLSDWKQQL+RDI T+KSQSN V+IRNVLNR+ +DCPD+ETLCIK
Sbjct  800   LFPNKVTIQLPQDEALLSDWKQQLERDIGTLKSQSNIVSIRNVLNRIGIDCPDLETLCIK  859

Query  2694  DQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKK  2873
             DQALT  SVEKIIGWALSHHFMH +ES  +E KL ISS SI YG+++ QG+ NETKS+KK
Sbjct  860   DQALT--SVEKIIGWALSHHFMHKTESPVEEVKLVISSASISYGVNIFQGIHNETKSLKK  917

Query  2874  SLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQ  3053
             SLKDVVTEN+FEK+LLADVIPPSDIGVTF DIGALENVKDTLKELVMLPLQRPELFCKGQ
Sbjct  918   SLKDVVTENDFEKRLLADVIPPSDIGVTFCDIGALENVKDTLKELVMLPLQRPELFCKGQ  977

Query  3054  LTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLA  3233
             LTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LA
Sbjct  978   LTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLA  1037

Query  3234  SKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRP  3413
             SKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRP
Sbjct  1038  SKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRP  1097

Query  3414  FDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLK  3593
             FDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KEEL PNVDL+AIANMTEGYSGSDLK
Sbjct  1098  FDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEELTPNVDLEAIANMTEGYSGSDLK  1157

Query  3594  NLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASV  3773
             NLCVTAAHCPIREILEKEKKEKALA+S++RP+PALH+S D+RPLN DDF+YAHEQVCASV
Sbjct  1158  NLCVTAAHCPIREILEKEKKEKALAVSDSRPVPALHSSVDVRPLNKDDFKYAHEQVCASV  1217

Query  3774  SSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             SSES NM ELLQWNELYGEGGSRKKK+LSYFM
Sbjct  1218  SSESANMNELLQWNELYGEGGSRKKKSLSYFM  1249



>ref|XP_009797825.1| PREDICTED: uncharacterized protein LOC104244168 [Nicotiana sylvestris]
Length=1248

 Score =  1899 bits (4920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 978/1235 (79%), Positives = 1083/1235 (88%), Gaps = 23/1235 (2%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGA-SALKSPEAPVPEK  377
             NGKRSKA E+LSST+D LG KT GAVNES    AEQE+RSADL  A + LKS +A +P K
Sbjct  25    NGKRSKAAEALSSTNDTLGGKTQGAVNES----AEQEVRSADLAAAATVLKSSDASLPLK  80

Query  378   LPEAPLGGEPLVSPMILGDSAIDV-DKVKANGSALNRGKKRQLKSNL-GTAWGKLLSQYP  551
              PE  + GEPLVSPM LG S ID  +K K NGS   + KKRQLKSN+ G AW +L+SQ  
Sbjct  81    SPENQVDGEPLVSPMTLGHSVIDAAEKAKLNGS---KAKKRQLKSNVVGAAWAQLISQCS  137

Query  552   QNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQ  731
             QN H  + + T++VGQGRQCDLC+ DPSVSKSLCNLKHI++EKG  +TLLEI+GKKG VQ
Sbjct  138   QNPHFVMHRPTYSVGQGRQCDLCIGDPSVSKSLCNLKHIEQEKGGFVTLLEITGKKGDVQ  197

Query  732   VNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVK  911
             VN K+YPK STVPLN GDEV+FGSSG+HAYIF   TN++ S  S+P  +SILEAHSG VK
Sbjct  198   VNSKVYPKMSTVPLNDGDEVVFGSSGQHAYIFNIITNDNKS--SLPHPISILEAHSGSVK  255

Query  912   GVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPD  1091
             G++FEARSGDPSTVAVAS LASLSNL+KEL LLPPS  N  D+K+G EM  LP A+G  D
Sbjct  256   GLHFEARSGDPSTVAVASALASLSNLEKELSLLPPSSQNGKDVKEGSEMSRLPAANGVAD  315

Query  1092  KHDLDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQ  1262
             KHDLD DMKD SDH+D+P   L EK+G ISPD+ N+N+NL+ GA+DS D EIGK++GA Q
Sbjct  316   KHDLDIDMKDASDHSDLPGVLLREKTGVISPDTRNENMNLD-GALDSDDAEIGKISGAAQ  374

Query  1263  ELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLISMSTRRQAFKDGLQQT  1433
             ELRPL+ +LAGSS  EFDLSGN SR  ++RRE   LL+DFDP I  STR QAFKD LQQ 
Sbjct  375   ELRPLLHVLAGSSA-EFDLSGNFSRNFEERREICKLLRDFDPPILTSTRHQAFKDLLQQG  433

Query  1434  ILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAG  1613
             +LDS NI+VSFE+FPYYLSE TKNVLIASTYIHLKC+KF K AS+LPT+CPRILLSGPAG
Sbjct  434   LLDSKNIDVSFENFPYYLSETTKNVLIASTYIHLKCHKFTKYASDLPTLCPRILLSGPAG  493

Query  1614  SEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAA  1790
             SEIYQETLAKALAK+FGARLL+VDSL+LPGGS AK++D VKE+ KPER   F KRAAQ A
Sbjct  494   SEIYQETLAKALAKFFGARLLIVDSLLLPGGSTAKDIDSVKESSKPERASTFAKRAAQVA  553

Query  1791  VLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-  1964
              L  NKKPASSVEADITGGS ISSHAQ KQEASTASSKN TFK GDRVKYVGPL +G S 
Sbjct  554   ALHLNKKPASSVEADITGGSTISSHAQPKQEASTASSKNYTFKKGDRVKYVGPLQSGISP  613

Query  1965  LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLR  2144
             LQTP RGP YGY+GKV+LAFE+N  SKIGVRFD+SIPEGNDLGGLCEEDHGFFCAAD LR
Sbjct  614   LQTPLRGPTYGYRGKVVLAFEDNEASKIGVRFDKSIPEGNDLGGLCEEDHGFFCAADLLR  673

Query  2145  LDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPE  2324
             +D+SS DD+DKLAI+ELFEV S+E KSS L+L VKDIEKSMVGNPEA++AFK+KLE LPE
Sbjct  674   VDSSSSDDIDKLAIDELFEVASKESKSSALVLLVKDIEKSMVGNPEAYAAFKVKLEHLPE  733

Query  2325  NVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQ  2504
             NVVVIASYTQTDNRKEKSHPGG LFTK GSNQTALLDLAFPDNFGRLHDRSKETPK +KQ
Sbjct  734   NVVVIASYTQTDNRKEKSHPGGLLFTKLGSNQTALLDLAFPDNFGRLHDRSKETPKTMKQ  793

Query  2505  LTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETL  2684
             L RLFPNKV IQ+PQDE LLSDWKQQL+RDIET+KSQSN  +IRNVL+R+ +DCPD+ETL
Sbjct  794   LIRLFPNKVTIQLPQDEALLSDWKQQLERDIETLKSQSNIASIRNVLSRIGIDCPDLETL  853

Query  2685  CIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKS  2864
             CIKDQALT+ESVEKIIGWALSHHFMH SESS KE KL IS ESI YGL++LQG QNETKS
Sbjct  854   CIKDQALTSESVEKIIGWALSHHFMHKSESSIKEAKLVISGESIGYGLNILQGTQNETKS  913

Query  2865  VKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFC  3044
             +KKSLKDV TEN+FEK+LLADVIPP DIGVTFDDIGALENVKDTLKELVMLPLQRPELFC
Sbjct  914   LKKSLKDVATENDFEKRLLADVIPPCDIGVTFDDIGALENVKDTLKELVMLPLQRPELFC  973

Query  3045  KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF  3224
             KGQLTKPCKGILLFG PGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK+VKAVF
Sbjct  974   KGQLTKPCKGILLFGSPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKFVKAVF  1033

Query  3225  TLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAAT  3404
             +LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAAT
Sbjct  1034  SLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAAT  1093

Query  3405  NRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGS  3584
             NRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL +EELAPNVDL AIANMTEGYSGS
Sbjct  1094  NRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAEEELAPNVDLKAIANMTEGYSGS  1153

Query  3585  DLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVC  3764
             DLKNLCVTAAHCPIREILEKEKKE+ALA++E+RP+P+LH+S+DIRPLN+DDF YAHEQVC
Sbjct  1154  DLKNLCVTAAHCPIREILEKEKKERALAVAESRPVPSLHSSADIRPLNIDDFNYAHEQVC  1213

Query  3765  ASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             ASVSSES NM ELLQWNELYGEGGSRKKK+LSYFM
Sbjct  1214  ASVSSESANMNELLQWNELYGEGGSRKKKSLSYFM  1248



>ref|XP_009781903.1| PREDICTED: uncharacterized protein LOC104230725 isoform X1 [Nicotiana 
sylvestris]
Length=1238

 Score =  1897 bits (4915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 998/1257 (79%), Positives = 1094/1257 (87%), Gaps = 30/1257 (2%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSS-TDDMLGEKTPGAVNESGPESAEQ  308
             MVETRRSSSSSKR L SPSSP+ NGKRSKATE+LSS T+D LGEK  G +NESGPESAEQ
Sbjct  1     MVETRRSSSSSKRSLSSPSSPISNGKRSKATEALSSSTNDTLGEKIQGELNESGPESAEQ  60

Query  309   EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  488
             E+RSADL  A       A VP+K  E     EPLVSPM LGDS IDV+K KA  SALNRG
Sbjct  61    EVRSADLAAA-------ADVPQKSLETEAANEPLVSPMTLGDSVIDVEKSKAKESALNRG  113

Query  489   KKRQLKSNLGTA-WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKH  665
             KKRQLKSN+G A WGKL+SQ  QN HV + ++T+TVGQGR  DL + D SVSK+LCNLKH
Sbjct  114   KKRQLKSNVGAAAWGKLVSQCSQNPHVVMHRATYTVGQGRGSDLWIGDSSVSKTLCNLKH  173

Query  666   IQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNE  845
              + EKG SITLLE+ GKKG VQVNGK+YPKNSTVPL GGDE++FGSSG+H+YIF    ++
Sbjct  174   TETEKGVSITLLEVMGKKGDVQVNGKVYPKNSTVPLKGGDEIVFGSSGQHSYIF----DD  229

Query  846   DISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVC  1025
             ++SAAS    VSILEAHSG +KG++ EARS DPSTVAVASTLASLSNL KEL LLPPS  
Sbjct  230   NLSAASFARPVSILEAHSGSIKGLHLEARSRDPSTVAVASTLASLSNLSKELSLLPPSSQ  289

Query  1026  NDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNL  1196
             N  D+KQ  E+P LP ASG  +K DLD+DMKD SD NDVP   +DEK+  ISPD GNDNL
Sbjct  290   NGKDVKQCSELPILPAASGVAEKDDLDTDMKDASDCNDVPRVLVDEKNDVISPDVGNDNL  349

Query  1197  NLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR---ELLK  1367
             NL+N A+DS D EIGKV       RPL+ + AGSS  EFDLSG IS+I++++R   EL K
Sbjct  350   NLDNTALDSVDAEIGKV-------RPLLGVHAGSSASEFDLSGRISKILEEQRDFRELFK  402

Query  1368  DFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNK  1547
             DFDP IS  TRRQAFK+ LQQ +LD NNIEVSFE+FPYYLSE TKN+LIASTYIHLKCNK
Sbjct  403   DFDPPISALTRRQAFKNALQQGVLDFNNIEVSFENFPYYLSENTKNILIASTYIHLKCNK  462

Query  1548  FVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELD  1724
             F K  S+LPTVCPRILLSGPAGSEIYQETLAKALAK FGA+LL+VDSL+LPGGS AK++D
Sbjct  463   FAKYTSDLPTVCPRILLSGPAGSEIYQETLAKALAKRFGAKLLIVDSLLLPGGSIAKDVD  522

Query  1725  PVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK  1904
             PVKE+ KP R  VF KRAAQAA L  NKKPASSVEADITGGS ISSHAQ KQE STASSK
Sbjct  523   PVKESSKPGRASVFAKRAAQAAALHLNKKPASSVEADITGGSTISSHAQPKQETSTASSK  582

Query  1905  N-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPE  2078
             N TFK GDRVKYVG   +GFS LQTP RGP YGY+GKV+LAFEENG SKIGVRFD+SIPE
Sbjct  583   NYTFKKGDRVKYVGS-SSGFSPLQTPLRGPTYGYRGKVVLAFEENGSSKIGVRFDKSIPE  641

Query  2079  GNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIE  2258
             GNDLGGLC+EDHGFFCAAD LRLD+SS D++DKLAINELFEV S E KSSPL+LF+KDIE
Sbjct  642   GNDLGGLCDEDHGFFCAADLLRLDSSSTDEIDKLAINELFEVASNESKSSPLVLFIKDIE  701

Query  2259  KSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDL  2438
             KSMVGNPEA++AFK+KLE LPENVV IAS TQ+DNRKEKSHPGG LFTKFGSNQT+LLDL
Sbjct  702   KSMVGNPEAYAAFKIKLEHLPENVVAIASLTQSDNRKEKSHPGGLLFTKFGSNQTSLLDL  761

Query  2439  AFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQS  2618
             AFPDNFGRLHDRSKETPK +KQLTRLFPNKV IQIPQDETLLSDWKQQLDRD+ETMKSQS
Sbjct  762   AFPDNFGRLHDRSKETPKTMKQLTRLFPNKVTIQIPQDETLLSDWKQQLDRDMETMKSQS  821

Query  2619  NAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLA  2798
             N  +IRNVLNR  +DCPD+ETLCIKDQALTNESVEKIIGWALSHHFMH SESS K+ KL 
Sbjct  822   NIASIRNVLNRNRIDCPDLETLCIKDQALTNESVEKIIGWALSHHFMHESESSVKDAKLV  881

Query  2799  ISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGAL  2978
             IS ESI YGL++LQG+Q+ETKS KKSLKDVVTENEFEK+LL DVIPPSDIGVTF+DIGAL
Sbjct  882   ISGESIAYGLNILQGIQSETKSSKKSLKDVVTENEFEKRLLGDVIPPSDIGVTFNDIGAL  941

Query  2979  ENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN  3158
             E VKDTLKELVMLPLQRPELFCKGQLTKPC GILLFGPPGTGKTMLAKAVATEAGANFIN
Sbjct  942   ETVKDTLKELVMLPLQRPELFCKGQLTKPCTGILLFGPPGTGKTMLAKAVATEAGANFIN  1001

Query  3159  ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNE  3338
             ISMSSITSKWFGEGEKYVKAVFTLASKIA SVVFVDEVDSMLGRRE+PGEHEAMRKMKNE
Sbjct  1002  ISMSSITSKWFGEGEKYVKAVFTLASKIASSVVFVDEVDSMLGRRENPGEHEAMRKMKNE  1061

Query  3339  FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTK  3518
             FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVN+PDAPNR+KILR+IL K
Sbjct  1062  FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNVPDAPNRKKILRVILAK  1121

Query  3519  EELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPAL  3698
             EELAPNVD++AIANMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKA A++ENRP PAL
Sbjct  1122  EELAPNVDVEAIANMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKASAVAENRPTPAL  1181

Query  3699  HNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
              +S+DIRPLNMDDF+YAHEQVCASVSSES+NM ELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1182  RSSADIRPLNMDDFKYAHEQVCASVSSESSNMNELLQWNDLYGEGGSRKKTSLSYFM  1238



>ref|XP_009598050.1| PREDICTED: uncharacterized protein LOC104093922 isoform X1 [Nicotiana 
tomentosiformis]
Length=1237

 Score =  1894 bits (4907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 998/1257 (79%), Positives = 1095/1257 (87%), Gaps = 31/1257 (2%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSS-TDDMLGEKTPGAVNESGPESAEQ  308
             MVETRRSSSSSKR L SPSSP+ NGKRSKA E+LSS T+D LGEK  G +NESGPESAEQ
Sbjct  1     MVETRRSSSSSKRSLSSPSSPISNGKRSKAAEALSSSTNDTLGEKIQGELNESGPESAEQ  60

Query  309   EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  488
             E+RSADLD A       A VP+K  E     EPLVSPM LGDS IDV+K KA  SALNRG
Sbjct  61    EVRSADLDAA-------ADVPQKSLETEAANEPLVSPMTLGDSVIDVEKSKAKESALNRG  113

Query  489   KKRQLKSNLGTA-WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKH  665
             KKRQLKSN+  A WGKL+SQ  QN HV + ++T+TVGQGR  DL + D SVSK+LCNLKH
Sbjct  114   KKRQLKSNVAAAAWGKLVSQCSQNPHVVMHRATYTVGQGRGSDLWIGDSSVSKTLCNLKH  173

Query  666   IQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNE  845
              + EKG SITLLE+ GKKG VQVNGK+YPKNSTVPL GGDEV+FGSSG+H+YIF    ++
Sbjct  174   TETEKGVSITLLEVMGKKGDVQVNGKVYPKNSTVPLKGGDEVVFGSSGQHSYIF----DD  229

Query  846   DISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVC  1025
             ++SAAS   SVSIL AHSG +KG++ EARS DPSTVAVASTLASLSNL KEL LLPPS  
Sbjct  230   NLSAASFAHSVSILGAHSGSIKGLHLEARSRDPSTVAVASTLASLSNLPKELSLLPPSSQ  289

Query  1026  NDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNL  1196
             N  D+KQ  E+P LP ASG  DK DLD DMKD SD NDVP   +DEK+   SPD GN NL
Sbjct  290   NGKDVKQSSEVPILPAASGVADKDDLDIDMKDASDCNDVPRVLVDEKNDVTSPDVGNGNL  349

Query  1197  NLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR---ELLK  1367
             NL+N A+DS D EIGKV       RPL+R+LAGSS  EF LSG IS+I++++R   EL K
Sbjct  350   NLDNIALDSVDAEIGKV-------RPLLRVLAGSSASEFGLSG-ISKILEEQRDFRELFK  401

Query  1368  DFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNK  1547
             DFDP IS  TRRQAFK+ L+Q +LD NNIEVSFE+FPYYLSE TK++LIASTYIHLKCNK
Sbjct  402   DFDPPISALTRRQAFKNALEQGVLDFNNIEVSFENFPYYLSENTKDILIASTYIHLKCNK  461

Query  1548  FVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELD  1724
             F K  S+LPTVCPRILLSGPAGSEIYQETLAKALAK+FGA+LL+VDSL+LPGGS AK++D
Sbjct  462   FAKYTSDLPTVCPRILLSGPAGSEIYQETLAKALAKHFGAKLLIVDSLLLPGGSIAKDVD  521

Query  1725  PVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK  1904
             PVKE+ KP R  VF KRAAQAA L  NKKPASSVEADITGGS ISSHAQ KQEASTASSK
Sbjct  522   PVKESSKPGRASVFAKRAAQAAALHLNKKPASSVEADITGGSTISSHAQPKQEASTASSK  581

Query  1905  N-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPE  2078
             N TFK GDRVKYVG   +GFS LQTP RGP YGYKGKV+LAFEENG SKIGVRFD+SIPE
Sbjct  582   NYTFKKGDRVKYVGS-SSGFSPLQTPLRGPTYGYKGKVVLAFEENGSSKIGVRFDKSIPE  640

Query  2079  GNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIE  2258
             GNDLGGLC+EDHGFFCAAD LRLD+SS D++DKLAINELFEV S E KSSPL+LF+KDIE
Sbjct  641   GNDLGGLCDEDHGFFCAADLLRLDSSSTDEIDKLAINELFEVASNESKSSPLVLFIKDIE  700

Query  2259  KSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDL  2438
             KSMVGNPEA++AFK+KLE LPENVV IAS TQ+DNRKEKSHPGG LFTKFGSNQTALLDL
Sbjct  701   KSMVGNPEAYAAFKIKLEHLPENVVAIASLTQSDNRKEKSHPGGLLFTKFGSNQTALLDL  760

Query  2439  AFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQS  2618
             AFPDNFGRLHDRSKETPK +KQLTRLFPNKV IQIPQDETLLSDWKQQLDRD+ETMKSQ+
Sbjct  761   AFPDNFGRLHDRSKETPKTMKQLTRLFPNKVTIQIPQDETLLSDWKQQLDRDMETMKSQA  820

Query  2619  NAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLA  2798
             N  +IRNVLNR+ +DCPD+ETLCIKDQALTNESVEKI+GWALSHHFMH SESS K+ KL 
Sbjct  821   NIASIRNVLNRIRIDCPDLETLCIKDQALTNESVEKIVGWALSHHFMHESESSVKDAKLV  880

Query  2799  ISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGAL  2978
             IS ESI YGL++LQG+Q+ETKS KKSLKDVVTENEFEK+LL DVIPPSDIGVTF+DIGAL
Sbjct  881   ISGESIAYGLNILQGIQSETKSSKKSLKDVVTENEFEKRLLGDVIPPSDIGVTFNDIGAL  940

Query  2979  ENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN  3158
             E VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN
Sbjct  941   ETVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN  1000

Query  3159  ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNE  3338
             ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNE
Sbjct  1001  ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNE  1060

Query  3339  FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTK  3518
             FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVN+PDAPNR+KILR+IL K
Sbjct  1061  FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNVPDAPNRKKILRVILAK  1120

Query  3519  EELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPAL  3698
             EEL PNVD++AIANMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKA A++EN+P PAL
Sbjct  1121  EELVPNVDVEAIANMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKASAVAENKPSPAL  1180

Query  3699  HNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             H+S+DIRPLNMDDF+YAHEQVCASVS ES+NM ELLQWNELYGEGGSRKK +LSYFM
Sbjct  1181  HSSADIRPLNMDDFKYAHEQVCASVSPESSNMNELLQWNELYGEGGSRKKISLSYFM  1237



>ref|XP_010323026.1| PREDICTED: uncharacterized protein LOC101246936 isoform X3 [Solanum 
lycopersicum]
Length=1219

 Score =  1888 bits (4890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 948/1197 (79%), Positives = 1061/1197 (89%), Gaps = 13/1197 (1%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKL  380
             NGKRSKA E+LSST+D +G+KT GAVNESG ESAEQE+RSADL GAS LKS +A +P K 
Sbjct  24    NGKRSKAVEALSSTNDTIGQKTQGAVNESGQESAEQEVRSADLSGASVLKSSDASLPLKS  83

Query  381   PEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNS  560
             PE  + GEPLVSP+ LG S I+ +KVK NGS LNRGKKRQLKSN+G AWGKL+SQ  QN 
Sbjct  84    PENQVKGEPLVSPITLGHSVINAEKVKLNGSTLNRGKKRQLKSNVGAAWGKLISQCSQNP  143

Query  561   HVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNG  740
             HV +   T++VGQGRQCDL + DPSVSKSLCNLKHI++EKG  ITLLEI+GKKG VQVNG
Sbjct  144   HVVMHHPTYSVGQGRQCDLWIGDPSVSKSLCNLKHIEQEKGGFITLLEITGKKGDVQVNG  203

Query  741   KIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVN  920
             K+YPKNSTVPLN GDE++FGSSG HAYIF+K TN++ S   +P  VSILEAHSG VKG++
Sbjct  204   KVYPKNSTVPLNDGDEMVFGSSGDHAYIFEKITNDNKSC--LPRQVSILEAHSGSVKGLH  261

Query  921   FEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHD  1100
              EARSGDPSTVAVASTLASLSN +KE  LL PS  N  D++Q  E+P LP A G  DKHD
Sbjct  262   IEARSGDPSTVAVASTLASLSNFQKESSLLSPSSQNGKDLQQSSELPRLPAADGVSDKHD  321

Query  1101  LDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQELR  1271
             LD++MKD S+ +++P   L EK+G ISPDSGN+ LNL+NGA+DS D EIGK++G  QELR
Sbjct  322   LDAEMKDASNLSNLPGVSLCEKTGVISPDSGNEKLNLDNGALDSVDAEIGKISGVAQELR  381

Query  1272  PLIRMLAGSSTPEFDLSGNISRIIDQRR---ELLKDFDPLISMSTRRQAFKDGLQQTILD  1442
             PL+R+LAGSS  EFDLSG+IS+I++ RR   ELL+D DP I  STRRQAFKD LQQ ILD
Sbjct  382   PLLRVLAGSS--EFDLSGSISKILEDRRGIRELLRDLDPPILTSTRRQAFKDALQQGILD  439

Query  1443  SNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEI  1622
             S +IEVSFE+FPYYLSE TKNVLI+STY+HLKC+KF+K A +LPT+CPRILLSGPAGSEI
Sbjct  440   SKSIEVSFENFPYYLSETTKNVLISSTYVHLKCHKFIKYAPDLPTLCPRILLSGPAGSEI  499

Query  1623  YQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLR  1799
             YQETLAKALAKYFG RLL+VDSL+LPGGS AK++D VKE+ KPER  VF KRAAQ A L 
Sbjct  500   YQETLAKALAKYFGVRLLIVDSLLLPGGSIAKDIDSVKESSKPERASVFAKRAAQVAALH  559

Query  1800  FNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQT  1973
              NKKPASSVEADITGGS +SSHAQ KQEASTASSKN TFK GDRVKYVGPL +GFS LQ 
Sbjct  560   LNKKPASSVEADITGGSTVSSHAQPKQEASTASSKNYTFKKGDRVKYVGPLQSGFSPLQA  619

Query  1974  PARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDN  2153
             P RGP YGY+GKV+LAFE+N  SKIG+RFDRSIPEGNDLGG CEEDHGFFCAADFLRLD+
Sbjct  620   PLRGPTYGYRGKVVLAFEDNESSKIGIRFDRSIPEGNDLGGRCEEDHGFFCAADFLRLDS  679

Query  2154  SSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVV  2333
             S+ DD+DKLAI+ELFEV S+E K S L+LFVKDIEKSMVGNPEA++AFK+KLE LPENV+
Sbjct  680   SNSDDIDKLAIDELFEVASKESKISALVLFVKDIEKSMVGNPEAYAAFKIKLEHLPENVI  739

Query  2334  VIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTR  2513
             VIAS+TQTD+RKEKSHPGG LFTKFGSNQTALLDLAFPD+FGRLHDRSKETPK +KQLTR
Sbjct  740   VIASHTQTDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRSKETPKTMKQLTR  799

Query  2514  LFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIK  2693
             LFPNKV IQ+PQDE LLSDWKQQL+RDI T+KSQSN V+IRNVLNR+ +DCPD+ETLCIK
Sbjct  800   LFPNKVTIQLPQDEALLSDWKQQLERDIGTLKSQSNIVSIRNVLNRIGIDCPDLETLCIK  859

Query  2694  DQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKK  2873
             DQALT+ESVEKIIGWALSHHFMH +ES  +E KL ISS SI YG+++ QG+ NETKS+KK
Sbjct  860   DQALTSESVEKIIGWALSHHFMHKTESPVEEVKLVISSASISYGVNIFQGIHNETKSLKK  919

Query  2874  SLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQ  3053
             SLKDVVTEN+FEK+LLADVIPPSDIGVTF DIGALENVKDTLKELVMLPLQRPELFCKGQ
Sbjct  920   SLKDVVTENDFEKRLLADVIPPSDIGVTFCDIGALENVKDTLKELVMLPLQRPELFCKGQ  979

Query  3054  LTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLA  3233
             LTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LA
Sbjct  980   LTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLA  1039

Query  3234  SKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRP  3413
             SKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRP
Sbjct  1040  SKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRP  1099

Query  3414  FDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLK  3593
             FDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KEEL PNVDL+AIANMTEGYSGSDLK
Sbjct  1100  FDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEELTPNVDLEAIANMTEGYSGSDLK  1159

Query  3594  NLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVC  3764
             NLCVTAAHCPIREILEKEKKEKALA+S++RP+PALH+S D+RPLN DDF+YAHEQVC
Sbjct  1160  NLCVTAAHCPIREILEKEKKEKALAVSDSRPVPALHSSVDVRPLNKDDFKYAHEQVC  1216



>ref|XP_009781904.1| PREDICTED: uncharacterized protein LOC104230725 isoform X2 [Nicotiana 
sylvestris]
Length=1235

 Score =  1886 bits (4886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 995/1257 (79%), Positives = 1091/1257 (87%), Gaps = 33/1257 (3%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSS-TDDMLGEKTPGAVNESGPESAEQ  308
             MVETRRSSSSSKR L SPSSP+ NGKRSKATE+LSS T+D LGEK  G +NESGPESAEQ
Sbjct  1     MVETRRSSSSSKRSLSSPSSPISNGKRSKATEALSSSTNDTLGEKIQGELNESGPESAEQ  60

Query  309   EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  488
             E+RSADL  A       A VP+K  E     EPLVSPM LGDS IDV+K KA  SALNRG
Sbjct  61    EVRSADLAAA-------ADVPQKSLETEAANEPLVSPMTLGDSVIDVEKSKAKESALNRG  113

Query  489   KKRQLKSNLGTA-WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKH  665
             KKRQLKSN+G A WGKL+SQ  QN HV + ++T+TVGQGR  DL + D SVSK+LCNLKH
Sbjct  114   KKRQLKSNVGAAAWGKLVSQCSQNPHVVMHRATYTVGQGRGSDLWIGDSSVSKTLCNLKH  173

Query  666   IQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNE  845
              + EKG SITLLE+ GKKG VQVNGK+YPKNSTVPL GGDE++FGSSG+H+YIF    ++
Sbjct  174   TETEKGVSITLLEVMGKKGDVQVNGKVYPKNSTVPLKGGDEIVFGSSGQHSYIF----DD  229

Query  846   DISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVC  1025
             ++SAAS    VSILEAHSG +KG++ EARS DPSTVAVASTLASLSNL KEL LLPPS  
Sbjct  230   NLSAASFARPVSILEAHSGSIKGLHLEARSRDPSTVAVASTLASLSNLSKELSLLPPSSQ  289

Query  1026  NDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNL  1196
             N  D+KQ  E+P LP ASG  +K DLD+DMKD SD NDVP   +DEK+  ISPD GNDNL
Sbjct  290   NGKDVKQCSELPILPAASGVAEKDDLDTDMKDASDCNDVPRVLVDEKNDVISPDVGNDNL  349

Query  1197  NLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR---ELLK  1367
             NL+N A+DS D EIGKV       RPL+ + AGSS  EFDLSG IS+I++++R   EL K
Sbjct  350   NLDNTALDSVDAEIGKV-------RPLLGVHAGSSASEFDLSGRISKILEEQRDFRELFK  402

Query  1368  DFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNK  1547
             DFDP IS  TRRQAFK+ LQQ +LD NNIEVSFE+FPYYLSE TKN+LIASTYIHLKCNK
Sbjct  403   DFDPPISALTRRQAFKNALQQGVLDFNNIEVSFENFPYYLSENTKNILIASTYIHLKCNK  462

Query  1548  FVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELD  1724
             F K  S+LPTVCPRILLSG   SEIYQETLAKALAK FGA+LL+VDSL+LPGGS AK++D
Sbjct  463   FAKYTSDLPTVCPRILLSG---SEIYQETLAKALAKRFGAKLLIVDSLLLPGGSIAKDVD  519

Query  1725  PVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK  1904
             PVKE+ KP R  VF KRAAQAA L  NKKPASSVEADITGGS ISSHAQ KQE STASSK
Sbjct  520   PVKESSKPGRASVFAKRAAQAAALHLNKKPASSVEADITGGSTISSHAQPKQETSTASSK  579

Query  1905  N-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPE  2078
             N TFK GDRVKYVG   +GFS LQTP RGP YGY+GKV+LAFEENG SKIGVRFD+SIPE
Sbjct  580   NYTFKKGDRVKYVGS-SSGFSPLQTPLRGPTYGYRGKVVLAFEENGSSKIGVRFDKSIPE  638

Query  2079  GNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIE  2258
             GNDLGGLC+EDHGFFCAAD LRLD+SS D++DKLAINELFEV S E KSSPL+LF+KDIE
Sbjct  639   GNDLGGLCDEDHGFFCAADLLRLDSSSTDEIDKLAINELFEVASNESKSSPLVLFIKDIE  698

Query  2259  KSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDL  2438
             KSMVGNPEA++AFK+KLE LPENVV IAS TQ+DNRKEKSHPGG LFTKFGSNQT+LLDL
Sbjct  699   KSMVGNPEAYAAFKIKLEHLPENVVAIASLTQSDNRKEKSHPGGLLFTKFGSNQTSLLDL  758

Query  2439  AFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQS  2618
             AFPDNFGRLHDRSKETPK +KQLTRLFPNKV IQIPQDETLLSDWKQQLDRD+ETMKSQS
Sbjct  759   AFPDNFGRLHDRSKETPKTMKQLTRLFPNKVTIQIPQDETLLSDWKQQLDRDMETMKSQS  818

Query  2619  NAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLA  2798
             N  +IRNVLNR  +DCPD+ETLCIKDQALTNESVEKIIGWALSHHFMH SESS K+ KL 
Sbjct  819   NIASIRNVLNRNRIDCPDLETLCIKDQALTNESVEKIIGWALSHHFMHESESSVKDAKLV  878

Query  2799  ISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGAL  2978
             IS ESI YGL++LQG+Q+ETKS KKSLKDVVTENEFEK+LL DVIPPSDIGVTF+DIGAL
Sbjct  879   ISGESIAYGLNILQGIQSETKSSKKSLKDVVTENEFEKRLLGDVIPPSDIGVTFNDIGAL  938

Query  2979  ENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN  3158
             E VKDTLKELVMLPLQRPELFCKGQLTKPC GILLFGPPGTGKTMLAKAVATEAGANFIN
Sbjct  939   ETVKDTLKELVMLPLQRPELFCKGQLTKPCTGILLFGPPGTGKTMLAKAVATEAGANFIN  998

Query  3159  ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNE  3338
             ISMSSITSKWFGEGEKYVKAVFTLASKIA SVVFVDEVDSMLGRRE+PGEHEAMRKMKNE
Sbjct  999   ISMSSITSKWFGEGEKYVKAVFTLASKIASSVVFVDEVDSMLGRRENPGEHEAMRKMKNE  1058

Query  3339  FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTK  3518
             FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVN+PDAPNR+KILR+IL K
Sbjct  1059  FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNVPDAPNRKKILRVILAK  1118

Query  3519  EELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPAL  3698
             EELAPNVD++AIANMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKA A++ENRP PAL
Sbjct  1119  EELAPNVDVEAIANMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKASAVAENRPTPAL  1178

Query  3699  HNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
              +S+DIRPLNMDDF+YAHEQVCASVSSES+NM ELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1179  RSSADIRPLNMDDFKYAHEQVCASVSSESSNMNELLQWNDLYGEGGSRKKTSLSYFM  1235



>ref|XP_009598052.1| PREDICTED: uncharacterized protein LOC104093922 isoform X2 [Nicotiana 
tomentosiformis]
Length=1234

 Score =  1883 bits (4877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 995/1257 (79%), Positives = 1092/1257 (87%), Gaps = 34/1257 (3%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSS-TDDMLGEKTPGAVNESGPESAEQ  308
             MVETRRSSSSSKR L SPSSP+ NGKRSKA E+LSS T+D LGEK  G +NESGPESAEQ
Sbjct  1     MVETRRSSSSSKRSLSSPSSPISNGKRSKAAEALSSSTNDTLGEKIQGELNESGPESAEQ  60

Query  309   EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  488
             E+RSADLD A       A VP+K  E     EPLVSPM LGDS IDV+K KA  SALNRG
Sbjct  61    EVRSADLDAA-------ADVPQKSLETEAANEPLVSPMTLGDSVIDVEKSKAKESALNRG  113

Query  489   KKRQLKSNLGTA-WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKH  665
             KKRQLKSN+  A WGKL+SQ  QN HV + ++T+TVGQGR  DL + D SVSK+LCNLKH
Sbjct  114   KKRQLKSNVAAAAWGKLVSQCSQNPHVVMHRATYTVGQGRGSDLWIGDSSVSKTLCNLKH  173

Query  666   IQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNE  845
              + EKG SITLLE+ GKKG VQVNGK+YPKNSTVPL GGDEV+FGSSG+H+YIF    ++
Sbjct  174   TETEKGVSITLLEVMGKKGDVQVNGKVYPKNSTVPLKGGDEVVFGSSGQHSYIF----DD  229

Query  846   DISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVC  1025
             ++SAAS   SVSIL AHSG +KG++ EARS DPSTVAVASTLASLSNL KEL LLPPS  
Sbjct  230   NLSAASFAHSVSILGAHSGSIKGLHLEARSRDPSTVAVASTLASLSNLPKELSLLPPSSQ  289

Query  1026  NDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNL  1196
             N  D+KQ  E+P LP ASG  DK DLD DMKD SD NDVP   +DEK+   SPD GN NL
Sbjct  290   NGKDVKQSSEVPILPAASGVADKDDLDIDMKDASDCNDVPRVLVDEKNDVTSPDVGNGNL  349

Query  1197  NLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR---ELLK  1367
             NL+N A+DS D EIGKV       RPL+R+LAGSS  EF LSG IS+I++++R   EL K
Sbjct  350   NLDNIALDSVDAEIGKV-------RPLLRVLAGSSASEFGLSG-ISKILEEQRDFRELFK  401

Query  1368  DFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNK  1547
             DFDP IS  TRRQAFK+ L+Q +LD NNIEVSFE+FPYYLSE TK++LIASTYIHLKCNK
Sbjct  402   DFDPPISALTRRQAFKNALEQGVLDFNNIEVSFENFPYYLSENTKDILIASTYIHLKCNK  461

Query  1548  FVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELD  1724
             F K  S+LPTVCPRILLSG   SEIYQETLAKALAK+FGA+LL+VDSL+LPGGS AK++D
Sbjct  462   FAKYTSDLPTVCPRILLSG---SEIYQETLAKALAKHFGAKLLIVDSLLLPGGSIAKDVD  518

Query  1725  PVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK  1904
             PVKE+ KP R  VF KRAAQAA L  NKKPASSVEADITGGS ISSHAQ KQEASTASSK
Sbjct  519   PVKESSKPGRASVFAKRAAQAAALHLNKKPASSVEADITGGSTISSHAQPKQEASTASSK  578

Query  1905  N-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPE  2078
             N TFK GDRVKYVG   +GFS LQTP RGP YGYKGKV+LAFEENG SKIGVRFD+SIPE
Sbjct  579   NYTFKKGDRVKYVGS-SSGFSPLQTPLRGPTYGYKGKVVLAFEENGSSKIGVRFDKSIPE  637

Query  2079  GNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIE  2258
             GNDLGGLC+EDHGFFCAAD LRLD+SS D++DKLAINELFEV S E KSSPL+LF+KDIE
Sbjct  638   GNDLGGLCDEDHGFFCAADLLRLDSSSTDEIDKLAINELFEVASNESKSSPLVLFIKDIE  697

Query  2259  KSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDL  2438
             KSMVGNPEA++AFK+KLE LPENVV IAS TQ+DNRKEKSHPGG LFTKFGSNQTALLDL
Sbjct  698   KSMVGNPEAYAAFKIKLEHLPENVVAIASLTQSDNRKEKSHPGGLLFTKFGSNQTALLDL  757

Query  2439  AFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQS  2618
             AFPDNFGRLHDRSKETPK +KQLTRLFPNKV IQIPQDETLLSDWKQQLDRD+ETMKSQ+
Sbjct  758   AFPDNFGRLHDRSKETPKTMKQLTRLFPNKVTIQIPQDETLLSDWKQQLDRDMETMKSQA  817

Query  2619  NAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLA  2798
             N  +IRNVLNR+ +DCPD+ETLCIKDQALTNESVEKI+GWALSHHFMH SESS K+ KL 
Sbjct  818   NIASIRNVLNRIRIDCPDLETLCIKDQALTNESVEKIVGWALSHHFMHESESSVKDAKLV  877

Query  2799  ISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGAL  2978
             IS ESI YGL++LQG+Q+ETKS KKSLKDVVTENEFEK+LL DVIPPSDIGVTF+DIGAL
Sbjct  878   ISGESIAYGLNILQGIQSETKSSKKSLKDVVTENEFEKRLLGDVIPPSDIGVTFNDIGAL  937

Query  2979  ENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN  3158
             E VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN
Sbjct  938   ETVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN  997

Query  3159  ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNE  3338
             ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNE
Sbjct  998   ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNE  1057

Query  3339  FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTK  3518
             FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVN+PDAPNR+KILR+IL K
Sbjct  1058  FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNVPDAPNRKKILRVILAK  1117

Query  3519  EELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPAL  3698
             EEL PNVD++AIANMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKA A++EN+P PAL
Sbjct  1118  EELVPNVDVEAIANMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKASAVAENKPSPAL  1177

Query  3699  HNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             H+S+DIRPLNMDDF+YAHEQVCASVS ES+NM ELLQWNELYGEGGSRKK +LSYFM
Sbjct  1178  HSSADIRPLNMDDFKYAHEQVCASVSPESSNMNELLQWNELYGEGGSRKKISLSYFM  1234



>ref|XP_009781905.1| PREDICTED: uncharacterized protein LOC104230725 isoform X3 [Nicotiana 
sylvestris]
Length=1233

 Score =  1882 bits (4876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 994/1257 (79%), Positives = 1090/1257 (87%), Gaps = 35/1257 (3%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSS-TDDMLGEKTPGAVNESGPESAEQ  308
             MVETRRSSSSSKR L SPSSP+ NGKRSKATE+LSS T+D LGEK  G +NESGPESAEQ
Sbjct  1     MVETRRSSSSSKRSLSSPSSPISNGKRSKATEALSSSTNDTLGEKIQGELNESGPESAEQ  60

Query  309   EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  488
             E+RSADL  A       A VP+K  E     EPLVSPM L     DV+K KA  SALNRG
Sbjct  61    EVRSADLAAA-------ADVPQKSLETEAANEPLVSPMTL-----DVEKSKAKESALNRG  108

Query  489   KKRQLKSNLGTA-WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKH  665
             KKRQLKSN+G A WGKL+SQ  QN HV + ++T+TVGQGR  DL + D SVSK+LCNLKH
Sbjct  109   KKRQLKSNVGAAAWGKLVSQCSQNPHVVMHRATYTVGQGRGSDLWIGDSSVSKTLCNLKH  168

Query  666   IQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNE  845
              + EKG SITLLE+ GKKG VQVNGK+YPKNSTVPL GGDE++FGSSG+H+YIF    ++
Sbjct  169   TETEKGVSITLLEVMGKKGDVQVNGKVYPKNSTVPLKGGDEIVFGSSGQHSYIF----DD  224

Query  846   DISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVC  1025
             ++SAAS    VSILEAHSG +KG++ EARS DPSTVAVASTLASLSNL KEL LLPPS  
Sbjct  225   NLSAASFARPVSILEAHSGSIKGLHLEARSRDPSTVAVASTLASLSNLSKELSLLPPSSQ  284

Query  1026  NDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNL  1196
             N  D+KQ  E+P LP ASG  +K DLD+DMKD SD NDVP   +DEK+  ISPD GNDNL
Sbjct  285   NGKDVKQCSELPILPAASGVAEKDDLDTDMKDASDCNDVPRVLVDEKNDVISPDVGNDNL  344

Query  1197  NLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR---ELLK  1367
             NL+N A+DS D EIGKV       RPL+ + AGSS  EFDLSG IS+I++++R   EL K
Sbjct  345   NLDNTALDSVDAEIGKV-------RPLLGVHAGSSASEFDLSGRISKILEEQRDFRELFK  397

Query  1368  DFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNK  1547
             DFDP IS  TRRQAFK+ LQQ +LD NNIEVSFE+FPYYLSE TKN+LIASTYIHLKCNK
Sbjct  398   DFDPPISALTRRQAFKNALQQGVLDFNNIEVSFENFPYYLSENTKNILIASTYIHLKCNK  457

Query  1548  FVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELD  1724
             F K  S+LPTVCPRILLSGPAGSEIYQETLAKALAK FGA+LL+VDSL+LPGGS AK++D
Sbjct  458   FAKYTSDLPTVCPRILLSGPAGSEIYQETLAKALAKRFGAKLLIVDSLLLPGGSIAKDVD  517

Query  1725  PVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK  1904
             PVKE+ KP R  VF KRAAQAA L  NKKPASSVEADITGGS ISSHAQ KQE STASSK
Sbjct  518   PVKESSKPGRASVFAKRAAQAAALHLNKKPASSVEADITGGSTISSHAQPKQETSTASSK  577

Query  1905  N-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPE  2078
             N TFK GDRVKYVG   +GFS LQTP RGP YGY+GKV+LAFEENG SKIGVRFD+SIPE
Sbjct  578   NYTFKKGDRVKYVGS-SSGFSPLQTPLRGPTYGYRGKVVLAFEENGSSKIGVRFDKSIPE  636

Query  2079  GNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIE  2258
             GNDLGGLC+EDHGFFCAAD LRLD+SS D++DKLAINELFEV S E KSSPL+LF+KDIE
Sbjct  637   GNDLGGLCDEDHGFFCAADLLRLDSSSTDEIDKLAINELFEVASNESKSSPLVLFIKDIE  696

Query  2259  KSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDL  2438
             KSMVGNPEA++AFK+KLE LPENVV IAS TQ+DNRKEKSHPGG LFTKFGSNQT+LLDL
Sbjct  697   KSMVGNPEAYAAFKIKLEHLPENVVAIASLTQSDNRKEKSHPGGLLFTKFGSNQTSLLDL  756

Query  2439  AFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQS  2618
             AFPDNFGRLHDRSKETPK +KQLTRLFPNKV IQIPQDETLLSDWKQQLDRD+ETMKSQS
Sbjct  757   AFPDNFGRLHDRSKETPKTMKQLTRLFPNKVTIQIPQDETLLSDWKQQLDRDMETMKSQS  816

Query  2619  NAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLA  2798
             N  +IRNVLNR  +DCPD+ETLCIKDQALTNESVEKIIGWALSHHFMH SESS K+ KL 
Sbjct  817   NIASIRNVLNRNRIDCPDLETLCIKDQALTNESVEKIIGWALSHHFMHESESSVKDAKLV  876

Query  2799  ISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGAL  2978
             IS ESI YGL++LQG+Q+ETKS KKSLKDVVTENEFEK+LL DVIPPSDIGVTF+DIGAL
Sbjct  877   ISGESIAYGLNILQGIQSETKSSKKSLKDVVTENEFEKRLLGDVIPPSDIGVTFNDIGAL  936

Query  2979  ENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN  3158
             E VKDTLKELVMLPLQRPELFCKGQLTKPC GILLFGPPGTGKTMLAKAVATEAGANFIN
Sbjct  937   ETVKDTLKELVMLPLQRPELFCKGQLTKPCTGILLFGPPGTGKTMLAKAVATEAGANFIN  996

Query  3159  ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNE  3338
             ISMSSITSKWFGEGEKYVKAVFTLASKIA SVVFVDEVDSMLGRRE+PGEHEAMRKMKNE
Sbjct  997   ISMSSITSKWFGEGEKYVKAVFTLASKIASSVVFVDEVDSMLGRRENPGEHEAMRKMKNE  1056

Query  3339  FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTK  3518
             FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVN+PDAPNR+KILR+IL K
Sbjct  1057  FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNVPDAPNRKKILRVILAK  1116

Query  3519  EELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPAL  3698
             EELAPNVD++AIANMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKA A++ENRP PAL
Sbjct  1117  EELAPNVDVEAIANMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKASAVAENRPTPAL  1176

Query  3699  HNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
              +S+DIRPLNMDDF+YAHEQVCASVSSES+NM ELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1177  RSSADIRPLNMDDFKYAHEQVCASVSSESSNMNELLQWNDLYGEGGSRKKTSLSYFM  1233



>ref|XP_009598053.1| PREDICTED: uncharacterized protein LOC104093922 isoform X3 [Nicotiana 
tomentosiformis]
Length=1232

 Score =  1880 bits (4871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 994/1257 (79%), Positives = 1091/1257 (87%), Gaps = 36/1257 (3%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSS-TDDMLGEKTPGAVNESGPESAEQ  308
             MVETRRSSSSSKR L SPSSP+ NGKRSKA E+LSS T+D LGEK  G +NESGPESAEQ
Sbjct  1     MVETRRSSSSSKRSLSSPSSPISNGKRSKAAEALSSSTNDTLGEKIQGELNESGPESAEQ  60

Query  309   EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  488
             E+RSADLD A       A VP+K  E     EPLVSPM L     DV+K KA  SALNRG
Sbjct  61    EVRSADLDAA-------ADVPQKSLETEAANEPLVSPMTL-----DVEKSKAKESALNRG  108

Query  489   KKRQLKSNLGTA-WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKH  665
             KKRQLKSN+  A WGKL+SQ  QN HV + ++T+TVGQGR  DL + D SVSK+LCNLKH
Sbjct  109   KKRQLKSNVAAAAWGKLVSQCSQNPHVVMHRATYTVGQGRGSDLWIGDSSVSKTLCNLKH  168

Query  666   IQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNE  845
              + EKG SITLLE+ GKKG VQVNGK+YPKNSTVPL GGDEV+FGSSG+H+YIF    ++
Sbjct  169   TETEKGVSITLLEVMGKKGDVQVNGKVYPKNSTVPLKGGDEVVFGSSGQHSYIF----DD  224

Query  846   DISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVC  1025
             ++SAAS   SVSIL AHSG +KG++ EARS DPSTVAVASTLASLSNL KEL LLPPS  
Sbjct  225   NLSAASFAHSVSILGAHSGSIKGLHLEARSRDPSTVAVASTLASLSNLPKELSLLPPSSQ  284

Query  1026  NDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNL  1196
             N  D+KQ  E+P LP ASG  DK DLD DMKD SD NDVP   +DEK+   SPD GN NL
Sbjct  285   NGKDVKQSSEVPILPAASGVADKDDLDIDMKDASDCNDVPRVLVDEKNDVTSPDVGNGNL  344

Query  1197  NLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR---ELLK  1367
             NL+N A+DS D EIGKV       RPL+R+LAGSS  EF LSG IS+I++++R   EL K
Sbjct  345   NLDNIALDSVDAEIGKV-------RPLLRVLAGSSASEFGLSG-ISKILEEQRDFRELFK  396

Query  1368  DFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNK  1547
             DFDP IS  TRRQAFK+ L+Q +LD NNIEVSFE+FPYYLSE TK++LIASTYIHLKCNK
Sbjct  397   DFDPPISALTRRQAFKNALEQGVLDFNNIEVSFENFPYYLSENTKDILIASTYIHLKCNK  456

Query  1548  FVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELD  1724
             F K  S+LPTVCPRILLSGPAGSEIYQETLAKALAK+FGA+LL+VDSL+LPGGS AK++D
Sbjct  457   FAKYTSDLPTVCPRILLSGPAGSEIYQETLAKALAKHFGAKLLIVDSLLLPGGSIAKDVD  516

Query  1725  PVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK  1904
             PVKE+ KP R  VF KRAAQAA L  NKKPASSVEADITGGS ISSHAQ KQEASTASSK
Sbjct  517   PVKESSKPGRASVFAKRAAQAAALHLNKKPASSVEADITGGSTISSHAQPKQEASTASSK  576

Query  1905  N-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPE  2078
             N TFK GDRVKYVG   +GFS LQTP RGP YGYKGKV+LAFEENG SKIGVRFD+SIPE
Sbjct  577   NYTFKKGDRVKYVGS-SSGFSPLQTPLRGPTYGYKGKVVLAFEENGSSKIGVRFDKSIPE  635

Query  2079  GNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIE  2258
             GNDLGGLC+EDHGFFCAAD LRLD+SS D++DKLAINELFEV S E KSSPL+LF+KDIE
Sbjct  636   GNDLGGLCDEDHGFFCAADLLRLDSSSTDEIDKLAINELFEVASNESKSSPLVLFIKDIE  695

Query  2259  KSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDL  2438
             KSMVGNPEA++AFK+KLE LPENVV IAS TQ+DNRKEKSHPGG LFTKFGSNQTALLDL
Sbjct  696   KSMVGNPEAYAAFKIKLEHLPENVVAIASLTQSDNRKEKSHPGGLLFTKFGSNQTALLDL  755

Query  2439  AFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQS  2618
             AFPDNFGRLHDRSKETPK +KQLTRLFPNKV IQIPQDETLLSDWKQQLDRD+ETMKSQ+
Sbjct  756   AFPDNFGRLHDRSKETPKTMKQLTRLFPNKVTIQIPQDETLLSDWKQQLDRDMETMKSQA  815

Query  2619  NAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLA  2798
             N  +IRNVLNR+ +DCPD+ETLCIKDQALTNESVEKI+GWALSHHFMH SESS K+ KL 
Sbjct  816   NIASIRNVLNRIRIDCPDLETLCIKDQALTNESVEKIVGWALSHHFMHESESSVKDAKLV  875

Query  2799  ISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGAL  2978
             IS ESI YGL++LQG+Q+ETKS KKSLKDVVTENEFEK+LL DVIPPSDIGVTF+DIGAL
Sbjct  876   ISGESIAYGLNILQGIQSETKSSKKSLKDVVTENEFEKRLLGDVIPPSDIGVTFNDIGAL  935

Query  2979  ENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN  3158
             E VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN
Sbjct  936   ETVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN  995

Query  3159  ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNE  3338
             ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNE
Sbjct  996   ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNE  1055

Query  3339  FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTK  3518
             FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVN+PDAPNR+KILR+IL K
Sbjct  1056  FMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNVPDAPNRKKILRVILAK  1115

Query  3519  EELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPAL  3698
             EEL PNVD++AIANMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKA A++EN+P PAL
Sbjct  1116  EELVPNVDVEAIANMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKASAVAENKPSPAL  1175

Query  3699  HNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             H+S+DIRPLNMDDF+YAHEQVCASVS ES+NM ELLQWNELYGEGGSRKK +LSYFM
Sbjct  1176  HSSADIRPLNMDDFKYAHEQVCASVSPESSNMNELLQWNELYGEGGSRKKISLSYFM  1232



>ref|XP_006359390.1| PREDICTED: uncharacterized protein LOC102597355 isoform X1 [Solanum 
tuberosum]
Length=1252

 Score =  1873 bits (4853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 981/1264 (78%), Positives = 1085/1264 (86%), Gaps = 30/1264 (2%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQE  311
             MVETRRSSSS +   P  SS   NGKRSKA E+LSST+D LGEK+ G VN+SGPESAEQE
Sbjct  1     MVETRRSSSSKRSLSPPSSSLQNNGKRSKAVEALSSTNDTLGEKSQGGVNDSGPESAEQE  60

Query  312   IRSADLDGASALKSPE-------APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANG  470
             +RSADL GAS LKS +       A  P+K  E     EPLVSPM LGDSAIDV+K K+NG
Sbjct  61    VRSADLAGASVLKSSDDAAATAAAAAPQKSMETEGANEPLVSPMTLGDSAIDVEKSKSNG  120

Query  471   SALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSL  650
             SALNRGKKRQLKSN G AWGKLLSQ  QN H+ + +  +TVGQ R  DL + D +VSK+L
Sbjct  121   SALNRGKKRQLKSN-GAAWGKLLSQCSQNPHLVMHRPMYTVGQSRSSDLWIGDSTVSKAL  179

Query  651   CNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQ  830
             CNLKH + EKG SITLLEI+GKKG VQVNGK+YPKNSTVPL GGDEV+FGSSG+HAYIF 
Sbjct  180   CNLKHTETEKGVSITLLEITGKKGDVQVNGKVYPKNSTVPLKGGDEVVFGSSGQHAYIF-  238

Query  831   KFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellll  1010
                + D+SA S+   VSILEAHSG +KG+  EARSGDPSTVAVASTLASLSNL+K+L LL
Sbjct  239   ---DNDLSATSLAHPVSILEAHSGSIKGLRLEARSGDPSTVAVASTLASLSNLRKDLSLL  295

Query  1011  PPSVCNDNDIKQGPEMPALPVASGEP--DKHDLDSDMKDVSDHNDVP---LDEKSGAISP  1175
             PPS  ND D+KQG E+P LP ASG    +K DLD+DMKD SD ND P   +DEK+  ISP
Sbjct  296   PPSSQNDKDVKQGSEVPILPAASGLSLTEKDDLDTDMKDASDGNDEPGVLVDEKNDVISP  355

Query  1176  DSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR  1355
                N NLNL+N  +DS D EIGKV       +PL+++LAGSS  EFDLSG+IS+I +++R
Sbjct  356   GIENGNLNLDNVVLDSVDAEIGKV-------QPLLQVLAGSSASEFDLSGSISKIFEEQR  408

Query  1356  ---ELLKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTY  1526
                ELLKD DP IS  TRRQ FK+ LQQ ++D N I+V+FE+FPYYL E TKNVLIASTY
Sbjct  409   NFRELLKDIDPPISALTRRQTFKNALQQGVVDFNTIDVTFENFPYYLCENTKNVLIASTY  468

Query  1527  IHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG  1706
             IHLKCN F +  S+LPTVCPRILLSGPAGSEIYQETLAKALAKYF A+LL+VDSL+LPGG
Sbjct  469   IHLKCNGFAQYVSDLPTVCPRILLSGPAGSEIYQETLAKALAKYFCAKLLIVDSLLLPGG  528

Query  1707  S-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQE  1883
             S AK+++PVK + KPER  VF KRAAQAA L  NKKPASSVEADITGGS +SS AQ KQE
Sbjct  529   SSAKDVEPVKVSSKPERASVFAKRAAQAAALHLNKKPASSVEADITGGSILSSQAQPKQE  588

Query  1884  ASTASSKN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVR  2057
             ASTASSKN TFK GDRVKYVG L +GFS LQ P RGP YGY+GKV+LAFEENG SKIGVR
Sbjct  589   ASTASSKNYTFKKGDRVKYVGSLTSGFSPLQAPLRGPTYGYRGKVVLAFEENGSSKIGVR  648

Query  2058  FDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLI  2237
             FDRSIPEGNDLGGLC+EDHGFFCAAD LRLD+SS D++DKLAINELFEV S+E KS PL+
Sbjct  649   FDRSIPEGNDLGGLCDEDHGFFCAADLLRLDSSSTDEIDKLAINELFEVASKESKSGPLV  708

Query  2238  LFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSN  2417
             LF+KDIEKSMVGNPEA++AFK+KLE LPENVV IAS+ Q+D+RKEKSHPGG LFTKFGSN
Sbjct  709   LFIKDIEKSMVGNPEAYAAFKIKLEHLPENVVAIASHAQSDSRKEKSHPGGLLFTKFGSN  768

Query  2418  QTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDI  2597
             QTALLDLAFPDNFGRL DRSKETPK +KQLTRLFPNKV IQIPQDETLLSDWKQ+LDRD+
Sbjct  769   QTALLDLAFPDNFGRLQDRSKETPKTMKQLTRLFPNKVTIQIPQDETLLSDWKQKLDRDM  828

Query  2598  ETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESS  2777
             ETMKSQSN  +IRNVLNR++++C D+ETLCIKDQALTNESVEKIIGWALSHH+MH SESS
Sbjct  829   ETMKSQSNIASIRNVLNRIKINCDDLETLCIKDQALTNESVEKIIGWALSHHYMHESESS  888

Query  2778  TKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVT  2957
              KE KL ISSESI YGLS+ QG+Q ETKS KKSLKDVVTENEFEKKLL DVIPP+DIGVT
Sbjct  889   MKEPKLIISSESIAYGLSMFQGIQGETKSSKKSLKDVVTENEFEKKLLGDVIPPTDIGVT  948

Query  2958  FDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATE  3137
             F+DIGALE VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATE
Sbjct  949   FNDIGALETVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATE  1008

Query  3138  AGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEA  3317
             AGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRE+PGEHEA
Sbjct  1009  AGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRENPGEHEA  1068

Query  3318  MRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKI  3497
             MRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKI
Sbjct  1069  MRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDASNREKI  1128

Query  3498  LRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSE  3677
             L +IL KEELAPNVD +AIA MT+GYSGSDLKNLCV+AAHCPIREILEKEKKEK  AI+E
Sbjct  1129  LGVILAKEELAPNVDFEAIATMTDGYSGSDLKNLCVSAAHCPIREILEKEKKEKTSAIAE  1188

Query  3678  NRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKAL  3857
             NRP PALH+S+DIRPLNMDDF+YAHEQVCASVSSES+NM ELLQWN+LYGEGGSRKK +L
Sbjct  1189  NRPTPALHSSADIRPLNMDDFKYAHEQVCASVSSESSNMNELLQWNDLYGEGGSRKKTSL  1248

Query  3858  SYFM  3869
             SYFM
Sbjct  1249  SYFM  1252



>emb|CDP03506.1| unnamed protein product [Coffea canephora]
Length=1250

 Score =  1858 bits (4814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 961/1253 (77%), Positives = 1085/1253 (87%), Gaps = 10/1253 (1%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQE  311
             MVETRRSSS+SKRPLPSPSSPLP GKRSKA E+ SST+D  GE    A  ESG ES EQE
Sbjct  1     MVETRRSSSTSKRPLPSPSSPLPKGKRSKAGEASSSTNDSSGEVGIDAAKESGRESREQE  60

Query  312   IRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGK  491
             +RSADL  A  LK  +  VPEKLPE  L  EPLVSPM LGDS ID++K K+ G  LNRGK
Sbjct  61    VRSADLTDADNLKLSDGEVPEKLPEGQLESEPLVSPMTLGDSVIDLEKTKSIGKVLNRGK  120

Query  492   KRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQ  671
             KRQ+KS    AWGKLLSQ+ QN HV +  STFTVGQ RQ DL V DPSVSKSLC L+HI 
Sbjct  121   KRQMKSKAAAAWGKLLSQFSQNRHVVISNSTFTVGQDRQSDLWVGDPSVSKSLCRLRHIS  180

Query  672   REKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDI  851
              E+G  +TLLEI+GKKG VQVNGKIYPKNSTVPL+GGDEV+F SSGKHAYIFQ+ T +++
Sbjct  181   TERGCPVTLLEITGKKGSVQVNGKIYPKNSTVPLSGGDEVVFSSSGKHAYIFQQLTPDNV  240

Query  852   SAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCND  1031
             S  ++PPSV+ILE+H+GP+KG++FEARSGD S VAVASTLASLSNL+KEL LLPPS   D
Sbjct  241   SGTALPPSVNILESHNGPIKGLHFEARSGDSSAVAVASTLASLSNLRKELSLLPPSSRKD  300

Query  1032  NDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVP-LDEKSGAISPDSGNDNLNLEN  1208
              D+++G EMP LP      D   +D++MKD +DHND P L EK+      + N+N+NL++
Sbjct  301   EDVQEGSEMPTLPSTCEVSDNPIVDAEMKDTTDHNDSPVLGEKANVPLSRAANENMNLDS  360

Query  1209  GAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDP  1379
               ID  D EIGK   A  ++R  +RM   S   EFDLSG+IS+I+D++RE   LLKD DP
Sbjct  361   VEIDPVDPEIGKEAAASHDIR-FLRMFPRSGAAEFDLSGSISKILDEQREIGELLKDLDP  419

Query  1380  LISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKC  1559
              I  STRR+AFKD LQQ ++D N IEVSFE+FPYYLSE TKNVLIASTYI LKCNKF K 
Sbjct  420   PILTSTRREAFKDVLQQGVIDPNCIEVSFENFPYYLSETTKNVLIASTYIPLKCNKFAKF  479

Query  1560  ASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKE  1736
              S+LPTVCPRILLSGPAGS+IYQE L KALAK+F A+LL+VDSL+LPGGS  KE+D VKE
Sbjct  480   TSDLPTVCPRILLSGPAGSDIYQEMLTKALAKHFNAKLLIVDSLLLPGGSTVKEVDSVKE  539

Query  1737  APKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TF  1913
               +PER  VF KRAA  A L   KKPASSVEA+ITGGS +SS AQ KQE+STASSK  TF
Sbjct  540   GSRPERASVFAKRAAHTAALHL-KKPASSVEAEITGGSTLSSQAQPKQESSTASSKTYTF  598

Query  1914  KTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDL  2090
             K GDRVKY+GPL +GFS +QTP+RGP+YGY+GKV+LAFEENG SKIGVRFDRSIPEGNDL
Sbjct  599   KKGDRVKYMGPLSSGFSPMQTPSRGPSYGYRGKVVLAFEENGASKIGVRFDRSIPEGNDL  658

Query  2091  GGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMV  2270
             GGLCE+DHGFFCAAD LRLD S+ DD D+LAI+ELFEV S+E K+SPLILFVK+ EKSM+
Sbjct  659   GGLCEDDHGFFCAADLLRLDTST-DDFDRLAIHELFEVASKESKNSPLILFVKETEKSMM  717

Query  2271  GNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPD  2450
             GNPEA+++FK+KLEKLP+NVVVIAS+TQTDNRKEKSHPGG LFTKFGSNQTALLDLAFPD
Sbjct  718   GNPEAYASFKVKLEKLPKNVVVIASHTQTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPD  777

Query  2451  NFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVN  2630
             NFGRLHDR KETPK +KQL+RLFPNKV IQIPQDE++LSDWKQQLDRDIET+KSQSN V+
Sbjct  778   NFGRLHDRGKETPKTMKQLSRLFPNKVTIQIPQDESMLSDWKQQLDRDIETLKSQSNIVS  837

Query  2631  IRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSE  2810
             IR VLNRV +DCPD+++LCIKDQALT+E+VEKIIGWALSHHFMH SE+S K+ +L+I++E
Sbjct  838   IRTVLNRVGIDCPDLDSLCIKDQALTSENVEKIIGWALSHHFMHFSEASVKDSRLSIANE  897

Query  2811  SIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVK  2990
             SI YGL++LQG+QNETK  KKSLKDVVTENEFEK+LLADVIPP+DIGVTFDDIGALENVK
Sbjct  898   SISYGLNILQGIQNETKCSKKSLKDVVTENEFEKRLLADVIPPTDIGVTFDDIGALENVK  957

Query  2991  DTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMS  3170
             DTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMS
Sbjct  958   DTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMS  1017

Query  3171  SITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVN  3350
             SITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVN
Sbjct  1018  SITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVN  1077

Query  3351  WDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELA  3530
             WDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKIL++IL+KEE+A
Sbjct  1078  WDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILKVILSKEEVA  1137

Query  3531  PNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSS  3710
             PNVDL++IANMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKALA+ ENRPLPALH SS
Sbjct  1138  PNVDLESIANMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKALALRENRPLPALHTSS  1197

Query  3711  DIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             D+RP++M+DF+YAHEQVCASVSSES NM ELLQWNELYGEGGSRKKK+LSYFM
Sbjct  1198  DVRPVSMEDFKYAHEQVCASVSSESANMNELLQWNELYGEGGSRKKKSLSYFM  1250



>ref|XP_010326579.1| PREDICTED: uncharacterized protein LOC101250339 isoform X1 [Solanum 
lycopersicum]
Length=1254

 Score =  1858 bits (4813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 965/1242 (78%), Positives = 1072/1242 (86%), Gaps = 31/1242 (2%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPE-------  359
             NGKRSKA E+LSST+D LG K+ G VN+SGPESAEQE+RSADL GAS LKS +       
Sbjct  25    NGKRSKAVEALSSTNDTLGMKSQGGVNDSGPESAEQEVRSADLVGASVLKSSDDAAATPA  84

Query  360   -APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKL  536
              A  P+K  E     EPLVSPM LGDSAIDVDK K+NGSALNRGKKRQLKSN G AWGKL
Sbjct  85    AAAAPQKSMETEGANEPLVSPMTLGDSAIDVDKSKSNGSALNRGKKRQLKSN-GAAWGKL  143

Query  537   LSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGK  716
             LSQ  QN H+ + + T+TVGQ R+ DL + D +VSK LCNLKH + EKG SITLLEI+GK
Sbjct  144   LSQCSQNPHLVMHRPTYTVGQSRESDLWIGDSTVSKDLCNLKHTETEKGVSITLLEITGK  203

Query  717   KGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAH  896
             KG VQVNGK+YPKNSTVPL GGDEV+FGSSG+HAYIF    + D+SA S+   VSILEAH
Sbjct  204   KGDVQVNGKVYPKNSTVPLKGGDEVVFGSSGQHAYIF----DNDLSATSLAHPVSILEAH  259

Query  897   SGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVA  1076
             SG +KG++ EARSGDPSTVAVASTLASLSNL+K+L LLPPS  N  D KQG E+P LP A
Sbjct  260   SGSIKGLHLEARSGDPSTVAVASTLASLSNLRKDLSLLPPSSQNGKDGKQGSEVPILPSA  319

Query  1077  SGEP--DKHDLDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNLNLENGAIDSYDGEIG  1241
             SG    +K DLD+DMKD SD ND P   +DEK+  ISP   N NLNL+N  +DS D EIG
Sbjct  320   SGLSLTEKDDLDTDMKDASDGNDEPGVLVDEKNDVISPGVENGNLNLDNVVLDSVDAEIG  379

Query  1242  KVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR---ELLKDFDPLISMSTRRQAF  1412
             KV       +PL+++LAGSS  EFDLSG+IS+I +++R   ELLKDFD  +S  TRRQ F
Sbjct  380   KV-------QPLLQVLAGSSASEFDLSGSISKIFEEQRNFRELLKDFDRPVSALTRRQTF  432

Query  1413  KDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRI  1592
             K+ LQQ ++D N I+V+FE+FPYYL E TKNVLIASTYIHLKCN F K AS+LPTVCPRI
Sbjct  433   KNALQQGVVDFNTIDVTFENFPYYLCENTKNVLIASTYIHLKCNGFAKFASDLPTVCPRI  492

Query  1593  LLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPG-GSAKELDPVKEAPKPERTGVFT  1769
             LLSGPAGSEIYQETLAKALAKYF A+L++VDSL+LPG  S+K+++PVK + KPER  VF 
Sbjct  493   LLSGPAGSEIYQETLAKALAKYFCAKLMIVDSLLLPGVSSSKDVEPVKVSSKPERASVFA  552

Query  1770  KRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGP  1946
             KRAAQAA L  NKKPASSVEADITGGS +SSHAQ KQEASTASSKN TFK GDRVKY+G 
Sbjct  553   KRAAQAAALHLNKKPASSVEADITGGSILSSHAQPKQEASTASSKNYTFKKGDRVKYIGS  612

Query  1947  LPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFF  2123
             L + FS LQ+P RGP YGY+GKV+LAFEENG SKIGVRFDRSIPEGNDLGGLC+EDHGFF
Sbjct  613   LTSSFSPLQSPIRGPTYGYRGKVVLAFEENGSSKIGVRFDRSIPEGNDLGGLCDEDHGFF  672

Query  2124  CAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKL  2303
             CAAD LRLD+SS D++DKLAINELFEV  +E KS PL+LF+KDIEKSMVGNPEA++AFK+
Sbjct  673   CAADLLRLDSSSNDEIDKLAINELFEVALKESKSGPLVLFIKDIEKSMVGNPEAYAAFKI  732

Query  2304  KLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKE  2483
             KLE LPENVV IAS+ Q+D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNFGRLHDRSKE
Sbjct  733   KLEHLPENVVAIASHAQSDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFGRLHDRSKE  792

Query  2484  TPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELD  2663
             TPK +KQLTRLFPNKV IQIPQDETLLSDWKQ+LDRD+ETMKSQSN  +IRNVLNR +++
Sbjct  793   TPKTMKQLTRLFPNKVTIQIPQDETLLSDWKQKLDRDMETMKSQSNIASIRNVLNRFKIN  852

Query  2664  CPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQG  2843
             C D+E LCIKDQALTNESVEKIIGWALSHH MH SES+ KE KLAISSESI YGLS+ QG
Sbjct  853   CDDLEILCIKDQALTNESVEKIIGWALSHHLMHKSESAMKETKLAISSESIAYGLSMFQG  912

Query  2844  VQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPL  3023
             +Q ETKS+KKSLKDVVTENEFEKKLL DVIPPSDIGVTF+DIGALE VKDTLKELVMLPL
Sbjct  913   IQGETKSLKKSLKDVVTENEFEKKLLGDVIPPSDIGVTFNDIGALETVKDTLKELVMLPL  972

Query  3024  QRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  3203
             QRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE
Sbjct  973   QRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  1032

Query  3204  KYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKER  3383
             KYVKAVFTLASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKER
Sbjct  1033  KYVKAVFTLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKER  1092

Query  3384  VLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANM  3563
             VLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKIL +IL KEELAPNVDL+AIA M
Sbjct  1093  VLVLAATNRPFDLDEAVIRRLPRRLMVNLPDASNREKILGVILAKEELAPNVDLEAIATM  1152

Query  3564  TEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFR  3743
             T+GYSGSDLKNLCV+AAHCPIREILEKEKKEK LAI+E+RP PALH+S+DIRPLNMDDF+
Sbjct  1153  TDGYSGSDLKNLCVSAAHCPIREILEKEKKEKTLAIAESRPSPALHSSADIRPLNMDDFK  1212

Query  3744  YAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             YAHEQVCASVSSES+NM ELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1213  YAHEQVCASVSSESSNMNELLQWNDLYGEGGSRKKTSLSYFM  1254



>ref|XP_006359391.1| PREDICTED: uncharacterized protein LOC102597355 isoform X2 [Solanum 
tuberosum]
Length=1235

 Score =  1845 bits (4779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 952/1223 (78%), Positives = 1055/1223 (86%), Gaps = 30/1223 (2%)
 Frame = +3

Query  255   GEKTPGAVNESGPESAEQEIRSADLDGASALKSPE-------APVPEKLPEAPLGGEPLV  413
             G+++ G VN+SGPESAEQE+RSADL GAS LKS +       A  P+K  E     EPLV
Sbjct  25    GKRSKGGVNDSGPESAEQEVRSADLAGASVLKSSDDAAATAAAAAPQKSMETEGANEPLV  84

Query  414   SPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTV  593
             SPM LGDSAIDV+K K+NGSALNRGKKRQLKSN G AWGKLLSQ  QN H+ + +  +TV
Sbjct  85    SPMTLGDSAIDVEKSKSNGSALNRGKKRQLKSN-GAAWGKLLSQCSQNPHLVMHRPMYTV  143

Query  594   GQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPL  773
             GQ R  DL + D +VSK+LCNLKH + EKG SITLLEI+GKKG VQVNGK+YPKNSTVPL
Sbjct  144   GQSRSSDLWIGDSTVSKALCNLKHTETEKGVSITLLEITGKKGDVQVNGKVYPKNSTVPL  203

Query  774   NGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTV  953
              GGDEV+FGSSG+HAYIF    + D+SA S+   VSILEAHSG +KG+  EARSGDPSTV
Sbjct  204   KGGDEVVFGSSGQHAYIF----DNDLSATSLAHPVSILEAHSGSIKGLRLEARSGDPSTV  259

Query  954   AVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEP--DKHDLDSDMKDVS  1127
             AVASTLASLSNL+K+L LLPPS  ND D+KQG E+P LP ASG    +K DLD+DMKD S
Sbjct  260   AVASTLASLSNLRKDLSLLPPSSQNDKDVKQGSEVPILPAASGLSLTEKDDLDTDMKDAS  319

Query  1128  DHNDVP---LDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGS  1298
             D ND P   +DEK+  ISP   N NLNL+N  +DS D EIGKV       +PL+++LAGS
Sbjct  320   DGNDEPGVLVDEKNDVISPGIENGNLNLDNVVLDSVDAEIGKV-------QPLLQVLAGS  372

Query  1299  STPEFDLSGNISRIIDQRR---ELLKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFE  1469
             S  EFDLSG+IS+I +++R   ELLKD DP IS  TRRQ FK+ LQQ ++D N I+V+FE
Sbjct  373   SASEFDLSGSISKIFEEQRNFRELLKDIDPPISALTRRQTFKNALQQGVVDFNTIDVTFE  432

Query  1470  DFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKAL  1649
             +FPYYL E TKNVLIASTYIHLKCN F +  S+LPTVCPRILLSGPAGSEIYQETLAKAL
Sbjct  433   NFPYYLCENTKNVLIASTYIHLKCNGFAQYVSDLPTVCPRILLSGPAGSEIYQETLAKAL  492

Query  1650  AKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSV  1826
             AKYF A+LL+VDSL+LPGGS AK+++PVK + KPER  VF KRAAQAA L  NKKPASSV
Sbjct  493   AKYFCAKLLIVDSLLLPGGSSAKDVEPVKVSSKPERASVFAKRAAQAAALHLNKKPASSV  552

Query  1827  EADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGY  2000
             EADITGGS +SS AQ KQEASTASSKN TFK GDRVKYVG L +GFS LQ P RGP YGY
Sbjct  553   EADITGGSILSSQAQPKQEASTASSKNYTFKKGDRVKYVGSLTSGFSPLQAPLRGPTYGY  612

Query  2001  KGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKL  2180
             +GKV+LAFEENG SKIGVRFDRSIPEGNDLGGLC+EDHGFFCAAD LRLD+SS D++DKL
Sbjct  613   RGKVVLAFEENGSSKIGVRFDRSIPEGNDLGGLCDEDHGFFCAADLLRLDSSSTDEIDKL  672

Query  2181  AINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTD  2360
             AINELFEV S+E KS PL+LF+KDIEKSMVGNPEA++AFK+KLE LPENVV IAS+ Q+D
Sbjct  673   AINELFEVASKESKSGPLVLFIKDIEKSMVGNPEAYAAFKIKLEHLPENVVAIASHAQSD  732

Query  2361  NRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQ  2540
             +RKEKSHPGG LFTKFGSNQTALLDLAFPDNFGRL DRSKETPK +KQLTRLFPNKV IQ
Sbjct  733   SRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFGRLQDRSKETPKTMKQLTRLFPNKVTIQ  792

Query  2541  IPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESV  2720
             IPQDETLLSDWKQ+LDRD+ETMKSQSN  +IRNVLNR++++C D+ETLCIKDQALTNESV
Sbjct  793   IPQDETLLSDWKQKLDRDMETMKSQSNIASIRNVLNRIKINCDDLETLCIKDQALTNESV  852

Query  2721  EKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTEN  2900
             EKIIGWALSHH+MH SESS KE KL ISSESI YGLS+ QG+Q ETKS KKSLKDVVTEN
Sbjct  853   EKIIGWALSHHYMHESESSMKEPKLIISSESIAYGLSMFQGIQGETKSSKKSLKDVVTEN  912

Query  2901  EFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGIL  3080
             EFEKKLL DVIPP+DIGVTF+DIGALE VKDTLKELVMLPLQRPELFCKGQLTKPCKGIL
Sbjct  913   EFEKKLLGDVIPPTDIGVTFNDIGALETVKDTLKELVMLPLQRPELFCKGQLTKPCKGIL  972

Query  3081  LFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVF  3260
             LFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVF
Sbjct  973   LFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVF  1032

Query  3261  VDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIR  3440
             VDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIR
Sbjct  1033  VDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIR  1092

Query  3441  RLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHC  3620
             RLPRRLMVNLPDA NREKIL +IL KEELAPNVD +AIA MT+GYSGSDLKNLCV+AAHC
Sbjct  1093  RLPRRLMVNLPDASNREKILGVILAKEELAPNVDFEAIATMTDGYSGSDLKNLCVSAAHC  1152

Query  3621  PIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTE  3800
             PIREILEKEKKEK  AI+ENRP PALH+S+DIRPLNMDDF+YAHEQVCASVSSES+NM E
Sbjct  1153  PIREILEKEKKEKTSAIAENRPTPALHSSADIRPLNMDDFKYAHEQVCASVSSESSNMNE  1212

Query  3801  LLQWNELYGEGGSRKKKALSYFM  3869
             LLQWN+LYGEGGSRKK +LSYFM
Sbjct  1213  LLQWNDLYGEGGSRKKTSLSYFM  1235



>ref|XP_004247431.1| PREDICTED: uncharacterized protein LOC101250339 isoform X2 [Solanum 
lycopersicum]
Length=1237

 Score =  1833 bits (4748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 950/1224 (78%), Positives = 1057/1224 (86%), Gaps = 31/1224 (3%)
 Frame = +3

Query  255   GEKTPGAVNESGPESAEQEIRSADLDGASALKSPE--------APVPEKLPEAPLGGEPL  410
             G+++ G VN+SGPESAEQE+RSADL GAS LKS +        A  P+K  E     EPL
Sbjct  26    GKRSKGGVNDSGPESAEQEVRSADLVGASVLKSSDDAAATPAAAAAPQKSMETEGANEPL  85

Query  411   VSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFT  590
             VSPM LGDSAIDVDK K+NGSALNRGKKRQLKSN G AWGKLLSQ  QN H+ + + T+T
Sbjct  86    VSPMTLGDSAIDVDKSKSNGSALNRGKKRQLKSN-GAAWGKLLSQCSQNPHLVMHRPTYT  144

Query  591   VGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVP  770
             VGQ R+ DL + D +VSK LCNLKH + EKG SITLLEI+GKKG VQVNGK+YPKNSTVP
Sbjct  145   VGQSRESDLWIGDSTVSKDLCNLKHTETEKGVSITLLEITGKKGDVQVNGKVYPKNSTVP  204

Query  771   LNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPST  950
             L GGDEV+FGSSG+HAYIF    + D+SA S+   VSILEAHSG +KG++ EARSGDPST
Sbjct  205   LKGGDEVVFGSSGQHAYIF----DNDLSATSLAHPVSILEAHSGSIKGLHLEARSGDPST  260

Query  951   VAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEP--DKHDLDSDMKDV  1124
             VAVASTLASLSNL+K+L LLPPS  N  D KQG E+P LP ASG    +K DLD+DMKD 
Sbjct  261   VAVASTLASLSNLRKDLSLLPPSSQNGKDGKQGSEVPILPSASGLSLTEKDDLDTDMKDA  320

Query  1125  SDHNDVP---LDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAG  1295
             SD ND P   +DEK+  ISP   N NLNL+N  +DS D EIGKV       +PL+++LAG
Sbjct  321   SDGNDEPGVLVDEKNDVISPGVENGNLNLDNVVLDSVDAEIGKV-------QPLLQVLAG  373

Query  1296  SSTPEFDLSGNISRIIDQRR---ELLKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSF  1466
             SS  EFDLSG+IS+I +++R   ELLKDFD  +S  TRRQ FK+ LQQ ++D N I+V+F
Sbjct  374   SSASEFDLSGSISKIFEEQRNFRELLKDFDRPVSALTRRQTFKNALQQGVVDFNTIDVTF  433

Query  1467  EDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKA  1646
             E+FPYYL E TKNVLIASTYIHLKCN F K AS+LPTVCPRILLSGPAGSEIYQETLAKA
Sbjct  434   ENFPYYLCENTKNVLIASTYIHLKCNGFAKFASDLPTVCPRILLSGPAGSEIYQETLAKA  493

Query  1647  LAKYFGARLLVVDSLVLPG-GSAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASS  1823
             LAKYF A+L++VDSL+LPG  S+K+++PVK + KPER  VF KRAAQAA L  NKKPASS
Sbjct  494   LAKYFCAKLMIVDSLLLPGVSSSKDVEPVKVSSKPERASVFAKRAAQAAALHLNKKPASS  553

Query  1824  VEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYG  1997
             VEADITGGS +SSHAQ KQEASTASSKN TFK GDRVKY+G L + FS LQ+P RGP YG
Sbjct  554   VEADITGGSILSSHAQPKQEASTASSKNYTFKKGDRVKYIGSLTSSFSPLQSPIRGPTYG  613

Query  1998  YKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDK  2177
             Y+GKV+LAFEENG SKIGVRFDRSIPEGNDLGGLC+EDHGFFCAAD LRLD+SS D++DK
Sbjct  614   YRGKVVLAFEENGSSKIGVRFDRSIPEGNDLGGLCDEDHGFFCAADLLRLDSSSNDEIDK  673

Query  2178  LAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQT  2357
             LAINELFEV  +E KS PL+LF+KDIEKSMVGNPEA++AFK+KLE LPENVV IAS+ Q+
Sbjct  674   LAINELFEVALKESKSGPLVLFIKDIEKSMVGNPEAYAAFKIKLEHLPENVVAIASHAQS  733

Query  2358  DNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMI  2537
             D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNFGRLHDRSKETPK +KQLTRLFPNKV I
Sbjct  734   DSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKTMKQLTRLFPNKVTI  793

Query  2538  QIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNES  2717
             QIPQDETLLSDWKQ+LDRD+ETMKSQSN  +IRNVLNR +++C D+E LCIKDQALTNES
Sbjct  794   QIPQDETLLSDWKQKLDRDMETMKSQSNIASIRNVLNRFKINCDDLEILCIKDQALTNES  853

Query  2718  VEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTE  2897
             VEKIIGWALSHH MH SES+ KE KLAISSESI YGLS+ QG+Q ETKS+KKSLKDVVTE
Sbjct  854   VEKIIGWALSHHLMHKSESAMKETKLAISSESIAYGLSMFQGIQGETKSLKKSLKDVVTE  913

Query  2898  NEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGI  3077
             NEFEKKLL DVIPPSDIGVTF+DIGALE VKDTLKELVMLPLQRPELFCKGQLTKPCKGI
Sbjct  914   NEFEKKLLGDVIPPSDIGVTFNDIGALETVKDTLKELVMLPLQRPELFCKGQLTKPCKGI  973

Query  3078  LLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVV  3257
             LLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSV+
Sbjct  974   LLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVI  1033

Query  3258  FVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVI  3437
             FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVI
Sbjct  1034  FVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVI  1093

Query  3438  RRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAH  3617
             RRLPRRLMVNLPDA NREKIL +IL KEELAPNVDL+AIA MT+GYSGSDLKNLCV+AAH
Sbjct  1094  RRLPRRLMVNLPDASNREKILGVILAKEELAPNVDLEAIATMTDGYSGSDLKNLCVSAAH  1153

Query  3618  CPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMT  3797
             CPIREILEKEKKEK LAI+E+RP PALH+S+DIRPLNMDDF+YAHEQVCASVSSES+NM 
Sbjct  1154  CPIREILEKEKKEKTLAIAESRPSPALHSSADIRPLNMDDFKYAHEQVCASVSSESSNMN  1213

Query  3798  ELLQWNELYGEGGSRKKKALSYFM  3869
             ELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1214  ELLQWNDLYGEGGSRKKTSLSYFM  1237



>ref|XP_011082476.1| PREDICTED: uncharacterized protein LOC105165229 [Sesamum indicum]
 ref|XP_011082477.1| PREDICTED: uncharacterized protein LOC105165229 [Sesamum indicum]
Length=1230

 Score =  1787 bits (4628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 910/1198 (76%), Positives = 1023/1198 (85%), Gaps = 31/1198 (3%)
 Frame = +3

Query  303   EQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN  482
             E E  SADL  +  +K  +    EK PE          P +  D+ ID +K K++G ++N
Sbjct  55    ELEAGSADLAISGVVKQSDDLTAEKSPE----------PAVEDDTVIDAEKGKSSGPSVN  104

Query  483   RGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLK  662
             RGKKRQLKS+ G AWGKLLSQ  QN HV + + TFTVGQGRQCDL V DP+VSKSLC+LK
Sbjct  105   RGKKRQLKSDTGIAWGKLLSQCSQNPHVVMHRPTFTVGQGRQCDLWVGDPTVSKSLCSLK  164

Query  663   HIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTN  842
              ++ E G+S+T+LEI+GKKG VQVNGK+YPK+ST+PLNGGDEV+F SSGKHAYIFQ+ TN
Sbjct  165   LMETEGGDSVTVLEITGKKGAVQVNGKVYPKDSTIPLNGGDEVVFSSSGKHAYIFQQLTN  224

Query  843   EDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSV  1022
                SA  MPPSVSILEAH GP+KG++ EAR+GDPSTVAVASTLASLS+L  EL LLPPS 
Sbjct  225   SGESATDMPPSVSILEAHGGPIKGLHIEARTGDPSTVAVASTLASLSHLSNELSLLPPSS  284

Query  1023  CNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVP---LDEKSGAISPDSGNDN  1193
              +  D++Q  E+P++P     PD   +D++MKD S HNDV    + EK+G  SP   +DN
Sbjct  285   RSGEDVQQASEIPSVPTTCEVPDNCVVDTEMKDTSVHNDVASASVVEKTGGPSPGLASDN  344

Query  1194  LNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR---ELL  1364
             LN+        D EIGK+ G   +LRP++  L G + P+FD++G++SRI+D+ R   +  
Sbjct  345   LNI--------DAEIGKIVGENNDLRPVLHFL-GPTAPDFDITGSLSRILDEHRGVRDQC  395

Query  1365  KDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCN  1544
             K  DP IS+S+RRQ FKDGL+Q ++D  NI+VSFE+FPYYLSE TKNVLIASTYIHLKCN
Sbjct  396   KGCDPPISVSSRRQEFKDGLRQGVIDCKNIDVSFENFPYYLSETTKNVLIASTYIHLKCN  455

Query  1545  KFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKEL  1721
             KFVK  S+LPTVCPRILLSGPAGSEIYQETL KALAKYFGARLL+VD+++LPGG   KE+
Sbjct  456   KFVKFTSDLPTVCPRILLSGPAGSEIYQETLTKALAKYFGARLLIVDTVLLPGGPMTKEV  515

Query  1722  DPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASS  1901
             D VKE PKPER  VF KR + A  LR   KPASSVEADITGGSAIS+ AQ KQEASTASS
Sbjct  516   DSVKENPKPERASVFGKRTSAALHLR---KPASSVEADITGGSAISTQAQPKQEASTASS  572

Query  1902  KN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIP  2075
             K+ TF+ GDRVKYVG LP+GFS  Q P RGP YGY+GKV+LAFEENG SKIGVRFDR+IP
Sbjct  573   KSYTFRKGDRVKYVGSLPSGFSPSQAPIRGPTYGYRGKVVLAFEENGSSKIGVRFDRTIP  632

Query  2076  EGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDI  2255
             EGNDLGGLCEEDHGFFCAAD LRLDNSS DD+DKLAINELFEV S E KSSPLILF+KDI
Sbjct  633   EGNDLGGLCEEDHGFFCAADLLRLDNSSGDDIDKLAINELFEVASVESKSSPLILFLKDI  692

Query  2256  EKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLD  2435
             EKSMVGNPEA++AFK+KLE LPENVVVIAS+TQTDNRKEKSHPGG LFTKFGSNQTALLD
Sbjct  693   EKSMVGNPEAYAAFKIKLETLPENVVVIASHTQTDNRKEKSHPGGLLFTKFGSNQTALLD  752

Query  2436  LAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQ  2615
             LAFPDNFGRLHDRSKE PK +KQL+RLFPNKV IQIPQDET+L DWKQQLDRDIE MKSQ
Sbjct  753   LAFPDNFGRLHDRSKEIPKTMKQLSRLFPNKVTIQIPQDETVLVDWKQQLDRDIERMKSQ  812

Query  2616  SNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKL  2795
             SN  +IR VLNRV LDCPD+ETLCIKDQALT+ES EK+IGW+LSHHFMH SE+S +E K 
Sbjct  813   SNIGSIRVVLNRVGLDCPDLETLCIKDQALTSESAEKVIGWSLSHHFMHCSEASLRESKF  872

Query  2796  AISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGA  2975
              ISSES+RYGL +LQG+QNE KS+KKSLKDVVTENEFEKKLLA+VIPP DIGVTFDDIGA
Sbjct  873   VISSESMRYGLDILQGIQNENKSLKKSLKDVVTENEFEKKLLAEVIPPGDIGVTFDDIGA  932

Query  2976  LENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFI  3155
             LENVK+TLKELVMLPLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFI
Sbjct  933   LENVKETLKELVMLPLQRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFI  992

Query  3156  NISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKN  3335
             NISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKN
Sbjct  993   NISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKN  1052

Query  3336  EFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILT  3515
             EFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKIL++IL 
Sbjct  1053  EFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDARNREKILKVILA  1112

Query  3516  KEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPA  3695
             KEELAPNVDL+A+A++TEGYSGSDLKNLCVTAAHCPIREILEKEKKEKALA++ENRPLPA
Sbjct  1113  KEELAPNVDLEAVASLTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKALALAENRPLPA  1172

Query  3696  LHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             LH+S+D+RPL MDDFRYAHEQVCASVSSES NM ELLQWNELYGEGGSRKKK+LSYFM
Sbjct  1173  LHSSADVRPLTMDDFRYAHEQVCASVSSESQNMNELLQWNELYGEGGSRKKKSLSYFM  1230



>ref|XP_011079689.1| PREDICTED: uncharacterized protein LOC105163145 isoform X1 [Sesamum 
indicum]
Length=1230

 Score =  1774 bits (4594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 904/1198 (75%), Positives = 1020/1198 (85%), Gaps = 31/1198 (3%)
 Frame = +3

Query  303   EQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN  482
             E E  SADL      K  +    E  PE        V+P   GDSAIDV+K K  G ++N
Sbjct  55    ELEAGSADLANGGGEKQSDDVAAEVAPET-------VAP---GDSAIDVEKGKPGGPSVN  104

Query  483   RGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLK  662
             RGKKRQLKSN G AWGKLLSQ  QN HV +++ TFTVGQGRQCDL V DP+VSKSLCNLK
Sbjct  105   RGKKRQLKSNAGAAWGKLLSQCSQNPHVVMERPTFTVGQGRQCDLWVRDPTVSKSLCNLK  164

Query  663   HIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTN  842
             H++ E G S+TLLEI+GKKG VQVNGKIY K+STVPLNGGDEV+F S+GKHAYIFQ+ T+
Sbjct  165   HMESEGGESLTLLEITGKKGAVQVNGKIYSKDSTVPLNGGDEVVFSSTGKHAYIFQQLTS  224

Query  843   EDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSV  1022
              + S   +PPSVSILEAH G +KG++ EARSG+PS V+VASTLASLS+   EL +LPPS 
Sbjct  225   MNASETGVPPSVSILEAHGGSIKGLHIEARSGEPSAVSVASTLASLSDNHDELSVLPPSC  284

Query  1023  CNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND---VPLDEKSGAISPDSGNDN  1193
              +D D + GPE+PALP A  E   + +D++MKD SDH D   VP+ EK+ A SP++ N+N
Sbjct  285   QDDEDAQHGPEIPALPSAC-EVSDNCVDTEMKDASDHGDGATVPVVEKTAAPSPNAANEN  343

Query  1194  LNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR---ELL  1364
             LN+        D E GK+     +LRP +++LAGS  P  D+SG+ISRI+D+ R   +L 
Sbjct  344   LNV--------DAENGKILAENNDLRPFLQILAGSVAPALDISGSISRILDEHRAIRDLG  395

Query  1365  KDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCN  1544
             KD  P IS+S+RRQAFKDGL+Q +L   NIEVSFE+FPYYLSE TKNVLIASTYIHLKC+
Sbjct  396   KDSHPTISISSRRQAFKDGLRQGLLQCKNIEVSFENFPYYLSETTKNVLIASTYIHLKCD  455

Query  1545  KFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKEL  1721
             KF K  S+LPTVCPRILLSGPAGSEIYQETLAKALAK+FG  LL+V++++LPGG S KE+
Sbjct  456   KFAKYTSDLPTVCPRILLSGPAGSEIYQETLAKALAKHFGVSLLIVNTILLPGGPSTKEV  515

Query  1722  DPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASS  1901
             D VKE+ KPER  VF KR+A A  L   KKP SSVEADITG S ++S  Q KQEASTASS
Sbjct  516   DSVKESSKPERASVFAKRSAAALHL---KKPPSSVEADITGCSNVNSQVQPKQEASTASS  572

Query  1902  KN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIP  2075
             KN TFK GDRVKYVG LP+GFS  QTP RGP YGY+GKV+LAFEENG SKIGVRFDR+IP
Sbjct  573   KNYTFKKGDRVKYVGSLPSGFSPTQTPIRGPTYGYRGKVVLAFEENGSSKIGVRFDRAIP  632

Query  2076  EGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDI  2255
             EGNDLGGLCEEDHGFFCAAD LRLD+SS DD++KLAINELFEV S+E KS+PLILF+KDI
Sbjct  633   EGNDLGGLCEEDHGFFCAADLLRLDSSSTDDIEKLAINELFEVASEESKSAPLILFLKDI  692

Query  2256  EKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLD  2435
             EK +VGNPEA++AFK+KLE LPENVVVIAS+TQTD+RKEKSHPGG LFTKFGSNQTALLD
Sbjct  693   EKCLVGNPEAYAAFKIKLETLPENVVVIASHTQTDSRKEKSHPGGLLFTKFGSNQTALLD  752

Query  2436  LAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQ  2615
             LAFPDNFGRLHDRSKETPK +KQL+RLFPNKV IQIPQDE +L DWKQ+LDRD ET+KSQ
Sbjct  753   LAFPDNFGRLHDRSKETPKTMKQLSRLFPNKVTIQIPQDEAVLVDWKQKLDRDTETLKSQ  812

Query  2616  SNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKL  2795
             SN  +IR+VL R  LDCPD+ETLCIKDQALTNESVEKIIGWALSHHFMHSSE+S++E KL
Sbjct  813   SNIGSIRSVLKRTGLDCPDLETLCIKDQALTNESVEKIIGWALSHHFMHSSEASSQELKL  872

Query  2796  AISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGA  2975
              ISSESI YGL++LQ +QNE KSVKKSLKDVVTENEFEKKLLA+V+PP DIGVTFDDIG+
Sbjct  873   VISSESISYGLNILQSIQNENKSVKKSLKDVVTENEFEKKLLAEVVPPGDIGVTFDDIGS  932

Query  2976  LENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFI  3155
             LENVK+TLKELVMLPLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFI
Sbjct  933   LENVKETLKELVMLPLQRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFI  992

Query  3156  NISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKN  3335
             NISMSSITSKWFGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKN
Sbjct  993   NISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKN  1052

Query  3336  EFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILT  3515
             EFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKIL++IL 
Sbjct  1053  EFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAQNREKILKVILA  1112

Query  3516  KEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPA  3695
             KEELA NVDL+A+A+MTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKALA++ENR LPA
Sbjct  1113  KEELAANVDLEAVASMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKALAMAENRQLPA  1172

Query  3696  LHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             LH+S+D+RPL+MDDFRYAHEQVCASVSSES NM ELLQWNELYGEGGSRKK +LSYFM
Sbjct  1173  LHSSADVRPLSMDDFRYAHEQVCASVSSESQNMNELLQWNELYGEGGSRKKSSLSYFM  1230



>ref|XP_011079690.1| PREDICTED: uncharacterized protein LOC105163145 isoform X2 [Sesamum 
indicum]
Length=1223

 Score =  1754 bits (4543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 899/1198 (75%), Positives = 1014/1198 (85%), Gaps = 38/1198 (3%)
 Frame = +3

Query  303   EQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN  482
             E E  SADL      K  +    E  PE        V+P   GDSAIDV+K K  G ++N
Sbjct  55    ELEAGSADLANGGGEKQSDDVAAEVAPET-------VAP---GDSAIDVEKGKPGGPSVN  104

Query  483   RGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLK  662
             RGKKRQLKSN G AWGKLLSQ  QN HV +++ TFTVGQGRQCDL V DP+VSKSLCNLK
Sbjct  105   RGKKRQLKSNAGAAWGKLLSQCSQNPHVVMERPTFTVGQGRQCDLWVRDPTVSKSLCNLK  164

Query  663   HIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTN  842
             H++ E G S+TLLEI+GKKG VQVNGKIY K+STVPLNGGDEV+F S+GKHAYIFQ+ T+
Sbjct  165   HMESEGGESLTLLEITGKKGAVQVNGKIYSKDSTVPLNGGDEVVFSSTGKHAYIFQQLTS  224

Query  843   EDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSV  1022
              + S   +PPSVSILEAH G +KG++ EARSG+PS V+VASTLASLS+   EL +LPPS 
Sbjct  225   MNASETGVPPSVSILEAHGGSIKGLHIEARSGEPSAVSVASTLASLSDNHDELSVLPPSC  284

Query  1023  CNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND---VPLDEKSGAISPDSGNDN  1193
              +D D + GPE+PALP A  E   + +D++MKD SDH D   VP+ EK+ A SP++ N+N
Sbjct  285   QDDEDAQHGPEIPALPSAC-EVSDNCVDTEMKDASDHGDGATVPVVEKTAAPSPNAANEN  343

Query  1194  LNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR---ELL  1364
             LN+        D E GK+     +LRP +++LAGS  P  D+SG+ISRI+D+ R   +L 
Sbjct  344   LNV--------DAENGKILAENNDLRPFLQILAGSVAPALDISGSISRILDEHRAIRDLG  395

Query  1365  KDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCN  1544
             KD  P IS+S+RRQAFKDGL+Q +L   NIEVSFE+FPYYLSE TKNVLIASTYIHLKC+
Sbjct  396   KDSHPTISISSRRQAFKDGLRQGLLQCKNIEVSFENFPYYLSETTKNVLIASTYIHLKCD  455

Query  1545  KFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKEL  1721
             KF K  S+LPTVCPRILLSGPAGSEIYQETLAKALAK+FG  LL+V++++LPGG S KE+
Sbjct  456   KFAKYTSDLPTVCPRILLSGPAGSEIYQETLAKALAKHFGVSLLIVNTILLPGGPSTKEV  515

Query  1722  DPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASS  1901
             D VKE+ KPER  VF KR+A A  L   KKP SSVEADITG S ++S  Q KQEASTASS
Sbjct  516   DSVKESSKPERASVFAKRSAAALHL---KKPPSSVEADITGCSNVNSQVQPKQEASTASS  572

Query  1902  KN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIP  2075
             KN TFK GDRVKYVG LP+GFS  QTP RG       KV+LAFEENG SKIGVRFDR+IP
Sbjct  573   KNYTFKKGDRVKYVGSLPSGFSPTQTPIRG-------KVVLAFEENGSSKIGVRFDRAIP  625

Query  2076  EGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDI  2255
             EGNDLGGLCEEDHGFFCAAD LRLD+SS DD++KLAINELFEV S+E KS+PLILF+KDI
Sbjct  626   EGNDLGGLCEEDHGFFCAADLLRLDSSSTDDIEKLAINELFEVASEESKSAPLILFLKDI  685

Query  2256  EKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLD  2435
             EK +VGNPEA++AFK+KLE LPENVVVIAS+TQTD+RKEKSHPGG LFTKFGSNQTALLD
Sbjct  686   EKCLVGNPEAYAAFKIKLETLPENVVVIASHTQTDSRKEKSHPGGLLFTKFGSNQTALLD  745

Query  2436  LAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQ  2615
             LAFPDNFGRLHDRSKETPK +KQL+RLFPNKV IQIPQDE +L DWKQ+LDRD ET+KSQ
Sbjct  746   LAFPDNFGRLHDRSKETPKTMKQLSRLFPNKVTIQIPQDEAVLVDWKQKLDRDTETLKSQ  805

Query  2616  SNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKL  2795
             SN  +IR+VL R  LDCPD+ETLCIKDQALTNESVEKIIGWALSHHFMHSSE+S++E KL
Sbjct  806   SNIGSIRSVLKRTGLDCPDLETLCIKDQALTNESVEKIIGWALSHHFMHSSEASSQELKL  865

Query  2796  AISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGA  2975
              ISSESI YGL++LQ +QNE KSVKKSLKDVVTENEFEKKLLA+V+PP DIGVTFDDIG+
Sbjct  866   VISSESISYGLNILQSIQNENKSVKKSLKDVVTENEFEKKLLAEVVPPGDIGVTFDDIGS  925

Query  2976  LENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFI  3155
             LENVK+TLKELVMLPLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFI
Sbjct  926   LENVKETLKELVMLPLQRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFI  985

Query  3156  NISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKN  3335
             NISMSSITSKWFGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKN
Sbjct  986   NISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKN  1045

Query  3336  EFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILT  3515
             EFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKIL++IL 
Sbjct  1046  EFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAQNREKILKVILA  1105

Query  3516  KEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPA  3695
             KEELA NVDL+A+A+MTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKALA++ENR LPA
Sbjct  1106  KEELAANVDLEAVASMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKALAMAENRQLPA  1165

Query  3696  LHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             LH+S+D+RPL+MDDFRYAHEQVCASVSSES NM ELLQWNELYGEGGSRKK +LSYFM
Sbjct  1166  LHSSADVRPLSMDDFRYAHEQVCASVSSESQNMNELLQWNELYGEGGSRKKSSLSYFM  1223



>ref|XP_011079691.1| PREDICTED: uncharacterized protein LOC105163145 isoform X3 [Sesamum 
indicum]
Length=1197

 Score =  1737 bits (4498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 882/1198 (74%), Positives = 994/1198 (83%), Gaps = 64/1198 (5%)
 Frame = +3

Query  303   EQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN  482
             E E  SADL      K  +    E  PE        V+P   GDSAIDV+K K  G ++N
Sbjct  55    ELEAGSADLANGGGEKQSDDVAAEVAPET-------VAP---GDSAIDVEKGKPGGPSVN  104

Query  483   RGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLK  662
             RGKKRQLKSN G AWGKLLSQ  QN HV +++ TFTVGQGRQCDL V DP+VSKSLCNLK
Sbjct  105   RGKKRQLKSNAGAAWGKLLSQCSQNPHVVMERPTFTVGQGRQCDLWVRDPTVSKSLCNLK  164

Query  663   HIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTN  842
             H++ E G S+TLLEI+GKKG VQVNGKIY K+STVPLNGGDEV+F S+GKHAYIFQ+ T+
Sbjct  165   HMESEGGESLTLLEITGKKGAVQVNGKIYSKDSTVPLNGGDEVVFSSTGKHAYIFQQLTS  224

Query  843   EDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSV  1022
              + S   +PPSVSILEAH G +KG++ E                                
Sbjct  225   MNASETGVPPSVSILEAHGGSIKGLHIE--------------------------------  252

Query  1023  CNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND---VPLDEKSGAISPDSGNDN  1193
              +D D + GPE+PALP A  E   + +D++MKD SDH D   VP+ EK+ A SP++ N+N
Sbjct  253   -DDEDAQHGPEIPALPSAC-EVSDNCVDTEMKDASDHGDGATVPVVEKTAAPSPNAANEN  310

Query  1194  LNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQR---RELL  1364
             LN+        D E GK+     +LRP +++LAGS  P  D+SG+ISRI+D+    R+L 
Sbjct  311   LNV--------DAENGKILAENNDLRPFLQILAGSVAPALDISGSISRILDEHRAIRDLG  362

Query  1365  KDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCN  1544
             KD  P IS+S+RRQAFKDGL+Q +L   NIEVSFE+FPYYLSE TKNVLIASTYIHLKC+
Sbjct  363   KDSHPTISISSRRQAFKDGLRQGLLQCKNIEVSFENFPYYLSETTKNVLIASTYIHLKCD  422

Query  1545  KFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKEL  1721
             KF K  S+LPTVCPRILLSGPAGSEIYQETLAKALAK+FG  LL+V++++LPGG S KE+
Sbjct  423   KFAKYTSDLPTVCPRILLSGPAGSEIYQETLAKALAKHFGVSLLIVNTILLPGGPSTKEV  482

Query  1722  DPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASS  1901
             D VKE+ KPER  VF KR+A A  L   KKP SSVEADITG S ++S  Q KQEASTASS
Sbjct  483   DSVKESSKPERASVFAKRSAAALHL---KKPPSSVEADITGCSNVNSQVQPKQEASTASS  539

Query  1902  KN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIP  2075
             KN TFK GDRVKYVG LP+GFS  QTP RGP YGY+GKV+LAFEENG SKIGVRFDR+IP
Sbjct  540   KNYTFKKGDRVKYVGSLPSGFSPTQTPIRGPTYGYRGKVVLAFEENGSSKIGVRFDRAIP  599

Query  2076  EGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDI  2255
             EGNDLGGLCEEDHGFFCAAD LRLD+SS DD++KLAINELFEV S+E KS+PLILF+KDI
Sbjct  600   EGNDLGGLCEEDHGFFCAADLLRLDSSSTDDIEKLAINELFEVASEESKSAPLILFLKDI  659

Query  2256  EKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLD  2435
             EK +VGNPEA++AFK+KLE LPENVVVIAS+TQTD+RKEKSHPGG LFTKFGSNQTALLD
Sbjct  660   EKCLVGNPEAYAAFKIKLETLPENVVVIASHTQTDSRKEKSHPGGLLFTKFGSNQTALLD  719

Query  2436  LAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQ  2615
             LAFPDNFGRLHDRSKETPK +KQL+RLFPNKV IQIPQDE +L DWKQ+LDRD ET+KSQ
Sbjct  720   LAFPDNFGRLHDRSKETPKTMKQLSRLFPNKVTIQIPQDEAVLVDWKQKLDRDTETLKSQ  779

Query  2616  SNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKL  2795
             SN  +IR+VL R  LDCPD+ETLCIKDQALTNESVEKIIGWALSHHFMHSSE+S++E KL
Sbjct  780   SNIGSIRSVLKRTGLDCPDLETLCIKDQALTNESVEKIIGWALSHHFMHSSEASSQELKL  839

Query  2796  AISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGA  2975
              ISSESI YGL++LQ +QNE KSVKKSLKDVVTENEFEKKLLA+V+PP DIGVTFDDIG+
Sbjct  840   VISSESISYGLNILQSIQNENKSVKKSLKDVVTENEFEKKLLAEVVPPGDIGVTFDDIGS  899

Query  2976  LENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFI  3155
             LENVK+TLKELVMLPLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFI
Sbjct  900   LENVKETLKELVMLPLQRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFI  959

Query  3156  NISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKN  3335
             NISMSSITSKWFGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKN
Sbjct  960   NISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKN  1019

Query  3336  EFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILT  3515
             EFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKIL++IL 
Sbjct  1020  EFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAQNREKILKVILA  1079

Query  3516  KEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPA  3695
             KEELA NVDL+A+A+MTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKALA++ENR LPA
Sbjct  1080  KEELAANVDLEAVASMTEGYSGSDLKNLCVTAAHCPIREILEKEKKEKALAMAENRQLPA  1139

Query  3696  LHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             LH+S+D+RPL+MDDFRYAHEQVCASVSSES NM ELLQWNELYGEGGSRKK +LSYFM
Sbjct  1140  LHSSADVRPLSMDDFRYAHEQVCASVSSESQNMNELLQWNELYGEGGSRKKSSLSYFM  1197



>ref|XP_007050879.1| AAA-type ATPase family protein isoform 1 [Theobroma cacao]
 gb|EOX95036.1| AAA-type ATPase family protein isoform 1 [Theobroma cacao]
Length=1251

 Score =  1657 bits (4291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 862/1246 (69%), Positives = 1012/1246 (81%), Gaps = 46/1246 (4%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNE-------SGPESAEQEIRSADLDGASALKSPEAP  365
             KRSKA+E  SS+ +  G    G +NE       SG +S   E+RS+DL  + + K+ +A 
Sbjct  27    KRSKASEPASSSTN--GAVVSGPLNEALGPPKESGSDSRVTELRSSDLRVSDSAKAVDAS  84

Query  366   VPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK---SNLGTAWGK  533
             V +K  +A +    LVSP  LG++A+DV+K KA G+    R KKR  K   S     WGK
Sbjct  85    VTDKSADADVENGTLVSPGSLGEAAMDVEKAKAVGAGFTGRVKKRPTKPAKSGSKVPWGK  144

Query  534   LLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISG  713
             LLSQ+ QN H+ +  + FTVGQ RQC+LC+ DP+VS  LC +KHI+ + G SI LLEISG
Sbjct  145   LLSQHSQNPHLVMCGTLFTVGQSRQCNLCLKDPNVSTVLCKVKHIESD-GTSIALLEISG  203

Query  714   KKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEA  893
              KG VQVNG+IY K++++ LN GDE+IF S+G HAYIFQ+ TN++++A  +P SVSILEA
Sbjct  204   GKGSVQVNGRIYRKSNSLILNAGDELIFTSTGNHAYIFQQLTNDNLAAPGIPSSVSILEA  263

Query  894   HSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPV  1073
              + P+KG+   ARSGDPS VA A+T                 +      K+  +M  LP 
Sbjct  264   QAAPIKGI-IAARSGDPSAVAGAAT-----------------ILASLSTKENSDMSTLPS  305

Query  1074  ASGEPDKHDLDSDMKDVSDHND---VPLDEKSGAISPDSGNDNLNLEN-GAIDSYDGEIG  1241
                  D    + DMKD + +ND   V   EK+ A  P++ N+N NL+  G  D+ D +  
Sbjct  306   GCDVSDDRVPEVDMKDSASNNDPATVSSREKTVAPPPEAANENPNLDRLGLDDTMDADNS  365

Query  1242  KVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDP-LISMSTRRQA  1409
             KV GA   LRPL+R+LAG+S+ +FDLSG+I++I+D++RE   +LK+FDP ++ +ST+RQA
Sbjct  366   KVPGAGYPLRPLLRILAGTSSTDFDLSGSIAKILDEQREFREMLKEFDPPMVLISTKRQA  425

Query  1410  FKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPR  1589
             FKD LQ+ IL+ +NI+VSFE+FPYYLS+ TKNVLIASTY+HLKCNKF K AS+LPT+ PR
Sbjct  426   FKDSLQEGILNPDNIDVSFENFPYYLSDTTKNVLIASTYVHLKCNKFAKYASDLPTMSPR  485

Query  1590  ILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVF  1766
             ILLSGPAGSEIYQETLAKALAK+FGARLL+VDSL+LPGGS +KE D VKE  + ER  ++
Sbjct  486   ILLSGPAGSEIYQETLAKALAKHFGARLLIVDSLLLPGGSTSKEADGVKETSRAERASIY  545

Query  1767  TKRAAQAAVLRFN--KKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKY  1937
              KRAAQA+       K+P SSVEADITGGS++SS A  KQE STA+SKN TFK GDRVK+
Sbjct  546   AKRAAQASAAAALQQKRPTSSVEADITGGSSLSSQALPKQEVSTATSKNYTFKKGDRVKF  605

Query  1938  VGPL-PTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEED  2111
             VG   P+G S LQ   RGP  G++GKV+LAFEENG SKIGVRFDRSIPEGNDLGGLCEED
Sbjct  606   VGATAPSGLSSLQPALRGPTIGFRGKVVLAFEENGSSKIGVRFDRSIPEGNDLGGLCEED  665

Query  2112  HGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFS  2291
             HGFFCAA  LRLD+S  DD+DKLA+NELFEV   E K SPLILFVKDIEKSM GN + +S
Sbjct  666   HGFFCAASSLRLDSSGGDDVDKLAVNELFEVALNESKGSPLILFVKDIEKSMAGNTDVYS  725

Query  2292  AFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHD  2471
             A K K+EKLP NVVVI S+TQ DNRKEKSHPGG LFTKFG+NQTALLDLAFPDNFGRLHD
Sbjct  726   ALKCKVEKLPANVVVIGSHTQMDNRKEKSHPGGLLFTKFGANQTALLDLAFPDNFGRLHD  785

Query  2472  RSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNR  2651
             RSKETPK +KQ+TRLFPNKV IQ+PQDE LL DWKQQL+RDIET+K+QSN V+IR+VLNR
Sbjct  786   RSKETPKTMKQVTRLFPNKVTIQLPQDEALLLDWKQQLERDIETLKAQSNIVSIRSVLNR  845

Query  2652  VELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLS  2831
               LDCPD+ETLCIKDQ LTNESVEK++GWALSHHFMHSSE+   + KL +S+ESI+YGL+
Sbjct  846   NGLDCPDLETLCIKDQTLTNESVEKVVGWALSHHFMHSSEALVNDAKLVVSTESIKYGLN  905

Query  2832  VLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELV  3011
             +LQG+Q+E+KS+KKSLKDVVTENEFEKKLLADVIPPSDIGV+FDDIGALENVKDTLKELV
Sbjct  906   ILQGIQSESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVSFDDIGALENVKDTLKELV  965

Query  3012  MLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWF  3191
             MLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWF
Sbjct  966   MLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWF  1025

Query  3192  GEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTK  3371
             GEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTK
Sbjct  1026  GEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTK  1085

Query  3372  DKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDA  3551
             DKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KEEL+P+VDL+A
Sbjct  1086  DKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEELSPDVDLEA  1145

Query  3552  IANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNM  3731
             IANMT+GYSGSDLKNLCV+AAHCPIREILEKEKKE+A A++ENRPLP+L++S+DIR L M
Sbjct  1146  IANMTDGYSGSDLKNLCVSAAHCPIREILEKEKKERAAAVTENRPLPSLYSSADIRSLKM  1205

Query  3732  DDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             DDF+YAHEQVCASVSSESTNM+EL QWNELYGEGGSRKKK LSYFM
Sbjct  1206  DDFKYAHEQVCASVSSESTNMSELHQWNELYGEGGSRKKKPLSYFM  1251



>gb|KHG14286.1| ATPase family AAA domain-containing protein 1 [Gossypium arboreum]
Length=1247

 Score =  1637 bits (4238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 855/1244 (69%), Positives = 1000/1244 (80%), Gaps = 46/1244 (4%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNE-------SGPESAEQEIRSADLDGASALKSPEAP  365
             KRSKA+E  SS+ +  G    G VNE       SG +S   E+RS+DL  + A K+ +A 
Sbjct  27    KRSKASEPASSSTN--GAAVSGPVNEALGPPKESGSDSRVTELRSSDLPVSDAAKAVDAS  84

Query  366   VPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK---SNLGTAWGK  533
             VP+K  +  +    LVS   LG++A+D +  K   +    R KKR  K   S     WGK
Sbjct  85    VPDKSADVDVENGALVSHRSLGEAAVDAENAKVISAGFTARVKKRPTKPAKSGSKVPWGK  144

Query  534   LLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISG  713
             LLSQY QN HV +  + FTVGQ RQC+LC+ DPS+S  LC +KHI+ + GNSI LLEI+G
Sbjct  145   LLSQYSQNPHVVMCGTIFTVGQSRQCNLCLKDPSISTVLCKVKHIESD-GNSIALLEITG  203

Query  714   KKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEA  893
              KG VQVNGK+Y KN+++ LN GDE+IF S+G HAYIFQ+ TN++++A  +P S+S+LEA
Sbjct  204   GKGSVQVNGKVYRKNASLILNAGDELIFTSTGNHAYIFQQLTNDNLAAPGIPSSLSVLEA  263

Query  894   HSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPV  1073
              + P+K +  EARSGDPS VA A+T                 +      K+  EM  LP 
Sbjct  264   QTAPIKEI-IEARSGDPSAVAGAAT-----------------ILASLSTKENSEMSTLPS  305

Query  1074  ASGEPDKHDLDSDMKDVSDHND---VPLDEKSGAISPDSGNDNLNLEN-GAIDSYDGEIG  1241
                  D    + DMKD + ++D       EK+   +PD+ N+N NL+  G  DS D +  
Sbjct  306   GCEVSDDRVPEVDMKDSASNSDPATASSREKTVPPTPDAANENSNLDRLGLDDSMDADNT  365

Query  1242  KVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLISM-STRRQA  1409
             K+ GA   LRPL+R+LAG+ST +FD SG+I++I+D+RRE   +LK+F+P  ++ ST+RQA
Sbjct  366   KIPGAGYSLRPLLRILAGTST-DFDFSGSIAKILDERREIREMLKEFEPPSALISTKRQA  424

Query  1410  FKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPR  1589
             FKD LQ+ IL+ +NI+VSFE+FPYYLS+ TK VLIASTY+HLKCNKF K AS+LP + PR
Sbjct  425   FKDSLQEGILNPDNIDVSFENFPYYLSDTTKKVLIASTYVHLKCNKFAKYASDLPIMSPR  484

Query  1590  ILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVF  1766
             ILLSGP+GSEIYQETLAKALAK+FGARLL+VDSL+LPGGS ++E D VKE  + ER  V+
Sbjct  485   ILLSGPSGSEIYQETLAKALAKHFGARLLIVDSLLLPGGSTSRETDAVKEPSRAERAYVY  544

Query  1767  TKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVG  1943
              KRAAQAA L+  KKP SSVEADITGGS++SS A  KQE STA+SK+ TFK GDRVK+VG
Sbjct  545   AKRAAQAAALQ-QKKPTSSVEADITGGSSLSSQALPKQEVSTATSKSFTFKKGDRVKFVG  603

Query  1944  PL-PTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHG  2117
                P+GFS LQ   RGPA G++GKVLLAFEENG SKIGVRFDRSIPEGNDLGGLCE DHG
Sbjct  604   TTSPSGFSSLQPALRGPAIGFRGKVLLAFEENGSSKIGVRFDRSIPEGNDLGGLCEVDHG  663

Query  2118  FFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAF  2297
             FFCAA  LRL+ S  DD+DKLA+NELFEV   E K SPLILFVKDIEKSM GN + +S+ 
Sbjct  664   FFCAASSLRLEASGGDDVDKLAVNELFEVAVNESKCSPLILFVKDIEKSMAGNTDVYSSL  723

Query  2298  KLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRS  2477
             K K+E LP NVV+I S+TQ DNRKEKSHPGG LFTKFG+NQTALLDLAFPDNFGRLHDRS
Sbjct  724   KSKVENLPANVVIIGSHTQMDNRKEKSHPGGLLFTKFGANQTALLDLAFPDNFGRLHDRS  783

Query  2478  KETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVE  2657
             KETPK +KQ+ RLFPNKV IQ+PQDE LL DWKQQL+RDIET+K+QSN V+ R+VLNR  
Sbjct  784   KETPKTMKQVARLFPNKVTIQLPQDEALLLDWKQQLERDIETLKAQSNIVSFRSVLNRNG  843

Query  2658  LDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVL  2837
             LDCPD+ETLCIKDQ LTNESVEK++GWALSHHFMHSSE+  K+ KL +S+ESI+YGL++L
Sbjct  844   LDCPDLETLCIKDQTLTNESVEKVVGWALSHHFMHSSEALIKDAKLVVSTESIKYGLNIL  903

Query  2838  QGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVML  3017
             QG+Q+E+KS+KKSLKDVVTENEFEKKLLADVIPPSDIGV+FDDIGALENVKDTLKELVML
Sbjct  904   QGIQSESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVSFDDIGALENVKDTLKELVML  963

Query  3018  PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE  3197
             PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE
Sbjct  964   PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE  1023

Query  3198  GEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDK  3377
             GEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDK
Sbjct  1024  GEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDK  1083

Query  3378  ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIA  3557
             ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KE+L+PNVDL+ IA
Sbjct  1084  ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEDLSPNVDLETIA  1143

Query  3558  NMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDD  3737
             NMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE+A A +ENRP P L+NS+D+RPL MDD
Sbjct  1144  NMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERASAAAENRPAPTLYNSADVRPLKMDD  1203

Query  3738  FRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             F+YAHEQVCASVSSESTNM ELLQWNELYGEGGSRKKK LSYFM
Sbjct  1204  FKYAHEQVCASVSSESTNMNELLQWNELYGEGGSRKKKPLSYFM  1247



>ref|XP_010652173.1| PREDICTED: uncharacterized protein LOC100260666 [Vitis vinifera]
Length=1259

 Score =  1636 bits (4236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 875/1239 (71%), Positives = 1025/1239 (83%), Gaps = 24/1239 (2%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLG---EKTPGAVNESGPESAEQEIRSAD---LDGASALKSPEAPV  368
             KRSK+ E+ SS+ ++ G   E+      ESG E  +Q  + +D    D + A  + +   
Sbjct  27    KRSKSQETASSSSEVPGPLPEEALCQAKESGSEHIDQAPQPSDPPRTDTSKASDACDVIA  86

Query  369   PEKLPEAPLGGEPLV--SPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLS  542
              EK  EA   GE LV  SP+ L DSA+  +K K+     NRG+KR +KSN   AWGKLLS
Sbjct  87    KEKSTEAVAEGEALVAASPLPLVDSAVGGEKSKSVAVVSNRGRKRSVKSNATVAWGKLLS  146

Query  543   QYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKG  722
             Q  Q  H PL    FT+GQ R  +L + DPS+S +LC L+HI+R  G S+ LLEI+G KG
Sbjct  147   QCSQYPHQPLCGPLFTIGQSRASNLSLRDPSISNTLCRLRHIER-GGASVVLLEITGGKG  205

Query  723   CVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSG  902
              VQVNGKI+ K+ST+ ++GGDE++F +SG+ AYIFQ+FT+++++A  +P SVSILEA S 
Sbjct  206   VVQVNGKIHQKSSTLIISGGDELVFSASGQPAYIFQQFTSDNLAAPVIPSSVSILEAQSA  265

Query  903   PVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASG  1082
             PVKG++ EARSGDPS VA AS LASLSNL+K+L LLPP    + D++QG EM   P   G
Sbjct  266   PVKGIHVEARSGDPSAVAGASILASLSNLRKDLSLLPPPKSGE-DVQQGTEMTTPPC--G  322

Query  1083  EPDKHDLDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNLNLENGAIDS-YDGEIGKVT  1250
               D    D+DMKD +++NDV      EK+   S ++ N+NLNL++  +D+  D EIGKV 
Sbjct  323   ASDSCIPDADMKD-AENNDVAGVSSREKTDVPSSEAANENLNLQSIGLDACTDTEIGKVP  381

Query  1251  GAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRREL---LKDFDPLISM-STRRQAFKD  1418
             GA  ELRPL+RMLAGSS+ +FDLSG+IS+I++++RE+   LKD +P +++ STRRQAFKD
Sbjct  382   GATYELRPLLRMLAGSSSSDFDLSGSISKILEEQREIREILKDLEPPMALTSTRRQAFKD  441

Query  1419  GLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILL  1598
              LQ+ IL S++IEVSFE FPYYLS+ TKNVLI STYIHL   KF K   +L +VCPRILL
Sbjct  442   SLQEGILSSDDIEVSFESFPYYLSDTTKNVLITSTYIHLMHIKFAKYTMDLSSVCPRILL  501

Query  1599  SGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSA-KELDPVKEAPKPERTGVFTKR  1775
             SGPAGSEIYQETL KALAK+F ARLL+VDSL+LPGGS  K+ DPVKE  + ER  +F KR
Sbjct  502   SGPAGSEIYQETLTKALAKHFTARLLIVDSLLLPGGSTPKDPDPVKENTRGERASIFAKR  561

Query  1776  AAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLP  1952
             AAQAAVL+ +KKPASSVEADITG S +SS A  KQE STA+SKN  FK GDRVK+VGP P
Sbjct  562   AAQAAVLQ-HKKPASSVEADITGASTVSSRALPKQETSTATSKNYIFKAGDRVKFVGPPP  620

Query  1953  TGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAA  2132
             +GFS   P RGP  GY+GKVLLAFEENG SKIGVRFDRSIPEGNDLGGLCE+DHGFFC A
Sbjct  621   SGFSPMPPLRGPTNGYRGKVLLAFEENGSSKIGVRFDRSIPEGNDLGGLCEDDHGFFCPA  680

Query  2133  DFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLE  2312
             D LRLD+SS DD+DKLA+NELFEV S E KSSPLILF+KDIEKS+VGNPEA+      L+
Sbjct  681   DLLRLDSSSSDDVDKLALNELFEVASNESKSSPLILFIKDIEKSIVGNPEAYXXXXXXLD  740

Query  2313  KLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPK  2492
              LPEN+V+I S+TQ D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNFGRLHDRSKETPK
Sbjct  741   NLPENIVIIGSHTQMDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPK  800

Query  2493  AIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPD  2672
              +KQLTRLFPNKVMIQ+PQDE+LL DWKQQLDRD ET+K+Q+N VNIR+VLNR  LDCPD
Sbjct  801   TMKQLTRLFPNKVMIQLPQDESLLLDWKQQLDRDGETLKAQANIVNIRSVLNRNGLDCPD  860

Query  2673  IETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQN  2852
             +ETL IKDQ+L ++ V+K++GWALS+HFMH S++S ++ KL ISSESI YGL++LQG+Q+
Sbjct  861   LETLSIKDQSLASDGVDKLVGWALSYHFMHCSDASVRDSKLLISSESISYGLNLLQGIQS  920

Query  2853  ETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRP  3032
             E+KS+KKSLKDVVTENEFEKKLL+DVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRP
Sbjct  921   ESKSLKKSLKDVVTENEFEKKLLSDVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRP  980

Query  3033  ELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYV  3212
             ELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYV
Sbjct  981   ELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYV  1040

Query  3213  KAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLV  3392
             KAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLV
Sbjct  1041  KAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLV  1100

Query  3393  LAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEG  3572
             LAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKILR+IL KEELAP+V L+A+ANMT+G
Sbjct  1101  LAATNRPFDLDEAVIRRLPRRLMVNLPDALNREKILRVILAKEELAPDVGLEAVANMTDG  1160

Query  3573  YSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAH  3752
             YSGSDLKNLCVTAAHCPIREILE+EKKEKALA++E+R LPAL+ S+DIRPLN++DFRYAH
Sbjct  1161  YSGSDLKNLCVTAAHCPIREILEREKKEKALALAESRALPALYCSTDIRPLNIEDFRYAH  1220

Query  3753  EQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             EQVCASVSSESTNMTELLQWNELYGEGGSRK+ +LSYFM
Sbjct  1221  EQVCASVSSESTNMTELLQWNELYGEGGSRKRASLSYFM  1259



>gb|KDO87278.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1251

 Score =  1624 bits (4205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 848/1234 (69%), Positives = 999/1234 (81%), Gaps = 22/1234 (2%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  386
             KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27    KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  387   APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGTA--WGKLLSQYPQ  554
             A +  + LVSP   G++A+D +K KA G   N R KKR  K   +G+   W +L+SQ  Q
Sbjct  84    ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQ  143

Query  555   NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQV  734
             NSH+ +  + FTVG  RQCDL + DPS+SK+LC L+ I+   G S  LLEI+G KG V+V
Sbjct  144   NSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIE-NGGPSGALLEITGGKGEVEV  202

Query  735   NGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKG  914
             NG ++PK+S V L GGDE++F  SGKH+YIFQ+ +++ ++A  + P +SILEA S P+K 
Sbjct  203   NGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKT  262

Query  915   VNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDK  1094
             ++ EARSGDPS VA AS LASLSN++K+L L+PP      D  Q  E+ +L      P+ 
Sbjct  263   MHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVD-AQNSEIASLASGCDGPED  321

Query  1095  HDLDSDMKDVSDHNDVPLDEKSG-AISP--DSGNDNLNLENGAIDS-YDGEIGKVTGAPQ  1262
                D DMKD + +ND       G  + P  D+ N+N NL++  +D+  D EIGK+ GA  
Sbjct  322   RIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATY  381

Query  1263  ELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFD-PLISMSTRRQAFKDGLQQ  1430
             ELRPL+RMLAGSS+P+FD+SG IS+I+D++RE   LLKD D P + +S RRQAFKD LQ+
Sbjct  382   ELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQE  441

Query  1431  TILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPA  1610
              IL   NIEVSFE FPYYLS+ITKNVLIASTY+HLKCN F K AS+LPT+CPRILLSGPA
Sbjct  442   GILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPA  501

Query  1611  GSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAAQAA  1790
             GSEIYQETLAKALAK+F ARLL+VDSL+LPGGS+KE D VKE+ + E+  +F KRAA   
Sbjct  502   GSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAA---  558

Query  1791  VLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSL  1967
              L  ++KP SSVEADITGG+A+ S A  K E STASSKN TFK GDRVK+VG + +G ++
Sbjct  559   -LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTV  617

Query  1968  QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRL  2147
             Q   RGP  G++G+V+L FE+N FSKIGVRFDRSIPEGN+LGG CE+DHGFFC A  LRL
Sbjct  618   QPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRL  677

Query  2148  DNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPEN  2327
             D+S  D++DKLAINELFEV   E KSSPLI+FVKDIEKS+ GN +A+ A K KLE LP N
Sbjct  678   DSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSN  737

Query  2328  VVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQL  2507
             VVVI S+TQ D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNF RLHDRSKETPKA+KQ+
Sbjct  738   VVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQI  797

Query  2508  TRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLC  2687
             +RLFPNKV IQ+PQDE LLSDWKQQL+RD+ET+K QSN ++IR+VL+R  LDC D+E+LC
Sbjct  798   SRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLC  857

Query  2688  IKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSV  2867
             IKDQ LT E VEKI+GWALSHHFMH SE+  K+ KL IS+ESI YGL++LQG+Q+E+KS+
Sbjct  858   IKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSL  917

Query  2868  KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  3047
             KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK
Sbjct  918   KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  977

Query  3048  GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFT  3227
             GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+
Sbjct  978   GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS  1037

Query  3228  LASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  3407
             LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN
Sbjct  1038  LASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  1097

Query  3408  RPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSD  3587
             RPFDLDEAV+RRLPRRLMVNLPDAPNREKI+R+IL KEELA +VDL+ IANM +GYSGSD
Sbjct  1098  RPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSD  1157

Query  3588  LKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCA  3767
             LKNLCVTAAHCPIREILEKEKKE+ALA++ENR  P L++S D+RPL MDDF+YAHEQVCA
Sbjct  1158  LKNLCVTAAHCPIREILEKEKKERALALAENRASPPLYSSVDVRPLKMDDFKYAHEQVCA  1217

Query  3768  SVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             SVSSESTNM ELLQWNELYGEGGSRK+K+LSYFM
Sbjct  1218  SVSSESTNMNELLQWNELYGEGGSRKRKSLSYFM  1251



>ref|XP_006444295.1| hypothetical protein CICLE_v10018538mg [Citrus clementina]
 gb|ESR57535.1| hypothetical protein CICLE_v10018538mg [Citrus clementina]
Length=1251

 Score =  1623 bits (4204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 847/1234 (69%), Positives = 998/1234 (81%), Gaps = 22/1234 (2%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  386
             KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27    KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  387   APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGTA--WGKLLSQYPQ  554
             A +  + LVSP   G++A+D +K KA G   N R KKR  K   +G+   W +L+SQ  Q
Sbjct  84    ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQ  143

Query  555   NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQV  734
             NSH+ +  + FTVG  RQCDL + DPS+SK+LC L+ I+   G S  LLEI+G KG V+V
Sbjct  144   NSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIE-NGGPSGALLEITGGKGEVEV  202

Query  735   NGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKG  914
             NG ++PK+S V L GGDE++F  SGKH+YIFQ+ +++ ++A  + P +SILEA S P+K 
Sbjct  203   NGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKT  262

Query  915   VNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDK  1094
             ++ EARSGDPS VA AS LASLSN++K+L L+PP      D  Q  E+ +L      P+ 
Sbjct  263   MHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVD-AQNSEIASLASGCDGPED  321

Query  1095  HDLDSDMKDVSDHNDVPLDEKSG-AISP--DSGNDNLNLENGAIDS-YDGEIGKVTGAPQ  1262
                D DMKD + +ND       G  + P  D+ N+N NL++  +D+  D EIGK+ GA  
Sbjct  322   RIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATY  381

Query  1263  ELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFD-PLISMSTRRQAFKDGLQQ  1430
             ELRPL+RMLAGSS+P+FD+SG IS+I+D++RE   LLKD D P + +S RRQAFKD LQ+
Sbjct  382   ELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQE  441

Query  1431  TILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPA  1610
              IL   NIEVSFE FPYYLS+ TKNVLIASTY+HLKCN F K AS+LPT+CPRILLSGPA
Sbjct  442   GILGPENIEVSFESFPYYLSDTTKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPA  501

Query  1611  GSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAAQAA  1790
             GSEIYQETLAKALAK+F ARLL+VDSL+LPGGS+KE D VKE+ + E+  +F KRAA   
Sbjct  502   GSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAA---  558

Query  1791  VLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSL  1967
              L  ++KP SSVEADITGG+A+ S A  K E STASSKN TFK GDRVK+VG + +G ++
Sbjct  559   -LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTV  617

Query  1968  QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRL  2147
             Q   RGP  G++G+V+L FE+N FSKIGVRFDRSIPEGN+LGG CE+DHGFFC A  LRL
Sbjct  618   QPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRL  677

Query  2148  DNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPEN  2327
             D+S  D++DKLAINELFEV   E KSSPLI+FVKDIEKS+ GN +A+ A K KLE LP N
Sbjct  678   DSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSN  737

Query  2328  VVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQL  2507
             VVVI S+TQ D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNF RLHDRSKETPKA+KQ+
Sbjct  738   VVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQI  797

Query  2508  TRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLC  2687
             +RLFPNKV IQ+PQDE LLSDWKQQL+RD+ET+K QSN ++IR+VL+R  LDC D+E+LC
Sbjct  798   SRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLC  857

Query  2688  IKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSV  2867
             IKDQ LT E VEKI+GWALSHHFMH SE+  K+ KL IS+ESI YGL++LQG+Q+E+KS+
Sbjct  858   IKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSL  917

Query  2868  KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  3047
             KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK
Sbjct  918   KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  977

Query  3048  GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFT  3227
             GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+
Sbjct  978   GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS  1037

Query  3228  LASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  3407
             LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN
Sbjct  1038  LASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  1097

Query  3408  RPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSD  3587
             RPFDLDEAV+RRLPRRLMVNLPDAPNREKI+R+IL KEELA +VDL+ IANM +GYSGSD
Sbjct  1098  RPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSD  1157

Query  3588  LKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCA  3767
             LKNLCVTAAHCPIREILEKEKKE+ALA++ENR  P L++S D+RPL MDDF+YAHEQVCA
Sbjct  1158  LKNLCVTAAHCPIREILEKEKKERALALAENRASPPLYSSVDVRPLKMDDFKYAHEQVCA  1217

Query  3768  SVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             SVSSESTNM ELLQWNELYGEGGSRK+K+LSYFM
Sbjct  1218  SVSSESTNMNELLQWNELYGEGGSRKRKSLSYFM  1251



>ref|XP_006479928.1| PREDICTED: uncharacterized protein LOC102620169 [Citrus sinensis]
Length=1251

 Score =  1622 bits (4200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 847/1234 (69%), Positives = 999/1234 (81%), Gaps = 22/1234 (2%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  386
             KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27    KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  387   APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGTA--WGKLLSQYPQ  554
             A +  + LVSP   G++A+D +K KA G   N R KKR  K   +G+   W +L+SQ  +
Sbjct  84    ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSE  143

Query  555   NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQV  734
             NSH+ +  + FTVG  RQCDL + DPS+SK+LC L+ I+   G S  LLEI+G KG V+V
Sbjct  144   NSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIE-NGGPSGALLEITGGKGEVEV  202

Query  735   NGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKG  914
             NG ++PK+S V L GGDE++F  SGKH+YIFQ+ +++ ++A  + P +SILEA S P+K 
Sbjct  203   NGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKT  262

Query  915   VNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDK  1094
             ++ EARSGDPS VA AS LASLSN++K+L L+PP      D  Q  E+ +L      P+ 
Sbjct  263   MHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVD-AQNSEIASLASGCDGPED  321

Query  1095  HDLDSDMKDVSDHNDVPLDEKSG-AISP--DSGNDNLNLENGAIDS-YDGEIGKVTGAPQ  1262
                D DMKD + +ND       G  + P  D+ N+N NL++  +D+  D EIGK+ GA  
Sbjct  322   RIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATY  381

Query  1263  ELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFD-PLISMSTRRQAFKDGLQQ  1430
             ELRPL+RMLAGSS+P+FD+SG IS+I+D++RE   LLKD D P + +S RRQAFKD LQ+
Sbjct  382   ELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQE  441

Query  1431  TILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPA  1610
              IL   NIEVSFE FPYYLS+ITKNVLIASTY+HLKCN F K AS+LPT+CPRILLSGPA
Sbjct  442   GILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPA  501

Query  1611  GSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAAQAA  1790
             GSEIYQETLAKALAK+F ARLL+VDSL+LPGGS+KE D VKE+ + E+  +F KRAA   
Sbjct  502   GSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAA---  558

Query  1791  VLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSL  1967
              L  ++KP SSVEADITGG+A+ S A  K E STASSKN TFK GDRVK+VG + +G ++
Sbjct  559   -LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTV  617

Query  1968  QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRL  2147
             Q   RGP  G++G+V+L FE+N FSKIGVRFDRSIPEGN+LGG CE+DHGFFC A  LRL
Sbjct  618   QPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRL  677

Query  2148  DNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPEN  2327
             D+S  D++DKLAINELFEV   E KSSPLI+FVKDIEKS+ GN +A+ A K KLE LP N
Sbjct  678   DSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSN  737

Query  2328  VVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQL  2507
             VVVI S+TQ D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNF RLHDRSKETPKA+KQ+
Sbjct  738   VVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQI  797

Query  2508  TRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLC  2687
             +RLFPNKV IQ+PQDE LLSDWKQQL+RD+ET+K QSN ++IR+VL+R  LDC D+E+LC
Sbjct  798   SRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLC  857

Query  2688  IKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSV  2867
             IKDQ LT E VEKI+GWALSHHFMH SE+  K+ KL IS+ESI YGL++LQG+Q+E+KS+
Sbjct  858   IKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSL  917

Query  2868  KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  3047
             KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK
Sbjct  918   KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  977

Query  3048  GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFT  3227
             GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+
Sbjct  978   GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS  1037

Query  3228  LASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  3407
             LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN
Sbjct  1038  LASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  1097

Query  3408  RPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSD  3587
             RPFDLDEAV+RRLPRRLMVNLPDAPNREKI+R+IL KEELA +VDL+ IANM +GYSGSD
Sbjct  1098  RPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSD  1157

Query  3588  LKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCA  3767
             LKNLCVTAAHCPIREILEKEKKE+ALA++ENR  P L++S D+RPL MDDF+YAHEQVCA
Sbjct  1158  LKNLCVTAAHCPIREILEKEKKERALALAENRASPPLYSSVDVRPLKMDDFKYAHEQVCA  1217

Query  3768  SVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             SVSSESTNM ELLQWNELYGEGGSRK+K+LSYFM
Sbjct  1218  SVSSESTNMNELLQWNELYGEGGSRKRKSLSYFM  1251



>emb|CBI36835.3| unnamed protein product [Vitis vinifera]
Length=1287

 Score =  1621 bits (4197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 875/1267 (69%), Positives = 1025/1267 (81%), Gaps = 52/1267 (4%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLG---EKTPGAVNESGPESAEQEIRSAD---LDGASALKSPEAPV  368
             KRSK+ E+ SS+ ++ G   E+      ESG E  +Q  + +D    D + A  + +   
Sbjct  27    KRSKSQETASSSSEVPGPLPEEALCQAKESGSEHIDQAPQPSDPPRTDTSKASDACDVIA  86

Query  369   PEKLPEAPLGGEPLV--SPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLS  542
              EK  EA   GE LV  SP+ L DSA+  +K K+     NRG+KR +KSN   AWGKLLS
Sbjct  87    KEKSTEAVAEGEALVAASPLPLVDSAVGGEKSKSVAVVSNRGRKRSVKSNATVAWGKLLS  146

Query  543   QYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKG  722
             Q  Q  H PL    FT+GQ R  +L + DPS+S +LC L+HI+R  G S+ LLEI+G KG
Sbjct  147   QCSQYPHQPLCGPLFTIGQSRASNLSLRDPSISNTLCRLRHIER-GGASVVLLEITGGKG  205

Query  723   CVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSG  902
              VQVNGKI+ K+ST+ ++GGDE++F +SG+ AYIFQ+FT+++++A  +P SVSILEA S 
Sbjct  206   VVQVNGKIHQKSSTLIISGGDELVFSASGQPAYIFQQFTSDNLAAPVIPSSVSILEAQSA  265

Query  903   PVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASG  1082
             PVKG++ EARSGDPS VA AS LASLSNL+K+L LLPP    + D++QG EM   P   G
Sbjct  266   PVKGIHVEARSGDPSAVAGASILASLSNLRKDLSLLPPPKSGE-DVQQGTEMTTPPC--G  322

Query  1083  EPDKHDLDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNLNLENGAIDS-YDGEIGKVT  1250
               D    D+DMKD +++NDV      EK+   S ++ N+NLNL++  +D+  D EIGKV 
Sbjct  323   ASDSCIPDADMKD-AENNDVAGVSSREKTDVPSSEAANENLNLQSIGLDACTDTEIGKVP  381

Query  1251  GAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRREL---LKDFDPLISM-STRRQAFKD  1418
             GA  ELRPL+RMLAGSS+ +FDLSG+IS+I++++RE+   LKD +P +++ STRRQAFKD
Sbjct  382   GATYELRPLLRMLAGSSSSDFDLSGSISKILEEQREIREILKDLEPPMALTSTRRQAFKD  441

Query  1419  GLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILL  1598
              LQ+ IL S++IEVSFE FPYYLS+ TKNVLI STYIHL   KF K   +L +VCPRILL
Sbjct  442   SLQEGILSSDDIEVSFESFPYYLSDTTKNVLITSTYIHLMHIKFAKYTMDLSSVCPRILL  501

Query  1599  SGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSA-KELDPVKEAPKPERTGVFTKR  1775
             SGPAGSEIYQETL KALAK+F ARLL+VDSL+LPGGS  K+ DPVKE  + ER  +F KR
Sbjct  502   SGPAGSEIYQETLTKALAKHFTARLLIVDSLLLPGGSTPKDPDPVKENTRGERASIFAKR  561

Query  1776  AAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLP  1952
             AAQAAVL+ +KKPASSVEADITG S +SS A  KQE STA+SKN  FK GDRVK+VGP P
Sbjct  562   AAQAAVLQ-HKKPASSVEADITGASTVSSRALPKQETSTATSKNYIFKAGDRVKFVGPPP  620

Query  1953  TGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAA  2132
             +GFS   P RGP  GY+GKVLLAFEENG SKIGVRFDRSIPEGNDLGGLCE+DHGFFC A
Sbjct  621   SGFSPMPPLRGPTNGYRGKVLLAFEENGSSKIGVRFDRSIPEGNDLGGLCEDDHGFFCPA  680

Query  2133  DFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLK--  2306
             D LRLD+SS DD+DKLA+NELFEV S E KSSPLILF+KDIEKS+VGNPEA+        
Sbjct  681   DLLRLDSSSSDDVDKLALNELFEVASNESKSSPLILFIKDIEKSIVGNPEAYXXXXXXXX  740

Query  2307  --------------------------LEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKF  2408
                                       L+ LPEN+V+I S+TQ D+RKEKSHPGG LFTKF
Sbjct  741   XXXXXXXXXXXXXXXXXXXXXXXXXXLDNLPENIVIIGSHTQMDSRKEKSHPGGLLFTKF  800

Query  2409  GSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLD  2588
             GSNQTALLDLAFPDNFGRLHDRSKETPK +KQLTRLFPNKVMIQ+PQDE+LL DWKQQLD
Sbjct  801   GSNQTALLDLAFPDNFGRLHDRSKETPKTMKQLTRLFPNKVMIQLPQDESLLLDWKQQLD  860

Query  2589  RDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSS  2768
             RD ET+K+Q+N VNIR+VLNR  LDCPD+ETL IKDQ+L ++ V+K++GWALS+HFMH S
Sbjct  861   RDGETLKAQANIVNIRSVLNRNGLDCPDLETLSIKDQSLASDGVDKLVGWALSYHFMHCS  920

Query  2769  ESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDI  2948
             ++S ++ KL ISSESI YGL++LQG+Q+E+KS+KKSLKDVVTENEFEKKLL+DVIPPSDI
Sbjct  921   DASVRDSKLLISSESISYGLNLLQGIQSESKSLKKSLKDVVTENEFEKKLLSDVIPPSDI  980

Query  2949  GVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAV  3128
             GVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAV
Sbjct  981   GVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAV  1040

Query  3129  ATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGE  3308
             ATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGE
Sbjct  1041  ATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGE  1100

Query  3309  HEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR  3488
             HEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NR
Sbjct  1101  HEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDALNR  1160

Query  3489  EKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekala  3668
             EKILR+IL KEELAP+V L+A+ANMT+GYSGSDLKNLCVTAAHCPIREILE+EKKEKALA
Sbjct  1161  EKILRVILAKEELAPDVGLEAVANMTDGYSGSDLKNLCVTAAHCPIREILEREKKEKALA  1220

Query  3669  iSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKK  3848
             ++E+R LPAL+ S+DIRPLN++DFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRK+
Sbjct  1221  LAESRALPALYCSTDIRPLNIEDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKR  1280

Query  3849  KALSYFM  3869
              +LSYFM
Sbjct  1281  ASLSYFM  1287



>ref|XP_007050880.1| ATP binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOX95037.1| ATP binding protein, putative isoform 2 [Theobroma cacao]
Length=1142

 Score =  1618 bits (4191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 830/1161 (71%), Positives = 964/1161 (83%), Gaps = 37/1161 (3%)
 Frame = +3

Query  441   IDVDKVKANGSALN-RGKKRQLK---SNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQ  608
             +DV+K KA G+    R KKR  K   S     WGKLLSQ+ QN H+ +  + FTVGQ RQ
Sbjct  1     MDVEKAKAVGAGFTGRVKKRPTKPAKSGSKVPWGKLLSQHSQNPHLVMCGTLFTVGQSRQ  60

Query  609   CDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDE  788
             C+LC+ DP+VS  LC +KHI+ + G SI LLEISG KG VQVNG+IY K++++ LN GDE
Sbjct  61    CNLCLKDPNVSTVLCKVKHIESD-GTSIALLEISGGKGSVQVNGRIYRKSNSLILNAGDE  119

Query  789   VIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVAST  968
             +IF S+G HAYIFQ+ TN++++A  +P SVSILEA + P+KG+   ARSGDPS VA A+T
Sbjct  120   LIFTSTGNHAYIFQQLTNDNLAAPGIPSSVSILEAQAAPIKGI-IAARSGDPSAVAGAAT  178

Query  969   laslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND---  1139
                              +      K+  +M  LP      D    + DMKD + +ND   
Sbjct  179   -----------------ILASLSTKENSDMSTLPSGCDVSDDRVPEVDMKDSASNNDPAT  221

Query  1140  VPLDEKSGAISPDSGNDNLNLEN-GAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFD  1316
             V   EK+ A  P++ N+N NL+  G  D+ D +  KV GA   LRPL+R+LAG+S+ +FD
Sbjct  222   VSSREKTVAPPPEAANENPNLDRLGLDDTMDADNSKVPGAGYPLRPLLRILAGTSSTDFD  281

Query  1317  LSGNISRIIDQRRE---LLKDFDP-LISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYY  1484
             LSG+I++I+D++RE   +LK+FDP ++ +ST+RQAFKD LQ+ IL+ +NI+VSFE+FPYY
Sbjct  282   LSGSIAKILDEQREFREMLKEFDPPMVLISTKRQAFKDSLQEGILNPDNIDVSFENFPYY  341

Query  1485  LSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFG  1664
             LS+ TKNVLIASTY+HLKCNKF K AS+LPT+ PRILLSGPAGSEIYQETLAKALAK+FG
Sbjct  342   LSDTTKNVLIASTYVHLKCNKFAKYASDLPTMSPRILLSGPAGSEIYQETLAKALAKHFG  401

Query  1665  ARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFN--KKPASSVEAD  1835
             ARLL+VDSL+LPGGS +KE D VKE  + ER  ++ KRAAQA+       K+P SSVEAD
Sbjct  402   ARLLIVDSLLLPGGSTSKEADGVKETSRAERASIYAKRAAQASAAAALQQKRPTSSVEAD  461

Query  1836  ITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPL-PTGFS-LQTPARGPAYGYKG  2006
             ITGGS++SS A  KQE STA+SKN TFK GDRVK+VG   P+G S LQ   RGP  G++G
Sbjct  462   ITGGSSLSSQALPKQEVSTATSKNYTFKKGDRVKFVGATAPSGLSSLQPALRGPTIGFRG  521

Query  2007  KVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAI  2186
             KV+LAFEENG SKIGVRFDRSIPEGNDLGGLCEEDHGFFCAA  LRLD+S  DD+DKLA+
Sbjct  522   KVVLAFEENGSSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAASSLRLDSSGGDDVDKLAV  581

Query  2187  NELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNR  2366
             NELFEV   E K SPLILFVKDIEKSM GN + +SA K K+EKLP NVVVI S+TQ DNR
Sbjct  582   NELFEVALNESKGSPLILFVKDIEKSMAGNTDVYSALKCKVEKLPANVVVIGSHTQMDNR  641

Query  2367  KEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIP  2546
             KEKSHPGG LFTKFG+NQTALLDLAFPDNFGRLHDRSKETPK +KQ+TRLFPNKV IQ+P
Sbjct  642   KEKSHPGGLLFTKFGANQTALLDLAFPDNFGRLHDRSKETPKTMKQVTRLFPNKVTIQLP  701

Query  2547  QDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEK  2726
             QDE LL DWKQQL+RDIET+K+QSN V+IR+VLNR  LDCPD+ETLCIKDQ LTNESVEK
Sbjct  702   QDEALLLDWKQQLERDIETLKAQSNIVSIRSVLNRNGLDCPDLETLCIKDQTLTNESVEK  761

Query  2727  IIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEF  2906
             ++GWALSHHFMHSSE+   + KL +S+ESI+YGL++LQG+Q+E+KS+KKSLKDVVTENEF
Sbjct  762   VVGWALSHHFMHSSEALVNDAKLVVSTESIKYGLNILQGIQSESKSLKKSLKDVVTENEF  821

Query  2907  EKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLF  3086
             EKKLLADVIPPSDIGV+FDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLF
Sbjct  822   EKKLLADVIPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLF  881

Query  3087  GPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVD  3266
             GPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSVVFVD
Sbjct  882   GPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVD  941

Query  3267  EVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRL  3446
             EVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRL
Sbjct  942   EVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRL  1001

Query  3447  PRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPI  3626
             PRRLMVNLPDAPNREKILR+IL KEEL+P+VDL+AIANMT+GYSGSDLKNLCV+AAHCPI
Sbjct  1002  PRRLMVNLPDAPNREKILRVILAKEELSPDVDLEAIANMTDGYSGSDLKNLCVSAAHCPI  1061

Query  3627  ReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELL  3806
             REILEKEKKE+A A++ENRPLP+L++S+DIR L MDDF+YAHEQVCASVSSESTNM+EL 
Sbjct  1062  REILEKEKKERAAAVTENRPLPSLYSSADIRSLKMDDFKYAHEQVCASVSSESTNMSELH  1121

Query  3807  QWNELYGEGGSRKKKALSYFM  3869
             QWNELYGEGGSRKKK LSYFM
Sbjct  1122  QWNELYGEGGSRKKKPLSYFM  1142



>ref|XP_006444294.1| hypothetical protein CICLE_v10018538mg [Citrus clementina]
 gb|ESR57534.1| hypothetical protein CICLE_v10018538mg [Citrus clementina]
Length=1256

 Score =  1616 bits (4185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 840/1239 (68%), Positives = 991/1239 (80%), Gaps = 27/1239 (2%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  386
             KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27    KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  387   APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGTA--WGKLLSQYPQ  554
             A +  + LVSP   G++A+D +K KA G   N R KKR  K   +G+   W +L+SQ  Q
Sbjct  84    ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQ  143

Query  555   NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQV  734
             NSH+ +  + FTVG  RQCDL + DPS+SK+LC L+ I+   G S  LLEI+G KG V+V
Sbjct  144   NSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIE-NGGPSGALLEITGGKGEVEV  202

Query  735   NGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKG  914
             NG ++PK+S V L GGDE++F  SGKH+YIFQ+ +++ ++A  + P +SILEA S P+K 
Sbjct  203   NGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKT  262

Query  915   VNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDK  1094
             ++ EARSGDPS VA AS LASLSN++K+L L+PP      D  Q  E+ +L      P+ 
Sbjct  263   MHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVD-AQNSEIASLASGCDGPED  321

Query  1095  HDLDSDMKDVSDHNDVPLDEKSG-AISP--DSGNDNLNLENGAIDS-YDGEIGKVTGAPQ  1262
                D DMKD + +ND       G  + P  D+ N+N NL++  +D+  D EIGK+ GA  
Sbjct  322   RIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATY  381

Query  1263  ELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFD-PLISMSTRRQAFKDGLQQ  1430
             ELRPL+RMLAGSS+P+FD+SG IS+I+D++RE   LLKD D P + +S RRQAFKD LQ+
Sbjct  382   ELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQE  441

Query  1431  TILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPA  1610
              IL   NIEVSFE FPYYLS+ TKNVLIASTY+HLKCN F K AS+LPT+CPRILLSGPA
Sbjct  442   GILGPENIEVSFESFPYYLSDTTKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPA  501

Query  1611  GSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAAQAA  1790
             GSEIYQETLAKALAK+F ARLL+VDSL+LPGGS+KE D VKE+ + E+  +F KRAA   
Sbjct  502   GSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAA---  558

Query  1791  VLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSL  1967
              L  ++KP SSVEADITGG+A+ S A  K E STASSKN TFK GDRVK+VG + +G ++
Sbjct  559   -LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTV  617

Query  1968  QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRL  2147
             Q   RGP  G++G+V+L FE+N FSKIGVRFDRSIPEGN+LGG CE+DHGFFC A  LRL
Sbjct  618   QPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRL  677

Query  2148  DNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPEN  2327
             D+S  D++DKLAINELFEV   E KSSPLI+FVKDIEKS+ GN +A+ A K KLE LP N
Sbjct  678   DSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSN  737

Query  2328  VVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQL  2507
             VVVI S+TQ D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNF RLHDRSKETPKA+KQ+
Sbjct  738   VVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQI  797

Query  2508  TRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLC  2687
             +RLFPNKV IQ+PQDE LLSDWKQQL+RD+ET+K QSN ++IR+VL+R  LDC D+E+LC
Sbjct  798   SRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLC  857

Query  2688  IKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSV  2867
             IKDQ LT E VEKI+GWALSHHFMH SE+  K+ KL IS+ESI YGL++LQG+Q+E+KS+
Sbjct  858   IKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSL  917

Query  2868  KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  3047
             KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK
Sbjct  918   KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  977

Query  3048  GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFT  3227
             GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+
Sbjct  978   GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS  1037

Query  3228  LASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  3407
             LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN
Sbjct  1038  LASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  1097

Query  3408  RPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSD  3587
             RPFDLDEAV+RRLPRRLMVNLPDAPNREKI+R+IL KEELA +VDL+ IANM +GYSGSD
Sbjct  1098  RPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSD  1157

Query  3588  LKNLCVTAAHCPIR-----eilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAH  3752
             LKNLCVTAAHCPIR     E       E+ALA++ENR  P L++S D+RPL MDDF+YAH
Sbjct  1158  LKNLCVTAAHCPIREILEKEKKSNVTLERALALAENRASPPLYSSVDVRPLKMDDFKYAH  1217

Query  3753  EQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             EQVCASVSSESTNM ELLQWNELYGEGGSRK+K+LSYFM
Sbjct  1218  EQVCASVSSESTNMNELLQWNELYGEGGSRKRKSLSYFM  1256



>ref|XP_008235052.1| PREDICTED: uncharacterized protein LOC103333915 [Prunus mume]
Length=1248

 Score =  1613 bits (4178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 848/1241 (68%), Positives = 994/1241 (80%), Gaps = 31/1241 (2%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTP----GAVNESGPESAEQEIRSAD---LDGASALKSPE  359
             N KRSKA+++ SS+++ +    P    G + ESG +  E E+RS+D    D   A+   +
Sbjct  21    NPKRSKASDA-SSSNNGVRSGPPAEPLGPIKESGSQPPEIELRSSDPPSTDSLKAVNGSD  79

Query  360   APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKK---RQLKSNLGTAWG  530
             A V E+ P+    GE LVSP  LG++A+         + L R KK   +  KSN  +AWG
Sbjct  80    ATVFERSPDVVAEGEALVSPQPLGETAVR--------AGLKRAKKLPKKTTKSNSKSAWG  131

Query  531   KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEIS  710
              L+SQ  +N H+ +  + FTVGQ R C+LC+ DPS+S +LC LKH++RE G+S   LEI+
Sbjct  132   MLISQCSKNPHLFICDTVFTVGQSRDCNLCLKDPSISTTLCKLKHVKRE-GSSAAELEIT  190

Query  711   GKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILE  890
             G KG VQVN KIY K+S V L+GGDEV+F  SGKHAYIFQ+ TN++  AA   P + ILE
Sbjct  191   GGKGDVQVNEKIYQKDSKVVLSGGDEVVFSLSGKHAYIFQQLTNDNNIAAQGIPPIGILE  250

Query  891   AHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllP-PSVCNDNDIKQGPEMPAL  1067
               S PV G++ EARSGDPS V  AS LAS+SN   +L  LP P+   DN ++Q  EMP+L
Sbjct  251   TQSTPVNGIHIEARSGDPSAVDGASILASMSNGPNDLSPLPEPAKAGDN-LQQDAEMPSL  309

Query  1068  PVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKV  1247
             P   G  D H  D +MKD ++ ND    +K     PD+ ++N N+++ A+D  D E GKV
Sbjct  310   PSGCGGSDDHTADIEMKDTTNTNDQVSGDKDIVQYPDTADENPNVDSLALD-MDTETGKV  368

Query  1248  TGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLISMSTRRQAFKD  1418
              G   +LRPL RM  GSS+  FDLSG+IS+I+D++RE   LL DFDP I +STRRQAFK+
Sbjct  369   PGEAYQLRPLFRMFGGSSSTNFDLSGSISKILDEQREIRELLHDFDPPILISTRRQAFKE  428

Query  1419  GLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILL  1598
              LQQ IL+ ++IEVSFE FPYYLS+ TK VLIAS +IHLKC++F K  S L T  PRILL
Sbjct  429   KLQQGILNPDDIEVSFESFPYYLSDTTKIVLIASIHIHLKCSEFAKYTSLLSTASPRILL  488

Query  1599  SGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSA-KELDPVKEAPKPERTGVFTKR  1775
             SGPAGSEIYQETLAKALAK+ GARLL+VDSL+LPG    KE D VKE  +PER  VF KR
Sbjct  489   SGPAGSEIYQETLAKALAKHCGARLLIVDSLLLPGAPVPKEADSVKEVSRPERVSVFAKR  548

Query  1776  AAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLP  1952
             AA AA L+ +KKP SSVEA+ITGGS +SS A  KQE STASS+  TFK GD+VK+VGP+ 
Sbjct  549   AAHAAGLK-HKKPTSSVEAEITGGSTVSSQAPPKQETSTASSRGVTFKQGDKVKFVGPIS  607

Query  1953  TGFSLQT-PARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCA  2129
              G  LQ+ P RGP+YG +GKV+L FE+NG SKIGVRFD+SIP+GNDLGG CEEDHGFFC+
Sbjct  608   AGPPLQSCPLRGPSYGCRGKVVLPFEDNGSSKIGVRFDKSIPDGNDLGGHCEEDHGFFCS  667

Query  2130  AD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLK  2306
             A   L LD S  DD+DKLAI+EL EV S E KS PLILFVK+IEK+MVGN +A++  K K
Sbjct  668   ASHLLHLDVSGGDDIDKLAISELLEVASNESKSLPLILFVKEIEKAMVGNSDAYTVLKSK  727

Query  2307  LEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKET  2486
             LE LPENVVVI S+TQ DNRKEKSHPGG LFTKFG NQTALLDLAFPDN GRLHDRSKET
Sbjct  728   LENLPENVVVIGSHTQLDNRKEKSHPGGLLFTKFGFNQTALLDLAFPDNLGRLHDRSKET  787

Query  2487  PKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDC  2666
             PK +KQLTR+FPNKVMIQ+PQDE LLSDWKQQL+RD+ET+K+QSN ++IR+VLNR+ LDC
Sbjct  788   PKTMKQLTRIFPNKVMIQLPQDEALLSDWKQQLERDVETLKAQSNIISIRSVLNRIRLDC  847

Query  2667  PDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGV  2846
             PD+E LCIKD ALT ESVEK++GWALS+H MH SE+  K+ KL ISSES++YGL++LQG+
Sbjct  848   PDLENLCIKDLALTTESVEKVVGWALSYHSMHCSEAVVKDDKLVISSESLQYGLNILQGI  907

Query  2847  QNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQ  3026
             QNE KS+KKSLKDVVT NEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQ
Sbjct  908   QNENKSIKKSLKDVVTGNEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQ  967

Query  3027  RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK  3206
             RPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK
Sbjct  968   RPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK  1027

Query  3207  YVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERV  3386
             YVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERV
Sbjct  1028  YVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERV  1087

Query  3387  LVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMT  3566
             LVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KE+  P+VDL+A+ANMT
Sbjct  1088  LVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEDFEPDVDLEAVANMT  1147

Query  3567  EGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRY  3746
             +GYSGSDLKNLCVTAAH PIREILE+EKKE++LA+ ENRP P L+ SSDIRPL M+DF++
Sbjct  1148  DGYSGSDLKNLCVTAAHRPIREILEREKKERSLAVVENRPQPELYCSSDIRPLKMEDFKH  1207

Query  3747  AHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             AHEQVCASVSSESTNM+ELLQWN+LYGEGGSRKKK+LSYFM
Sbjct  1208  AHEQVCASVSSESTNMSELLQWNDLYGEGGSRKKKSLSYFM  1248



>gb|KDO87279.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1211

 Score =  1612 bits (4175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 838/1212 (69%), Positives = 987/1212 (81%), Gaps = 22/1212 (2%)
 Frame = +3

Query  273   AVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVD  452
             A ++SG ES E E+RS+DLD     K  +    +K  +A +  + LVSP   G++A+D +
Sbjct  9     AASKSGSESREPELRSSDLDLTDDAKPADV---DKSVDADVEADALVSPPTPGETAVDAE  65

Query  453   KVKANGSALN-RGKKRQLK-SNLGTA--WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLC  620
             K KA G   N R KKR  K   +G+   W +L+SQ  QNSH+ +  + FTVG  RQCDL 
Sbjct  66    KSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQNSHLSMTGAVFTVGHNRQCDLY  125

Query  621   VDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFG  800
             + DPS+SK+LC L+ I+   G S  LLEI+G KG V+VNG ++PK+S V L GGDE++F 
Sbjct  126   LKDPSISKNLCRLRRIEN-GGPSGALLEITGGKGEVEVNGNVHPKDSQVVLRGGDELVFS  184

Query  801   SSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlasl  980
              SGKH+YIFQ+ +++ ++A  + P +SILEA S P+K ++ EARSGDPS VA AS LASL
Sbjct  185   PSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEARSGDPSAVAGASILASL  244

Query  981   snlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKS  1160
             SN++K+L L+PP      D  Q  E+ +L      P+    D DMKD + +ND       
Sbjct  245   SNIQKDLSLIPPPTKAGVD-AQNSEIASLASGCDGPEDRIPDVDMKDATSNNDDAGSSSR  303

Query  1161  G-AISP--DSGNDNLNLENGAIDS-YDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGN  1328
             G  + P  D+ N+N NL++  +D+  D EIGK+ GA  ELRPL+RMLAGSS+P+FD+SG 
Sbjct  304   GKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATYELRPLLRMLAGSSSPDFDISGG  363

Query  1329  ISRIIDQRRE---LLKDFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEI  1496
             IS+I+D++RE   LLKD D P + +S RRQAFKD LQ+ IL   NIEVSFE FPYYLS+I
Sbjct  364   ISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQEGILGPENIEVSFESFPYYLSDI  423

Query  1497  TKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLL  1676
             TKNVLIASTY+HLKCN F K AS+LPT+CPRILLSGPAGSEIYQETLAKALAK+F ARLL
Sbjct  424   TKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQETLAKALAKHFSARLL  483

Query  1677  VVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAI  1856
             +VDSL+LPGGS+KE D VKE+ + E+  +F KRAA    L  ++KP SSVEADITGG+A+
Sbjct  484   IVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAA----LLQHRKPTSSVEADITGGTAV  539

Query  1857  SSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSLQTPARGPAYGYKGKVLLAFEEN  2033
              S A  K E STASSKN TFK GDRVK+VG + +G ++Q   RGP  G++G+V+L FE+N
Sbjct  540   GSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDN  599

Query  2034  GFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQ  2213
              FSKIGVRFDRSIPEGN+LGG CE+DHGFFC A  LRLD+S  D++DKLAINELFEV   
Sbjct  600   DFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEVDKLAINELFEVALN  659

Query  2214  ECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGF  2393
             E KSSPLI+FVKDIEKS+ GN +A+ A K KLE LP NVVVI S+TQ D+RKEKSHPGG 
Sbjct  660   ESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIGSHTQLDSRKEKSHPGGL  719

Query  2394  LFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDW  2573
             LFTKFGSNQTALLDLAFPDNF RLHDRSKETPKA+KQ++RLFPNKV IQ+PQDE LLSDW
Sbjct  720   LFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKVTIQLPQDEALLSDW  779

Query  2574  KQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHH  2753
             KQQL+RD+ET+K QSN ++IR+VL+R  LDC D+E+LCIKDQ LT E VEKI+GWALSHH
Sbjct  780   KQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHH  839

Query  2754  FMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVI  2933
             FMH SE+  K+ KL IS+ESI YGL++LQG+Q+E+KS+KKSLKDVVTENEFEKKLLADVI
Sbjct  840   FMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSLKKSLKDVVTENEFEKKLLADVI  899

Query  2934  PPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTM  3113
             PPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTM
Sbjct  900   PPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTM  959

Query  3114  LAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRR  3293
             LAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRR
Sbjct  960   LAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRR  1019

Query  3294  ESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLP  3473
             E+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAV+RRLPRRLMVNLP
Sbjct  1020  ENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVVRRLPRRLMVNLP  1079

Query  3474  DAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekk  3653
             DAPNREKI+R+IL KEELA +VDL+ IANM +GYSGSDLKNLCVTAAHCPIREILEKEKK
Sbjct  1080  DAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSDLKNLCVTAAHCPIREILEKEKK  1139

Query  3654  ekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEG  3833
             E+ALA++ENR  P L++S D+RPL MDDF+YAHEQVCASVSSESTNM ELLQWNELYGEG
Sbjct  1140  ERALALAENRASPPLYSSVDVRPLKMDDFKYAHEQVCASVSSESTNMNELLQWNELYGEG  1199

Query  3834  GSRKKKALSYFM  3869
             GSRK+K+LSYFM
Sbjct  1200  GSRKRKSLSYFM  1211



>ref|XP_007143843.1| hypothetical protein PHAVU_007G106400g [Phaseolus vulgaris]
 gb|ESW15837.1| hypothetical protein PHAVU_007G106400g [Phaseolus vulgaris]
Length=1255

 Score =  1607 bits (4162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 858/1247 (69%), Positives = 996/1247 (80%), Gaps = 39/1247 (3%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTPGAVNESGP--ESAEQEIRSADLDGASALKSPE---AP  365
             N KRSK +E  SST       +   VNESGP  ESAE E+R +DL   ++LK+ +   A 
Sbjct  24    NTKRSKVSEDSSSTT----VPSVAPVNESGPANESAEPELRPSDLPDTTSLKAVDGCDAI  79

Query  366   VPEKLPEAPLGGEPLVSPMILGDSA---IDVDKVKANGSALNRGKKRQLKSNLGTAWGKL  536
              P+K P  P+ GE LVSP  LG++A        V A  S   R KKR +K +   AW KL
Sbjct  80    SPDKSPSTPVEGEALVSPQCLGETAEKSKGAGAVAATVSTGGRSKKRPMKLSPKVAWAKL  139

Query  537   LSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGK  716
             LSQ  QN HV +   +FTVGQGR C+L + DP+V   LC L HI+R  G+S+ LLEI+G 
Sbjct  140   LSQCSQNPHVSISDLSFTVGQGRNCNLWLKDPTVGNMLCKLSHIER-GGSSVALLEITGG  198

Query  717   KGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAH  896
             KG +QVNG+ + KN+ + L+GGDEV+FGSSGKHAYIFQ+ TN +IS A +P SVSILEA 
Sbjct  199   KGSIQVNGRTHRKNTRLILSGGDEVVFGSSGKHAYIFQQLTNNNISPAGIPSSVSILEAQ  258

Query  897   SGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVA  1076
             S P+ G   EARSGDPS VA AS LASLSNL K+L LL     N  +++Q  ++ +LP  
Sbjct  259   SAPINGAQVEARSGDPSAVAGASILASLSNLHKDLSLLSSPTKNGKNVQQNTDISSLPSG  318

Query  1077  SGEPDKHDL-DSDMKDVSDHNDVP-----LDEKSGAISPDSGNDNLNLENGAIDS-YDGE  1235
             +G+    D+ DS+MKD ++  DVP       EKS   S ++ N+N +L+   ID+  D +
Sbjct  319   NGD----DVPDSEMKDATNK-DVPSSGVFTAEKSVLASSNTVNENPSLDTTEIDTTVDAD  373

Query  1236  IGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELL---KDFD-PLISMSTRR  1403
             +GKVT A  ELRPL+RMLAGS  PE D+S  I++I+++RREL    KD D P I  STRR
Sbjct  374   VGKVTAATYELRPLLRMLAGS-CPELDISCGITKILEERRELRELLKDVDTPSILASTRR  432

Query  1404  QAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVC  1583
             QAFKD LQQ IL S +I+VSFE FPYYLS+ TKNVLIASTYIHLKCN F K AS+LP+V 
Sbjct  433   QAFKDSLQQRILKSEDIDVSFETFPYYLSDTTKNVLIASTYIHLKCNGFGKYASDLPSVS  492

Query  1584  PRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTG  1760
             PRILLSGPAGSEIYQETL KALAK+FGARLL+VDSL LPGG+ AKE+D  KE+ +PER  
Sbjct  493   PRILLSGPAGSEIYQETLCKALAKHFGARLLIVDSLSLPGGAPAKEVDSAKESSRPERPS  552

Query  1761  VFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK-NTFKTGDRVKY  1937
             VF KR++Q A L  NKKPASSV+A+I GGS +SS A  KQE STASSK  T K GDRVK+
Sbjct  553   VFAKRSSQTATLH-NKKPASSVDAEIIGGSTLSSQAMLKQEVSTASSKGTTLKEGDRVKF  611

Query  1938  VGPLPTGFSL--QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEED  2111
             VG  P+  S     P+RGP+YG +GKV+LAFE+NG SKIGVRFD+SIP+GNDLGGLCE+D
Sbjct  612   VGNFPSAVSALPNYPSRGPSYGSRGKVMLAFEDNGSSKIGVRFDKSIPDGNDLGGLCEDD  671

Query  2112  HGFFCAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAF  2288
              GFFC+A+  LR+D S  DD DK+AIN++FEV S + KS PL+LF+KDIEK++VGN   +
Sbjct  672   RGFFCSANHLLRVDVSGGDDSDKVAINDIFEVTSNQIKSGPLLLFIKDIEKTLVGN---Y  728

Query  2289  SAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLH  2468
                K K E LP NVVVI S+T  DNRKEK+ PGG LFTKFGSNQTALLDLAFPDNF RLH
Sbjct  729   EVLKNKFESLPPNVVVIGSHTMLDNRKEKTQPGGLLFTKFGSNQTALLDLAFPDNFSRLH  788

Query  2469  DRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLN  2648
             DRSKETPK +KQL RLFPNKV IQ+PQDE LLSDWK+QL+RDIETMK+QSN V +R VLN
Sbjct  789   DRSKETPKVMKQLGRLFPNKVTIQLPQDEGLLSDWKKQLERDIETMKAQSNIVGVRTVLN  848

Query  2649  RVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGL  2828
             R+ LDCPD+ETLCIKDQ L  ESVEKIIGWA+S+HFMHSSE+S K+ KL IS+ESI YGL
Sbjct  849   RIGLDCPDLETLCIKDQTLATESVEKIIGWAISYHFMHSSEASAKDSKLVISAESINYGL  908

Query  2829  SVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKEL  3008
             ++L G+QNE KS+KKSLKDVVTENEFEKKLLADVIPP+DIGVTFDDIGALENVKDTLKEL
Sbjct  909   NILHGIQNENKSLKKSLKDVVTENEFEKKLLADVIPPTDIGVTFDDIGALENVKDTLKEL  968

Query  3009  VMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKW  3188
             VMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKW
Sbjct  969   VMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKW  1028

Query  3189  FGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRT  3368
             FGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+P EHEAMRKMKNEFMVNWDGLRT
Sbjct  1029  FGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPSEHEAMRKMKNEFMVNWDGLRT  1088

Query  3369  KDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLD  3548
             KDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KE+LA +VD +
Sbjct  1089  KDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEDLALDVDFE  1148

Query  3549  AIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLN  3728
             A++NMT+GYSGSDLK LCVTAAHCP+REIL+KEKKEK +A+SEN+PLP L  SSDIRPL 
Sbjct  1149  AMSNMTDGYSGSDLKTLCVTAAHCPLREILKKEKKEKTIALSENKPLPGLCGSSDIRPLR  1208

Query  3729  MDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             MDDFRYAHEQVCASVSSESTNM ELLQWN+LYGEGGSRK ++LSYFM
Sbjct  1209  MDDFRYAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKMRSLSYFM  1255



>ref|XP_008451595.1| PREDICTED: uncharacterized protein LOC103492829 isoform X1 [Cucumis 
melo]
Length=1271

 Score =  1586 bits (4107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 850/1252 (68%), Positives = 1002/1252 (80%), Gaps = 41/1252 (3%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGA-----VNESGPESAEQEIRSADLDGASALKSP---EA  362
             KRSK  E+ SST+D+  +  P       V ESG E  +  I+SAD     +LK     + 
Sbjct  30    KRSKVVEASSSTEDV--QSAPPVEPLIPVGESGVEPVDPVIQSADPFDTDSLKVNNVCDE  87

Query  363   PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKAN-GSALNRGKKRQL---KSNLGTAWG  530
              VPE   +    G+ ++ P  LGD A D +K KA   S LNR KKR +   KSN   AWG
Sbjct  88    AVPENSHDLQAEGQAIMPPQPLGDVAADAEKSKAVVASMLNRTKKRTMRMPKSNSKPAWG  147

Query  531   KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNS-ITLLEI  707
             KLLSQ  QN H+ +  + FTVGQ RQC+L + DPSVS +LC L+HI+R  GNS + LLEI
Sbjct  148   KLLSQCSQNPHLFICGTLFTVGQSRQCNLWLKDPSVSTTLCKLRHIKR--GNSSVALLEI  205

Query  708   SGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSIL  887
             +G KG V VNGKI  KNS+V LNGGDEV+F SSGKHAYIFQ+ T++D + + +  SV+IL
Sbjct  206   TGGKGAVIVNGKIVQKNSSVILNGGDEVVFTSSGKHAYIFQQLTSDDFAVSGLS-SVNIL  264

Query  888   EAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPAL  1067
             EAH  PVKG++FE RS D S V  AS LAS SN++K+L LL P    + D+    E+P+ 
Sbjct  265   EAHCAPVKGIHFERRSRDASAVTGASILASFSNIQKDLPLLSPPAKTNEDV----ELPSG  320

Query  1068  PVASGE--PDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAID-SYDGEI  1238
                SGE  PD +  D    +   H D  +D+    I PDSG +  +L++ A+D S DGE+
Sbjct  321   CGVSGEQSPDSNLKDGSNNNTDRHGDASMDKNIDPI-PDSGTERPSLDSLALDASIDGEV  379

Query  1239  GKVTGAPQELRPLIRMLAGSSTPEFDLSG-NISRIIDQRRE---LLKDFDP-LISMSTRR  1403
             G+      ELRPL+++LA S++P+F+++G +IS+I+D++R+   L KDF P  + MSTRR
Sbjct  380   GEAPAKHSELRPLLQILASSASPDFNINGGSISKILDEQRDMGNLFKDFSPPAMLMSTRR  439

Query  1404  QAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVC  1583
             QAF++ LQQ IL  +NI+VS E FPYYLS+ TKNVLIAS ++HLKCNKFVK AS+LP + 
Sbjct  440   QAFRERLQQGILKPDNIDVSLESFPYYLSDTTKNVLIASMFVHLKCNKFVKHASDLPILS  499

Query  1584  PRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTG  1760
             PRILLSGPAGSEIYQETL KALA++FGARLL+VDSL+LPGG + K++D VK++ +P+RT 
Sbjct  500   PRILLSGPAGSEIYQETLTKALARHFGARLLIVDSLLLPGGPTPKDVDIVKDSSRPDRTS  559

Query  1761  VFTKRAAQAAV----LRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKNT-FKTGD  1925
              F KRA QAA     +  NKKP SSVEADI GGS +SS A  KQEASTASSK T FKTGD
Sbjct  560   FFAKRAVQAAAAAAAVSQNKKPTSSVEADIAGGSTLSSQALPKQEASTASSKTTAFKTGD  619

Query  1926  RVKYVGPLPTGFS--LQT-PARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGG  2096
             +VK+VG L +  S  LQT P RGP+YG +GKV+LAFEENG SKIGVRFD+SIP+GNDLGG
Sbjct  620   KVKFVGTLSSTLSPPLQTCPLRGPSYGCRGKVVLAFEENGSSKIGVRFDKSIPDGNDLGG  679

Query  2097  LCEEDHGFFCAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVG  2273
             LCEEDHGFFC+A+  LRLD    DD DKLAI+E+FEVVS E KSSPLILFVKDIEK+MVG
Sbjct  680   LCEEDHGFFCSANHLLRLDGPGGDDTDKLAIDEVFEVVSNESKSSPLILFVKDIEKAMVG  739

Query  2274  NPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDN  2453
             + +A+S  K +LE LP NVVVI S+T  DNRKEKSHPGG LFTKFGSNQTALLDLAFPDN
Sbjct  740   HSDAYSILKGRLENLPGNVVVIGSHTHMDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDN  799

Query  2454  FGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNI  2633
             FGRLHDR+KETPKA KQL+RLFPNKV I  PQDE LLS WKQQL+RD ET+K+Q+N V+I
Sbjct  800   FGRLHDRNKETPKATKQLSRLFPNKVTILPPQDEALLSVWKQQLERDTETLKTQANIVSI  859

Query  2634  RNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSES  2813
             R VLNR+ LDC +++ LCIKDQALT E+VEK++GWALSHHFMH S+   K+ KL IS+ES
Sbjct  860   RLVLNRIGLDCSNLDALCIKDQALTIETVEKVVGWALSHHFMHFSDVLVKDAKLIISTES  919

Query  2814  IRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKD  2993
             I YGL++L G+Q+E KS+KKSL+DVVTENEFEKKLLADVIPP DIGVTF+DIGALENVKD
Sbjct  920   IEYGLNILHGLQSENKSLKKSLRDVVTENEFEKKLLADVIPPGDIGVTFEDIGALENVKD  979

Query  2994  TLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSS  3173
             TLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSS
Sbjct  980   TLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSS  1039

Query  3174  ITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNW  3353
             ITSKWFGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNW
Sbjct  1040  ITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNW  1099

Query  3354  DGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAP  3533
             DGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KEELA 
Sbjct  1100  DGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEELAA  1159

Query  3534  NVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSD  3713
             ++DL+AIANMT+GYSGSDLKNLCVTAAHCPIREIL+KEKKE+  A+++N+PLPAL++S+D
Sbjct  1160  DIDLEAIANMTDGYSGSDLKNLCVTAAHCPIREILDKEKKERVSALTDNKPLPALYSSTD  1219

Query  3714  IRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             +R L MDDFR+AHEQVCASVSSESTNM ELLQWNELYGEGGSRKK +LSYFM
Sbjct  1220  VRSLKMDDFRFAHEQVCASVSSESTNMNELLQWNELYGEGGSRKKMSLSYFM  1271



>ref|XP_006575111.1| PREDICTED: uncharacterized protein LOC100801477 [Glycine max]
Length=1243

 Score =  1586 bits (4107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 869/1264 (69%), Positives = 1006/1264 (80%), Gaps = 39/1264 (3%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGP--ESAE  305
             MVETRRSSSSS +   S  SP  N KRSK +E  SST       +   VNESG   ESAE
Sbjct  1     MVETRRSSSSSSKRSLSSPSPPNNTKRSKVSEDSSSTT----VPSVAPVNESGTANESAE  56

Query  306   QEIRSADLDGASALKSPE---APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSA  476
              E+R +DL   ++LK+ +   A  P++ P AP+ GE LVSP   GD+A  +  V    +A
Sbjct  57    PELRPSDLPDTASLKAVDGCDAMSPDRSPSAPVEGEALVSPQCQGDTAEKLKGVPM-AAA  115

Query  477   LNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCN  656
               R KKR  K +   AWGKLLSQ  QN HV +    FTVGQGR C+L + DP+V   LC 
Sbjct  116   GGRSKKRPSKLSPKVAWGKLLSQCSQNPHVSMSDLIFTVGQGRNCNLWLKDPTVGNVLCK  175

Query  657   LKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKF  836
             L HI+R  G+S+ LLEI+G KG +QVNGK Y KN+ + L+GGDEV+FGSSGKHAYIFQ+ 
Sbjct  176   LSHIER-GGSSVALLEITGGKGSIQVNGKTYRKNARLILSGGDEVVFGSSGKHAYIFQQL  234

Query  837   TNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPP  1016
             TN +I+ A +P SVSILEA S P+ G   EARSGDPS VA AS LASLSNL K+L LL P
Sbjct  235   TNNNINPADIPSSVSILEAQSAPINGTQVEARSGDPSAVAGASILASLSNLPKDLSLLSP  294

Query  1017  SVCNDNDIKQGPEMPALPVASGEPDKHDL-DSDMKDVSDHNDVPLDEKSGAISPD-SGND  1190
                   +++Q  ++ +LP  +G+    D+ DS+MKD +  NDV     S   S D + N 
Sbjct  295   PAKTGKNVQQNADISSLPSGNGD----DMPDSEMKDAT--NDV----ASEVFSADKTVNK  344

Query  1191  NLNLENGAID-SYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELL-  1364
             N NL+   ++ + D ++GKVT A  ELRPL+RMLAGS  PE DLS  I++I+++RREL  
Sbjct  345   NPNLDTAEVNINVDPDVGKVTAATYELRPLLRMLAGS-CPEVDLSCGITKILEERRELRE  403

Query  1365  --KDFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHL  1535
               KD D P I  STRRQAFKD LQQ IL S NI+VSFE FPYYLS+ TKNVLIAST+IHL
Sbjct  404   LLKDVDTPTILASTRRQAFKDSLQQRILKSENIDVSFETFPYYLSDTTKNVLIASTFIHL  463

Query  1536  KCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SA  1712
             KC  F K AS+LP+V PRILLSGP GSEIYQETL KALAK+FGARLL+VDSL LPGG S+
Sbjct  464   KCIGFGKYASDLPSVSPRILLSGPPGSEIYQETLCKALAKHFGARLLIVDSLSLPGGASS  523

Query  1713  KELDPVKEAPKPER-TGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEAS  1889
             KE+D  KE+ +PER + V  KR++Q   L+ +KKPASSV+A+I GGS +SS A  KQE S
Sbjct  524   KEVDSAKESSRPERPSSVCAKRSSQTTTLQ-HKKPASSVDAEIVGGSTLSSQAMLKQEVS  582

Query  1890  TASSK-NTFKTGDRVKYVGPLPTGFSL--QTPARGPAYGYKGKVLLAFEENGFSKIGVRF  2060
             TASSK  T K GDRVK+VG  P+  S     P+RGP+YG +GKVLLAFE+N  SKIGVRF
Sbjct  583   TASSKGTTLKEGDRVKFVGNFPSAVSSLPNYPSRGPSYGSRGKVLLAFEDNRSSKIGVRF  642

Query  2061  DRSIPEGNDLGGLCEEDHGFFCAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLI  2237
             D+SIP+GNDLGGLCE+D GFFC+A+  LR+D S  DD DK+AIN++FEV S + KS  L+
Sbjct  643   DKSIPDGNDLGGLCEDDRGFFCSANHLLRVDGSGGDDADKVAINDIFEVTSNQSKSGSLV  702

Query  2238  LFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSN  2417
             LF+KDIEK+MVGN   +   K K E LP NVVVI S+T  DNRKEK+ PGG LFTKFGSN
Sbjct  703   LFIKDIEKAMVGN---YEVLKNKFESLPPNVVVIGSHTLLDNRKEKTQPGGLLFTKFGSN  759

Query  2418  QTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDI  2597
             QTALLDLAFPDNFGRLHDRSKETPK +KQL RLFPNKV IQ+PQDE LLSDWKQQL+RDI
Sbjct  760   QTALLDLAFPDNFGRLHDRSKETPKVMKQLGRLFPNKVTIQLPQDEALLSDWKQQLERDI  819

Query  2598  ETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESS  2777
             ETMK+QSN V++  VLNR+ LDCPD+ETLCI DQ LT ESVEKIIGWA+S+HFMHSSE+S
Sbjct  820   ETMKAQSNIVSVCTVLNRIGLDCPDLETLCINDQTLTTESVEKIIGWAISYHFMHSSEAS  879

Query  2778  TKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVT  2957
              K+ KL IS++SI YGL++LQG+QNE K++KKSLKDVVTENEFEKKLLADVIPP+DIGVT
Sbjct  880   IKDSKLVISAKSINYGLNILQGIQNENKNLKKSLKDVVTENEFEKKLLADVIPPTDIGVT  939

Query  2958  FDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATE  3137
             FDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATE
Sbjct  940   FDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATE  999

Query  3138  AGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEA  3317
             AGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+P EHEA
Sbjct  1000  AGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPSEHEA  1059

Query  3318  MRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKI  3497
             MRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKI
Sbjct  1060  MRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKI  1119

Query  3498  LRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSE  3677
             L +IL KE+LAP++D +AIANMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE++LA+SE
Sbjct  1120  LSVILAKEDLAPDIDFEAIANMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERSLALSE  1179

Query  3678  NRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKAL  3857
             N+PLP L +S DIRPL MDDFRYAHEQVCASVSSESTNM ELLQWN+LYGEGGSRK ++L
Sbjct  1180  NKPLPGLCSSGDIRPLKMDDFRYAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKMRSL  1239

Query  3858  SYFM  3869
             SYFM
Sbjct  1240  SYFM  1243



>gb|KHN46575.1| ATPase family AAA domain-containing protein 1 [Glycine soja]
Length=1237

 Score =  1584 bits (4102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 869/1261 (69%), Positives = 1004/1261 (80%), Gaps = 39/1261 (3%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGP--ESAE  305
             MVETRRSSSSS +   S  SP  N KRSK +E  SST       +   VNESG   ESAE
Sbjct  1     MVETRRSSSSSSKRSLSSPSPPNNTKRSKVSEDSSSTT----VPSVAPVNESGTANESAE  56

Query  306   QEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNR  485
              E+R +DL   ++LK  +A  P++ P AP+ GE LVSP   GD+A  +  V    +A  R
Sbjct  57    PELRPSDLPDTASLK--DAMSPDRSPSAPVEGEALVSPQCQGDTAEKLKGVPM--AAGGR  112

Query  486   GKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKH  665
              KKR  K +   AWGKLLSQ  QN HV +    FTVGQGR C+L + DP+V   LC L H
Sbjct  113   SKKRPSKLSPKVAWGKLLSQCSQNPHVSMSDLIFTVGQGRNCNLWLKDPTVGNVLCKLSH  172

Query  666   IQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNE  845
             I+R  G S+ LLEI+G KG +QVNGK Y KN+ + L+GGDEV+FGSSGKHAYIFQ+ TN 
Sbjct  173   IER-GGLSVALLEITGGKGSIQVNGKTYRKNARLILSGGDEVVFGSSGKHAYIFQQLTNN  231

Query  846   DISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVC  1025
             +I+ A +P SVSILEA S P+ G   EARSGDPS VA AS LASLSNL K+L LL P   
Sbjct  232   NINPADIPSSVSILEAQSAPINGTQVEARSGDPSAVAGASILASLSNLPKDLSLLSPPAK  291

Query  1026  NDNDIKQGPEMPALPVASGEPDKHDL-DSDMKDVSDHNDVPLDEKSGAISPD-SGNDNLN  1199
                +++Q  ++ +LP  +G+    D+ DS+MKD +  NDV     S   S D + N N N
Sbjct  292   TGKNVQQNADISSLPSGNGD----DMPDSEMKDAT--NDV----ASEVFSADKTVNKNPN  341

Query  1200  LENGAID-SYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELL---K  1367
             L+   ++ + D ++GKVT A  ELRPL+RMLAGS  PE DLS  I++I+++RREL    K
Sbjct  342   LDTAEVNINVDPDVGKVTAATYELRPLLRMLAGS-CPEVDLSCGITKILEERRELRELLK  400

Query  1368  DFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCN  1544
             D D P I  STRRQAFKD LQQ IL S NI+VSFE FPYYLS+ TKNVLIAST+IHLKC 
Sbjct  401   DVDTPTILASTRRQAFKDSLQQRILKSENIDVSFETFPYYLSDTTKNVLIASTFIHLKCI  460

Query  1545  KFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKEL  1721
              F K AS+LP+V PRILLSGP GSEIYQETL KALAK+FGARLL+VDSL LPGG S+KE+
Sbjct  461   GFGKYASDLPSVSPRILLSGPPGSEIYQETLCKALAKHFGARLLIVDSLSLPGGASSKEV  520

Query  1722  DPVKEAPKPER-TGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTAS  1898
             D  KE+ +PER + V  KR++Q   L+ +KKPASSV+A+I GGS +SS A  KQE STAS
Sbjct  521   DSAKESSRPERPSSVCAKRSSQTTTLQ-HKKPASSVDAEIVGGSTLSSQAMLKQEVSTAS  579

Query  1899  SK-NTFKTGDRVKYVGPLPTGFSL--QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRS  2069
             SK  T K GDRVK+VG  P+  S     P+RGP+YG +GKVLLAFE+N  SKIGVRFD+S
Sbjct  580   SKGTTLKEGDRVKFVGNFPSAVSSLPNYPSRGPSYGSRGKVLLAFEDNRSSKIGVRFDKS  639

Query  2070  IPEGNDLGGLCEEDHGFFCAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFV  2246
             IP+GNDLGGLCE+D GFFC+A+  LR+D S  DD DK+AIN++FEV S + KS  L+LF+
Sbjct  640   IPDGNDLGGLCEDDRGFFCSANHLLRVDGSGGDDADKVAINDIFEVTSNQSKSGSLVLFI  699

Query  2247  KDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTA  2426
             KDIEK+MVGN   +   K K E LP NVVVI S+T  DNRKEK+ PGG LFTKFGSNQTA
Sbjct  700   KDIEKAMVGN---YEVLKNKFESLPPNVVVIGSHTLLDNRKEKTQPGGLLFTKFGSNQTA  756

Query  2427  LLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETM  2606
             LLDLAFPDNFGRLHDRSKETPK +KQL RLFPNKV IQ+PQDE LLSDWKQQL+RDIETM
Sbjct  757   LLDLAFPDNFGRLHDRSKETPKVMKQLGRLFPNKVTIQLPQDEALLSDWKQQLERDIETM  816

Query  2607  KSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKE  2786
             K+QSN V++  VLNR+ LDCPD+ETLCI DQ LT ESVEKIIGWA+S+HFMHSSE+S K+
Sbjct  817   KAQSNIVSVCTVLNRIGLDCPDLETLCINDQTLTTESVEKIIGWAISYHFMHSSEASIKD  876

Query  2787  GKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDD  2966
              KL IS++SI YGL++LQG+QNE K++KKSLKDVVTENEFEKKLLADVIPP+DIGVTFDD
Sbjct  877   SKLVISAKSINYGLNILQGIQNENKNLKKSLKDVVTENEFEKKLLADVIPPTDIGVTFDD  936

Query  2967  IGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGA  3146
             IGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGA
Sbjct  937   IGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGA  996

Query  3147  NFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRK  3326
             NFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+P EHEAMRK
Sbjct  997   NFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPSEHEAMRK  1056

Query  3327  MKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRI  3506
             MKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKIL +
Sbjct  1057  MKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILSV  1116

Query  3507  ILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRP  3686
             IL KE+LAP++D +AIANMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE++LA+SEN+P
Sbjct  1117  ILAKEDLAPDIDFEAIANMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERSLALSENKP  1176

Query  3687  LPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYF  3866
             LP L +S DIRPL MDDFRYAHEQVCASVSSESTNM ELLQWN+LYGEGGSRK ++LSYF
Sbjct  1177  LPGLCSSGDIRPLKMDDFRYAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKMRSLSYF  1236

Query  3867  M  3869
             M
Sbjct  1237  M  1237



>gb|KDO87275.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1222

 Score =  1584 bits (4102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 833/1234 (68%), Positives = 979/1234 (79%), Gaps = 51/1234 (4%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  386
             KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27    KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  387   APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGT--AWGKLLSQYPQ  554
             A +  + LVSP   G++A+D +K KA G   N R KKR  K   +G+   W +L+SQ  Q
Sbjct  84    ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQ  143

Query  555   NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQV  734
             NSH+ +  + FTVG  RQCDL + DPS+SK+LC L+ I+   G S  LLEI+G KG V+V
Sbjct  144   NSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIE-NGGPSGALLEITGGKGEVEV  202

Query  735   NGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKG  914
             NG ++PK+S V L GGDE++F  SGKH+YIFQ+ +++ ++A  + P +SILEA S P+K 
Sbjct  203   NGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKT  262

Query  915   VNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDK  1094
             ++ EARSGDPS VA AS LASLSN++K+L L+PP      D  Q  E+ +L      P+ 
Sbjct  263   MHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVD-AQNSEIASLASGCDGPED  321

Query  1095  HDLDSDMKDVSDHNDVPLDEKSG-AISP--DSGNDNLNLENGAIDS-YDGEIGKVTGAPQ  1262
                D DMKD + +ND       G  + P  D+ N+N NL++  +D+  D EIGK+ GA  
Sbjct  322   RIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATY  381

Query  1263  ELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFD-PLISMSTRRQAFKDGLQQ  1430
             ELRPL+RMLAGSS+P+FD+SG IS+I+D++RE   LLKD D P + +S RRQAFKD LQ+
Sbjct  382   ELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQE  441

Query  1431  TILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPA  1610
              IL   NIEVSFE FPYYLS+ITKNVLIASTY+HLKCN F K AS+LPT+CPRILLSGPA
Sbjct  442   GILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPA  501

Query  1611  GSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAAQAA  1790
             GSEIYQETLAKALAK+F ARLL+VDSL+LPG                             
Sbjct  502   GSEIYQETLAKALAKHFSARLLIVDSLLLPG-----------------------------  532

Query  1791  VLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSL  1967
                 ++KP SSVEADITGG+A+ S A  K E STASSKN TFK GDRVK+VG + +G ++
Sbjct  533   ----HRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTV  588

Query  1968  QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRL  2147
             Q   RGP  G++G+V+L FE+N FSKIGVRFDRSIPEGN+LGG CE+DHGFFC A  LRL
Sbjct  589   QPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRL  648

Query  2148  DNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPEN  2327
             D+S  D++DKLAINELFEV   E KSSPLI+FVKDIEKS+ GN +A+ A K KLE LP N
Sbjct  649   DSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSN  708

Query  2328  VVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQL  2507
             VVVI S+TQ D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNF RLHDRSKETPKA+KQ+
Sbjct  709   VVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQI  768

Query  2508  TRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLC  2687
             +RLFPNKV IQ+PQDE LLSDWKQQL+RD+ET+K QSN ++IR+VL+R  LDC D+E+LC
Sbjct  769   SRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLC  828

Query  2688  IKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSV  2867
             IKDQ LT E VEKI+GWALSHHFMH SE+  K+ KL IS+ESI YGL++LQG+Q+E+KS+
Sbjct  829   IKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSL  888

Query  2868  KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  3047
             KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK
Sbjct  889   KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  948

Query  3048  GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFT  3227
             GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+
Sbjct  949   GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS  1008

Query  3228  LASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  3407
             LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN
Sbjct  1009  LASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  1068

Query  3408  RPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSD  3587
             RPFDLDEAV+RRLPRRLMVNLPDAPNREKI+R+IL KEELA +VDL+ IANM +GYSGSD
Sbjct  1069  RPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSD  1128

Query  3588  LKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCA  3767
             LKNLCVTAAHCPIREILEKEKKE+ALA++ENR  P L++S D+RPL MDDF+YAHEQVCA
Sbjct  1129  LKNLCVTAAHCPIREILEKEKKERALALAENRASPPLYSSVDVRPLKMDDFKYAHEQVCA  1188

Query  3768  SVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             SVSSESTNM ELLQWNELYGEGGSRK+K+LSYFM
Sbjct  1189  SVSSESTNMNELLQWNELYGEGGSRKRKSLSYFM  1222



>gb|KHG01617.1| ATPase family AAA domain-containing protein 1 [Gossypium arboreum]
 gb|KHG08860.1| ATPase family AAA domain-containing protein 1 [Gossypium arboreum]
Length=1244

 Score =  1577 bits (4083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 822/1244 (66%), Positives = 986/1244 (79%), Gaps = 46/1244 (4%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNE-------SGPESAEQEIRSADLDGASALKSPEAP  365
             KRSKA+E   S+++  G    G VNE       SG +S   E+RS+DL  + A K+ +A 
Sbjct  24    KRSKASEPALSSNN--GAAVSGPVNETLGPPKESGSDSRVMELRSSDLRVSDAAKAVDAS  81

Query  366   VPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGTA--WGK  533
               +K   A L    LV+P   G++A++ DKV+   + L  R K R +K + LG+   WGK
Sbjct  82    PIDKPAVADLENGTLVAPRSSGEAAVNADKVETVAAGLTGRAKNRPIKPAKLGSKFPWGK  141

Query  534   LLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISG  713
             LLSQ+ QN H+ +  + FTVGQ  QC+LC+ D ++S  LC +KHI+R+ G SI LLEI+G
Sbjct  142   LLSQHSQNPHLVMCGTLFTVGQSHQCNLCLKDHNISAILCKVKHIERD-GTSIALLEITG  200

Query  714   KKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEA  893
              KG VQVNG+ Y KN+++ LN GDE+IF S+G HAYIFQ+ TN++++A  +P S+SILEA
Sbjct  201   GKGSVQVNGRTYRKNTSLILNAGDELIFTSTGDHAYIFQQLTNDNLAAPGLPSSLSILEA  260

Query  894   HSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPV  1073
              + P+KG+  EAR G+PS VA A+T                 +      K+  EM  LP 
Sbjct  261   QTAPIKGI-IEARLGEPSAVAGAAT-----------------ILASLSTKENSEMSTLPS  302

Query  1074  ASGEPDKHDLDSDMKDVSDHND---VPLDEKSGAISPDSGNDNLNLEN-GAIDSYDGEIG  1241
                  D    + DMKD + + D       EK+    P++ N N NL+  G  DS D +  
Sbjct  303   GCEVSDDCVPEVDMKDSASNTDPATASSREKTVPSVPEAANGNPNLDRLGLDDSMDADNT  362

Query  1242  KVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLISM-STRRQA  1409
             K+ GA   LRPL+ +LAG+ST +FD SG+I++I+D++RE   +LK+F+P + + ST+R+A
Sbjct  363   KIPGAGYSLRPLLHILAGTST-DFDFSGSIAKILDEQREIREMLKEFEPPLGLVSTKRKA  421

Query  1410  FKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPR  1589
             FKD L+ +IL+ +NI++SFE+FPYYLS+ TKNVLIASTY+HLKC+KF K AS+LPT+ PR
Sbjct  422   FKDSLRDSILNPDNIDLSFENFPYYLSDTTKNVLIASTYVHLKCSKFAKYASDLPTMSPR  481

Query  1590  ILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVF  1766
             ILLSGPAGSEIYQETL KALAK+FGA LLVV+SL+LPGGS +K++D VKE  + E+  VF
Sbjct  482   ILLSGPAGSEIYQETLVKALAKHFGAGLLVVNSLLLPGGSTSKDVDAVKETSRAEKVTVF  541

Query  1767  TKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVG  1943
              KRAA  A L+  K+P SSVEADITGGS++ S A  KQE STA+SKN TFK GDRVK+VG
Sbjct  542   AKRAAHPAALQ-QKRPTSSVEADITGGSSLGSQALPKQEVSTATSKNYTFKKGDRVKFVG  600

Query  1944  PLPTGFS--LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHG  2117
                      L+   RGP  G++GKV+LAFEENG SKIGVRFDRSIPEGNDLGGLCEEDHG
Sbjct  601   SSSPSGFSSLEPALRGPMIGFRGKVVLAFEENGSSKIGVRFDRSIPEGNDLGGLCEEDHG  660

Query  2118  FFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAF  2297
             FFC+A  LRL+ S  DD+DKLA+NELFEV   E KS PLILFVKDIEKS+ GN + +++ 
Sbjct  661   FFCSASSLRLECSGGDDVDKLAVNELFEVTLNESKSGPLILFVKDIEKSVAGNTDVYASL  720

Query  2298  KLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRS  2477
             K K+E LP NVVVI S+TQ D+RKEKSHPGG LFTKFG NQTALLDLAFPDNFG+LH+RS
Sbjct  721   KSKVENLPANVVVIGSHTQMDSRKEKSHPGGLLFTKFGVNQTALLDLAFPDNFGKLHERS  780

Query  2478  KETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVE  2657
             KETPK +KQ+TRLFPNKV IQ+PQDE LL DWKQQL+RD ET+K+QSN V+IR++L++  
Sbjct  781   KETPKTMKQVTRLFPNKVTIQLPQDEVLLLDWKQQLERDTETLKAQSNIVSIRSILHQNG  840

Query  2658  LDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVL  2837
             LDCPD+ETLCIKDQ LTNESV K++GWALSH FM+SS    K+ KL +S+ESI+YGL +L
Sbjct  841   LDCPDLETLCIKDQTLTNESVGKVVGWALSHQFMYSSGVLLKDAKLVVSTESIKYGLDIL  900

Query  2838  QGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVML  3017
             QG+Q+E+K++KKSLKDVVTENEFEKKLLADVIPPSDIGV+FDDIGALENVKDTLKELVML
Sbjct  901   QGIQSESKTLKKSLKDVVTENEFEKKLLADVIPPSDIGVSFDDIGALENVKDTLKELVML  960

Query  3018  PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE  3197
             PLQRPELFCKGQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE
Sbjct  961   PLQRPELFCKGQLTKPSKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE  1020

Query  3198  GEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDK  3377
             GEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTK K
Sbjct  1021  GEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKAK  1080

Query  3378  ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIA  3557
             ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KEEL+PNVDL+AIA
Sbjct  1081  ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEELSPNVDLEAIA  1140

Query  3558  NMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDD  3737
             NMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE+ALA +E+RPLP+L++S+DIR L MDD
Sbjct  1141  NMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERALAAAESRPLPSLYSSADIRSLKMDD  1200

Query  3738  FRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             F+YAHEQVCASVSSESTNM ELLQWNELYGEGGSRKKK LSYFM
Sbjct  1201  FKYAHEQVCASVSSESTNMNELLQWNELYGEGGSRKKKQLSYFM  1244



>ref|XP_010097306.1| ATPase family AAA domain-containing protein 1 [Morus notabilis]
 gb|EXB67538.1| ATPase family AAA domain-containing protein 1 [Morus notabilis]
Length=1412

 Score =  1577 bits (4083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 847/1269 (67%), Positives = 988/1269 (78%), Gaps = 78/1269 (6%)
 Frame = +3

Query  270   GAVNESGPESAEQEIRSAD------LDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILG  431
             G V E+  ES   E+RS D      L  A+ +   +A +PEK  E  +    LVSP + G
Sbjct  153   GPVKEAVSESGGVELRSPDPANPDPLKEAATVAEFDATLPEKSAEEGVEDLALVSPQLSG  212

Query  432   DSAIDVDKVKANGSALNRGKKRQLK---SNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQG  602
             ++A+D DK KA   A  RGKKR  K   SN   AWGKLLSQ   N H+ +  S FTVGQ 
Sbjct  213   EAAVDADKSKAVVPASGRGKKRPSKLPKSNPKAAWGKLLSQCSLNPHLFIRDSLFTVGQS  272

Query  603   RQCDLCVDDPSVSKSLCNLKHIQREKGN-SITLLEISGKKGCVQVNGKIYPKNSTVPLNG  779
              QC+L + DPS+S +LC L+H++R  GN S+ LLEI+G KG V VNGK Y ++S V L G
Sbjct  273   VQCNLSIKDPSISNTLCRLRHLKR--GNASVALLEITGGKGAVLVNGKTYQRSSRVILTG  330

Query  780   GDEVIFGSSGKHAYI---------------------------FQKFTNEDISAASMPPSV  878
             GDEV+F S G+HAYI                           FQ+  ++ ++ A +P SV
Sbjct  331   GDEVVFSSLGRHAYIVLCTNCRYYVCYLSHKSSMYPLTPGKIFQQLVSDSLAPA-IPSSV  389

Query  879   SILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEM  1058
             SILEA S PVKG++ EARSGDPS VA AS LASLSN +K+L L+PP      +++Q  E+
Sbjct  390   SILEAQSSPVKGMHIEARSGDPSAVAGASILASLSNYRKDLSLIPPPAKAAEELQQDAEI  449

Query  1059  PALPVASGEPDKHDLDSDMKDVSDHND---VPLDEKSGAISPDSGNDNLNLENGAIDSY-  1226
              +LP           D DMKD S++ND       EK    SPD+ N+N NL++ A+D+  
Sbjct  450   SSLPTGCVGSGDIATDIDMKDCSNNNDQAGTSSREKEIVPSPDAANENPNLDSIALDANP  509

Query  1227  DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLISMST  1397
             DGE+GKV G P ELRPL+R+LAGSS+  FDLSG+IS+II+++RE   LLKDFD    ++T
Sbjct  510   DGEVGKVPGPPYELRPLLRILAGSSSSNFDLSGSISKIIEEQREIKELLKDFDRPGLIAT  569

Query  1398  RRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPT  1577
             R+QAFKD LQQ +L+  +IEV FE FPYYLS+ TKN+LIASTYIHLKC KF K  S+LP+
Sbjct  570   RKQAFKDKLQQGVLNPADIEVLFESFPYYLSDATKNILIASTYIHLKCKKFTKYTSDLPS  629

Query  1578  VCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPER  1754
             V PRILLSGPAGSEIYQETL KALAKYFGARLL+VDSL+LPGG + K+ D +K+  + ER
Sbjct  630   VSPRILLSGPAGSEIYQETLVKALAKYFGARLLIVDSLILPGGPTPKDSDNLKDGTRLER  689

Query  1755  TGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKNTFKTGDRVK  1934
                F KRAAQAA L  +KKPASSVEADITGGS +SS A  KQE STASS+ +    D+VK
Sbjct  690   L-FFPKRAAQAACLS-HKKPASSVEADITGGSTVSSQAPPKQETSTASSRGS----DKVK  743

Query  1935  YVGPLPTGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDH  2114
             YVGP P       P  GP+YGY+GKVLLAFE NG SKIGVRFD+SIP+GNDLGGLCEE+H
Sbjct  744   YVGPTPGLSQHSCPLSGPSYGYRGKVLLAFEGNGSSKIGVRFDKSIPDGNDLGGLCEENH  803

Query  2115  GFFCAADFL-RLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFS  2291
             GFFC+ + L RLD S  D+ DKLAINELFEV S E K+ PLILF+KD+EK++V N +A++
Sbjct  804   GFFCSVNHLVRLDGSGGDEFDKLAINELFEVASNESKNIPLILFIKDMEKAVVANSDAYT  863

Query  2292  AFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHD  2471
               K KLE LPENVVVI S+TQ DNRKEKSHPGG LFTKFGSNQTALLDLAFPD+FGRL D
Sbjct  864   VLKAKLENLPENVVVIGSHTQLDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLPD  923

Query  2472  RSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNR  2651
             R+KETPK IK LTRLFPNKV+IQ+PQDE +LSDWKQQL+RD+ET+K+QSN V+IR VL+R
Sbjct  924   RNKETPKTIKHLTRLFPNKVVIQLPQDEAVLSDWKQQLERDVETLKAQSNIVSIRTVLDR  983

Query  2652  VELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLS  2831
             + LDCPDIETLCIKDQALT E+VEK+IGWALS+HFMH +E+S KE KL IS+ESIRYGL+
Sbjct  984   IGLDCPDIETLCIKDQALTFENVEKVIGWALSYHFMHCAEASVKEDKLVISTESIRYGLN  1043

Query  2832  VLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELV  3011
             +LQG+QNE+KSVKKSLKDVVTENEFEKKLLADVIPP+DIGVTFDDIGALENVKDTLKELV
Sbjct  1044  ILQGIQNESKSVKKSLKDVVTENEFEKKLLADVIPPNDIGVTFDDIGALENVKDTLKELV  1103

Query  3012  MLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWF  3191
             MLPLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWF
Sbjct  1104  MLPLQRPELFNKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWF  1163

Query  3192  GEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTK  3371
             GEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTK
Sbjct  1164  GEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTK  1223

Query  3372  DKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDA  3551
             DKERVLVL ATNRPFDLDEAVIRRLPRRLMVNLPD PNREKI+++IL KEELAP+VDL+ 
Sbjct  1224  DKERVLVLGATNRPFDLDEAVIRRLPRRLMVNLPDCPNREKIIKVILAKEELAPDVDLET  1283

Query  3552  IANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNM  3731
             IANMT+GYSGSDLKNLC+ AAH PIREILEKEKKE+ALA++ENRPL AL++SSD+R L M
Sbjct  1284  IANMTDGYSGSDLKNLCIAAAHRPIREILEKEKKERALALAENRPLAALYSSSDVRHLKM  1343

Query  3732  DDFRYAHEQ-----------------------VCASVSSESTNMTELLQWNELYGEGGSR  3842
             +DF+ AHEQ                       VCASVSSESTNM ELLQWN+LYGEGGSR
Sbjct  1344  EDFKCAHEQAFAMVWDYYRDLFNIIDKTHLRKVCASVSSESTNMNELLQWNDLYGEGGSR  1403

Query  3843  KKKALSYFM  3869
             KKK+LSYFM
Sbjct  1404  KKKSLSYFM  1412



>ref|XP_006588596.1| PREDICTED: uncharacterized protein LOC100794406 isoform X2 [Glycine 
max]
Length=1246

 Score =  1576 bits (4082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 850/1243 (68%), Positives = 989/1243 (80%), Gaps = 39/1243 (3%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTPGAVNESGP--ESAEQEIRSADLDGASALKSPEAPV--  368
             N KRSK +E  SST       +   VNESG   ESAE E+  +DL   ++LK+ +  V  
Sbjct  23    NTKRSKVSEDSSSTT----VPSVAPVNESGTANESAEPELMLSDLPETASLKAVDGCVAM  78

Query  369   -PEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGK-KRQLKSNLG--TAWGKL  536
              P+K P  P+ GE LVSP   G++A     V    +    G+ K+Q  S L    AWGKL
Sbjct  79    SPDKSPSVPVEGEALVSPQCQGETAEKSKGVLMAAATTTGGRSKKQRPSKLSPKVAWGKL  138

Query  537   LSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGK  716
             LSQ  QN HV +    FTVGQGR C+L + DP+V   LC L HI+R  G+S+ LLEI+G 
Sbjct  139   LSQCSQNPHVSMSDLIFTVGQGRNCNLWLKDPTVGNVLCKLSHIER-GGSSVALLEITGG  197

Query  717   KGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAH  896
             KG +QVNGK Y KN+ + L+GGDEV+FGSSGKHAYIFQ  TN +IS A +P SVSILEA 
Sbjct  198   KGSIQVNGKTYRKNARLILSGGDEVVFGSSGKHAYIFQLLTNNNISPAVIPSSVSILEAQ  257

Query  897   SGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVA  1076
             S P+ G   EARSGDPS VA AS LASLSNL K+L LL P      +++Q  ++ +LP  
Sbjct  258   SAPINGTQVEARSGDPSAVAGASILASLSNLPKDLSLLSPPAKTGKNVQQNSDISSLP--  315

Query  1077  SGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPD-SGNDNLNLENGAID-SYDGEIGKVT  1250
             SG  D   + S+MKD +  NDV     S   S D + N+N +L+   +D + D ++ KVT
Sbjct  316   SGNEDDMPI-SEMKDAT--NDV----ASEVCSADKTVNENPSLDTAEVDINVDADVRKVT  368

Query  1251  GAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELL---KDFD-PLISMSTRRQAFKD  1418
              A  ELRPL+R+LAGS  PE DLS  I++I+++RREL    KD D P I  STRRQAF+D
Sbjct  369   AATYELRPLLRLLAGS-CPELDLSCGITKILEERRELRELLKDVDTPTILASTRRQAFRD  427

Query  1419  GLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILL  1598
              L+Q IL S NI+VSFE FPYYLS+ TK+VLIAST+IHLKC  F K AS+L +V PRILL
Sbjct  428   SLEQRILKSKNIDVSFETFPYYLSDTTKSVLIASTFIHLKCMGFGKYASDLSSVSPRILL  487

Query  1599  SGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPER-TGVFTK  1772
             SGPAGSEIYQETL KALAK+FGARLL+VDSL LPGG+ +KE+D  KE+ +PE+ + VFTK
Sbjct  488   SGPAGSEIYQETLCKALAKHFGARLLIVDSLSLPGGAPSKEVDSAKESSRPEKPSSVFTK  547

Query  1773  RAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK-NTFKTGDRVKYVGPL  1949
             R++Q A L+ +KKPASSV+A+I GGS ISS A  KQE STASSK  T K GDRVK+VG  
Sbjct  548   RSSQTATLQ-HKKPASSVDAEIVGGSTISSQAMLKQEVSTASSKGTTLKEGDRVKFVGNF  606

Query  1950  PTGFSL--QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFF  2123
             P+  S     P+RGP+YG +GKVLLAFE+N  SKIGVRFD+SIP+GNDLGGLCEED GFF
Sbjct  607   PSAVSSLPNYPSRGPSYGSRGKVLLAFEDNRSSKIGVRFDKSIPDGNDLGGLCEEDRGFF  666

Query  2124  CAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFK  2300
             C+A+  LR+D S  DD DK+AI+++FEV S + KS PL+LF+KDIEK+MVGN   +   K
Sbjct  667   CSANHLLRVDGSGGDDADKVAISDIFEVTSNQSKSGPLVLFIKDIEKAMVGN---YEVLK  723

Query  2301  LKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSK  2480
              K E LP NVVVI S+T  DNRKEK+ PGG LFTKFGSNQTALLDLAFPDNFGRLHDRSK
Sbjct  724   NKFESLPPNVVVIGSHTLLDNRKEKTQPGGLLFTKFGSNQTALLDLAFPDNFGRLHDRSK  783

Query  2481  ETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVEL  2660
             ETPK +KQL RLFPNKV IQ+PQDE +LSDWKQQL+RDIETMK+QSN V+IR VLNR+ L
Sbjct  784   ETPKVMKQLGRLFPNKVTIQLPQDEAILSDWKQQLERDIETMKAQSNIVSIRTVLNRIGL  843

Query  2661  DCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQ  2840
             DCPD+ETL IKDQ LT ESVEKIIGWA+S+HFMHSS++S K+ KL IS+ES+ YG+++LQ
Sbjct  844   DCPDLETLSIKDQTLTTESVEKIIGWAISYHFMHSSKASIKDSKLVISAESLNYGINILQ  903

Query  2841  GVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLP  3020
             G+QNE K++KKSLKDVVTENEFEKKLLADVIPP+DIGVTFDDIGALENVKDTLKELVMLP
Sbjct  904   GIQNENKNLKKSLKDVVTENEFEKKLLADVIPPTDIGVTFDDIGALENVKDTLKELVMLP  963

Query  3021  LQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEG  3200
             LQRPELFCKGQL KPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEG
Sbjct  964   LQRPELFCKGQLAKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEG  1023

Query  3201  EKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKE  3380
             EKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+P EHEAMRKMKNEFMVNWDGLRTKDKE
Sbjct  1024  EKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPSEHEAMRKMKNEFMVNWDGLRTKDKE  1083

Query  3381  RVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIAN  3560
             RVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KE+LAP+VD +AIAN
Sbjct  1084  RVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILVKEDLAPDVDFEAIAN  1143

Query  3561  MTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDF  3740
             MT+GYSGSDLKNLCVTAAHCPIREILEKEKKE++LA+SE++PLP L  S DIRPL MDDF
Sbjct  1144  MTDGYSGSDLKNLCVTAAHCPIREILEKEKKERSLALSESKPLPGLCGSGDIRPLKMDDF  1203

Query  3741  RYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             RYAHEQVCASVSSESTNM ELLQWN+LYGEGGSRK ++LSYFM
Sbjct  1204  RYAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKMRSLSYFM  1246



>gb|KDO87276.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1226

 Score =  1575 bits (4079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 832/1234 (67%), Positives = 979/1234 (79%), Gaps = 47/1234 (4%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  386
             KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27    KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  387   APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGTA--WGKLLSQYPQ  554
             A +  + LVSP   G++A+D +K KA G   N R KKR  K   +G+   W +L+SQ  Q
Sbjct  84    ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQ  143

Query  555   NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQV  734
             NSH+ +  + FTVG  RQCDL + DPS+SK+LC L+ I+   G S  LLEI+G KG V+V
Sbjct  144   NSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIEN-GGPSGALLEITGGKGEVEV  202

Query  735   NGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKG  914
             NG ++PK+S V L GGDE++F  SGKH+YIFQ+ +++ ++A  + P +SILEA S P+K 
Sbjct  203   NGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKT  262

Query  915   VNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDK  1094
             ++ EARSGDPS VA AS LASLSN++K+L L+PP      D  Q  E+ +L      P+ 
Sbjct  263   MHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVD-AQNSEIASLASGCDGPED  321

Query  1095  HDLDSDMKDVSDHNDVPLDEKSG-AISP--DSGNDNLNLENGAIDS-YDGEIGKVTGAPQ  1262
                D DMKD + +ND       G  + P  D+ N+N NL++  +D+  D EIGK+ GA  
Sbjct  322   RIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATY  381

Query  1263  ELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFD-PLISMSTRRQAFKDGLQQ  1430
             ELRPL+RMLAGSS+P+FD+SG IS+I+D++RE   LLKD D P + +S RRQAFKD LQ+
Sbjct  382   ELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQE  441

Query  1431  TILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPA  1610
              IL   NIEVSFE FPYYLS+ITKNVLIASTY+HLKCN F K AS+LPT+CPRILLSGPA
Sbjct  442   GILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPA  501

Query  1611  GSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAAQAA  1790
             GSEIYQETLAKALAK+F ARLL+VDSL+LPGGS+KE D VKE+ + E+  +F KRAA   
Sbjct  502   GSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAA---  558

Query  1791  VLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSL  1967
              L  ++KP SSVEADITGG+A+ S A  K E STASSKN TFK GDRVK+VG + +G ++
Sbjct  559   -LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTV  617

Query  1968  QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRL  2147
             Q                           +RFDRSIPEGN+LGG CE+DHGFFC A  LRL
Sbjct  618   QPT-------------------------LRFDRSIPEGNNLGGFCEDDHGFFCTASSLRL  652

Query  2148  DNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPEN  2327
             D+S  D++DKLAINELFEV   E KSSPLI+FVKDIEKS+ GN +A+ A K KLE LP N
Sbjct  653   DSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSN  712

Query  2328  VVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQL  2507
             VVVI S+TQ D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNF RLHDRSKETPKA+KQ+
Sbjct  713   VVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQI  772

Query  2508  TRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLC  2687
             +RLFPNKV IQ+PQDE LLSDWKQQL+RD+ET+K QSN ++IR+VL+R  LDC D+E+LC
Sbjct  773   SRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLC  832

Query  2688  IKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSV  2867
             IKDQ LT E VEKI+GWALSHHFMH SE+  K+ KL IS+ESI YGL++LQG+Q+E+KS+
Sbjct  833   IKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSL  892

Query  2868  KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  3047
             KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK
Sbjct  893   KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  952

Query  3048  GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFT  3227
             GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+
Sbjct  953   GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS  1012

Query  3228  LASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  3407
             LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN
Sbjct  1013  LASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  1072

Query  3408  RPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSD  3587
             RPFDLDEAV+RRLPRRLMVNLPDAPNREKI+R+IL KEELA +VDL+ IANM +GYSGSD
Sbjct  1073  RPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSD  1132

Query  3588  LKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCA  3767
             LKNLCVTAAHCPIREILEKEKKE+ALA++ENR  P L++S D+RPL MDDF+YAHEQVCA
Sbjct  1133  LKNLCVTAAHCPIREILEKEKKERALALAENRASPPLYSSVDVRPLKMDDFKYAHEQVCA  1192

Query  3768  SVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             SVSSESTNM ELLQWNELYGEGGSRK+K+LSYFM
Sbjct  1193  SVSSESTNMNELLQWNELYGEGGSRKRKSLSYFM  1226



>ref|XP_004136037.1| PREDICTED: uncharacterized protein LOC101211144 [Cucumis sativus]
Length=1270

 Score =  1575 bits (4077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 848/1251 (68%), Positives = 1002/1251 (80%), Gaps = 40/1251 (3%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGA-----VNESGPESAEQEIRSADLDGASALKSP---EA  362
             KRSK  E+ SST+D+  +  P       V ESG E  +  I+SAD     +LK     + 
Sbjct  30    KRSKVVEASSSTEDV--QSAPPVDPLIPVGESGVEPVDPVIQSADPFDTDSLKVNNVCDE  87

Query  363   PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKAN-GSALNRGKKRQL---KSNLGTAWG  530
              VPE   +    G+ ++ P  LGD A D +K KA   S LNR KKR +   KSN   AWG
Sbjct  88    AVPENSHDLQAEGQAIMPPQPLGDVAADAEKSKAVVASMLNRTKKRTMRMPKSNSKPAWG  147

Query  531   KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNS-ITLLEI  707
             KLLSQ  QN H+ +  + FTVGQ RQC+L + DPSVS +LC L+HI+R  GNS + LLEI
Sbjct  148   KLLSQCSQNPHLFICGTLFTVGQSRQCNLWLKDPSVSTTLCKLRHIKR--GNSSVALLEI  205

Query  708   SGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSIL  887
             +G KG V VNGKI  KNS+V LNGGDEV+F SSGKHAYIFQ+ T++D + + +  SV+IL
Sbjct  206   TGGKGAVIVNGKIVQKNSSVILNGGDEVVFTSSGKHAYIFQQLTSDDFTVSGLS-SVNIL  264

Query  888   EAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPAL  1067
             EAH  PVKG++FE RS D S V  AS LAS SN++K+L LL P    + D+K    +P++
Sbjct  265   EAHCAPVKGIHFERRSRDASAVTGASILASFSNIQKDLSLLSPPAKTNEDVK----LPSV  320

Query  1068  PVASGE--PDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAID-SYDGEI  1238
                SGE  PD +  D    D   H D  +D+    I PDSG +  +L+  A+D S DGE+
Sbjct  321   CGVSGEQSPDSNLKDGSTNDTDRHGDASMDKNIDPI-PDSGTERPSLDRLALDASIDGEV  379

Query  1239  GKVTGAPQELRPLIRMLAGSSTPEFDLSG-NISRIIDQRRE---LLKDFDP-LISMSTRR  1403
             G+      ELRPL+++LA S++P+F+++G +IS+I++++R+   L KDF P  + MSTRR
Sbjct  380   GEAPAKHSELRPLLQILASSASPDFNINGGSISKILNEQRDMGNLFKDFSPPAVLMSTRR  439

Query  1404  QAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVC  1583
             QAFK+ LQQ IL  +NI+VS E FPYYLS+ TKNVLIAS ++HLKCNKFVK AS+LP + 
Sbjct  440   QAFKERLQQGILKPDNIDVSLESFPYYLSDTTKNVLIASMFVHLKCNKFVKHASDLPILS  499

Query  1584  PRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTG  1760
             PRILLSGPAGSEIYQETL KALA++FGARLL+VDSL+LPGG + K++D VK+  +P+RT 
Sbjct  500   PRILLSGPAGSEIYQETLTKALARHFGARLLIVDSLLLPGGPTPKDVDIVKDNSRPDRTS  559

Query  1761  VFTKRAAQAAV---LRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKNT-FKTGDR  1928
              F KRA QAA    +  NKKP SSVEADI GGS +SS A  KQEASTASSK T FKTGD+
Sbjct  560   FFAKRAVQAAAAAAVSQNKKPTSSVEADIAGGSTLSSQALPKQEASTASSKTTAFKTGDK  619

Query  1929  VKYVGPLPTGFS--LQT-PARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGL  2099
             VK+VG L +  S  LQT P RGP+YG +GKV+LAFEENG SKIGVRFD+SIP+GNDLGGL
Sbjct  620   VKFVGTLSSTLSPPLQTCPLRGPSYGCRGKVVLAFEENGSSKIGVRFDKSIPDGNDLGGL  679

Query  2100  CEEDHGFFCAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGN  2276
             CEEDHGFFC+A+  LRLD    DD DKLAI+E+FEVVS E K+SPLILFVKDIEK+MVG+
Sbjct  680   CEEDHGFFCSANHLLRLDGPGGDDTDKLAIDEVFEVVSNESKNSPLILFVKDIEKAMVGH  739

Query  2277  PEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNF  2456
              +A+S  K +LE LP NVVVI S+T  DNRKEKSHPGG LFTKFGSNQTALLDLAFPDNF
Sbjct  740   SDAYSILKGRLENLPGNVVVIGSHTHMDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDNF  799

Query  2457  GRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIR  2636
             GRLHDR+KETPKA KQL+RLFPNKV I  PQ+E LLS WKQQL+RD ET+K+Q+N V+IR
Sbjct  800   GRLHDRNKETPKATKQLSRLFPNKVTILPPQEEALLSVWKQQLERDTETLKTQANIVSIR  859

Query  2637  NVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESI  2816
              VLNR+ LDC +++TLCIKDQALT E+VEK++GWALSHHFMH S+   K+ KL IS+ESI
Sbjct  860   LVLNRIGLDCSNLDTLCIKDQALTIETVEKVVGWALSHHFMHFSDVLVKDAKLIISTESI  919

Query  2817  RYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDT  2996
              YGL++L G+Q+E KS+KKSL+DVVTENEFEKKLLADVIPP DIGVTF+DIGALENVKDT
Sbjct  920   EYGLNILHGLQSENKSLKKSLRDVVTENEFEKKLLADVIPPGDIGVTFEDIGALENVKDT  979

Query  2997  LKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSI  3176
             LKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSI
Sbjct  980   LKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSI  1039

Query  3177  TSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWD  3356
             TSKWFGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWD
Sbjct  1040  TSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWD  1099

Query  3357  GLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPN  3536
             GLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KEELA +
Sbjct  1100  GLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEELAAD  1159

Query  3537  VDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDI  3716
             +DL+AIANMT+GYSGSDLKNLCVTAAHCPIREIL+KEKKE+  A+++N+PLPAL++S+D+
Sbjct  1160  IDLEAIANMTDGYSGSDLKNLCVTAAHCPIREILDKEKKERVSALTDNKPLPALYSSTDV  1219

Query  3717  RPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             R L M+DFR+AHEQVCASVSSESTNM ELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1220  RSLKMEDFRFAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKKMSLSYFM  1270



>ref|XP_003536887.1| PREDICTED: uncharacterized protein LOC100794406 isoform X1 [Glycine 
max]
Length=1247

 Score =  1573 bits (4073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 849/1243 (68%), Positives = 988/1243 (79%), Gaps = 39/1243 (3%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTPGAVNESGP--ESAEQEIRSADLDGASALKSPEAPV--  368
             N KR K +E  SST       +   VNESG   ESAE E+  +DL   ++LK+ +  V  
Sbjct  24    NTKRCKVSEDSSSTT----VPSVAPVNESGTANESAEPELMLSDLPETASLKAVDGCVAM  79

Query  369   -PEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGK-KRQLKSNLG--TAWGKL  536
              P+K P  P+ GE LVSP   G++A     V    +    G+ K+Q  S L    AWGKL
Sbjct  80    SPDKSPSVPVEGEALVSPQCQGETAEKSKGVLMAAATTTGGRSKKQRPSKLSPKVAWGKL  139

Query  537   LSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGK  716
             LSQ  QN HV +    FTVGQGR C+L + DP+V   LC L HI+R  G+S+ LLEI+G 
Sbjct  140   LSQCSQNPHVSMSDLIFTVGQGRNCNLWLKDPTVGNVLCKLSHIER-GGSSVALLEITGG  198

Query  717   KGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAH  896
             KG +QVNGK Y KN+ + L+GGDEV+FGSSGKHAYIFQ  TN +IS A +P SVSILEA 
Sbjct  199   KGSIQVNGKTYRKNARLILSGGDEVVFGSSGKHAYIFQLLTNNNISPAVIPSSVSILEAQ  258

Query  897   SGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVA  1076
             S P+ G   EARSGDPS VA AS LASLSNL K+L LL P      +++Q  ++ +LP  
Sbjct  259   SAPINGTQVEARSGDPSAVAGASILASLSNLPKDLSLLSPPAKTGKNVQQNSDISSLP--  316

Query  1077  SGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPD-SGNDNLNLENGAID-SYDGEIGKVT  1250
             SG  D   + S+MKD +  NDV     S   S D + N+N +L+   +D + D ++ KVT
Sbjct  317   SGNEDDMPI-SEMKDAT--NDV----ASEVCSADKTVNENPSLDTAEVDINVDADVRKVT  369

Query  1251  GAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELL---KDFD-PLISMSTRRQAFKD  1418
              A  ELRPL+R+LAGS  PE DLS  I++I+++RREL    KD D P I  STRRQAF+D
Sbjct  370   AATYELRPLLRLLAGS-CPELDLSCGITKILEERRELRELLKDVDTPTILASTRRQAFRD  428

Query  1419  GLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILL  1598
              L+Q IL S NI+VSFE FPYYLS+ TK+VLIAST+IHLKC  F K AS+L +V PRILL
Sbjct  429   SLEQRILKSKNIDVSFETFPYYLSDTTKSVLIASTFIHLKCMGFGKYASDLSSVSPRILL  488

Query  1599  SGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPER-TGVFTK  1772
             SGPAGSEIYQETL KALAK+FGARLL+VDSL LPGG+ +KE+D  KE+ +PE+ + VFTK
Sbjct  489   SGPAGSEIYQETLCKALAKHFGARLLIVDSLSLPGGAPSKEVDSAKESSRPEKPSSVFTK  548

Query  1773  RAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK-NTFKTGDRVKYVGPL  1949
             R++Q A L+ +KKPASSV+A+I GGS ISS A  KQE STASSK  T K GDRVK+VG  
Sbjct  549   RSSQTATLQ-HKKPASSVDAEIVGGSTISSQAMLKQEVSTASSKGTTLKEGDRVKFVGNF  607

Query  1950  PTGFSL--QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFF  2123
             P+  S     P+RGP+YG +GKVLLAFE+N  SKIGVRFD+SIP+GNDLGGLCEED GFF
Sbjct  608   PSAVSSLPNYPSRGPSYGSRGKVLLAFEDNRSSKIGVRFDKSIPDGNDLGGLCEEDRGFF  667

Query  2124  CAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFK  2300
             C+A+  LR+D S  DD DK+AI+++FEV S + KS PL+LF+KDIEK+MVGN   +   K
Sbjct  668   CSANHLLRVDGSGGDDADKVAISDIFEVTSNQSKSGPLVLFIKDIEKAMVGN---YEVLK  724

Query  2301  LKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSK  2480
              K E LP NVVVI S+T  DNRKEK+ PGG LFTKFGSNQTALLDLAFPDNFGRLHDRSK
Sbjct  725   NKFESLPPNVVVIGSHTLLDNRKEKTQPGGLLFTKFGSNQTALLDLAFPDNFGRLHDRSK  784

Query  2481  ETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVEL  2660
             ETPK +KQL RLFPNKV IQ+PQDE +LSDWKQQL+RDIETMK+QSN V+IR VLNR+ L
Sbjct  785   ETPKVMKQLGRLFPNKVTIQLPQDEAILSDWKQQLERDIETMKAQSNIVSIRTVLNRIGL  844

Query  2661  DCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQ  2840
             DCPD+ETL IKDQ LT ESVEKIIGWA+S+HFMHSS++S K+ KL IS+ES+ YG+++LQ
Sbjct  845   DCPDLETLSIKDQTLTTESVEKIIGWAISYHFMHSSKASIKDSKLVISAESLNYGINILQ  904

Query  2841  GVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLP  3020
             G+QNE K++KKSLKDVVTENEFEKKLLADVIPP+DIGVTFDDIGALENVKDTLKELVMLP
Sbjct  905   GIQNENKNLKKSLKDVVTENEFEKKLLADVIPPTDIGVTFDDIGALENVKDTLKELVMLP  964

Query  3021  LQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEG  3200
             LQRPELFCKGQL KPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEG
Sbjct  965   LQRPELFCKGQLAKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEG  1024

Query  3201  EKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKE  3380
             EKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+P EHEAMRKMKNEFMVNWDGLRTKDKE
Sbjct  1025  EKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPSEHEAMRKMKNEFMVNWDGLRTKDKE  1084

Query  3381  RVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIAN  3560
             RVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KE+LAP+VD +AIAN
Sbjct  1085  RVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILVKEDLAPDVDFEAIAN  1144

Query  3561  MTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDF  3740
             MT+GYSGSDLKNLCVTAAHCPIREILEKEKKE++LA+SE++PLP L  S DIRPL MDDF
Sbjct  1145  MTDGYSGSDLKNLCVTAAHCPIREILEKEKKERSLALSESKPLPGLCGSGDIRPLKMDDF  1204

Query  3741  RYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             RYAHEQVCASVSSESTNM ELLQWN+LYGEGGSRK ++LSYFM
Sbjct  1205  RYAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKMRSLSYFM  1247



>ref|XP_007201764.1| hypothetical protein PRUPE_ppa000530mg [Prunus persica]
 gb|EMJ02963.1| hypothetical protein PRUPE_ppa000530mg [Prunus persica]
Length=1113

 Score =  1572 bits (4070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 807/1114 (72%), Positives = 930/1114 (83%), Gaps = 12/1114 (1%)
 Frame = +3

Query  552   QNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQ  731
             +N H+ +  + FTVGQGR C+LC+ DPS+S +LC LKH++RE G+S   LEI+G KG VQ
Sbjct  4     RNPHLFICDTVFTVGQGRDCNLCLKDPSISTTLCKLKHVKRE-GSSAAELEITGGKGDVQ  62

Query  732   VNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVK  911
             VN KIY K+S V L+GGDEV+F  SGKHAYIFQ+ TN++  AA   PS+SILE  S PV 
Sbjct  63    VNEKIYQKDSKVVLSGGDEVVFSLSGKHAYIFQQLTNDNNIAAQGIPSISILETQSTPVN  122

Query  912   GVNFEARSGDPSTVAVASTlaslsnlkkellllP-PSVCNDNDIKQGPEMPALPVASGEP  1088
             G++ EARSGDPS V  AS LAS+SN   +L  LP P+   DN ++Q  EMP+LP   G P
Sbjct  123   GIHIEARSGDPSAVDGASILASMSNGPNDLSPLPEPAKAGDN-LQQDAEMPSLPSGCGGP  181

Query  1089  DKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQEL  1268
             D H  D +MKD ++ ND    +K     PD+ ++N N+++ A+D  D E GKV G   +L
Sbjct  182   DDHTADIEMKDTTNTNDQVSGDKDIVQYPDTADENPNVDSLALD-MDTETGKVPGEAYQL  240

Query  1269  RPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLISMSTRRQAFKDGLQQTIL  1439
             RPL RM  GSS+  FDLSG+IS+I+D++RE   LL DFDP I +STRRQAFK+ LQQ IL
Sbjct  241   RPLFRMFGGSSSTNFDLSGSISKILDEQREIRELLHDFDPPILISTRRQAFKEKLQQGIL  300

Query  1440  DSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSE  1619
             + ++IEVSFE FPYYLS+ TK VLIAS +IHLKC++F K  S L T  PRILLSGPAGSE
Sbjct  301   NPDDIEVSFESFPYYLSDTTKIVLIASAHIHLKCSEFAKYTSLLSTASPRILLSGPAGSE  360

Query  1620  IYQETLAKALAKYFGARLLVVDSLVLPGGSA-KELDPVKEAPKPERTGVFTKRAAQAAVL  1796
             IYQETLAKALAK+ GARLL+VDSL+LPG    KE D VKE  +PER  VF KRAA AA L
Sbjct  361   IYQETLAKALAKHCGARLLIVDSLLLPGAPVPKEADSVKEVSRPERVSVFAKRAAHAAGL  420

Query  1797  RFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSLQT  1973
             + +KKP SSVEA+ITGGS +SS A  KQE STASS+  TFK GD+VK+VG +  G  LQ+
Sbjct  421   K-HKKPTSSVEAEITGGSTVSSQAPPKQETSTASSRGVTFKQGDKVKFVGAISAGSPLQS  479

Query  1974  -PARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAAD-FLRL  2147
              P RGP+YG +GKV+LAFE+NG SKIGVRFD+SIP+GNDLGGLCEEDHGFFC+A   L L
Sbjct  480   CPLRGPSYGCRGKVVLAFEDNGSSKIGVRFDKSIPDGNDLGGLCEEDHGFFCSASHLLHL  539

Query  2148  DNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPEN  2327
             D S  DD+DKLAI+EL EV S E KS PLILFVK+IEK+MVGN +A++  K KLE LPEN
Sbjct  540   DVSGGDDIDKLAISELLEVASNESKSLPLILFVKEIEKAMVGNSDAYTVLKSKLENLPEN  599

Query  2328  VVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQL  2507
             VVVI S+TQ DNRKEKSHPGG LFTKFG NQTALLDLAFPDN GRLHDRSKETPK +KQL
Sbjct  600   VVVIGSHTQLDNRKEKSHPGGLLFTKFGFNQTALLDLAFPDNLGRLHDRSKETPKTMKQL  659

Query  2508  TRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLC  2687
             TR+FPNKV IQ+PQDE LLSDWKQQL+RD+ET+K+QSN V+IR+VLNR+ LDCPD+E LC
Sbjct  660   TRIFPNKVTIQLPQDEALLSDWKQQLERDVETLKAQSNIVSIRSVLNRIRLDCPDLENLC  719

Query  2688  IKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSV  2867
             IKD ALT ESVEK++GWALS+H MH SE+  K+ KL ISSES++YGL++LQG+QNE KS+
Sbjct  720   IKDLALTTESVEKVVGWALSYHSMHCSEAVVKDDKLVISSESLQYGLNILQGIQNENKSI  779

Query  2868  KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  3047
             KKSLKDVVT NEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELF K
Sbjct  780   KKSLKDVVTGNEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFSK  839

Query  3048  GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFT  3227
             GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+
Sbjct  840   GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS  899

Query  3228  LASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  3407
             LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN
Sbjct  900   LASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  959

Query  3408  RPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSD  3587
             RPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KE+  P+VDL+A+ANMT+GYSGSD
Sbjct  960   RPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEDFEPDVDLEAVANMTDGYSGSD  1019

Query  3588  LKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCA  3767
             LKNLCVTAAH PIREILE+EKKE++LA+ ENRP P L+ SSDIRPL M+DF++AHEQVCA
Sbjct  1020  LKNLCVTAAHRPIREILEREKKERSLAVVENRPQPELYCSSDIRPLKMEDFKHAHEQVCA  1079

Query  3768  SVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             SVSSESTNM+ELLQWN+LYGEGGSRKKK+LSYFM
Sbjct  1080  SVSSESTNMSELLQWNDLYGEGGSRKKKSLSYFM  1113



>gb|KDO87280.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1119

 Score =  1569 bits (4062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/1117 (72%), Positives = 933/1117 (84%), Gaps = 15/1117 (1%)
 Frame = +3

Query  546   YPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGC  725
             +  NSH+ +  + FTVG  RQCDL + DPS+SK+LC L+ I+   G S  LLEI+G KG 
Sbjct  9     FTGNSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIEN-GGPSGALLEITGGKGE  67

Query  726   VQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGP  905
             V+VNG ++PK+S V L GGDE++F  SGKH+YIFQ+ +++ ++A  + P +SILEA S P
Sbjct  68    VEVNGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAP  127

Query  906   VKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGE  1085
             +K ++ EARSGDPS VA AS LASLSN++K+L L+PP      D  Q  E+ +L      
Sbjct  128   LKTMHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVD-AQNSEIASLASGCDG  186

Query  1086  PDKHDLDSDMKDVSDHNDVPLDEKSG-AISP--DSGNDNLNLENGAIDS-YDGEIGKVTG  1253
             P+    D DMKD + +ND       G  + P  D+ N+N NL++  +D+  D EIGK+ G
Sbjct  187   PEDRIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPG  246

Query  1254  APQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFD-PLISMSTRRQAFKDG  1421
             A  ELRPL+RMLAGSS+P+FD+SG IS+I+D++RE   LLKD D P + +S RRQAFKD 
Sbjct  247   ATYELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDS  306

Query  1422  LQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLS  1601
             LQ+ IL   NIEVSFE FPYYLS+ITKNVLIASTY+HLKCN F K AS+LPT+CPRILLS
Sbjct  307   LQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLS  366

Query  1602  GPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAA  1781
             GPAGSEIYQETLAKALAK+F ARLL+VDSL+LPGGS+KE D VKE+ + E+  +F KRAA
Sbjct  367   GPAGSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAA  426

Query  1782  QAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTG  1958
                 L  ++KP SSVEADITGG+A+ S A  K E STASSKN TFK GDRVK+VG + +G
Sbjct  427   ----LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSG  482

Query  1959  FSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADF  2138
              ++Q   RGP  G++G+V+L FE+N FSKIGVRFDRSIPEGN+LGG CE+DHGFFC A  
Sbjct  483   TTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASS  542

Query  2139  LRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKL  2318
             LRLD+S  D++DKLAINELFEV   E KSSPLI+FVKDIEKS+ GN +A+ A K KLE L
Sbjct  543   LRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENL  602

Query  2319  PENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAI  2498
             P NVVVI S+TQ D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNF RLHDRSKETPKA+
Sbjct  603   PSNVVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKAL  662

Query  2499  KQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIE  2678
             KQ++RLFPNKV IQ+PQDE LLSDWKQQL+RD+ET+K QSN ++IR+VL+R  LDC D+E
Sbjct  663   KQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLE  722

Query  2679  TLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNET  2858
             +LCIKDQ LT E VEKI+GWALSHHFMH SE+  K+ KL IS+ESI YGL++LQG+Q+E+
Sbjct  723   SLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSES  782

Query  2859  KSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPEL  3038
             KS+KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPEL
Sbjct  783   KSLKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPEL  842

Query  3039  FCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA  3218
             FCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA
Sbjct  843   FCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA  902

Query  3219  VFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLA  3398
             VF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLA
Sbjct  903   VFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLA  962

Query  3399  ATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYS  3578
             ATNRPFDLDEAV+RRLPRRLMVNLPDAPNREKI+R+IL KEELA +VDL+ IANM +GYS
Sbjct  963   ATNRPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYS  1022

Query  3579  GSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQ  3758
             GSDLKNLCVTAAHCPIREILEKEKKE+ALA++ENR  P L++S D+RPL MDDF+YAHEQ
Sbjct  1023  GSDLKNLCVTAAHCPIREILEKEKKERALALAENRASPPLYSSVDVRPLKMDDFKYAHEQ  1082

Query  3759  VCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             VCASVSSESTNM ELLQWNELYGEGGSRK+K+LSYFM
Sbjct  1083  VCASVSSESTNMNELLQWNELYGEGGSRKRKSLSYFM  1119



>gb|KHN03730.1| ATPase family AAA domain-containing protein 1 [Glycine soja]
Length=1233

 Score =  1563 bits (4047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 860/1262 (68%), Positives = 999/1262 (79%), Gaps = 45/1262 (4%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGPESAEQE  311
             MVETRRSSSSS +   S  SP  N KR K +E  SST       +   VNESG  + E E
Sbjct  1     MVETRRSSSSSSKRSLSSPSPPNNTKRCKVSEDSSSTT----VPSVAPVNESG-TATEPE  55

Query  312   IRSADLDGASALKSPEAPV---PEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN  482
             +  +DL   ++LK+ +  V   P K P AP+ GE LVSP   G          A+G+   
Sbjct  56    LMLSDLPETASLKAVDGCVAMSPNKSPSAPVEGEALVSPQCQGG---------ADGATGG  106

Query  483   RGKK-RQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNL  659
             R KK R  K +   AWGKLLSQ  QN HV +    FTVGQGR C+L + DP+V   LC L
Sbjct  107   RSKKQRPSKLSPKVAWGKLLSQCSQNPHVSMSDLIFTVGQGRNCNLWLKDPTVGNVLCKL  166

Query  660   KHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFT  839
              HI+R  G+S+ LLEI+G KG +QVNGK Y KN+ + L+GGDEV+FGSSGKHAYIFQ  T
Sbjct  167   SHIER-GGSSVALLEITGGKGSIQVNGKTYRKNARLILSGGDEVVFGSSGKHAYIFQLLT  225

Query  840   NEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPS  1019
             N +IS A +P SVSILEA S P+ G   EARSGDPS VA AS LASLSNL K+L LL P 
Sbjct  226   NNNISPAVIPSSVSILEAQSAPINGTQVEARSGDPSAVAGASILASLSNLPKDLSLLSPP  285

Query  1020  VCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPD-SGNDNL  1196
                  +++Q  ++ +LP  SG  D   + S+MKD +  NDV     S   S D + N+N 
Sbjct  286   AKTGKNVQQNSDISSLP--SGNEDDMPI-SEMKDAT--NDV----ASEVCSADKTVNENP  336

Query  1197  NLENGAID-SYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELL---  1364
             +L+   +D + D ++ KVT A  ELRPL+R+LAGS  PE DLS  I++I+++RREL    
Sbjct  337   SLDTAEVDINVDADVRKVTAATYELRPLLRLLAGS-CPELDLSCGITKILEERRELRELL  395

Query  1365  KDFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC  1541
             KD D P I  STRRQAF+D L+Q IL S NI+VSFE FPYYLS+ TK+VLIAST+IHLKC
Sbjct  396   KDVDTPTILASTRRQAFRDSLEQRILKSKNIDVSFETFPYYLSDTTKSVLIASTFIHLKC  455

Query  1542  NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKE  1718
               F K AS+L +V PRILLSGPAGSEIYQETL KALAK+FGARLL+VDSL LPGG+ +KE
Sbjct  456   MGFGKYASDLSSVSPRILLSGPAGSEIYQETLCKALAKHFGARLLIVDSLSLPGGAPSKE  515

Query  1719  LDPVKEAPKPER-TGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTA  1895
             +D  KE+ +PE+ + VFTKR++Q A L+ +KKPASSV+A+I GGS ISS A  KQE STA
Sbjct  516   VDSAKESSRPEKPSSVFTKRSSQTATLQ-HKKPASSVDAEIVGGSTISSQAMLKQEVSTA  574

Query  1896  SSK-NTFKTGDRVKYVGPLPTGFSL--QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDR  2066
             SSK  T K GDRVK+VG  P+  S     P+RGP+YG +GKVLLAFE+N  SKIGVRFD+
Sbjct  575   SSKGTTLKEGDRVKFVGNFPSAVSSLPNYPSRGPSYGSRGKVLLAFEDNRSSKIGVRFDK  634

Query  2067  SIPEGNDLGGLCEEDHGFFCAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILF  2243
             SIP+GNDLGGLCE+D GFFC+A+  LR+D S  DD DK+AI+++FEV S + KS PL+LF
Sbjct  635   SIPDGNDLGGLCEDDRGFFCSANHLLRVDGSGGDDADKVAISDIFEVTSNQSKSGPLVLF  694

Query  2244  VKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQT  2423
             +KDIEK+MVGN   +   K K E LP NVVVI S+T  DNRKEK+ PGG LFTKFGSNQT
Sbjct  695   IKDIEKAMVGN---YEVLKNKFESLPPNVVVIGSHTLLDNRKEKTQPGGLLFTKFGSNQT  751

Query  2424  ALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIET  2603
             ALLDLAFPDNFGRLHDRSKETPK +KQL RLFPNKV IQ+PQDE +LSDWKQQL+RDIET
Sbjct  752   ALLDLAFPDNFGRLHDRSKETPKVMKQLGRLFPNKVTIQLPQDEGILSDWKQQLERDIET  811

Query  2604  MKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTK  2783
             MK+QSN V+IR VLNR+ LDCPD+ETL IKDQ LT ESVEKIIGWA+S+HFMHSS++S K
Sbjct  812   MKAQSNIVSIRTVLNRIGLDCPDLETLSIKDQTLTTESVEKIIGWAISYHFMHSSKASIK  871

Query  2784  EGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFD  2963
             + KL IS+ES+ YG+++LQG+QNE K++KKSLKDVVTENEFEKKLLADVIPP+DIGVTFD
Sbjct  872   DSKLVISAESLNYGINILQGIQNENKNLKKSLKDVVTENEFEKKLLADVIPPTDIGVTFD  931

Query  2964  DIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAG  3143
             DIGALENVKDTLKELVMLPLQRPELFCKGQL KPCKGILLFGPPGTGKTMLAKAVATEAG
Sbjct  932   DIGALENVKDTLKELVMLPLQRPELFCKGQLAKPCKGILLFGPPGTGKTMLAKAVATEAG  991

Query  3144  ANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMR  3323
             ANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+P EHEAMR
Sbjct  992   ANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPSEHEAMR  1051

Query  3324  KMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR  3503
             KMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR
Sbjct  1052  KMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR  1111

Query  3504  IILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENR  3683
             +IL KE+LAP+VD +AIANMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE++LA+SE++
Sbjct  1112  VILVKEDLAPDVDFEAIANMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERSLALSESK  1171

Query  3684  PLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSY  3863
             PLP L  S DIRPL MDDFRYAHEQVCASVSSESTNM ELLQWN+LYGEGGSRK ++LSY
Sbjct  1172  PLPGLCGSGDIRPLKMDDFRYAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKMRSLSY  1231

Query  3864  FM  3869
             FM
Sbjct  1232  FM  1233



>ref|XP_010259603.1| PREDICTED: uncharacterized protein LOC104598971 isoform X1 [Nelumbo 
nucifera]
Length=1244

 Score =  1563 bits (4046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 833/1242 (67%), Positives = 992/1242 (80%), Gaps = 41/1242 (3%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDM---LGEKTPGAVNESGPESAEQEIRSADLDGASALKSPE---A  362
             NGKR K  E+ SST+++      +T G+  ESG ES +QE+R +DL      K  +   A
Sbjct  25    NGKRLKVAEASSSTNEIPCVTPVETLGSSKESGCESHDQEVRLSDLSAFGPSKESDDCDA  84

Query  363   PVPEKLPEAPLGGEPLVSPMILGDSAIDVDK-VKANGSALNRGKKRQLKSNLGTAWGKLL  539
              + EK P+    GE L  P   G  AI+ D  V+  G+A+NR +KR  KS    AWG+LL
Sbjct  85    TMLEKSPDRNGEGEVLAPPSATGGPAIEADNAVELVGAAMNRARKRSTKSRTKVAWGRLL  144

Query  540   SQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKK  719
             SQ  QN H+ +  S FTVGQG+QC+LC+ DPSVS  LC L+H++R  G+S+ LLEI G K
Sbjct  145   SQCSQNPHLLMCGSPFTVGQGQQCNLCLRDPSVSTILCKLRHLER-GGSSVALLEILGSK  203

Query  720   GCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHS  899
             G VQVNGK+  KNS+  L+GGDE+IF S+G++AYIFQ+ T+E++++ ++P SV+I E+ +
Sbjct  204   GVVQVNGKVVGKNSSTILSGGDELIFSSTGQNAYIFQQLTDENLTSPALPSSVNISESQN  263

Query  900   GPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVAS  1079
                              VA AS LASLSNL+K+L L PP+   + +++   E   LP   
Sbjct  264   A----------------VAGASILASLSNLRKDLSLTPPAQTGE-EVQHDLERQTLPTGC  306

Query  1080  GEPDKHDLDSDMKDVSDH---NDVPLDEKSGAI-SPDSGNDN-LNLENGAIDS-YDGEIG  1241
               PD      + KD+S+H     V   EK+  I SPD+ +DN ++L+   +++  D E+G
Sbjct  307   -IPDIEITCHNRKDISEHVEETGVSSSEKAPVILSPDNASDNPVHLDGAGLNTRLDAEVG  365

Query  1242  KVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKDFD-PLISMSTRRQAFKD  1418
             K+ G   ELRPL+RML GSS P+F+LSG++ + ID++RE+LKDF  P I  ST++QAFKD
Sbjct  366   KIPGTNYELRPLLRMLTGSSLPDFELSGSVFKSIDEQREILKDFGRPTILSSTKQQAFKD  425

Query  1419  GLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILL  1598
              L+Q IL S+NIEVSF++FPYYLSE TKN+LIASTY+HLKC ++ K  ++LPTV PRILL
Sbjct  426   SLRQGILSSSNIEVSFDNFPYYLSESTKNILIASTYMHLKCKEYAKYITDLPTVSPRILL  485

Query  1599  SGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFTKR  1775
             SGP+GSEIYQETLAKALAK+F ARLL+VD   LPG  S K+ + +KE  + E+  V  +R
Sbjct  486   SGPSGSEIYQETLAKALAKHFEARLLMVDFPQLPGALSTKDSESIKEI-RLEKM-VTKQR  543

Query  1776  AAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPL-  1949
             A QA  L+  KKPASSVEADI G S +SS A  KQEASTASSK+ TFK GDRV+YVG L 
Sbjct  544   ATQADALQL-KKPASSVEADIIGTSVLSSQALPKQEASTASSKSFTFKQGDRVRYVGSLV  602

Query  1950  -PTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFF  2123
              P+GF  LQT +RGP  GY+GKV+LAFEENG SK+GVRFD++IPEGN LGGLCEEDHGFF
Sbjct  603   NPSGFPPLQTSSRGPGPGYRGKVVLAFEENGSSKVGVRFDKTIPEGNTLGGLCEEDHGFF  662

Query  2124  CAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKL  2303
             C AD L L+NS  DDLDKLAINELFE+   E KS+PLILF+KDIEKSMVGN EA++AFK 
Sbjct  663   CTADLLCLENSGSDDLDKLAINELFELACSESKSAPLILFMKDIEKSMVGNQEAYTAFKT  722

Query  2304  KLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKE  2483
             +LE LPEN+V+I S+TQ DNRKEKSHPGG LFTKFGS+QTALLD AFPDNFGRLHDR+KE
Sbjct  723   RLENLPENIVIIGSHTQLDNRKEKSHPGGLLFTKFGSSQTALLDFAFPDNFGRLHDRNKE  782

Query  2484  TPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELD  2663
              PKA KQLTRLFPNKV IQ+PQDE LL DWKQ+LDRD++T+K+QSN +NIR+VLNR  LD
Sbjct  783   VPKATKQLTRLFPNKVTIQLPQDEALLLDWKQRLDRDVKTLKAQSNIINIRSVLNRNGLD  842

Query  2664  CPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQG  2843
             CPD+ TLCIKD ALT ESVEKI+GWALSHHFM+    S K+ KL ISSESIR+GL++L  
Sbjct  843   CPDLGTLCIKDHALTIESVEKIVGWALSHHFMNRDRDSPKDAKLVISSESIRFGLNILNS  902

Query  2844  VQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPL  3023
             +Q+E+KS+KKSLKDVVTENEFEK+LLADVIPP+DIGVTFDDIGALENVK+TLKELVMLPL
Sbjct  903   IQSESKSLKKSLKDVVTENEFEKRLLADVIPPNDIGVTFDDIGALENVKETLKELVMLPL  962

Query  3024  QRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  3203
             QRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE
Sbjct  963   QRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  1022

Query  3204  KYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKER  3383
             KYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKER
Sbjct  1023  KYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKER  1082

Query  3384  VLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANM  3563
             VLVLAATNRPFDLDEAV+RRLPRRLMVNLPDA NREKILR+IL KEE+AP+VDL+AIA M
Sbjct  1083  VLVLAATNRPFDLDEAVVRRLPRRLMVNLPDAANREKILRVILAKEEMAPDVDLEAIACM  1142

Query  3564  TEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFR  3743
             T+GYSGSDLKNLCVTAAHCPIREILEKEKKEKALA++EN+P P L+ S DIRPLNM+DF+
Sbjct  1143  TDGYSGSDLKNLCVTAAHCPIREILEKEKKEKALALAENKPPPTLYGSGDIRPLNMEDFK  1202

Query  3744  YAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
              AHEQVCASVSSES NM ELLQWNELYGEGGSRKK++LSYFM
Sbjct  1203  RAHEQVCASVSSESANMNELLQWNELYGEGGSRKKRSLSYFM  1244



>gb|KDO87281.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1103

 Score =  1561 bits (4041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/1106 (72%), Positives = 927/1106 (84%), Gaps = 15/1106 (1%)
 Frame = +3

Query  579   STFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKN  758
             + FTVG  RQCDL + DPS+SK+LC L+ I+   G S  LLEI+G KG V+VNG ++PK+
Sbjct  4     AVFTVGHNRQCDLYLKDPSISKNLCRLRRIE-NGGPSGALLEITGGKGEVEVNGNVHPKD  62

Query  759   STVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSG  938
             S V L GGDE++F  SGKH+YIFQ+ +++ ++A  + P +SILEA S P+K ++ EARSG
Sbjct  63    SQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKTMHIEARSG  122

Query  939   DPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMK  1118
             DPS VA AS LASLSN++K+L L+PP      D  Q  E+ +L      P+    D DMK
Sbjct  123   DPSAVAGASILASLSNIQKDLSLIPPPTKAGVD-AQNSEIASLASGCDGPEDRIPDVDMK  181

Query  1119  DVSDHNDVPLDEKSG-AISP--DSGNDNLNLENGAIDS-YDGEIGKVTGAPQELRPLIRM  1286
             D + +ND       G  + P  D+ N+N NL++  +D+  D EIGK+ GA  ELRPL+RM
Sbjct  182   DATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATYELRPLLRM  241

Query  1287  LAGSSTPEFDLSGNISRIIDQRRE---LLKDFD-PLISMSTRRQAFKDGLQQTILDSNNI  1454
             LAGSS+P+FD+SG IS+I+D++RE   LLKD D P + +S RRQAFKD LQ+ IL   NI
Sbjct  242   LAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQEGILGPENI  301

Query  1455  EVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQET  1634
             EVSFE FPYYLS+ITKNVLIASTY+HLKCN F K AS+LPT+CPRILLSGPAGSEIYQET
Sbjct  302   EVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPAGSEIYQET  361

Query  1635  LAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKP  1814
             LAKALAK+F ARLL+VDSL+LPGGS+KE D VKE+ + E+  +F KRAA    L  ++KP
Sbjct  362   LAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAA----LLQHRKP  417

Query  1815  ASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSLQTPARGPA  1991
              SSVEADITGG+A+ S A  K E STASSKN TFK GDRVK+VG + +G ++Q   RGP 
Sbjct  418   TSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTVQPTLRGPG  477

Query  1992  YGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDL  2171
              G++G+V+L FE+N FSKIGVRFDRSIPEGN+LGG CE+DHGFFC A  LRLD+S  D++
Sbjct  478   IGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRLDSSLGDEV  537

Query  2172  DKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYT  2351
             DKLAINELFEV   E KSSPLI+FVKDIEKS+ GN +A+ A K KLE LP NVVVI S+T
Sbjct  538   DKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSNVVVIGSHT  597

Query  2352  QTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKV  2531
             Q D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNF RLHDRSKETPKA+KQ++RLFPNKV
Sbjct  598   QLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQISRLFPNKV  657

Query  2532  MIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTN  2711
              IQ+PQDE LLSDWKQQL+RD+ET+K QSN ++IR+VL+R  LDC D+E+LCIKDQ LT 
Sbjct  658   TIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLCIKDQTLTT  717

Query  2712  ESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVV  2891
             E VEKI+GWALSHHFMH SE+  K+ KL IS+ESI YGL++LQG+Q+E+KS+KKSLKDVV
Sbjct  718   EGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSLKKSLKDVV  777

Query  2892  TENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCK  3071
             TENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCK
Sbjct  778   TENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCK  837

Query  3072  GILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPS  3251
             GILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPS
Sbjct  838   GILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPS  897

Query  3252  VVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEA  3431
             VVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEA
Sbjct  898   VVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEA  957

Query  3432  VIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTA  3611
             V+RRLPRRLMVNLPDAPNREKI+R+IL KEELA +VDL+ IANM +GYSGSDLKNLCVTA
Sbjct  958   VVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSDLKNLCVTA  1017

Query  3612  AHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTN  3791
             AHCPIREILEKEKKE+ALA++ENR  P L++S D+RPL MDDF+YAHEQVCASVSSESTN
Sbjct  1018  AHCPIREILEKEKKERALALAENRASPPLYSSVDVRPLKMDDFKYAHEQVCASVSSESTN  1077

Query  3792  MTELLQWNELYGEGGSRKKKALSYFM  3869
             M ELLQWNELYGEGGSRK+K+LSYFM
Sbjct  1078  MNELLQWNELYGEGGSRKRKSLSYFM  1103



>ref|XP_006588597.1| PREDICTED: uncharacterized protein LOC100794406 isoform X3 [Glycine 
max]
Length=1237

 Score =  1559 bits (4036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 856/1263 (68%), Positives = 996/1263 (79%), Gaps = 43/1263 (3%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSSTDDMLGEKTPGAVNESGP--ESAE  305
             MVETRRSSSSS +   S  SP  N KR K +E  SST       +   VNESG   ESAE
Sbjct  1     MVETRRSSSSSSKRSLSSPSPPNNTKRCKVSEDSSSTT----VPSVAPVNESGTANESAE  56

Query  306   QEIRSADLDGASALKSPEAPV---PEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSA  476
              E+  +DL   ++LK+ +  V   P+K P  P+ GE         + +  V    A  + 
Sbjct  57    PELMLSDLPETASLKAVDGCVAMSPDKSPSVPVEGE-------TAEKSKGVLMAAATTTG  109

Query  477   LNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCN  656
                 K+R  K +   AWGKLLSQ  QN HV +    FTVGQGR C+L + DP+V   LC 
Sbjct  110   GRSKKQRPSKLSPKVAWGKLLSQCSQNPHVSMSDLIFTVGQGRNCNLWLKDPTVGNVLCK  169

Query  657   LKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKF  836
             L HI+R  G+S+ LLEI+G KG +QVNGK Y KN+ + L+GGDEV+FGSSGKHAYIFQ  
Sbjct  170   LSHIER-GGSSVALLEITGGKGSIQVNGKTYRKNARLILSGGDEVVFGSSGKHAYIFQLL  228

Query  837   TNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPP  1016
             TN +IS A +P SVSILEA S P+ G   EARSGDPS VA AS LASLSNL K+L LL P
Sbjct  229   TNNNISPAVIPSSVSILEAQSAPINGTQVEARSGDPSAVAGASILASLSNLPKDLSLLSP  288

Query  1017  SVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPD-SGNDN  1193
                   +++Q  ++ +LP  SG  D   + S+MKD +  NDV     S   S D + N+N
Sbjct  289   PAKTGKNVQQNSDISSLP--SGNEDDMPI-SEMKDAT--NDV----ASEVCSADKTVNEN  339

Query  1194  LNLENGAID-SYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELL--  1364
              +L+   +D + D ++ KVT A  ELRPL+R+LAGS  PE DLS  I++I+++RREL   
Sbjct  340   PSLDTAEVDINVDADVRKVTAATYELRPLLRLLAGS-CPELDLSCGITKILEERRELREL  398

Query  1365  -KDFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLK  1538
              KD D P I  STRRQAF+D L+Q IL S NI+VSFE FPYYLS+ TK+VLIAST+IHLK
Sbjct  399   LKDVDTPTILASTRRQAFRDSLEQRILKSKNIDVSFETFPYYLSDTTKSVLIASTFIHLK  458

Query  1539  CNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AK  1715
             C  F K AS+L +V PRILLSGPAGSEIYQETL KALAK+FGARLL+VDSL LPGG+ +K
Sbjct  459   CMGFGKYASDLSSVSPRILLSGPAGSEIYQETLCKALAKHFGARLLIVDSLSLPGGAPSK  518

Query  1716  ELDPVKEAPKPER-TGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEAST  1892
             E+D  KE+ +PE+ + VFTKR++Q A L+ +KKPASSV+A+I GGS ISS A  KQE ST
Sbjct  519   EVDSAKESSRPEKPSSVFTKRSSQTATLQ-HKKPASSVDAEIVGGSTISSQAMLKQEVST  577

Query  1893  ASSK-NTFKTGDRVKYVGPLPTGFSL--QTPARGPAYGYKGKVLLAFEENGFSKIGVRFD  2063
             ASSK  T K GDRVK+VG  P+  S     P+RGP+YG +GKVLLAFE+N  SKIGVRFD
Sbjct  578   ASSKGTTLKEGDRVKFVGNFPSAVSSLPNYPSRGPSYGSRGKVLLAFEDNRSSKIGVRFD  637

Query  2064  RSIPEGNDLGGLCEEDHGFFCAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLIL  2240
             +SIP+GNDLGGLCEED GFFC+A+  LR+D S  DD DK+AI+++FEV S + KS PL+L
Sbjct  638   KSIPDGNDLGGLCEEDRGFFCSANHLLRVDGSGGDDADKVAISDIFEVTSNQSKSGPLVL  697

Query  2241  FVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQ  2420
             F+KDIEK+MVGN   +   K K E LP NVVVI S+T  DNRKEK+ PGG LFTKFGSNQ
Sbjct  698   FIKDIEKAMVGN---YEVLKNKFESLPPNVVVIGSHTLLDNRKEKTQPGGLLFTKFGSNQ  754

Query  2421  TALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIE  2600
             TALLDLAFPDNFGRLHDRSKETPK +KQL RLFPNKV IQ+PQDE +LSDWKQQL+RDIE
Sbjct  755   TALLDLAFPDNFGRLHDRSKETPKVMKQLGRLFPNKVTIQLPQDEAILSDWKQQLERDIE  814

Query  2601  TMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESST  2780
             TMK+QSN V+IR VLNR+ LDCPD+ETL IKDQ LT ESVEKIIGWA+S+HFMHSS++S 
Sbjct  815   TMKAQSNIVSIRTVLNRIGLDCPDLETLSIKDQTLTTESVEKIIGWAISYHFMHSSKASI  874

Query  2781  KEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTF  2960
             K+ KL IS+ES+ YG+++LQG+QNE K++KKSLKDVVTENEFEKKLLADVIPP+DIGVTF
Sbjct  875   KDSKLVISAESLNYGINILQGIQNENKNLKKSLKDVVTENEFEKKLLADVIPPTDIGVTF  934

Query  2961  DDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEA  3140
             DDIGALENVKDTLKELVMLPLQRPELFCKGQL KPCKGILLFGPPGTGKTMLAKAVATEA
Sbjct  935   DDIGALENVKDTLKELVMLPLQRPELFCKGQLAKPCKGILLFGPPGTGKTMLAKAVATEA  994

Query  3141  GANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAM  3320
             GANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+P EHEAM
Sbjct  995   GANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPSEHEAM  1054

Query  3321  RKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKIL  3500
             RKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKIL
Sbjct  1055  RKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKIL  1114

Query  3501  RIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSEN  3680
             R+IL KE+LAP+VD +AIANMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE++LA+SE+
Sbjct  1115  RVILVKEDLAPDVDFEAIANMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERSLALSES  1174

Query  3681  RPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALS  3860
             +PLP L  S DIRPL MDDFRYAHEQVCASVSSESTNM ELLQWN+LYGEGGSRK ++LS
Sbjct  1175  KPLPGLCGSGDIRPLKMDDFRYAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKMRSLS  1234

Query  3861  YFM  3869
             YFM
Sbjct  1235  YFM  1237



>ref|XP_004495974.1| PREDICTED: uncharacterized protein LOC101498262 [Cicer arietinum]
Length=1236

 Score =  1557 bits (4032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 828/1237 (67%), Positives = 981/1237 (79%), Gaps = 41/1237 (3%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPG-AVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLP  383
             KRSK +E  SST        P   VNES P + E EI+ +DL   ++LK  +    +K P
Sbjct  25    KRSKVSEDASST------TLPSLPVNESAPRN-ESEIQPSDLPQTASLKVVDGE-NDKSP  76

Query  384   EAPLGGEPLVSPMILGDSAIDVDKVKANGSAL-NRGKKRQLKSNLGTAWGKLLSQYPQNS  560
               P+  +PLVSP   G++A   +K K     +  R K+  +K +    WGKL+SQ+ QN 
Sbjct  77    SLPIEDDPLVSPQSPGETA---EKSKVAAPVVPCRKKRSAVKLSPKAEWGKLISQFSQNP  133

Query  561   HVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNG  740
             HV +    FTVGQGRQ +L + DP+V   LC L HI+   G+S+ LLEI+G KG VQVNG
Sbjct  134   HVSISDPIFTVGQGRQSNLMLKDPTVGSVLCKLSHIEH-GGSSVALLEITGGKGTVQVNG  192

Query  741   KIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVN  920
             K Y +N+ + LNGGDEV+FGSSGKHAYIFQ+  + ++S A +PP VSILEA S P+ G+ 
Sbjct  193   KTYRRNARLILNGGDEVVFGSSGKHAYIFQQLKSNNVSTADLPP-VSILEAQSAPINGMQ  251

Query  921   FEARSGDPSTVAVASTlaslsnlkk--ellllPPSVCNDNDIKQGPEMPALPVASGEPDK  1094
              EARSGDPS VA AS LASLSN+     L+  P + C     KQ  ++ +LP  SG  D 
Sbjct  252   VEARSGDPSAVAGASILASLSNIHNDLSLVSPPATTCK----KQSADISSLP--SGHEDN  305

Query  1095  HDLDSDMKDVSDHNDVPLDEKSGAISPDSG---NDNLNLENGAIDS-YDGEIGKVTGAPQ  1262
                D++MKD ++ N+      SG   P S    NDN +L+   +D+  D ++GK+T A  
Sbjct  306   IP-DNEMKDTTNDNESAGAFPSGKAVPASSTNVNDNPSLDTMDVDAEVDTDVGKMTAANN  364

Query  1263  ELRPLIRMLAGSSTPEFDLSGNISRIIDQRREL---LKDFDPLISMSTRRQAFKDGLQQT  1433
             ELRPL+ MLAGS + E D+SG+IS+I++ RREL   LKD D  I  STR+QAFKD LQQ 
Sbjct  365   ELRPLLCMLAGSGS-EIDISGSISKILEDRRELRELLKDVDTPILASTRQQAFKDSLQQR  423

Query  1434  ILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAG  1613
             IL++ +I+VSFE FPYYLS+ TKNVLIASTYIHLKC    K AS+LP+V PRILLSGPAG
Sbjct  424   ILNAEDIDVSFETFPYYLSDTTKNVLIASTYIHLKCKGIGKYASDLPSVSPRILLSGPAG  483

Query  1614  SEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAA  1790
             SEIYQETL+KALAK+FGA+LL+VDSL LPGG+ +KE+D  KE+ KPER  V  KR  QA+
Sbjct  484   SEIYQETLSKALAKHFGAKLLIVDSLSLPGGTPSKEVDSPKESSKPERPSVILKRCTQAS  543

Query  1791  VLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKNT-FKTGDRVKYVGPLPTGFS-  1964
              L  +KKP SSV+A+I GGS +SS A  KQE STASSK T  K GDRVK+VG  P   S 
Sbjct  544   TLH-HKKPTSSVDAEIIGGSTLSSQAMLKQEVSTASSKGTALKKGDRVKFVGNFPPAVSS  602

Query  1965  LQT-PARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFL  2141
             LQ   +RGP+YG++GKV+LAFE+N  SKIGVRFD+SIP+GNDLGG CE DHGFFC A+ L
Sbjct  603   LQNCSSRGPSYGFRGKVVLAFEDNESSKIGVRFDKSIPDGNDLGGHCEYDHGFFCYANHL  662

Query  2142  -RLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKL  2318
              R+D+S  DD DK+AINE+FEV S +CKS  L+LF+KDIEK+MVGN +     K K E L
Sbjct  663   QRVDSSGGDDSDKVAINEIFEVASNQCKSGSLVLFIKDIEKAMVGNSDVL---KSKFESL  719

Query  2319  PENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAI  2498
             P+N+VVI S TQ D+RKEK+HPGG LFTKFGSNQTALLDLAFPDNF +LHDRSKET K +
Sbjct  720   PQNIVVIGSNTQLDSRKEKTHPGGLLFTKFGSNQTALLDLAFPDNFSKLHDRSKETSKVM  779

Query  2499  KQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIE  2678
             KQL RLFPNKV IQ+PQDETLLSDWKQQLDRDIETMK+ +N V+IR+VLNR+ LDC D+E
Sbjct  780   KQLNRLFPNKVTIQLPQDETLLSDWKQQLDRDIETMKAHANVVSIRSVLNRIGLDCSDLE  839

Query  2679  TLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNET  2858
             T+CIKDQ LT E+VEKIIGWA+S+HFMHSS+ S KE KLAIS+ESI+YG ++LQG+QNE 
Sbjct  840   TICIKDQTLTTENVEKIIGWAISYHFMHSSDVSAKESKLAISAESIKYGFNILQGIQNEN  899

Query  2859  KSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPEL  3038
             K+ KKSLKDVVTENEFEKKLL DVIPP+DIGVTFDDIGALENVK+TLKELVMLPL+RPEL
Sbjct  900   KNGKKSLKDVVTENEFEKKLLGDVIPPTDIGVTFDDIGALENVKETLKELVMLPLKRPEL  959

Query  3039  FCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA  3218
             FCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA
Sbjct  960   FCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA  1019

Query  3219  VFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLA  3398
             VF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTK+KER+LVLA
Sbjct  1020  VFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKEKERILVLA  1079

Query  3399  ATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYS  3578
             ATNRPFDLDEAVIRRLPRRLMV+LPDAPNR KILR+IL KE+LAP+VDL+AIANM++GYS
Sbjct  1080  ATNRPFDLDEAVIRRLPRRLMVDLPDAPNRGKILRVILAKEDLAPDVDLEAIANMSDGYS  1139

Query  3579  GSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQ  3758
             GSDLKNLCVTAAHCPIREILEKEKKE++LA++EN+PLP L +S+DIRPL M+DFRYAHEQ
Sbjct  1140  GSDLKNLCVTAAHCPIREILEKEKKERSLALAENKPLPGLCSSADIRPLKMEDFRYAHEQ  1199

Query  3759  VCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             VCASVSSESTNM EL QWN+LYGEGGSRK ++LSYFM
Sbjct  1200  VCASVSSESTNMNELQQWNDLYGEGGSRKMRSLSYFM  1236



>gb|KDO87277.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1223

 Score =  1553 bits (4021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 821/1234 (67%), Positives = 971/1234 (79%), Gaps = 50/1234 (4%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  386
             KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27    KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  387   APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGTA--WGKLLSQYPQ  554
             A +  + LVSP   G++A+D +K KA G   N R KKR  K   +G+   W +L+SQ  Q
Sbjct  84    ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQ  143

Query  555   NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQV  734
             NSH+ +  + FTVG  RQCDL + DPS+SK+LC L+ I+   G S  LLEI+G KG V+V
Sbjct  144   NSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIE-NGGPSGALLEITGGKGEVEV  202

Query  735   NGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKG  914
             NG ++PK+S V L GGDE++F  SGKH+YIFQ+ +++ ++A  + P +SILEA S P+K 
Sbjct  203   NGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKT  262

Query  915   VNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDK  1094
             ++ EARSGDPS VA AS LASLSN++K+L L+PP      D  Q  E+ +L      P+ 
Sbjct  263   MHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVD-AQNSEIASLASGCDGPED  321

Query  1095  HDLDSDMKDVSDHNDVPLDEKSG-AISP--DSGNDNLNLENGAIDS-YDGEIGKVTGAPQ  1262
                D DMKD + +ND       G  + P  D+ N+N NL++  +D+  D EIGK+ GA  
Sbjct  322   RIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATY  381

Query  1263  ELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFD-PLISMSTRRQAFKDGLQQ  1430
             ELRPL+RMLAGSS+P+FD+SG IS+I+D++RE   LLKD D P + +S RRQAFKD LQ+
Sbjct  382   ELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQE  441

Query  1431  TILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPA  1610
              IL   NIEVSFE FPYYLS+ITKNVLIASTY+HLKCN F K AS+LPT+CPRILLSGPA
Sbjct  442   GILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPA  501

Query  1611  GSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAAQAA  1790
             GSEIYQETLAKALAK+F ARLL+VDSL+LPGGS+KE D VKE+ + E+  +F KRAA   
Sbjct  502   GSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAA---  558

Query  1791  VLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSL  1967
              L  ++KP SSVEADITGG+A+ S A  K E STASSKN TFK GDRVK+VG + +G ++
Sbjct  559   -LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTV  617

Query  1968  QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRL  2147
             Q   RGP  G++G+V+L FE+N FSKIGVRFDRSIPEGN+LGG CE+DHGFFC A  LRL
Sbjct  618   QPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRL  677

Query  2148  DNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPEN  2327
             D+S  D++DKLAINELFEV   E KSSPLI+FVKDIEKS+ GN +A+ A K KLE LP N
Sbjct  678   DSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSN  737

Query  2328  VVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQL  2507
             VVVI S+TQ D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNF RLHDRSKETPKA+KQ+
Sbjct  738   VVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQI  797

Query  2508  TRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLC  2687
             +RLFPNKV IQ+PQDE LLSDWKQQL+RD+ET+K QSN ++IR+VL+R  LDC D+E+LC
Sbjct  798   SRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLC  857

Query  2688  IKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSV  2867
             IKDQ LT E VEKI+GWALSHHFMH SE+  K+ KL IS+ESI YGL++LQG+Q+E+KS+
Sbjct  858   IKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSL  917

Query  2868  KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  3047
             KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK
Sbjct  918   KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  977

Query  3048  GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFT  3227
             GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK              
Sbjct  978   GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK--------------  1023

Query  3228  LASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  3407
                           VDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN
Sbjct  1024  --------------VDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  1069

Query  3408  RPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSD  3587
             RPFDLDEAV+RRLPRRLMVNLPDAPNREKI+R+IL KEELA +VDL+ IANM +GYSGSD
Sbjct  1070  RPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSD  1129

Query  3588  LKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCA  3767
             LKNLCVTAAHCPIREILEKEKKE+ALA++ENR  P L++S D+RPL MDDF+YAHEQVCA
Sbjct  1130  LKNLCVTAAHCPIREILEKEKKERALALAENRASPPLYSSVDVRPLKMDDFKYAHEQVCA  1189

Query  3768  SVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             SVSSESTNM ELLQWNELYGEGGSRK+K+LSYFM
Sbjct  1190  SVSSESTNMNELLQWNELYGEGGSRKRKSLSYFM  1223



>ref|XP_009342111.1| PREDICTED: uncharacterized protein LOC103934131 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009342139.1| PREDICTED: uncharacterized protein LOC103934149 isoform X1 [Pyrus 
x bretschneideri]
Length=1253

 Score =  1550 bits (4014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 824/1245 (66%), Positives = 980/1245 (79%), Gaps = 34/1245 (3%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTP----GAVNESGPESAEQEIRSADLDGASALKSP---E  359
             N KRSKA+++ SS ++ +    P    G + ESG +S E E+R +D     +LK+    +
Sbjct  21    NPKRSKASDA-SSANNGVRSGPPAEPLGPIKESGSQSPELELRPSDPPTTDSLKASNGSD  79

Query  360   APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKK---RQLKSNLGTAWG  530
             A   E+ P+A   GE LVSP  LG++A+         + L R KK   +  KSN   AWG
Sbjct  80    ATALERSPDAVPEGEALVSPQPLGETAVR--------AGLKRAKKLPKKTAKSNSKAAWG  131

Query  531   KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEIS  710
              L+SQ  +N H+ +  + FTVGQ R+C LC+ DPS+S +LC LKH +RE G S   LEI 
Sbjct  132   MLISQCSKNPHLFICDTVFTVGQSRECHLCIKDPSISTTLCKLKHFKRE-GLSTAELEII  190

Query  711   GKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILE  890
             G    VQVN K Y +++ V LNGGDEV+F SSG+HAYIFQ  TN++  AA   PS+SI+E
Sbjct  191   GGDSDVQVNEKTYQRDTKVILNGGDEVVFSSSGRHAYIFQPLTNDNNIAAQGIPSISIIE  250

Query  891   AHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALP  1070
               + PV G++ EARSGDPS V  AS LAS+SN+  +L LLP      ++++Q  EM +LP
Sbjct  251   TQNAPVNGMHMEARSGDPSAVDGASILASMSNVPNDLSLLPEPAKAGDELQQDAEMTSLP  310

Query  1071  VASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVT  1250
              AS   D    D  MK+ ++ ND    +K     PD+  +N NL++ A+D  + E  KV+
Sbjct  311   SASRGSDDCTPDIVMKESTNVNDQVSGDKDIVQYPDTAKENSNLDSVALD-MNIETRKVS  369

Query  1251  GAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLISMSTRRQAFKDG  1421
             GA  ELRPL+RM  GSS+ +FDL+G+IS+I+D++RE   LL + DP + +STRRQAFK+ 
Sbjct  370   GATHELRPLLRMFGGSSSTDFDLTGSISKILDEQREIGELLHNLDPPMLISTRRQAFKEK  429

Query  1422  LQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLS  1601
             LQQ IL  ++I+VSFE FPYYLSE TK VLIAST+ +LKC+KF K  S LPT  PRILLS
Sbjct  430   LQQGILSPDDIDVSFESFPYYLSETTKKVLIASTHPNLKCSKFGKYFSSLPTGSPRILLS  489

Query  1602  GPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSA---KELDPVKEAPKPERTGVFTK  1772
             GPAGSEIYQETLAKALAK+FGARLL+VDSL+LPG  A   K+ D VKE P+PER  +F K
Sbjct  490   GPAGSEIYQETLAKALAKHFGARLLIVDSLLLPGVQAPPPKDSDSVKEVPRPERVSIFAK  549

Query  1773  RAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPL  1949
             RAA AA  + +KKP SSVEA+ITGGS +SS A  KQE STASS+  TFK GD+VK+VG +
Sbjct  550   RAAHAAGFK-HKKPTSSVEAEITGGSTVSSQALPKQETSTASSRGITFKQGDKVKFVGAI  608

Query  1950  PTG-FSLQTPA--RGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGF  2120
              +G   LQ+    RGP+YG +GKV+LAFEEN  +KIGVRFD+SIP+GNDLGGLCEED GF
Sbjct  609   SSGPLQLQSCPLLRGPSYGCRGKVVLAFEENEAAKIGVRFDKSIPDGNDLGGLCEEDRGF  668

Query  2121  FCAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAF  2297
             FC+A   L LD S  DD+DKLAI EL EV S E KS PLI+F+KDIEK M GNP+A+S  
Sbjct  669   FCSASHLLPLDVSGGDDIDKLAIGELLEVASHESKSLPLIVFLKDIEKVMAGNPDAYSVL  728

Query  2298  KLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFG-RLHDR  2474
             K KLE LPENVVVI S+TQ D RKEKSHPG  LFTKFG NQTALLDLAFPDN G RLHDR
Sbjct  729   KCKLENLPENVVVIGSHTQLDTRKEKSHPGSLLFTKFGFNQTALLDLAFPDNLGGRLHDR  788

Query  2475  SKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRV  2654
             SKETPK +KQL+R+FPNKV IQ+PQDETLLSDWKQQL+RD+ET+K+QSN V IR+VLNRV
Sbjct  789   SKETPKTMKQLSRIFPNKVTIQLPQDETLLSDWKQQLERDVETLKAQSNIVTIRSVLNRV  848

Query  2655  ELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSV  2834
              +DCPD+E+LCI D AL  ESVEK++GWA+SHH MH S++  K+ KL IS+ES++ GL++
Sbjct  849   AVDCPDLESLCINDLALATESVEKVVGWAISHHLMHCSDALVKDDKLVISTESLKDGLNI  908

Query  2835  LQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVM  3014
             LQGVQNE KS+KKSLKDVVT NEFEKKLL DVIPPSDIGV+FDDIGALENVKDTLKELVM
Sbjct  909   LQGVQNENKSIKKSLKDVVTGNEFEKKLLVDVIPPSDIGVSFDDIGALENVKDTLKELVM  968

Query  3015  LPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG  3194
             LPLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG
Sbjct  969   LPLQRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG  1028

Query  3195  EGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKD  3374
             EGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD
Sbjct  1029  EGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKD  1088

Query  3375  KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAI  3554
             KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKILR+IL KE+L P+VDL+A+
Sbjct  1089  KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAQNREKILRVILAKEDLEPDVDLEAV  1148

Query  3555  ANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMD  3734
             AN+T+GYSGSDLKNLCV AAH PIREILEKEKKE++LA++ENRP+P L+ S+DIRPL M+
Sbjct  1149  ANLTDGYSGSDLKNLCVAAAHLPIREILEKEKKERSLALAENRPVPELYCSTDIRPLKME  1208

Query  3735  DFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             DF++AHEQVCASVSSESTNM ELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1209  DFKHAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKKTSLSYFM  1253



>gb|EYU46684.1| hypothetical protein MIMGU_mgv1a000404mg [Erythranthe guttata]
Length=1182

 Score =  1548 bits (4007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 815/1159 (70%), Positives = 931/1159 (80%), Gaps = 48/1159 (4%)
 Frame = +3

Query  432   DSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQC  611
             DS ++ +    +G   + G K QLKSN   AWGKL+SQ P+  HV + +  FTVGQGRQC
Sbjct  59    DSVVNEEDEGKSGGPSDNGGKGQLKSNGDAAWGKLISQCPKIPHVVIHRPIFTVGQGRQC  118

Query  612   DLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEV  791
             DL +  P+VS SLCNLK  + E G S T LEI+G KG V+VNGK   K+ST PL  GDE+
Sbjct  119   DLSLS-PTVSNSLCNLKRKESEGGESCTELEITGNKGSVEVNGKPCSKDSTTPLKEGDEL  177

Query  792   IF-GSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVAST  968
              F  SSGKHAYIFQ  T+ + S   +P  + ILE + G ++G++ EAR GDPS ++VAS 
Sbjct  178   AFCSSSGKHAYIFQLLTDINSSPIDVPSPLCILETNDGTIEGLHIEARPGDPSAISVASA  237

Query  969   laslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPL  1148
             LA+LS+   E L  PPS       + G E+P+LP A    D     +DMKD SDHND   
Sbjct  238   LATLSDHHAEEL--PPS-------QNGSEIPSLPSACAVSD-----TDMKDASDHND---  280

Query  1149  DEKSGAISPDSGN----DNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFD  1316
                 GA +    N    D +N+        DGE  K+  AP ELRP  +MLA SSTP F 
Sbjct  281   ----GATASPVENVVIGDKMNV--------DGESDKINLAP-ELRPFSQMLASSSTPAFG  327

Query  1317  LSGNISRIIDQRR---ELLKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYL  1487
             +S +ISRI+D+ R      K  DP +S+++RRQA+KD LQQ +L   +IEVSF+DF YYL
Sbjct  328   VSSSISRILDEHRPNRNQRKHSDPPVSLASRRQAYKDALQQGLLHCKDIEVSFDDFQYYL  387

Query  1488  SEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGA  1667
             SE TK VLIAS YIHLKCNKF K ASELPT+CPRILLSGPAGSEIYQETLAKALAKYFGA
Sbjct  388   SETTKKVLIASAYIHLKCNKFTKFASELPTLCPRILLSGPAGSEIYQETLAKALAKYFGA  447

Query  1668  RLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITG  1844
              LL+VDS+ LPGG + KE D VKE+ KPER  VF+KR   A  L   KKP SSV+ADITG
Sbjct  448   GLLIVDSIALPGGPTTKEADSVKESSKPERASVFSKRTTAALHL---KKPTSSVDADITG  504

Query  1845  GSAISSH-AQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQTPA-RGPAYGYKGKV  2012
              S +SSH    KQE STA+SKN TFK GDRVK+VG +P GFS  QTPA RGPAYGY+GKV
Sbjct  505   NSTVSSHPTMPKQEISTATSKNYTFKKGDRVKFVGCMP-GFSPAQTPAMRGPAYGYRGKV  563

Query  2013  LLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINE  2192
             +LAFEENG SKIGVRFDR+I EGNDLGGLCEEDHGFFCAAD LRL++S  D++DKLA+NE
Sbjct  564   VLAFEENGSSKIGVRFDRTITEGNDLGGLCEEDHGFFCAADTLRLESSGADEIDKLAVNE  623

Query  2193  LFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKE  2372
             LFEVVS E K  PLILF+KDIEKS+ GN EA+++ K+KL+ L EN+VVIAS+TQTD+RKE
Sbjct  624   LFEVVSAESKVGPLILFLKDIEKSLSGNTEAYTSLKVKLDSLSENIVVIASHTQTDSRKE  683

Query  2373  KSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQD  2552
             KSHPGG LFTKFGSNQTALLDLAFPDNFGRLHD+SKE  K  K   RLFPNKV IQIPQ+
Sbjct  684   KSHPGGLLFTKFGSNQTALLDLAFPDNFGRLHDKSKEATKITKLFNRLFPNKVTIQIPQE  743

Query  2553  ETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKII  2732
             ET+L DWKQQLDRDIETMKSQSN  +IR+VLNR  L+CPD+ETL IKDQAL N++VEKII
Sbjct  744   ETVLVDWKQQLDRDIETMKSQSNFGSIRSVLNRFGLECPDLETLSIKDQALNNDNVEKII  803

Query  2733  GWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEK  2912
             GWALSHHFM+ SE+  K+ K+ ISSESI YG+++L G+QNE KS KKSLKDV TENEFEK
Sbjct  804   GWALSHHFMNCSEAPLKDSKIVISSESIVYGVNILHGIQNENKSSKKSLKDVATENEFEK  863

Query  2913  KLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGP  3092
             KLL +VIPP DIGVTFDDIGALENVK+TLKELVMLPLQRPELF KGQLTKPCKGILLFGP
Sbjct  864   KLLGEVIPPGDIGVTFDDIGALENVKETLKELVMLPLQRPELFSKGQLTKPCKGILLFGP  923

Query  3093  PGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEV  3272
             PGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKI+PSVVFVDEV
Sbjct  924   PGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKISPSVVFVDEV  983

Query  3273  DSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPR  3452
             DSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPR
Sbjct  984   DSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPR  1043

Query  3453  RLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIRe  3632
             RLMVNLPDA NREKIL++IL KEELAP +DL A+A+MT+GYSGSDLKNLCV+AAHCPIRE
Sbjct  1044  RLMVNLPDALNREKILKVILAKEELAPGLDLAAVASMTDGYSGSDLKNLCVSAAHCPIRE  1103

Query  3633  ilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQW  3812
             ILEKEKK+KALA++ENRPLPALH+S D+RPL MDDF++AHEQVCASVSSES NM EL QW
Sbjct  1104  ILEKEKKDKALAVAENRPLPALHSSVDVRPLTMDDFKFAHEQVCASVSSESQNMNELQQW  1163

Query  3813  NELYGEGGSRKKKALSYFM  3869
             NELYGEGGSRKKK+LSYFM
Sbjct  1164  NELYGEGGSRKKKSLSYFM  1182



>ref|XP_008368992.1| PREDICTED: uncharacterized protein LOC103432576 isoform X1 [Malus 
domestica]
Length=1253

 Score =  1546 bits (4002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 821/1245 (66%), Positives = 977/1245 (78%), Gaps = 34/1245 (3%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTP----GAVNESGPESAEQEIRSADLDGASALKSP---E  359
             N KRSKA+++ SS+++ +    P    G + ESG +S E E+R +D     +LK+    +
Sbjct  21    NPKRSKASDA-SSSNNGVRSGPPAEPLGPIKESGSQSPELELRPSDPPTTDSLKASNGSD  79

Query  360   APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKK---RQLKSNLGTAWG  530
             A   E+ P+A   GE LVSP  LG++A+         + L R KK   +  K N  +AWG
Sbjct  80    ATALERSPDAIPEGEALVSPQPLGETAVR--------AGLKRAKKLPKKTAKLNSKSAWG  131

Query  531   KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEIS  710
              L+SQ  +N H+ +  + FTVGQ R+C LC+ DPS+S +LC LKH++RE G S   LEI 
Sbjct  132   MLISQCSKNPHLFICDTVFTVGQSRECHLCIKDPSISTTLCKLKHVKRE-GLSTAELEII  190

Query  711   GKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILE  890
             G  G VQVN K Y K++ V LNGGDEV+F SSG+HAYIFQ+ TN++  AA   PS+SI+E
Sbjct  191   GGNGDVQVNEKTYQKDTKVILNGGDEVVFSSSGRHAYIFQQLTNDNNIAAQGIPSISIIE  250

Query  891   AHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALP  1070
               + PV G++ EARSGDPS V  AS LAS+SN+  +L LLP      ++++Q  EM +LP
Sbjct  251   TRNAPVNGMHMEARSGDPSAVDGASILASMSNVPNDLSLLPEPAKAGDELQQDAEMTSLP  310

Query  1071  VASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVT  1250
              A    D H LD  MK+ ++ ND    +K     PD   +N NL++ A+D  D E  KV+
Sbjct  311   SACRGSDDHTLDIVMKESTNINDQVSGDKDIVQYPDIAKENPNLDSVALD-MDTETRKVS  369

Query  1251  GAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLISMSTRRQAFKDG  1421
             GA  +LRPL+RM  GSS+  FDL+G+IS++ D++RE   LL + DP + +STRRQAFK+ 
Sbjct  370   GATHQLRPLLRMFGGSSSTNFDLTGSISKMFDEQREIRELLHNLDPPMLISTRRQAFKEK  429

Query  1422  LQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLS  1601
             LQQ IL  ++I+VSFE FPYYLSE TK VLIAST+ +LKC+KF K  S LPT  PRILLS
Sbjct  430   LQQGILSPDDIDVSFESFPYYLSETTKKVLIASTHPNLKCSKFGKYFSSLPTGSPRILLS  489

Query  1602  GPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSA---KELDPVKEAPKPERTGVFTK  1772
             GPAGSEIYQETLAKAL K+FGARLL+VDSL+LPG  A   K+ D VKE P+PER  +F K
Sbjct  490   GPAGSEIYQETLAKALTKHFGARLLIVDSLLLPGVQAPPPKDSDSVKEVPRPERVSIFAK  549

Query  1773  RAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPL  1949
             RAA AA  + +KKP SSVEA+ITGGS +SS A  KQE STASS+  TFK GD+VK+VG +
Sbjct  550   RAAHAAGFK-HKKPTSSVEAEITGGSTVSSQALPKQETSTASSRGITFKQGDKVKFVGAI  608

Query  1950  PTG-FSLQTPA--RGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGF  2120
              +G   LQ+    RGP+YG +GKV+LAFEEN  +KIGVRFD+SIP+GNDLGGLCEEDHGF
Sbjct  609   SSGPLQLQSCPLLRGPSYGCRGKVVLAFEENEAAKIGVRFDKSIPDGNDLGGLCEEDHGF  668

Query  2121  FCAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAF  2297
             FC+A   L LD S  DD+DKLAI EL EV S E KS PLI+F+KDIEK M GNP+A+S  
Sbjct  669   FCSASHLLPLDVSGGDDIDKLAIGELLEVASHESKSLPLIVFLKDIEKVMAGNPDAYSVL  728

Query  2298  KLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFG-RLHDR  2474
             K KLE LPENVVVI S+TQ D RKEKSHPG  LFTKFG NQTALLDLAFPDN G RLHDR
Sbjct  729   KSKLENLPENVVVIGSHTQLDTRKEKSHPGSLLFTKFGFNQTALLDLAFPDNLGGRLHDR  788

Query  2475  SKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRV  2654
             SKETPK +KQL+R+FPNKV IQ+PQDE LLSDWKQQL+RD ET+K+QSN V IR+V NRV
Sbjct  789   SKETPKTMKQLSRIFPNKVTIQLPQDEALLSDWKQQLERDGETLKAQSNIVTIRSVFNRV  848

Query  2655  ELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSV  2834
              +DCPD+E+LCI D ALT ESVEK+ GWA+SHH MH S++  K+ KL IS+ES++ GL++
Sbjct  849   AVDCPDLESLCINDLALTTESVEKVAGWAISHHLMHCSDALVKDDKLVISTESLKDGLNI  908

Query  2835  LQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVM  3014
             L G+QNE KS+KKSLKDVVT NEFEKKLL DVIPPSDIGV+FDDIGALENVKDTLKELVM
Sbjct  909   LHGIQNENKSMKKSLKDVVTGNEFEKKLLVDVIPPSDIGVSFDDIGALENVKDTLKELVM  968

Query  3015  LPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG  3194
             LPLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG
Sbjct  969   LPLQRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG  1028

Query  3195  EGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKD  3374
             EGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD
Sbjct  1029  EGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKD  1088

Query  3375  KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAI  3554
             KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKILR+IL KE+L  +VDL+A+
Sbjct  1089  KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAQNREKILRVILAKEDLEADVDLEAV  1148

Query  3555  ANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMD  3734
             AN+T+GYSGSDLKNLCV AAH PIREILEKEKKE++LA++ENRP+P L+ S+DIRPL M+
Sbjct  1149  ANLTDGYSGSDLKNLCVAAAHLPIREILEKEKKERSLALAENRPVPELYCSTDIRPLKME  1208

Query  3735  DFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             DF++AHEQVCASVSSESTNM ELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1209  DFKHAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKKTSLSYFM  1253



>ref|XP_004292654.1| PREDICTED: uncharacterized protein LOC101311652 [Fragaria vesca 
subsp. vesca]
Length=1237

 Score =  1545 bits (4000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 830/1242 (67%), Positives = 980/1242 (79%), Gaps = 44/1242 (4%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTP----GAVNESGPESAEQEIRSADLDGASALKSPE-AP  365
             N KRSKA+++ SS+++ +   TP    G + ES  +S + E+RS D   A +LK+   + 
Sbjct  21    NPKRSKASDA-SSSNNGVRSGTPAEPLGPIKESESQSPDLELRSPDPQTADSLKAVNGSD  79

Query  366   VPEKLPE---APLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKK---RQLKSNLGTAW  527
               E+ P+          L SP  L D+A+         S L R KK   R  KSN   AW
Sbjct  80    AAERAPDDVAEAEAAAALESPKPLSDTAVR--------SGLKRNKKVPKRSAKSNQKLAW  131

Query  528   GKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEI  707
             G+LLSQ  +N H  L   TFTVGQGR+C+LC+ DPSVS +LC LK  +   G+S   +EI
Sbjct  132   GQLLSQCSKNPHQFL-CDTFTVGQGRECNLCLKDPSVSTTLCKLKPGE---GSSTAEMEI  187

Query  708   SGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSIL  887
             +G KG V VNGKIY ++S V L GGDEV+FGSSGKHAYIF + TN +I+   +  S+SIL
Sbjct  188   TGAKGYVLVNGKIYQQDSKVILIGGDEVVFGSSGKHAYIFMQLTNGNIANQGIS-SISIL  246

Query  888   EAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPAL  1067
             E  S PV G++ EARS DPS V  AS LAS+SN+   L LLP S     D++Q  ++P+ 
Sbjct  247   ETQSAPVNGLHIEARSRDPS-VDGASILASMSNVPNNLSLLPASAKAGGDLQQDADIPST  305

Query  1068  PVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKV  1247
             P   G  D    D++MKD ++ ND    +K     PD+ N+N NL++ A+D  D E GK 
Sbjct  306   PSGCGGSDDRTPDTEMKDSTNIND---GDKDIVSYPDTANENPNLDSLALD-MDTETGKS  361

Query  1248  TGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLISMSTRRQAFKD  1418
             +GA     PL+RML   S  +FD SG+IS+I+++ RE   LL+DFDP I +STRRQAF+D
Sbjct  362   SGARW---PLLRMLG--SGAKFDFSGSISKILNEPREIRELLQDFDPPILLSTRRQAFRD  416

Query  1419  GLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILL  1598
              LQQ IL+ N+IEV+FE FPYYLS+ TKNVLIAS +IHLKCNKF K AS+LPT  PRILL
Sbjct  417   KLQQGILNPNDIEVTFESFPYYLSDTTKNVLIASIHIHLKCNKFAKYASDLPTGSPRILL  476

Query  1599  SGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKE-LDPVKEAPKPERTGVFTKR  1775
             SGPAGSEIYQETLAKALAK+FGA+LL+V+SLV+PGG A +  +  KEA + ER  +F+KR
Sbjct  477   SGPAGSEIYQETLAKALAKHFGAKLLIVESLVMPGGQASQNTESAKEAARAERVNMFSKR  536

Query  1776  AAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGP--  1946
             AA AA LR +KKP SSV+A++TGGS +SS A  KQE STASSK  TFK GD+VK++G   
Sbjct  537   AAHAAGLR-HKKPTSSVDAEMTGGSTLSSQALPKQETSTASSKGITFKQGDKVKFIGTAG  595

Query  1947  LPTGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFC  2126
             LP   +     RGP YGYKGKV+L FEENG SKIGVRF+++IP+GNDLGG CEED GFFC
Sbjct  596   LPYAVNPMPNLRGPQYGYKGKVVLPFEENGSSKIGVRFEKAIPDGNDLGGHCEEDRGFFC  655

Query  2127  AADFL-RLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKL  2303
             +A+ L R+D S  DD+DKLAINEL EV S E KS PLILF+KD+EK+MVGN +AF  FK 
Sbjct  656   SANHLMRMDVSGGDDIDKLAINELLEVASNESKSMPLILFMKDVEKAMVGNSDAFIHFKS  715

Query  2304  KLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKE  2483
             KLE LPENVV+I S+TQ DNRKEKSHPGG LFTKFG +QTALLDLAFPDN GRL DRSKE
Sbjct  716   KLESLPENVVIIGSHTQLDNRKEKSHPGGLLFTKFGFSQTALLDLAFPDNLGRLQDRSKE  775

Query  2484  TPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELD  2663
             TPK++K LTR+FPNKV IQ+PQDE LLSDWKQQLDRD+ET+K+ SN V+IR VLNR+ LD
Sbjct  776   TPKSLKNLTRIFPNKVTIQLPQDEALLSDWKQQLDRDVETLKAVSNIVSIRAVLNRINLD  835

Query  2664  CPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQG  2843
             CPD+E+LC+KD  LT ESVEK+IGWALS+H MH SE+  K+GKL I +ES++YGL++LQG
Sbjct  836   CPDLESLCVKDPTLTTESVEKVIGWALSYHSMHCSEAEVKDGKLVICTESLKYGLNILQG  895

Query  2844  VQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPL  3023
             +Q+E KS KKSLKDVVT NEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPL
Sbjct  896   IQSENKSTKKSLKDVVTGNEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPL  955

Query  3024  QRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  3203
             QRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE
Sbjct  956   QRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  1015

Query  3204  KYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKER  3383
             KYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKER
Sbjct  1016  KYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKER  1075

Query  3384  VLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANM  3563
             VLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KE+L P+VDL+ +A+M
Sbjct  1076  VLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEDLEPDVDLEGVASM  1135

Query  3564  TEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFR  3743
             T+GYSGSDLKNLCVTAAH PIREILEKEKKE++ A+ ENRP+P+L+ S+DIRPL M+DF+
Sbjct  1136  TDGYSGSDLKNLCVTAAHRPIREILEKEKKERSFALEENRPVPSLYCSADIRPLKMEDFK  1195

Query  3744  YAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             +AHEQVCASVSSESTNM ELLQWN+LYGEGGSRKKKALSYFM
Sbjct  1196  HAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKKKALSYFM  1237



>ref|XP_008451596.1| PREDICTED: uncharacterized protein LOC103492829 isoform X2 [Cucumis 
melo]
Length=1254

 Score =  1543 bits (3995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 835/1251 (67%), Positives = 985/1251 (79%), Gaps = 56/1251 (4%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGA-----VNESGPESAEQEIRSADLDGASALKSP---EA  362
             KRSK  E+ SST+D+  +  P       V ESG E  +  I+SAD     +LK     + 
Sbjct  30    KRSKVVEASSSTEDV--QSAPPVEPLIPVGESGVEPVDPVIQSADPFDTDSLKVNNVCDE  87

Query  363   PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKAN-GSALNRGKKRQL---KSNLGTAWG  530
              VPE   +    G+ ++ P  LGD A D +K KA   S LNR KKR +   KSN   AWG
Sbjct  88    AVPENSHDLQAEGQAIMPPQPLGDVAADAEKSKAVVASMLNRTKKRTMRMPKSNSKPAWG  147

Query  531   KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNS-ITLLEI  707
             KLLSQ  QN H+ +  + FTVGQ RQC+L + DPSVS +LC L+HI+R  GNS + LLEI
Sbjct  148   KLLSQCSQNPHLFICGTLFTVGQSRQCNLWLKDPSVSTTLCKLRHIKR--GNSSVALLEI  205

Query  708   SGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSIL  887
             +G KG V VNGKI  KNS+V LNGGDEV+F SSGKHAYIFQ+ T++D + + +  SV+IL
Sbjct  206   TGGKGAVIVNGKIVQKNSSVILNGGDEVVFTSSGKHAYIFQQLTSDDFAVSGLS-SVNIL  264

Query  888   EAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPAL  1067
             EAH  PVKG++FE RS D S V  AS LAS SN++K+L LL P    + D+    E+P+ 
Sbjct  265   EAHCAPVKGIHFERRSRDASAVTGASILASFSNIQKDLPLLSPPAKTNEDV----ELPSG  320

Query  1068  PVASGE--PDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAID-SYDGEI  1238
                SGE  PD +  D    +   H D  +D+    I PDSG +  +L++ A+D S DGE+
Sbjct  321   CGVSGEQSPDSNLKDGSNNNTDRHGDASMDKNIDPI-PDSGTERPSLDSLALDASIDGEV  379

Query  1239  GKVTGAPQELRPLIRMLAGSSTPEFDLSG-NISRIIDQRRE---LLKDFDP-LISMSTRR  1403
             G+      ELRPL+++LA S++P+F+++G +IS+I+D++R+   L KDF P  + MSTRR
Sbjct  380   GEAPAKHSELRPLLQILASSASPDFNINGGSISKILDEQRDMGNLFKDFSPPAMLMSTRR  439

Query  1404  QAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVC  1583
             QAF++ LQQ IL  +NI+VS E FPYYLS+ TKNVLIAS ++HLKCNKFVK AS+LP + 
Sbjct  440   QAFRERLQQGILKPDNIDVSLESFPYYLSDTTKNVLIASMFVHLKCNKFVKHASDLPILS  499

Query  1584  PRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTG  1760
             PRILLSGPAGSEIYQETL KALA++FGARLL+VDSL+LPGG + K++D VK++ +P+RT 
Sbjct  500   PRILLSGPAGSEIYQETLTKALARHFGARLLIVDSLLLPGGPTPKDVDIVKDSSRPDRTS  559

Query  1761  VFTKRAAQAAV----LRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKNT-FKTGD  1925
              F KRA QAA     +  NKKP SSVEADI GGS +SS A  KQEASTASSK T FKTGD
Sbjct  560   FFAKRAVQAAAAAAAVSQNKKPTSSVEADIAGGSTLSSQALPKQEASTASSKTTAFKTGD  619

Query  1926  RVKYVGPLPTGFS--LQT-PARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGG  2096
             +VK+VG L +  S  LQT P RGP+YG +GKV+LAFEENG SKIGVRFD+SIP+ N L  
Sbjct  620   KVKFVGTLSSTLSPPLQTCPLRGPSYGCRGKVVLAFEENGSSKIGVRFDKSIPDANHL--  677

Query  2097  LCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGN  2276
                           LRLD    DD DKLAI+E+FEVVS E KSSPLILFVKDIEK+MVG+
Sbjct  678   --------------LRLDGPGGDDTDKLAIDEVFEVVSNESKSSPLILFVKDIEKAMVGH  723

Query  2277  PEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNF  2456
              +A+S  K +LE LP NVVVI S+T  DNRKEKSHPGG LFTKFGSNQTALLDLAFPDNF
Sbjct  724   SDAYSILKGRLENLPGNVVVIGSHTHMDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDNF  783

Query  2457  GRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIR  2636
             GRLHDR+KETPKA KQL+RLFPNKV I  PQDE LLS WKQQL+RD ET+K+Q+N V+IR
Sbjct  784   GRLHDRNKETPKATKQLSRLFPNKVTILPPQDEALLSVWKQQLERDTETLKTQANIVSIR  843

Query  2637  NVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESI  2816
              VLNR+ LDC +++ LCIKDQALT E+VEK++GWALSHHFMH S+   K+ KL IS+ESI
Sbjct  844   LVLNRIGLDCSNLDALCIKDQALTIETVEKVVGWALSHHFMHFSDVLVKDAKLIISTESI  903

Query  2817  RYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDT  2996
              YGL++L G+Q+E KS+KKSL+DVVTENEFEKKLLADVIPP DIGVTF+DIGALENVKDT
Sbjct  904   EYGLNILHGLQSENKSLKKSLRDVVTENEFEKKLLADVIPPGDIGVTFEDIGALENVKDT  963

Query  2997  LKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSI  3176
             LKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSI
Sbjct  964   LKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSI  1023

Query  3177  TSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWD  3356
             TSKWFGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWD
Sbjct  1024  TSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWD  1083

Query  3357  GLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPN  3536
             GLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KEELA +
Sbjct  1084  GLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEELAAD  1143

Query  3537  VDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDI  3716
             +DL+AIANMT+GYSGSDLKNLCVTAAHCPIREIL+KEKKE+  A+++N+PLPAL++S+D+
Sbjct  1144  IDLEAIANMTDGYSGSDLKNLCVTAAHCPIREILDKEKKERVSALTDNKPLPALYSSTDV  1203

Query  3717  RPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             R L MDDFR+AHEQVCASVSSESTNM ELLQWNELYGEGGSRKK +LSYFM
Sbjct  1204  RSLKMDDFRFAHEQVCASVSSESTNMNELLQWNELYGEGGSRKKMSLSYFM  1254



>ref|XP_009598054.1| PREDICTED: uncharacterized protein LOC104093922 isoform X4 [Nicotiana 
tomentosiformis]
Length=1048

 Score =  1540 bits (3986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 821/1064 (77%), Positives = 905/1064 (85%), Gaps = 31/1064 (3%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATESLSS-TDDMLGEKTPGAVNESGPESAEQ  308
             MVETRRSSSSSKR L SPSSP+ NGKRSKA E+LSS T+D LGEK  G +NESGPESAEQ
Sbjct  1     MVETRRSSSSSKRSLSSPSSPISNGKRSKAAEALSSSTNDTLGEKIQGELNESGPESAEQ  60

Query  309   EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  488
             E+RSADLD A       A VP+K  E     EPLVSPM LGDS IDV+K KA  SALNRG
Sbjct  61    EVRSADLDAA-------ADVPQKSLETEAANEPLVSPMTLGDSVIDVEKSKAKESALNRG  113

Query  489   KKRQLKSNLGTA-WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKH  665
             KKRQLKSN+  A WGKL+SQ  QN HV + ++T+TVGQGR  DL + D SVSK+LCNLKH
Sbjct  114   KKRQLKSNVAAAAWGKLVSQCSQNPHVVMHRATYTVGQGRGSDLWIGDSSVSKTLCNLKH  173

Query  666   IQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNE  845
              + EKG SITLLE+ GKKG VQVNGK+YPKNSTVPL GGDEV+FGSSG+H+YIF    ++
Sbjct  174   TETEKGVSITLLEVMGKKGDVQVNGKVYPKNSTVPLKGGDEVVFGSSGQHSYIF----DD  229

Query  846   DISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVC  1025
             ++SAAS   SVSIL AHSG +KG++ EARS DPSTVAVASTLASLSNL KEL LLPPS  
Sbjct  230   NLSAASFAHSVSILGAHSGSIKGLHLEARSRDPSTVAVASTLASLSNLPKELSLLPPSSQ  289

Query  1026  NDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVP---LDEKSGAISPDSGNDNL  1196
             N  D+KQ  E+P LP ASG  DK DLD DMKD SD NDVP   +DEK+   SPD GN NL
Sbjct  290   NGKDVKQSSEVPILPAASGVADKDDLDIDMKDASDCNDVPRVLVDEKNDVTSPDVGNGNL  349

Query  1197  NLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR---ELLK  1367
             NL+N A+DS D EIGKV       RPL+R+LAGSS  EF LSG IS+I++++R   EL K
Sbjct  350   NLDNIALDSVDAEIGKV-------RPLLRVLAGSSASEFGLSG-ISKILEEQRDFRELFK  401

Query  1368  DFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNK  1547
             DFDP IS  TRRQAFK+ L+Q +LD NNIEVSFE+FPYYLSE TK++LIASTYIHLKCNK
Sbjct  402   DFDPPISALTRRQAFKNALEQGVLDFNNIEVSFENFPYYLSENTKDILIASTYIHLKCNK  461

Query  1548  FVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELD  1724
             F K  S+LPTVCPRILLSGPAGSEIYQETLAKALAK+FGA+LL+VDSL+LPGGS AK++D
Sbjct  462   FAKYTSDLPTVCPRILLSGPAGSEIYQETLAKALAKHFGAKLLIVDSLLLPGGSIAKDVD  521

Query  1725  PVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK  1904
             PVKE+ KP R  VF KRAAQAA L  NKKPASSVEADITGGS ISSHAQ KQEASTASSK
Sbjct  522   PVKESSKPGRASVFAKRAAQAAALHLNKKPASSVEADITGGSTISSHAQPKQEASTASSK  581

Query  1905  N-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPE  2078
             N TFK GDRVKYVG   +GFS LQTP RGP YGYKGKV+LAFEENG SKIGVRFD+SIPE
Sbjct  582   NYTFKKGDRVKYVGS-SSGFSPLQTPLRGPTYGYKGKVVLAFEENGSSKIGVRFDKSIPE  640

Query  2079  GNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIE  2258
             GNDLGGLC+EDHGFFCAAD LRLD+SS D++DKLAINELFEV S E KSSPL+LF+KDIE
Sbjct  641   GNDLGGLCDEDHGFFCAADLLRLDSSSTDEIDKLAINELFEVASNESKSSPLVLFIKDIE  700

Query  2259  KSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDL  2438
             KSMVGNPEA++AFK+KLE LPENVV IAS TQ+DNRKEKSHPGG LFTKFGSNQTALLDL
Sbjct  701   KSMVGNPEAYAAFKIKLEHLPENVVAIASLTQSDNRKEKSHPGGLLFTKFGSNQTALLDL  760

Query  2439  AFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQS  2618
             AFPDNFGRLHDRSKETPK +KQLTRLFPNKV IQIPQDETLLSDWKQQLDRD+ETMKSQ+
Sbjct  761   AFPDNFGRLHDRSKETPKTMKQLTRLFPNKVTIQIPQDETLLSDWKQQLDRDMETMKSQA  820

Query  2619  NAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLA  2798
             N  +IRNVLNR+ +DCPD+ETLCIKDQALTNESVEKI+GWALSHHFMH SESS K+ KL 
Sbjct  821   NIASIRNVLNRIRIDCPDLETLCIKDQALTNESVEKIVGWALSHHFMHESESSVKDAKLV  880

Query  2799  ISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGAL  2978
             IS ESI YGL++LQG+Q+ETKS KKSLKDVVTENEFEK+LL DVIPPSDIGVTF+DIGAL
Sbjct  881   ISGESIAYGLNILQGIQSETKSSKKSLKDVVTENEFEKRLLGDVIPPSDIGVTFNDIGAL  940

Query  2979  ENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN  3158
             E VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN
Sbjct  941   ETVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFIN  1000

Query  3159  ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGR  3290
             ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEV  +  R
Sbjct  1001  ISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVGDIFSR  1044



>ref|XP_010269522.1| PREDICTED: uncharacterized protein LOC104606152 isoform X1 [Nelumbo 
nucifera]
Length=1265

 Score =  1539 bits (3985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 831/1248 (67%), Positives = 975/1248 (78%), Gaps = 32/1248 (3%)
 Frame = +3

Query  201   NGKRSKATESLSSTDD---MLGEKTPGAVNESGPESAEQEIRSAD---LDGASALKSPEA  362
             NGKRSK  E+ SS +    +L  +T G+  E G ES +QE R +D    D +    S +A
Sbjct  25    NGKRSKVAEASSSINGXPCVLPVETLGSSKEPGSESHDQEGRFSDPSVCDPSKEFDSCDA  84

Query  363   PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLS  542
              + EK  +    GE LVSP  +G  A++ D V  N + +NR +KR +KS    AWGKLLS
Sbjct  85    VMLEKPQDVNGEGETLVSPSSIGAPAMEDDNV--NNAVMNRARKRSIKSRAKVAWGKLLS  142

Query  543   QYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKG  722
             Q  QN H+ +  S FTVGQ +QC+LC+ DPSVS  LC LKH++R  G SI LLEISG KG
Sbjct  143   QCSQNPHLLMCGSPFTVGQSQQCNLCLRDPSVSTVLCKLKHLER-GGTSIVLLEISGSKG  201

Query  723   CVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSG  902
              VQVNGK + KNS+  L+GGDE++F S+G+HAYIFQ+ TN+ +++   P SVSI  + S 
Sbjct  202   VVQVNGKAFGKNSSTILSGGDELVFSSTGQHAYIFQQLTNDSLASPLFPSSVSIPGSQSV  261

Query  903   PVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGP-EMPALPVAS  1079
             PVKG++FE RS DPS VA AS LASLSNL+K+L LLPP       ++Q   E   LP   
Sbjct  262   PVKGIHFETRSRDPSAVAGASILASLSNLRKDLSLLPPPAQTGEGVRQHDLERQMLPSGC  321

Query  1080  GE---PDKHDLDSDMKDVSDHND---VPLDEK-SGAISPDSGNDN-LNLENGAIDSY-DG  1232
              +   P+        KD+S HN+   +   EK +  IS D+  +N ++L++  + ++ D 
Sbjct  322   EDGLMPNIKVTCHGRKDISKHNEEAGISSSEKDTVVISSDTATNNRMHLDSTGLGAHLDA  381

Query  1233  EIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDF-DPLISMSTR  1400
             EIG ++G   ELRPL+RMLAGSS+P+FDLSG+I + ID++RE   LLK F  P    S++
Sbjct  382   EIGAISGTNYELRPLLRMLAGSSSPDFDLSGSILKTIDEQREIKELLKGFGQPRNLPSSK  441

Query  1401  RQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTV  1580
             +QAFKDGLQQ IL SN+I+VSF++FPYYLSE TKNVLI+STYIHLKC ++ K   +L +V
Sbjct  442   KQAFKDGLQQRILSSNDIDVSFDNFPYYLSETTKNVLISSTYIHLKCKEYSKYIKDLSSV  501

Query  1581  CPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERT  1757
              PRILLSGPAGSEIYQETL KALAK+F ARLL++D + L GG S ++ + VKE+   +  
Sbjct  502   SPRILLSGPAGSEIYQETLIKALAKHFEARLLIIDVVQLLGGLSPRDSESVKESRSEKSA  561

Query  1758  GVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVK  1934
              V  +R  QA  +   KKP SSVEADI G S   S A  KQEASTASSKN  FK GDRV+
Sbjct  562   TVPKQRTTQADAIHL-KKPTSSVEADIAGTSMFCSQALPKQEASTASSKNYKFKHGDRVR  620

Query  1935  YVGPLPTGFS---LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCE  2105
             Y+G          LQT +RGP++GY GKV+LAFEENG SK+GVRFDRSI EGNDLGGLCE
Sbjct  621   YIGGGVNSSGVPPLQTSSRGPSHGYLGKVVLAFEENGSSKVGVRFDRSITEGNDLGGLCE  680

Query  2106  EDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEA  2285
             EDHGFFC AD LRLD+S  D    L I ELFE+   E K+ PLILF+KDIEKS+VGN EA
Sbjct  681   EDHGFFCNADLLRLDSSGDD---DLDIYELFELAYIESKNGPLILFLKDIEKSLVGNMEA  737

Query  2286  FSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRL  2465
             +   K KL  LPEN+VVI S+TQ DNRKEKSHPGG LFTKFGSNQTALLD AFPDNFGRL
Sbjct  738   YIHLKFKLHNLPENIVVIGSHTQLDNRKEKSHPGGLLFTKFGSNQTALLDFAFPDNFGRL  797

Query  2466  HDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVL  2645
             HDR+KE  K  +QL RLFPNKV IQ+PQDE LL DWKQ+LDRD+ET+K QSN +NIR++L
Sbjct  798   HDRNKEVSKTTRQLNRLFPNKVTIQLPQDEALLLDWKQRLDRDVETLKVQSNIINIRSIL  857

Query  2646  NRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYG  2825
             NR  L+CPD+ETLCIKDQA T ESVEKIIGWALS+H M+S+E+S K+ KL ISSESI YG
Sbjct  858   NRNGLECPDLETLCIKDQAFTGESVEKIIGWALSYHLMNSNEASMKDDKLVISSESITYG  917

Query  2826  LSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKE  3005
             L++L  +Q+E+KS+KKSLKDVVT+NEFEK+LLADVIP +DIGVTFDDIGALE VKDTLKE
Sbjct  918   LNILHDIQSESKSLKKSLKDVVTDNEFEKRLLADVIPXNDIGVTFDDIGALETVKDTLKE  977

Query  3006  LVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK  3185
             LVM PLQRPELFC+GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK
Sbjct  978   LVMFPLQRPELFCRGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK  1037

Query  3186  WFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLR  3365
             WFGEGEKYVKAVFTLASKI+PSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLR
Sbjct  1038  WFGEGEKYVKAVFTLASKISPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLR  1097

Query  3366  TKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDL  3545
             TKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKILR+IL KEE+APNVDL
Sbjct  1098  TKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAANREKILRVILAKEEIAPNVDL  1157

Query  3546  DAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPL  3725
             +A+ANMTEGYSGSDLKNLCVTAAHCPIREILE EKK+KALA+SENRP PALH S DIRPL
Sbjct  1158  EAVANMTEGYSGSDLKNLCVTAAHCPIREILEMEKKDKALALSENRPPPALHGSEDIRPL  1217

Query  3726  NMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             NMDDF+YAHEQVCASVSSES NM ELLQWNELYGEGGSRKK++LSYFM
Sbjct  1218  NMDDFKYAHEQVCASVSSESANMNELLQWNELYGEGGSRKKRSLSYFM  1265



>ref|XP_008386656.1| PREDICTED: uncharacterized protein LOC103449148 [Malus domestica]
Length=1255

 Score =  1537 bits (3979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 818/1244 (66%), Positives = 980/1244 (79%), Gaps = 30/1244 (2%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTP----GAVNESGPESAEQEIRSAD---LDGASALKSPE  359
             N KRSKA+++ SS+++ +    P    G + ESG +  E E+RS+D   +D   A+  P+
Sbjct  21    NPKRSKASDA-SSSNNGVRSGPPAEPLGPIKESGSQPPELELRSSDPPTIDSLKAINGPD  79

Query  360   APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLL  539
             A   E+ P+    GE LVSP  LG++A     V+A      +  K++ K N  +AWG L+
Sbjct  80    ATALERSPDDVAEGEALVSPQPLGETA-----VRAGLKRGKKLPKKKAKLNSKSAWGMLI  134

Query  540   SQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKK  719
             SQ+ +N H  + ++ FTVGQ  +C LC+ DPS+S +LC LKH++R+ G+S   LEI   K
Sbjct  135   SQFSKNPHQFICETVFTVGQSHECHLCLKDPSISTTLCKLKHVKRD-GSSAAELEIICGK  193

Query  720   GCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHS  899
             G VQVN K Y K++ V LNGGDEV+FG SGKHAYIFQ+ TN+   A    PS+SILE  +
Sbjct  194   GDVQVNEKTYQKDTKVILNGGDEVVFGLSGKHAYIFQQLTNDHGIATQGIPSISILETQN  253

Query  900   GPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVAS  1079
              PV G++ EARSGDPS V  AS LA++SN+  +L LL       +D++Q  EMP+LP A 
Sbjct  254   APVNGMHMEARSGDPSAVDGASILATMSNVPNDLSLLSEPAKAGDDLQQDAEMPSLPSAC  313

Query  1080  GEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAP  1259
              + D H  D +MK+ ++ ND    +K+    PD+ N+N NL++  +D  D E  K +GA 
Sbjct  314   RDTDDHTPDIEMKESTNINDQVSGDKNIVQYPDTANENPNLDSVELD-IDTETQKASGAT  372

Query  1260  QELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLISMSTRRQAFKDGLQQ  1430
              +LRPL RM  GSS+  FDLS +I++I+D++RE   LL +FDP + +STRRQAFK+ LQQ
Sbjct  373   YQLRPLFRMFTGSSSANFDLSDSIAKILDEQREIRELLHNFDPPMLISTRRQAFKEKLQQ  432

Query  1431  TILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPA  1610
              IL  ++I+VSFE FPYYLSE TK VLIAST+ +L+C+ F K  S LPT  PRILLSGPA
Sbjct  433   GILRPDDIDVSFEGFPYYLSETTKKVLIASTHPNLRCSNFGKYFSSLPTGSPRILLSGPA  492

Query  1611  GSEIYQETLAKALAKYFGARLLVVDSLVLPGGSA---KELDPVKEAPKPERTGVFTKRAA  1781
             GSEIYQETLAKALAK+FGARLL+VDSL+LPG  A   K+ D VKE P+ ER   FTKRAA
Sbjct  493   GSEIYQETLAKALAKHFGARLLIVDSLLLPGVEAPPPKDSDSVKEVPRLERVSTFTKRAA  552

Query  1782  QAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK-NTFKTGDRVKYVGPLPTG  1958
              AA  + +KKP SSVEA+ITGGS +SS A  KQE STASS+ NTFK GDRVK+VG + +G
Sbjct  553   HAAGFK-HKKPTSSVEAEITGGSTVSSQALPKQETSTASSRVNTFKQGDRVKFVGAISSG  611

Query  1959  FS-LQTPA--RGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCA  2129
                LQ+    RGP+YG +GKV+LAFEENG SKIGVRFD+SIP+GNDLGGLCEEDHGFFC+
Sbjct  612   TQPLQSCPLLRGPSYGCRGKVVLAFEENGASKIGVRFDKSIPDGNDLGGLCEEDHGFFCS  671

Query  2130  AD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLK  2306
             A   L LD S  DD+DKLAI EL EV + E KS PLI+F+KDIEK M GNP+A+S  K K
Sbjct  672   ASHLLPLDVSGGDDIDKLAIGELLEVATNESKSLPLIVFLKDIEKVMAGNPDAYSVLKSK  731

Query  2307  LEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFG-RLHDRSKE  2483
             L  LPENVVVI S+TQ DNRKEKSHPG  L TKFG NQTALLDLAFPDN G RLH+RSKE
Sbjct  732   LSNLPENVVVIGSHTQLDNRKEKSHPGSLLLTKFGLNQTALLDLAFPDNLGGRLHERSKE  791

Query  2484  TPKAIKQ--LTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVE  2657
             TPK +KQ  L+R+FPNKV IQ+PQDE LLSDWKQQL+ D+ET+KSQSN V IR+VLNRV 
Sbjct  792   TPKTMKQVQLSRIFPNKVTIQLPQDEALLSDWKQQLECDVETLKSQSNIVTIRSVLNRVS  851

Query  2658  LDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVL  2837
             +DCPD+E+LCIKD  LT ESV+K++GWA+SHH MH S++  K+ KL IS+ES+  GL++L
Sbjct  852   VDCPDLESLCIKDJXLTTESVDKVVGWAVSHHLMHCSDALVKDDKLVISTESLXDGLNIL  911

Query  2838  QGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVML  3017
             QG+QNE KS+KKSLKDVVT NEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVML
Sbjct  912   QGIQNENKSIKKSLKDVVTGNEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVML  971

Query  3018  PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE  3197
             PLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITS WFGE
Sbjct  972   PLQRPELFXKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSXWFGE  1031

Query  3198  GEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDK  3377
             GEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDK
Sbjct  1032  GEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDK  1091

Query  3378  ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIA  3557
             ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPD  NREKILR++L KE+L  +VDL+A+A
Sbjct  1092  ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDGQNREKILRVVLAKEDLETDVDLEAVA  1151

Query  3558  NMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDD  3737
             N+T+GYSGSDLKNLCV AAH PIREILEKEKKE++LA++ENRP+P L+ S+DIRPL M+D
Sbjct  1152  NLTDGYSGSDLKNLCVAAAHLPIREILEKEKKERSLALAENRPVPELYCSTDIRPLKMED  1211

Query  3738  FRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             F++AH+QVCASVSSESTNM+ELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1212  FKHAHDQVCASVSSESTNMSELLQWNDLYGEGGSRKKTSLSYFM  1255



>ref|XP_009342112.1| PREDICTED: uncharacterized protein LOC103934131 isoform X2 [Pyrus 
x bretschneideri]
 ref|XP_009342140.1| PREDICTED: uncharacterized protein LOC103934149 isoform X2 [Pyrus 
x bretschneideri]
Length=1245

 Score =  1535 bits (3975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 817/1242 (66%), Positives = 973/1242 (78%), Gaps = 36/1242 (3%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTP----GAVNESGPESAEQEIRSADLDGASALKSP---E  359
             N KRSKA+++ SS ++ +    P    G + ESG +S E E+R +D     +LK+    +
Sbjct  21    NPKRSKASDA-SSANNGVRSGPPAEPLGPIKESGSQSPELELRPSDPPTTDSLKASNGSD  79

Query  360   APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKK---RQLKSNLGTAWG  530
             A   E+ P+A   GE LVSP  LG++A+         + L R KK   +  KSN   AWG
Sbjct  80    ATALERSPDAVPEGEALVSPQPLGETAVR--------AGLKRAKKLPKKTAKSNSKAAWG  131

Query  531   KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEIS  710
              L+SQ  +N H+ +  + FTVGQ R+C LC+ DPS+S +LC LKH +RE G S   LEI 
Sbjct  132   MLISQCSKNPHLFICDTVFTVGQSRECHLCIKDPSISTTLCKLKHFKRE-GLSTAELEII  190

Query  711   GKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILE  890
             G    VQVN K Y +++ V LNGGDEV+F SSG+HAYIFQ  TN++  AA   PS+SI+E
Sbjct  191   GGDSDVQVNEKTYQRDTKVILNGGDEVVFSSSGRHAYIFQPLTNDNNIAAQGIPSISIIE  250

Query  891   AHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALP  1070
               + PV G++ EARSGDPS V  AS LAS+SN+  +L LLP      ++++Q  EM +LP
Sbjct  251   TQNAPVNGMHMEARSGDPSAVDGASILASMSNVPNDLSLLPEPAKAGDELQQDAEMTSLP  310

Query  1071  VASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVT  1250
              AS   D    D  MK+ ++ ND    +K     PD+  +N NL++ A+D  + E  KV+
Sbjct  311   SASRGSDDCTPDIVMKESTNVNDQVSGDKDIVQYPDTAKENSNLDSVALD-MNIETRKVS  369

Query  1251  GAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLISMSTRRQAFKDG  1421
             GA  ELRPL+RM  GSS+ +FDL+G+IS+I+D++RE   LL + DP + +STRRQAFK+ 
Sbjct  370   GATHELRPLLRMFGGSSSTDFDLTGSISKILDEQREIGELLHNLDPPMLISTRRQAFKEK  429

Query  1422  LQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLS  1601
             LQQ IL  ++I+VSFE FPYYLSE TK VLIAST+ +LKC+KF K  S LPT  PRILLS
Sbjct  430   LQQGILSPDDIDVSFESFPYYLSETTKKVLIASTHPNLKCSKFGKYFSSLPTGSPRILLS  489

Query  1602  GPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAA  1781
             GPAGSEIYQETLAKALAK+FGARLL+V +        K+ D VKE P+PER  +F KRAA
Sbjct  490   GPAGSEIYQETLAKALAKHFGARLLIVQA-----PPPKDSDSVKEVPRPERVSIFAKRAA  544

Query  1782  QAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTG  1958
              AA  + +KKP SSVEA+ITGGS +SS A  KQE STASS+  TFK GD+VK+VG + +G
Sbjct  545   HAAGFK-HKKPTSSVEAEITGGSTVSSQALPKQETSTASSRGITFKQGDKVKFVGAISSG  603

Query  1959  -FSLQTPA--RGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCA  2129
                LQ+    RGP+YG +GKV+LAFEEN  +KIGVRFD+SIP+GNDLGGLCEED GFFC+
Sbjct  604   PLQLQSCPLLRGPSYGCRGKVVLAFEENEAAKIGVRFDKSIPDGNDLGGLCEEDRGFFCS  663

Query  2130  AD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLK  2306
             A   L LD S  DD+DKLAI EL EV S E KS PLI+F+KDIEK M GNP+A+S  K K
Sbjct  664   ASHLLPLDVSGGDDIDKLAIGELLEVASHESKSLPLIVFLKDIEKVMAGNPDAYSVLKCK  723

Query  2307  LEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFG-RLHDRSKE  2483
             LE LPENVVVI S+TQ D RKEKSHPG  LFTKFG NQTALLDLAFPDN G RLHDRSKE
Sbjct  724   LENLPENVVVIGSHTQLDTRKEKSHPGSLLFTKFGFNQTALLDLAFPDNLGGRLHDRSKE  783

Query  2484  TPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELD  2663
             TPK +KQL+R+FPNKV IQ+PQDETLLSDWKQQL+RD+ET+K+QSN V IR+VLNRV +D
Sbjct  784   TPKTMKQLSRIFPNKVTIQLPQDETLLSDWKQQLERDVETLKAQSNIVTIRSVLNRVAVD  843

Query  2664  CPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQG  2843
             CPD+E+LCI D AL  ESVEK++GWA+SHH MH S++  K+ KL IS+ES++ GL++LQG
Sbjct  844   CPDLESLCINDLALATESVEKVVGWAISHHLMHCSDALVKDDKLVISTESLKDGLNILQG  903

Query  2844  VQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPL  3023
             VQNE KS+KKSLKDVVT NEFEKKLL DVIPPSDIGV+FDDIGALENVKDTLKELVMLPL
Sbjct  904   VQNENKSIKKSLKDVVTGNEFEKKLLVDVIPPSDIGVSFDDIGALENVKDTLKELVMLPL  963

Query  3024  QRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  3203
             QRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE
Sbjct  964   QRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  1023

Query  3204  KYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKER  3383
             KYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKER
Sbjct  1024  KYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKER  1083

Query  3384  VLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANM  3563
             VLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKILR+IL KE+L P+VDL+A+AN+
Sbjct  1084  VLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAQNREKILRVILAKEDLEPDVDLEAVANL  1143

Query  3564  TEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFR  3743
             T+GYSGSDLKNLCV AAH PIREILEKEKKE++LA++ENRP+P L+ S+DIRPL M+DF+
Sbjct  1144  TDGYSGSDLKNLCVAAAHLPIREILEKEKKERSLALAENRPVPELYCSTDIRPLKMEDFK  1203

Query  3744  YAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             +AHEQVCASVSSESTNM ELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1204  HAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKKTSLSYFM  1245



>ref|XP_011033559.1| PREDICTED: uncharacterized protein LOC105132009 [Populus euphratica]
Length=1227

 Score =  1532 bits (3967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 803/1146 (70%), Positives = 931/1146 (81%), Gaps = 32/1146 (3%)
 Frame = +3

Query  477   LNRGKKR---QLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKS  647
             LN+ KKR    +KSN   AWG+LLSQ  QN H  ++ + F+VGQ RQC+L ++DPS+S  
Sbjct  99    LNKSKKRVPKSVKSNAKAAWGQLLSQCSQNPHKLMNSTLFSVGQSRQCNLWLNDPSISTV  158

Query  648   LCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIF  827
             LC LKHI+R  G S+ LLEI+G KG VQVNGK+Y KN ++ LNGGDEVIF +SGKHAYIF
Sbjct  159   LCKLKHIER-GGASVVLLEITGGKGAVQVNGKLYQKNESLVLNGGDEVIFTTSGKHAYIF  217

Query  828   QKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkelll  1007
             Q+ T+ ++S   MP SVSILEA S P+KG++ EAR  DPS  A AS LASLS+L      
Sbjct  218   QQLTSNNLSTPGMP-SVSILEAQSAPIKGIHIEARPRDPSDYAGASILASLSHLL-----  271

Query  1008  lPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND---VPLDEKSGAISPD  1178
              PP+     D +Q  +   LP      +    D +MKD + +ND   V   EK+   S +
Sbjct  272   -PPAAKTGEDTQQNTDFSILPSGCEASEDRIPDVEMKDGTSNNDTADVSPREKAAVPSSN  330

Query  1179  SGNDNLNLEN-GAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQR-  1352
             + ++N N+++ G+    D  IG++  +  EL+PL++MLAGSS+ E D      +I D+R 
Sbjct  331   AASENANVDSMGSGACTDAVIGRIPNSTYELKPLLQMLAGSSS-ELD------KIFDERE  383

Query  1353  -RELLKDFDPL-ISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTY  1526
              RE+LKD DP  + MSTRRQ FKD LQ+ IL+   IEVSF+ FPYYLS+ TK VLI +T+
Sbjct  384   RREILKDLDPPPVLMSTRRQLFKDSLQKGILNPEEIEVSFDSFPYYLSDTTKKVLIGATF  443

Query  1527  IHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPG  1703
             IHLKC NK  K A +LPTV PR+LLSGPAGSEIYQETL KALAK  GARLL+VDSL LPG
Sbjct  444   IHLKCGNKVAKFACDLPTVSPRMLLSGPAGSEIYQETLTKALAKDVGARLLIVDSLQLPG  503

Query  1704  GSA-KELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQ  1880
             GS  KE D  +E+ K ER  VF KRA QAA+   +KKP SSVEADITG S  SSHA+ KQ
Sbjct  504   GSIPKEADSSRESSKSERVSVFAKRAVQAALQ--SKKPTSSVEADITGCSTFSSHARPKQ  561

Query  1881  EASTASSKN-TFKTGDRVKYVGP-LPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIG  2051
             E STASSKN TFKTGDRVK+VG  L +  S LQ P +GP  G +GKV+LAFE N  SKIG
Sbjct  562   ETSTASSKNYTFKTGDRVKFVGASLASAISSLQPPLKGPTIGLRGKVVLAFEGNDSSKIG  621

Query  2052  VRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSP  2231
             VRFDRSIPEGNDLGG CEEDHGF+C A+ LRLD S  +D+D+LAINELFEV   E K+ P
Sbjct  622   VRFDRSIPEGNDLGGRCEEDHGFYCTANSLRLDISGGEDVDRLAINELFEVALNESKNGP  681

Query  2232  LILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFG  2411
             LILF+KD+EKS+VGN +A+S+ K KLE LP  VVV+ S+TQ DNRKEKSH GG LFTKFG
Sbjct  682   LILFLKDLEKSVVGNQDAYSSLKSKLESLPGKVVVVGSHTQIDNRKEKSHAGGLLFTKFG  741

Query  2412  SNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDR  2591
              N TALLDLAFPD+FGRL DRSKETPKA+KQL+RLFPNKV +Q+PQDE LL DWKQQL+R
Sbjct  742   GNHTALLDLAFPDSFGRLSDRSKETPKAMKQLSRLFPNKVTVQLPQDEALLVDWKQQLER  801

Query  2592  DIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSE  2771
             DIET+K Q+N  +IR+VL+RV L CPD+ET+CIKDQAL  ESVEK++GWALSHHFMH SE
Sbjct  802   DIETLKVQANIASIRSVLSRVGLCCPDLETVCIKDQALATESVEKMVGWALSHHFMHCSE  861

Query  2772  SSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIG  2951
             +S K+ KL ISSES+ YGLS+LQG+QNE KS+K SLKDVVTENEFEKKLLADVIPPSDIG
Sbjct  862   ASVKDSKLLISSESVMYGLSILQGIQNENKSLKNSLKDVVTENEFEKKLLADVIPPSDIG  921

Query  2952  VTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVA  3131
             VTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVA
Sbjct  922   VTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVA  981

Query  3132  TEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEH  3311
             TEAGANFINISMSSITSKWFGEGEKYVKAVF+L+SKI+PSVVFVDEVDSMLGRRE+PGEH
Sbjct  982   TEAGANFINISMSSITSKWFGEGEKYVKAVFSLSSKISPSVVFVDEVDSMLGRRENPGEH  1041

Query  3312  EAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRE  3491
             EAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRE
Sbjct  1042  EAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRE  1101

Query  3492  KILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalai  3671
             KILR+IL KE+LAP+VDL+A+ANMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE++LA+
Sbjct  1102  KILRVILAKEDLAPDVDLEAVANMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERSLAL  1161

Query  3672  SENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKK  3851
             +E+ PLP L++S+DIRPL M+DFRYAHEQVCASVSSESTNM ELLQWN+LYGEGGSRKKK
Sbjct  1162  AEDSPLPVLYSSADIRPLKMEDFRYAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKKK  1221

Query  3852  ALSYFM  3869
             +LSYFM
Sbjct  1222  SLSYFM  1227



>ref|XP_002301474.2| AAA-type ATPase family protein [Populus trichocarpa]
 gb|EEE80747.2| AAA-type ATPase family protein [Populus trichocarpa]
Length=1229

 Score =  1530 bits (3962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 805/1170 (69%), Positives = 931/1170 (80%), Gaps = 50/1170 (4%)
 Frame = +3

Query  441   IDVDKVKANGS------ALNRGKKR---QLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTV  593
             + +D+V ANG        LN+ KKR    +KSN   AWG+LLSQ  QN H  ++ + FTV
Sbjct  83    VSLDEVTANGEKSKGAVVLNKSKKRVPKSVKSNAKAAWGQLLSQCSQNPHKLINSTLFTV  142

Query  594   GQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPL  773
             GQ RQC+L ++D S+S  LC LKHI+R  G  I LLEI+G KG VQVNGK+Y KN T+ L
Sbjct  143   GQSRQCNLWLNDSSISTILCKLKHIER-GGAPIALLEITGGKGAVQVNGKLYQKNETLAL  201

Query  774   NGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTV  953
             NGGDEVIF +SGKHAYIFQ+ T+  +    MP SVSILEA S P+KG++ EARS DPS  
Sbjct  202   NGGDEVIFTTSGKHAYIFQQLTSNSLGTPGMP-SVSILEAQSAPIKGIHIEARSRDPSDY  260

Query  954   AVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDH  1133
             A AS LASLS+L       PP+     D +Q  +   LP      + H  D +MKD + +
Sbjct  261   AGASILASLSHLL------PPAAKTGEDGQQNTDFSTLPSGCEASEDHVPDVEMKDGTSN  314

Query  1134  ND---VPLDEKSGAISPDSGN-------DNLNLENGAIDSYDGEIGKVTGAPQELRPLIR  1283
             ND   V   EK  A++P S         D++ L  GA    +  IG++  +  EL+PL+R
Sbjct  315   NDPSDVSPSEK--AVAPSSNAANENANADSMRL--GAC--TNAVIGRIPNSTYELKPLLR  368

Query  1284  MLAGSSTPEFDLSGNISRIIDQR--RELLKDFDPL-ISMSTRRQAFKDGLQQTILDSNNI  1454
             MLAGSS+ EFD      +I D+R  RE+LKD DP  + MSTRRQ FKD LQ+ IL+   I
Sbjct  369   MLAGSSS-EFD------KIFDERERREILKDLDPPPVLMSTRRQLFKDSLQKGILNPEEI  421

Query  1455  EVSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQE  1631
             EVSF++FPYYLS+ TK VLI + +IHLKC NK  K A +LPTV PR+LLSGPAGSEIYQE
Sbjct  422   EVSFDNFPYYLSDTTKKVLIGAAFIHLKCGNKVAKFACDLPTVSPRMLLSGPAGSEIYQE  481

Query  1632  TLAKALAKYFGARLLVVDSLVLPGGSA-KELDPVKEAPKPERTGVFTKRAAQAAVLRFNK  1808
             TL KALAK  GARLL+VDSL LPGGS  KE D  +E+ K ER   F KRA QAA+L   K
Sbjct  482   TLTKALAKDAGARLLIVDSLQLPGGSIHKEADSSRESLKSERVSAFAKRAMQAALL--TK  539

Query  1809  KPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVG-PLPTGFS-LQTPA  1979
             KP SSVEA ITG S   SHA+ KQE STASSKN TFKTGDRVK+VG  L +  S LQ P 
Sbjct  540   KPTSSVEAGITGCSTFGSHARPKQETSTASSKNYTFKTGDRVKFVGTSLASAISSLQPPL  599

Query  1980  RGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSS  2159
             + P  G +GKV+L FE N   KIGVRFD+SIPEGNDLGG CEEDHGFFC A+ LRLD+S 
Sbjct  600   KEPTIGLRGKVVLTFEGNSSYKIGVRFDQSIPEGNDLGGRCEEDHGFFCTANSLRLDSSG  659

Query  2160  IDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVI  2339
              +D+D+LAINELFEV   E K++PLILF+KD+EKS+VGN +A+++ K KLE LPE V+V+
Sbjct  660   GEDVDRLAINELFEVALNESKNAPLILFLKDLEKSLVGNQDAYTSLKSKLENLPEKVIVM  719

Query  2340  ASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLF  2519
              S+TQ DNRKEKSH GG LFTKFG N TALLDLAFPD+FGR  DRSKETPKA+KQL+RLF
Sbjct  720   GSHTQIDNRKEKSHAGGLLFTKFGGNHTALLDLAFPDSFGRPSDRSKETPKAMKQLSRLF  779

Query  2520  PNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQ  2699
             PNKV +Q+PQDE LL DWKQQL+RDIET+K+Q+N  + R+VL+RV L CPD+ET+C+KDQ
Sbjct  780   PNKVTVQLPQDEALLVDWKQQLERDIETLKAQANIFSFRSVLSRVGLCCPDLETVCLKDQ  839

Query  2700  ALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSL  2879
             ALT ESVEK++GWALSHHFMH SE+S  + K+ ISSESI YGLSVL GVQNE+KS+KKSL
Sbjct  840   ALTTESVEKVVGWALSHHFMHCSEASVNDSKILISSESILYGLSVLHGVQNESKSLKKSL  899

Query  2880  KDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLT  3059
             KDVVTENEFEKKLLADV+PPSDIGV+FDDIGALENVKDTLKELVMLPLQRPELFCKGQLT
Sbjct  900   KDVVTENEFEKKLLADVMPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPELFCKGQLT  959

Query  3060  KPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASK  3239
             KPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASK
Sbjct  960   KPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASK  1019

Query  3240  IAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFD  3419
             IAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFD
Sbjct  1020  IAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFD  1079

Query  3420  LDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNL  3599
             LDEAVIRRLPRRLMVNLPDAPNREKILR+IL KE+LAP+VDL+A+ANMT+GYSGSD+KNL
Sbjct  1080  LDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEDLAPDVDLEAVANMTDGYSGSDIKNL  1139

Query  3600  CVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSS  3779
             CVTAAHCPIREIL+ EKKE+ LA++EN PLP L++SSDIRPL M+DFRYAHEQVCASVSS
Sbjct  1140  CVTAAHCPIREILKTEKKERTLALAENSPLPTLYSSSDIRPLKMEDFRYAHEQVCASVSS  1199

Query  3780  ESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             ESTNM ELLQWN+LYGEGGSRKKK+LSYFM
Sbjct  1200  ESTNMNELLQWNDLYGEGGSRKKKSLSYFM  1229



>gb|KDP28140.1| hypothetical protein JCGZ_13911 [Jatropha curcas]
Length=1205

 Score =  1523 bits (3944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 803/1216 (66%), Positives = 942/1216 (77%), Gaps = 77/1216 (6%)
 Frame = +3

Query  261   KTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSA  440
             +T  +V ESG    + E++S+D    + +  P +   E+ P+    GE L+SP  LG++ 
Sbjct  54    ETLTSVKESGSIPRDPELQSSD-PLVTVVSEPVSADAERSPDPE--GEGLLSPQPLGETN  110

Query  441   IDVDKV-KANGSALNRGKKRQLKSNLGT--------AWGKLLSQYPQNSHVPLDQSTFTV  593
             ++  ++ KA G+ L+RG+KR  KS +          AW KLLSQ  Q  H  +  + FTV
Sbjct  111   LNAAEISKAVGATLSRGRKRPAKSAVAKPVKPLDKLAWAKLLSQCSQYPHKEMRSTLFTV  170

Query  594   GQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPL  773
             GQGR CDL ++DPSVS  LC LK ++     S  LLE+ G KG VQVNGK+  K   V +
Sbjct  171   GQGRHCDLVINDPSVSTILCRLKQLEN-GAASAALLEVIGGKGAVQVNGKLLQKPGMVVI  229

Query  774   NGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTV  953
             NGGDE++F SSGKHAYIFQ+ TN+++ A  +  SV+ILEA   P+KG+  EARSGDPS  
Sbjct  230   NGGDELVFSSSGKHAYIFQQLTNDNLGAPGI-SSVNILEAQGAPIKGIQIEARSGDPSAF  288

Query  954   AVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDH  1133
             A AS LASLS+++K+L L+PP    D D+ Q  E+  +P   G PD    + +MKD +  
Sbjct  289   AGASILASLSDIQKDLSLIPPPAKADEDMPQNTEISTVPSLCGAPDDCIPEVNMKDTT--  346

Query  1134  NDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEF  1313
                            S +   +L         G + KV   P+E+               
Sbjct  347   ---------------SSSSEFDLS--------GSLSKVLDEPREI---------------  368

Query  1314  DLSGNISRIIDQRRELLKDFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLS  1490
                          RE LKD D P+I MSTRRQA+KD LQQ IL+  +I+VSF+ FPYYLS
Sbjct  369   -------------REQLKDSDPPMILMSTRRQAYKDSLQQGILNPESIDVSFDSFPYYLS  415

Query  1491  EITKNVLIASTYIHLKCNKFV-KCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGA  1667
             + TK VLI + +IHLKC+K + K + +LPTV PR+LLSGPAGSEIYQETL KALAK  GA
Sbjct  416   DTTKKVLIGAAFIHLKCDKKIPKFSCDLPTVSPRVLLSGPAGSEIYQETLVKALAKDVGA  475

Query  1668  RLLVVDSLVLPGGSA-KELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITG  1844
             RLLV+DSL+LPGGSA KE D VKE  KP+R  VF KRA QAA+   +KKP SSVEADITG
Sbjct  476   RLLVIDSLLLPGGSAPKEADSVKEGAKPDRASVFAKRAVQAAL--HHKKPPSSVEADITG  533

Query  1845  GSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSLQTPARGPAYGYKGKVLLA  2021
             GS ISS    KQE STASSKN TFK GDRVK+VG      SLQ   RGP+ G++GKV+L 
Sbjct  534   GSTISSQGLPKQETSTASSKNYTFKAGDRVKFVGL----SSLQHSLRGPSNGFRGKVVLP  589

Query  2022  FEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFE  2201
             FE+NG SKIGVRFDR+IPEGNDLGGLCEEDHGFFC A+ LRLD +  +D+D+LA++ELFE
Sbjct  590   FEDNGSSKIGVRFDRAIPEGNDLGGLCEEDHGFFCPANSLRLDGAGGEDVDRLAVSELFE  649

Query  2202  VVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSH  2381
             V   E K  PLILF+KDIEKSMVGN +A++A + KLE LP+ V+VI S+TQ DNRKEKS 
Sbjct  650   VALNESKQGPLILFIKDIEKSMVGNQDAYTALRSKLENLPDKVIVIGSHTQMDNRKEKSQ  709

Query  2382  PGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETL  2561
             PGG LFTKFGSN TALLDLAFPDNFGRLHDRSKETPK +KQL RLFPNKV IQ+PQDE L
Sbjct  710   PGGLLFTKFGSNHTALLDLAFPDNFGRLHDRSKETPKTMKQLARLFPNKVAIQLPQDEAL  769

Query  2562  LSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWA  2741
             L DWKQQL+RD+ET+K+Q+N V+IR+VL+RV L C D+ET+CIKDQALT ESVEKIIGWA
Sbjct  770   LLDWKQQLERDVETLKAQANVVSIRSVLSRVSLHCTDLETVCIKDQALTTESVEKIIGWA  829

Query  2742  LSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLL  2921
             LSHHFMH +E+S ++ KL IS+ESI+YGLS+LQG+Q+E+KS+KKSLKDVVT+NEFEKKLL
Sbjct  830   LSHHFMHCTEASVEDAKLVISTESIKYGLSILQGIQSESKSLKKSLKDVVTDNEFEKKLL  889

Query  2922  ADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGT  3101
              DVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGT
Sbjct  890   VDVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGT  949

Query  3102  GKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSM  3281
             GKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSM
Sbjct  950   GKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSM  1009

Query  3282  LGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLM  3461
             LGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLM
Sbjct  1010  LGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLM  1069

Query  3462  VNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReile  3641
             VNLPDAPNREKILR+IL KEELAP+VD++A+ANMT+GYSGSDLKNLCVTAAHCPIREILE
Sbjct  1070  VNLPDAPNREKILRVILAKEELAPDVDIEAVANMTDGYSGSDLKNLCVTAAHCPIREILE  1129

Query  3642  kekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNEL  3821
             KEKKE+  A+ EN+PLPAL++SSD+RPL M+DFRYAHEQVCASVSSESTNM ELLQWNEL
Sbjct  1130  KEKKERTSALVENKPLPALYSSSDVRPLRMEDFRYAHEQVCASVSSESTNMNELLQWNEL  1189

Query  3822  YGEGGSRKKKALSYFM  3869
             YGEGGSRKKK+LSYFM
Sbjct  1190  YGEGGSRKKKSLSYFM  1205



>ref|XP_011008046.1| PREDICTED: uncharacterized protein LOC105113541 isoform X2 [Populus 
euphratica]
Length=1229

 Score =  1521 bits (3938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 802/1169 (69%), Positives = 926/1169 (79%), Gaps = 48/1169 (4%)
 Frame = +3

Query  441   IDVDKVKANGS------ALNRGKKR---QLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTV  593
             + +D+V ANG        LN+ KKR    +KSN   AWG+LLSQ  QN H  ++ + FTV
Sbjct  83    VSLDEVTANGEKSKGAVVLNKSKKRVPKSVKSNAKAAWGQLLSQCSQNPHKLINSTLFTV  142

Query  594   GQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPL  773
             GQ RQC+L ++D S+S  LC LKHI+R  G  I LLEI+G KG VQVNGK+Y KN TV L
Sbjct  143   GQSRQCNLWLNDSSISTILCKLKHIER-GGAPIALLEITGGKGAVQVNGKLYQKNETVAL  201

Query  774   NGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTV  953
             NGGDEVIF +SGKHAYIFQ+ T+  +    MP SVSILEA S P+KG++ E RS DPS  
Sbjct  202   NGGDEVIFTTSGKHAYIFQQLTSNSLGTPGMP-SVSILEAQSAPIKGIHSETRSRDPSDY  260

Query  954   AVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDH  1133
             A AS LASLS+L       PP+     D +Q  +   LP      + H  D +MKD + +
Sbjct  261   AGASILASLSHLL------PPAAKTGEDGQQNTDFSTLPSGCEASEDHVPDVEMKDGTSN  314

Query  1134  NDVPLD--EKSGAISPDSGN-------DNLNLENGAIDSYDGEIGKVTGAPQELRPLIRM  1286
              D P+D       ++P S         D++ L  GA    +  IG++  +  EL+PL+RM
Sbjct  315   KD-PIDVSPSEKPVAPSSNAANENANADSMRL--GAC--TNAVIGRIPNSTYELKPLLRM  369

Query  1287  LAGSSTPEFDLSGNISRIIDQR--RELLKDFDPL-ISMSTRRQAFKDGLQQTILDSNNIE  1457
             LAGSS+ EFD      +I D+R  RE LKD DP  + MSTRRQ FKD LQ+ IL+   IE
Sbjct  370   LAGSSS-EFD------KIFDERERREFLKDLDPPPVLMSTRRQLFKDSLQKGILNPEEIE  422

Query  1458  VSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQET  1634
             VSF++FPYYLS+ TK VLI + +IHLKC NK  K A +LPTV PR+LLSGPAGSEIYQET
Sbjct  423   VSFDNFPYYLSDTTKKVLIGAAFIHLKCGNKVAKFACDLPTVSPRMLLSGPAGSEIYQET  482

Query  1635  LAKALAKYFGARLLVVDSLVLPGGSA-KELDPVKEAPKPERTGVFTKRAAQAAVLRFNKK  1811
             L KALAK  GARLL+VDSL LPGGS  KE D  +E+ K ER   F KRA QAA+L   KK
Sbjct  483   LTKALAKDAGARLLIVDSLQLPGGSIHKEADSSRESLKSERVSAFAKRAMQAALL--TKK  540

Query  1812  PASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVG-PLPTGFS-LQTPAR  1982
             P SSVEA ITG S   SHA+ KQE STASSKN +FKTGDRVK+VG  L +  S LQ P +
Sbjct  541   PTSSVEAGITGCSTFGSHARPKQETSTASSKNYSFKTGDRVKFVGTSLASAISSLQPPLK  600

Query  1983  GPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSI  2162
              P  G +GKV+LAFE N   KIGVRFD+SIPEGNDLGG CEEDHGFFC A+ LRLD+S  
Sbjct  601   EPTIGLRGKVVLAFEGNNSYKIGVRFDQSIPEGNDLGGRCEEDHGFFCTANSLRLDSSGG  660

Query  2163  DDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIA  2342
             +D+D+LAINELFEV   E K+ PLILF+KD+EKS+VGN +A+S+ K KLE LPE V+V+ 
Sbjct  661   EDVDRLAINELFEVALNESKNGPLILFLKDLEKSVVGNQDAYSSLKSKLENLPEKVIVMG  720

Query  2343  SYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFP  2522
             S+TQ DNRKEKSH GG LFTKFG N TALLDLAFPD+ GR  DRSKETPKA+KQL+RLFP
Sbjct  721   SHTQIDNRKEKSHAGGLLFTKFGGNHTALLDLAFPDSIGRPSDRSKETPKAMKQLSRLFP  780

Query  2523  NKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQA  2702
             NKV +Q+PQDE LL DWKQQL+RDIET+K+Q+N  + R+VL+RV L CPD+ET+C+KDQA
Sbjct  781   NKVTVQLPQDEALLVDWKQQLERDIETLKAQANIFSFRSVLSRVGLCCPDLETVCLKDQA  840

Query  2703  LTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLK  2882
             LT ESVEK++GWALSHHFMH SE+S  + K+ ISSESI YGLS+L GVQNE+KS+KKSLK
Sbjct  841   LTTESVEKVVGWALSHHFMHCSEASVNDSKILISSESILYGLSILHGVQNESKSLKKSLK  900

Query  2883  DVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTK  3062
             DVVTENEFEKKLLADV+PPSDIGV+FDDIGALENVKDTLKELVMLPLQRPELFCKGQLTK
Sbjct  901   DVVTENEFEKKLLADVMPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTK  960

Query  3063  PCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKI  3242
             PCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKI
Sbjct  961   PCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKI  1020

Query  3243  APSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDL  3422
             APSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDL
Sbjct  1021  APSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDL  1080

Query  3423  DEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLC  3602
             DEAVIRRLPRRLMVNLPDAPNREKILR+IL KE+LAP+VDL+A+ANMT+GYSGSD+KNLC
Sbjct  1081  DEAVIRRLPRRLMVNLPDAPNREKILRVILAKEDLAPDVDLEAVANMTDGYSGSDIKNLC  1140

Query  3603  VTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSE  3782
             VTAAHCPIREIL+KEKKE  LA++EN PLP L++SSDIRPL M+DFRYAHEQVCASVSSE
Sbjct  1141  VTAAHCPIREILKKEKKEITLALAENSPLPTLYSSSDIRPLKMEDFRYAHEQVCASVSSE  1200

Query  3783  STNMTELLQWNELYGEGGSRKKKALSYFM  3869
             STNM ELLQWN+LYGEGGSRKKK+LSYFM
Sbjct  1201  STNMNELLQWNDLYGEGGSRKKKSLSYFM  1229



>gb|KGN44925.1| hypothetical protein Csa_7G396400 [Cucumis sativus]
Length=1119

 Score =  1521 bits (3938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 796/1124 (71%), Positives = 936/1124 (83%), Gaps = 26/1124 (2%)
 Frame = +3

Query  552   QNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNS-ITLLEISGKKGCV  728
             QN H+ +  + FTVGQ RQC+L + DPSVS +LC L+HI+R  GNS + LLEI+G KG V
Sbjct  4     QNPHLFICGTLFTVGQSRQCNLWLKDPSVSTTLCKLRHIKR--GNSSVALLEITGGKGAV  61

Query  729   QVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPV  908
              VNGKI  KNS+V LNGGDEV+F SSGKHAYIFQ+ T++D + + +  SV+ILEAH  PV
Sbjct  62    IVNGKIVQKNSSVILNGGDEVVFTSSGKHAYIFQQLTSDDFTVSGLS-SVNILEAHCAPV  120

Query  909   KGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGE-  1085
             KG++FE RS D S V  AS LAS SN++K+L LL P    + D+K    +P++   SGE 
Sbjct  121   KGIHFERRSRDASAVTGASILASFSNIQKDLSLLSPPAKTNEDVK----LPSVCGVSGEQ  176

Query  1086  -PDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAID-SYDGEIGKVTGAP  1259
              PD +  D    D   H D  +D+    I PDSG +  +L+  A+D S DGE+G+     
Sbjct  177   SPDSNLKDGSTNDTDRHGDASMDKNIDPI-PDSGTERPSLDRLALDASIDGEVGEAPAKH  235

Query  1260  QELRPLIRMLAGSSTPEFDLSG-NISRIIDQRRE---LLKDFDP-LISMSTRRQAFKDGL  1424
              ELRPL+++LA S++P+F+++G +IS+I++++R+   L KDF P  + MSTRRQAFK+ L
Sbjct  236   SELRPLLQILASSASPDFNINGGSISKILNEQRDMGNLFKDFSPPAVLMSTRRQAFKERL  295

Query  1425  QQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSG  1604
             QQ IL  +NI+VS E FPYYLS+ TKNVLIAS ++HLKCNKFVK AS+LP + PRILLSG
Sbjct  296   QQGILKPDNIDVSLESFPYYLSDTTKNVLIASMFVHLKCNKFVKHASDLPILSPRILLSG  355

Query  1605  PAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAA  1781
             PAGSEIYQETL KALA++FGARLL+VDSL+LPGG + K++D VK+  +P+RT  F KRA 
Sbjct  356   PAGSEIYQETLTKALARHFGARLLIVDSLLLPGGPTPKDVDIVKDNSRPDRTSFFAKRAV  415

Query  1782  QAAV---LRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKNT-FKTGDRVKYVGPL  1949
             QAA    +  NKKP SSVEADI GGS +SS A  KQEASTASSK T FKTGD+VK+VG L
Sbjct  416   QAAAAAAVSQNKKPTSSVEADIAGGSTLSSQALPKQEASTASSKTTAFKTGDKVKFVGTL  475

Query  1950  PTGFS--LQT-PARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGF  2120
              +  S  LQT P RGP+YG +GKV+LAFEENG SKIGVRFD+SIP+GNDLGGLCEEDHGF
Sbjct  476   SSTLSPPLQTCPLRGPSYGCRGKVVLAFEENGSSKIGVRFDKSIPDGNDLGGLCEEDHGF  535

Query  2121  FCAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAF  2297
             FC+A+  LRLD    DD DKLAI+E+FEVVS E K+SPLILFVKDIEK+MVG+ +A+S  
Sbjct  536   FCSANHLLRLDGPGGDDTDKLAIDEVFEVVSNESKNSPLILFVKDIEKAMVGHSDAYSIL  595

Query  2298  KLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRS  2477
             K +LE LP NVVVI S+T  DNRKEKSHPGG LFTKFGSNQTALLDLAFPDNFGRLHDR+
Sbjct  596   KGRLENLPGNVVVIGSHTHMDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFGRLHDRN  655

Query  2478  KETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVE  2657
             KETPKA KQL+RLFPNKV I  PQ+E LLS WKQQL+RD ET+K+Q+N V+IR VLNR+ 
Sbjct  656   KETPKATKQLSRLFPNKVTILPPQEEALLSVWKQQLERDTETLKTQANIVSIRLVLNRIG  715

Query  2658  LDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVL  2837
             LDC +++TLCIKDQALT E+VEK++GWALSHHFMH S+   K+ KL IS+ESI YGL++L
Sbjct  716   LDCSNLDTLCIKDQALTIETVEKVVGWALSHHFMHFSDVLVKDAKLIISTESIEYGLNIL  775

Query  2838  QGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVML  3017
              G+Q+E KS+KKSL+DVVTENEFEKKLLADVIPP DIGVTF+DIGALENVKDTLKELVML
Sbjct  776   HGLQSENKSLKKSLRDVVTENEFEKKLLADVIPPGDIGVTFEDIGALENVKDTLKELVML  835

Query  3018  PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE  3197
             PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE
Sbjct  836   PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE  895

Query  3198  GEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDK  3377
             GEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDK
Sbjct  896   GEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDK  955

Query  3378  ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIA  3557
             ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KEELA ++DL+AIA
Sbjct  956   ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEELAADIDLEAIA  1015

Query  3558  NMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDD  3737
             NMT+GYSGSDLKNLCVTAAHCPIREIL+KEKKE+  A+++N+PLPAL++S+D+R L M+D
Sbjct  1016  NMTDGYSGSDLKNLCVTAAHCPIREILDKEKKERVSALTDNKPLPALYSSTDVRSLKMED  1075

Query  3738  FRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             FR+AHEQVCASVSSESTNM ELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1076  FRFAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKKMSLSYFM  1119



>ref|XP_010259604.1| PREDICTED: uncharacterized protein LOC104598971 isoform X2 [Nelumbo 
nucifera]
Length=1227

 Score =  1515 bits (3922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 818/1242 (66%), Positives = 977/1242 (79%), Gaps = 58/1242 (5%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDM---LGEKTPGAVNESGPESAEQEIRSADLDGASALKSPE---A  362
             NGKR K  E+ SST+++      +T G+  ESG ES +QE+R +DL      K  +   A
Sbjct  25    NGKRLKVAEASSSTNEIPCVTPVETLGSSKESGCESHDQEVRLSDLSAFGPSKESDDCDA  84

Query  363   PVPEKLPEAPLGGEPLVSPMILGDSAIDVDK-VKANGSALNRGKKRQLKSNLGTAWGKLL  539
              + EK P+    GE L  P   G  AI+ D  V+  G+A+NR +KR  KS    AWG+LL
Sbjct  85    TMLEKSPDRNGEGEVLAPPSATGGPAIEADNAVELVGAAMNRARKRSTKSRTKVAWGRLL  144

Query  540   SQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKK  719
             SQ  QN H+ +  S FTVGQG+QC+LC+ DPSVS  LC L+H++R  G+S+ LLEI G K
Sbjct  145   SQCSQNPHLLMCGSPFTVGQGQQCNLCLRDPSVSTILCKLRHLER-GGSSVALLEILGSK  203

Query  720   GCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHS  899
             G VQVNGK+  KNS+  L+GGDE+IF S+G++AYIFQ+ T+E++++ ++P SV+I E+ +
Sbjct  204   GVVQVNGKVVGKNSSTILSGGDELIFSSTGQNAYIFQQLTDENLTSPALPSSVNISESQN  263

Query  900   GPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVAS  1079
                              VA AS LASLSNL+K+L L PP+   + +++   E   LP   
Sbjct  264   A----------------VAGASILASLSNLRKDLSLTPPAQTGE-EVQHDLERQTLPTGC  306

Query  1080  GEPDKHDLDSDMKDVSDH---NDVPLDEKSGAI-SPDSGNDN-LNLENGAIDS-YDGEIG  1241
               PD      + KD+S+H     V   EK+  I SPD+ +DN ++L+   +++  D E+G
Sbjct  307   -IPDIEITCHNRKDISEHVEETGVSSSEKAPVILSPDNASDNPVHLDGAGLNTRLDAEVG  365

Query  1242  KVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKDFD-PLISMSTRRQAFKD  1418
             K+ G   ELRPL+RML GSS P+F+LSG++ + ID++RE+LKDF  P I  ST++QAFKD
Sbjct  366   KIPGTNYELRPLLRMLTGSSLPDFELSGSVFKSIDEQREILKDFGRPTILSSTKQQAFKD  425

Query  1419  GLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILL  1598
              L+Q IL S+NIEVSF++FPYYLSE TKN+LIASTY+HLKC ++ K  ++LPTV PRILL
Sbjct  426   SLRQGILSSSNIEVSFDNFPYYLSESTKNILIASTYMHLKCKEYAKYITDLPTVSPRILL  485

Query  1599  SGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFTKR  1775
             SGP+GSEIYQETLAKALAK+F ARLL+VD   LPG  S K+ + +KE  + E+  V  +R
Sbjct  486   SGPSGSEIYQETLAKALAKHFEARLLMVDFPQLPGALSTKDSESIKEI-RLEKM-VTKQR  543

Query  1776  AAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPL-  1949
             A QA  L+  KKPASSVEADI G S +SS A  KQEASTASSK+ TFK GDRV+YVG L 
Sbjct  544   ATQADALQL-KKPASSVEADIIGTSVLSSQALPKQEASTASSKSFTFKQGDRVRYVGSLV  602

Query  1950  -PTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFF  2123
              P+GF  LQT +RGP  GY+GKV+LAFEENG SK+GVRFD++IPE               
Sbjct  603   NPSGFPPLQTSSRGPGPGYRGKVVLAFEENGSSKVGVRFDKTIPE---------------  647

Query  2124  CAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKL  2303
               AD L L+NS  DDLDKLAINELFE+   E KS+PLILF+KDIEKSMVGN EA++AFK 
Sbjct  648   --ADLLCLENSGSDDLDKLAINELFELACSESKSAPLILFMKDIEKSMVGNQEAYTAFKT  705

Query  2304  KLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKE  2483
             +LE LPEN+V+I S+TQ DNRKEKSHPGG LFTKFGS+QTALLD AFPDNFGRLHDR+KE
Sbjct  706   RLENLPENIVIIGSHTQLDNRKEKSHPGGLLFTKFGSSQTALLDFAFPDNFGRLHDRNKE  765

Query  2484  TPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELD  2663
              PKA KQLTRLFPNKV IQ+PQDE LL DWKQ+LDRD++T+K+QSN +NIR+VLNR  LD
Sbjct  766   VPKATKQLTRLFPNKVTIQLPQDEALLLDWKQRLDRDVKTLKAQSNIINIRSVLNRNGLD  825

Query  2664  CPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQG  2843
             CPD+ TLCIKD ALT ESVEKI+GWALSHHFM+    S K+ KL ISSESIR+GL++L  
Sbjct  826   CPDLGTLCIKDHALTIESVEKIVGWALSHHFMNRDRDSPKDAKLVISSESIRFGLNILNS  885

Query  2844  VQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPL  3023
             +Q+E+KS+KKSLKDVVTENEFEK+LLADVIPP+DIGVTFDDIGALENVK+TLKELVMLPL
Sbjct  886   IQSESKSLKKSLKDVVTENEFEKRLLADVIPPNDIGVTFDDIGALENVKETLKELVMLPL  945

Query  3024  QRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  3203
             QRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE
Sbjct  946   QRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  1005

Query  3204  KYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKER  3383
             KYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKER
Sbjct  1006  KYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKER  1065

Query  3384  VLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANM  3563
             VLVLAATNRPFDLDEAV+RRLPRRLMVNLPDA NREKILR+IL KEE+AP+VDL+AIA M
Sbjct  1066  VLVLAATNRPFDLDEAVVRRLPRRLMVNLPDAANREKILRVILAKEEMAPDVDLEAIACM  1125

Query  3564  TEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFR  3743
             T+GYSGSDLKNLCVTAAHCPIREILEKEKKEKALA++EN+P P L+ S DIRPLNM+DF+
Sbjct  1126  TDGYSGSDLKNLCVTAAHCPIREILEKEKKEKALALAENKPPPTLYGSGDIRPLNMEDFK  1185

Query  3744  YAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
              AHEQVCASVSSES NM ELLQWNELYGEGGSRKK++LSYFM
Sbjct  1186  RAHEQVCASVSSESANMNELLQWNELYGEGGSRKKRSLSYFM  1227



>ref|XP_011008045.1| PREDICTED: uncharacterized protein LOC105113541 isoform X1 [Populus 
euphratica]
Length=1233

 Score =  1514 bits (3921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 802/1173 (68%), Positives = 926/1173 (79%), Gaps = 52/1173 (4%)
 Frame = +3

Query  441   IDVDKVKANGS------ALNRGKKR---QLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTV  593
             + +D+V ANG        LN+ KKR    +KSN   AWG+LLSQ  QN H  ++ + FTV
Sbjct  83    VSLDEVTANGEKSKGAVVLNKSKKRVPKSVKSNAKAAWGQLLSQCSQNPHKLINSTLFTV  142

Query  594   GQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPL  773
             GQ RQC+L ++D S+S  LC LKHI+R  G  I LLEI+G KG VQVNGK+Y KN TV L
Sbjct  143   GQSRQCNLWLNDSSISTILCKLKHIER-GGAPIALLEITGGKGAVQVNGKLYQKNETVAL  201

Query  774   NGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTV  953
             NGGDEVIF +SGKHAYIFQ+ T+  +    MP SVSILEA S P+KG++ E RS DPS  
Sbjct  202   NGGDEVIFTTSGKHAYIFQQLTSNSLGTPGMP-SVSILEAQSAPIKGIHSETRSRDPSDY  260

Query  954   AVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDH  1133
             A AS LASLS+L       PP+     D +Q  +   LP      + H  D +MKD + +
Sbjct  261   AGASILASLSHLL------PPAAKTGEDGQQNTDFSTLPSGCEASEDHVPDVEMKDGTSN  314

Query  1134  NDVPLD--EKSGAISPDSGN-------DNLNLENGAIDSYDGEIGKVTGAPQELRPLIRM  1286
              D P+D       ++P S         D++ L  GA    +  IG++  +  EL+PL+RM
Sbjct  315   KD-PIDVSPSEKPVAPSSNAANENANADSMRL--GAC--TNAVIGRIPNSTYELKPLLRM  369

Query  1287  LAGSSTPEFDLSGNISRIIDQR--RELLKDFDPL-ISMSTRRQAFKDGLQQTILDSNNIE  1457
             LAGSS+ EFD      +I D+R  RE LKD DP  + MSTRRQ FKD LQ+ IL+   IE
Sbjct  370   LAGSSS-EFD------KIFDERERREFLKDLDPPPVLMSTRRQLFKDSLQKGILNPEEIE  422

Query  1458  VSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQET  1634
             VSF++FPYYLS+ TK VLI + +IHLKC NK  K A +LPTV PR+LLSGPAGSEIYQET
Sbjct  423   VSFDNFPYYLSDTTKKVLIGAAFIHLKCGNKVAKFACDLPTVSPRMLLSGPAGSEIYQET  482

Query  1635  LAKALAKYFGARLLVVDSLVLPGGSA-KELDPVKEAPKPERTGVFTKRAAQAAVLRFNKK  1811
             L KALAK  GARLL+VDSL LPGGS  KE D  +E+ K ER   F KRA QAA+L   KK
Sbjct  483   LTKALAKDAGARLLIVDSLQLPGGSIHKEADSSRESLKSERVSAFAKRAMQAALL--TKK  540

Query  1812  PASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVG-PLPTGFS-LQTPAR  1982
             P SSVEA ITG S   SHA+ KQE STASSKN +FKTGDRVK+VG  L +  S LQ P +
Sbjct  541   PTSSVEAGITGCSTFGSHARPKQETSTASSKNYSFKTGDRVKFVGTSLASAISSLQPPLK  600

Query  1983  GPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSI  2162
              P  G +GKV+LAFE N   KIGVRFD+SIPEGNDLGG CEEDHGFFC A+ LRLD+S  
Sbjct  601   EPTIGLRGKVVLAFEGNNSYKIGVRFDQSIPEGNDLGGRCEEDHGFFCTANSLRLDSSGG  660

Query  2163  DDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIA  2342
             +D+D+LAINELFEV   E K+ PLILF+KD+EKS+VGN +A+S+ K KLE LPE V+V+ 
Sbjct  661   EDVDRLAINELFEVALNESKNGPLILFLKDLEKSVVGNQDAYSSLKSKLENLPEKVIVMG  720

Query  2343  SYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFP----DNFGRLHDRSKETPKAIKQLT  2510
             S+TQ DNRKEKSH GG LFTKFG N TALLDLAFP    D+ GR  DRSKETPKA+KQL+
Sbjct  721   SHTQIDNRKEKSHAGGLLFTKFGGNHTALLDLAFPPLIQDSIGRPSDRSKETPKAMKQLS  780

Query  2511  RLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCI  2690
             RLFPNKV +Q+PQDE LL DWKQQL+RDIET+K+Q+N  + R+VL+RV L CPD+ET+C+
Sbjct  781   RLFPNKVTVQLPQDEALLVDWKQQLERDIETLKAQANIFSFRSVLSRVGLCCPDLETVCL  840

Query  2691  KDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVK  2870
             KDQALT ESVEK++GWALSHHFMH SE+S  + K+ ISSESI YGLS+L GVQNE+KS+K
Sbjct  841   KDQALTTESVEKVVGWALSHHFMHCSEASVNDSKILISSESILYGLSILHGVQNESKSLK  900

Query  2871  KSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKG  3050
             KSLKDVVTENEFEKKLLADV+PPSDIGV+FDDIGALENVKDTLKELVMLPLQRPELFCKG
Sbjct  901   KSLKDVVTENEFEKKLLADVMPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPELFCKG  960

Query  3051  QLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTL  3230
             QLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+L
Sbjct  961   QLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSL  1020

Query  3231  ASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNR  3410
             ASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNR
Sbjct  1021  ASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNR  1080

Query  3411  PFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDL  3590
             PFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KE+LAP+VDL+A+ANMT+GYSGSD+
Sbjct  1081  PFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILAKEDLAPDVDLEAVANMTDGYSGSDI  1140

Query  3591  KNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCAS  3770
             KNLCVTAAHCPIREIL+KEKKE  LA++EN PLP L++SSDIRPL M+DFRYAHEQVCAS
Sbjct  1141  KNLCVTAAHCPIREILKKEKKEITLALAENSPLPTLYSSSDIRPLKMEDFRYAHEQVCAS  1200

Query  3771  VSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             VSSESTNM ELLQWN+LYGEGGSRKKK+LSYFM
Sbjct  1201  VSSESTNMNELLQWNDLYGEGGSRKKKSLSYFM  1233



>ref|XP_006588599.1| PREDICTED: uncharacterized protein LOC100794406 isoform X5 [Glycine 
max]
Length=1223

 Score =  1514 bits (3919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 828/1243 (67%), Positives = 966/1243 (78%), Gaps = 63/1243 (5%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTPGAVNESGP--ESAEQEIRSADLDGASALKSPEAPV--  368
             N KR K +E  SST       +   VNESG   ESAE E+  +DL   ++LK+ +  V  
Sbjct  24    NTKRCKVSEDSSSTT----VPSVAPVNESGTANESAEPELMLSDLPETASLKAVDGCVAM  79

Query  369   -PEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGK-KRQLKSNLG--TAWGKL  536
              P+K P  P+ GE LVSP   G++A     V    +    G+ K+Q  S L    AWGKL
Sbjct  80    SPDKSPSVPVEGEALVSPQCQGETAEKSKGVLMAAATTTGGRSKKQRPSKLSPKVAWGKL  139

Query  537   LSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGK  716
             LSQ  QN HV +    FTVGQGR C+L + DP+V   LC L HI+R  G+S+ LLEI+G 
Sbjct  140   LSQCSQNPHVSMSDLIFTVGQGRNCNLWLKDPTVGNVLCKLSHIER-GGSSVALLEITGG  198

Query  717   KGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAH  896
             KG +QVNGK Y KN+ + L+GGDEV+FGSSGKHAYIFQ  TN +IS A +P SVSILEA 
Sbjct  199   KGSIQVNGKTYRKNARLILSGGDEVVFGSSGKHAYIFQLLTNNNISPAVIPSSVSILEAQ  258

Query  897   SGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVA  1076
             S P+ G   EARSGDPS VA AS LASLSNL K+L LL P      +++Q  ++ +LP  
Sbjct  259   SAPINGTQVEARSGDPSAVAGASILASLSNLPKDLSLLSPPAKTGKNVQQNSDISSLP--  316

Query  1077  SGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPD-SGNDNLNLENGAID-SYDGEIGKVT  1250
             SG  D   + S+MKD +  NDV     S   S D + N+N +L+   +D + D ++ KVT
Sbjct  317   SGNEDDMPI-SEMKDAT--NDV----ASEVCSADKTVNENPSLDTAEVDINVDADVRKVT  369

Query  1251  GAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELL---KDFD-PLISMSTRRQAFKD  1418
              A  ELRPL+R+LAGS  PE DLS  I++I+++RREL    KD D P I  STRRQAF+D
Sbjct  370   AATYELRPLLRLLAGS-CPELDLSCGITKILEERRELRELLKDVDTPTILASTRRQAFRD  428

Query  1419  GLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILL  1598
              L+Q IL S NI+VSFE FPYYLS+ TK+VLIAST+IHLKC  F K AS+L +V PRILL
Sbjct  429   SLEQRILKSKNIDVSFETFPYYLSDTTKSVLIASTFIHLKCMGFGKYASDLSSVSPRILL  488

Query  1599  SGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPER-TGVFTK  1772
             SGPAGSEIYQETL KALAK+FGARLL+VDSL LPGG+ +KE+D  KE+ +PE+ + VFTK
Sbjct  489   SGPAGSEIYQETLCKALAKHFGARLLIVDSLSLPGGAPSKEVDSAKESSRPEKPSSVFTK  548

Query  1773  RAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK-NTFKTGDRVKYVGPL  1949
             R++Q A L+ +KKPASSV+A+I GGS ISS A  KQE STASSK  T K GDRVK+VG  
Sbjct  549   RSSQTATLQ-HKKPASSVDAEIVGGSTISSQAMLKQEVSTASSKGTTLKEGDRVKFVGNF  607

Query  1950  PTGFSL--QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFF  2123
             P+  S     P+RGP+YG +GKVLLAFE+N  SKIGVRFD+SIP+GNDLGGLCEED GFF
Sbjct  608   PSAVSSLPNYPSRGPSYGSRGKVLLAFEDNRSSKIGVRFDKSIPDGNDLGGLCEEDRGFF  667

Query  2124  CAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFK  2300
             C+A+  LR+D S  DD DK+AI+++FEV S + KS PL+LF+KDIEK+MVGN   +   K
Sbjct  668   CSANHLLRVDGSGGDDADKVAISDIFEVTSNQSKSGPLVLFIKDIEKAMVGN---YEVLK  724

Query  2301  LKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSK  2480
              K E LP NVVVI S+T  DNRKEK                        DNFGRLHDRSK
Sbjct  725   NKFESLPPNVVVIGSHTLLDNRKEK------------------------DNFGRLHDRSK  760

Query  2481  ETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVEL  2660
             ETPK +KQL RLFPNKV IQ+PQDE +LSDWKQQL+RDIETMK+QSN V+IR VLNR+ L
Sbjct  761   ETPKVMKQLGRLFPNKVTIQLPQDEAILSDWKQQLERDIETMKAQSNIVSIRTVLNRIGL  820

Query  2661  DCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQ  2840
             DCPD+ETL IKDQ LT ESVEKIIGWA+S+HFMHSS++S K+ KL IS+ES+ YG+++LQ
Sbjct  821   DCPDLETLSIKDQTLTTESVEKIIGWAISYHFMHSSKASIKDSKLVISAESLNYGINILQ  880

Query  2841  GVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLP  3020
             G+QNE K++KKSLKDVVTENEFEKKLLADVIPP+DIGVTFDDIGALENVKDTLKELVMLP
Sbjct  881   GIQNENKNLKKSLKDVVTENEFEKKLLADVIPPTDIGVTFDDIGALENVKDTLKELVMLP  940

Query  3021  LQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEG  3200
             LQRPELFCKGQL KPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEG
Sbjct  941   LQRPELFCKGQLAKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEG  1000

Query  3201  EKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKE  3380
             EKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+P EHEAMRKMKNEFMVNWDGLRTKDKE
Sbjct  1001  EKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPSEHEAMRKMKNEFMVNWDGLRTKDKE  1060

Query  3381  RVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIAN  3560
             RVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR+IL KE+LAP+VD +AIAN
Sbjct  1061  RVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRVILVKEDLAPDVDFEAIAN  1120

Query  3561  MTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDF  3740
             MT+GYSGSDLKNLCVTAAHCPIREILEKEKKE++LA+SE++PLP L  S DIRPL MDDF
Sbjct  1121  MTDGYSGSDLKNLCVTAAHCPIREILEKEKKERSLALSESKPLPGLCGSGDIRPLKMDDF  1180

Query  3741  RYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             RYAHEQVCASVSSESTNM ELLQWN+LYGEGGSRK ++LSYFM
Sbjct  1181  RYAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKMRSLSYFM  1223



>gb|KHN03731.1| Protein MSP1 [Glycine soja]
Length=1226

 Score =  1513 bits (3917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 809/1238 (65%), Positives = 957/1238 (77%), Gaps = 49/1238 (4%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTPGAVNESGP--ESAEQEIRSADLDGASALKSPEAPVPE  374
             N KRSK +E  S             VNESG   ES E E+R +DL   ++LK   A V +
Sbjct  23    NTKRSKVSEDSS---------VAAPVNESGTGNESGEPELRPSDLPDTASLKV--AGVCD  71

Query  375   KLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQ  554
             K   +P  GE LV P+  G++A   +K K  G      KKR  KS   TAWGKLLSQ  +
Sbjct  72    K---SPSEGEALVPPLCAGETA---EKSKVAGLPPRSVKKRAAKSCPKTAWGKLLSQCSK  125

Query  555   NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQV  734
               HV + +  FTVGQGR C+L + DP++   LC L HI+R  G+S  LLEI+G KG + V
Sbjct  126   TPHVCMTEPFFTVGQGRHCNLWLKDPTIGSVLCKLSHIER-GGSSGALLEITGGKGSIHV  184

Query  735   NGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKG  914
             NGK Y KN+ + L+GGDEV+FGSS K+AYIFQ+ +N +IS A +  SVSILEA S P+ G
Sbjct  185   NGKTYRKNARLILSGGDEVVFGSSAKYAYIFQQLSNSNISTADIASSVSILEAQSAPLNG  244

Query  915   VNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDK  1094
             +  EARSGDPS VA AS LASLSN   + L L P         Q  ++ +L    G+   
Sbjct  245   MQVEARSGDPSAVAGASILASLSNNICKELSLLPPAAKTGKNVQNTDISSLHSGCGD---  301

Query  1095  HDL-DSDMKDVSDHNDVPLD---EKSGAISPDSGNDNLNLENGAIDS-YDGEIGKVTGAP  1259
              D+ D++M D +++ +   D   +K+   S  + N+N NL++  +D+  D  +GK+T A 
Sbjct  302   -DIPDNEMNDTTNNAEPAGDFSADKTVLASSTTVNENPNLDSVEVDTNIDANVGKMTAAA  360

Query  1260  QELRPLIRMLAGSSTPEFDLSGNISRIIDQRREL---LKDFD-PLISMSTRRQAFKDGLQ  1427
              ELRPL+RML GS  PEFDLSG+IS+I++ RREL   LKD D P +  ST+R+AFKD LQ
Sbjct  361   YELRPLLRMLTGS-CPEFDLSGSISKILEGRRELRELLKDVDTPTVLASTKREAFKDILQ  419

Query  1428  QTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGP  1607
             Q IL +  I+VSFE FPYYLS+ TKNVLIAST+IHLKCN F K AS+LP+V PRILLSGP
Sbjct  420   QRILIAEKIDVSFETFPYYLSDTTKNVLIASTFIHLKCNGFGKYASDLPSVSPRILLSGP  479

Query  1608  AGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQ  1784
             AGSEIYQETL+KAL K+FGARLL+VDSL LPGGS +KE+D  KE+   E+  VF+++   
Sbjct  480   AGSEIYQETLSKALVKHFGARLLIVDSLSLPGGSPSKEVDSAKESYCAEKPSVFSRKKNL  539

Query  1785  AAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKNTFKTGDRVKYVGPLPTGFS  1964
                +  +KKPASSV A+I GG  + S A +K          T K GDRVK++G  P+  S
Sbjct  540   HTAMLQHKKPASSVNAEIIGGPMLISSASSKG--------TTLKKGDRVKFIGSFPSAVS  591

Query  1965  L--QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAAD-  2135
                   +RGP+YG +GKVLLAFE+NG SKIGVRFD+SIP+GNDLGGLCE+D GFFC+A+ 
Sbjct  592   SLPNYISRGPSYGSRGKVLLAFEDNGSSKIGVRFDKSIPDGNDLGGLCEDDRGFFCSANH  651

Query  2136  FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEK  2315
              LR+D S  DDLDK+AINE+FEVVS + KS  L+LF+KDIEK+M+GN   +   K K E 
Sbjct  652   LLRVDGSGGDDLDKVAINEIFEVVSNQSKSGALVLFIKDIEKAMIGN---YEILKSKFES  708

Query  2316  LPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKA  2495
             LP NVVV+ S+TQ DNRKEK+ PG  LFTKFGSNQTALLDLAFPDNF RLHDRSKE  K 
Sbjct  709   LPPNVVVVGSHTQLDNRKEKTQPGSLLFTKFGSNQTALLDLAFPDNFSRLHDRSKEISKV  768

Query  2496  IKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDI  2675
             +KQL+RLFPNKV IQ+PQDE LLSDWKQQLD DIETMK+QSN V+IR VL R+ LDCPD+
Sbjct  769   MKQLSRLFPNKVTIQLPQDEALLSDWKQQLDCDIETMKAQSNVVSIRLVLGRIGLDCPDL  828

Query  2676  ETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNE  2855
             ETLCIKD  LT ESVEKIIGWA+S+HFMHSSE+S +  KL IS+ESI+YG ++LQG+QNE
Sbjct  829   ETLCIKDHTLTTESVEKIIGWAISYHFMHSSEASIRYSKLVISAESIKYGHNILQGIQNE  888

Query  2856  TKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPE  3035
              K++KKSLKDVVTENEFEKKLL DVIPP+DIGVTFDDIGALENVK+TLKELVMLPLQRPE
Sbjct  889   NKNMKKSLKDVVTENEFEKKLLTDVIPPTDIGVTFDDIGALENVKETLKELVMLPLQRPE  948

Query  3036  LFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVK  3215
             LF KGQL KPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVK
Sbjct  949   LFGKGQLAKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVK  1008

Query  3216  AVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVL  3395
             AVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKER+LVL
Sbjct  1009  AVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERILVL  1068

Query  3396  AATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGY  3575
             AATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKI+ +IL KEELAP+VD +AIANMT+GY
Sbjct  1069  AATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKIVSVILAKEELAPDVDFEAIANMTDGY  1128

Query  3576  SGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHE  3755
             SGSDLKNLCVTAAHCPIREILEKEKKE++LA++EN+PLP L +S+DIRPL M+DF YAHE
Sbjct  1129  SGSDLKNLCVTAAHCPIREILEKEKKERSLALTENQPLPQLCSSTDIRPLKMEDFIYAHE  1188

Query  3756  QVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             QVC SVSSESTNM ELLQWN+LYGEGGSRK ++LSYFM
Sbjct  1189  QVCVSVSSESTNMNELLQWNDLYGEGGSRKMRSLSYFM  1226



>ref|XP_006588598.1| PREDICTED: uncharacterized protein LOC100794406 isoform X4 [Glycine 
max]
Length=1226

 Score =  1513 bits (3917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 809/1238 (65%), Positives = 958/1238 (77%), Gaps = 49/1238 (4%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTPGAVNESGP--ESAEQEIRSADLDGASALKSPEAPVPE  374
             N KRSK +E  S             VNESG   ES E E+R +DL   ++LK   A V +
Sbjct  23    NTKRSKVSEDSS---------VAAPVNESGTGNESGEPELRPSDLPDTASLKV--AGVCD  71

Query  375   KLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQ  554
             K   +P  GE LV P+  G++A   +K K  G      KKR  KS   TAWGKLLSQ  +
Sbjct  72    K---SPSEGEALVPPLCAGETA---EKSKVAGLPPRSVKKRAAKSCPKTAWGKLLSQCSK  125

Query  555   NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQV  734
               HV + +  FTVGQGR C+L + DP++   LC L HI+R  G+S  LLEI+G KG + V
Sbjct  126   TPHVCMTEPFFTVGQGRHCNLWLKDPTIGSVLCKLSHIER-GGSSGALLEITGGKGSIHV  184

Query  735   NGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKG  914
             NGK Y KN+ + L+GGDEV+FGSS K+AYIFQ+ +N +IS A +  SVSILEA S P+ G
Sbjct  185   NGKTYRKNARLILSGGDEVVFGSSAKYAYIFQQLSNSNISTADIASSVSILEAQSAPLNG  244

Query  915   VNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDK  1094
             +  EARSGDPS VA AS LASLSN   + L L P         Q  ++ +L    G+   
Sbjct  245   MQVEARSGDPSAVAGASILASLSNNICKELSLLPPAAKTGKNVQNTDISSLHSGCGD---  301

Query  1095  HDL-DSDMKDVSDHNDVPLD---EKSGAISPDSGNDNLNLENGAIDS-YDGEIGKVTGAP  1259
              D+ D++M D +++ +   D   +K+   S  + N+N NL++  +D+  D  +GK+T A 
Sbjct  302   -DIPDNEMNDTTNNAEPAGDFSADKTVLASSTTVNENPNLDSVEVDTNIDANVGKMTAAA  360

Query  1260  QELRPLIRMLAGSSTPEFDLSGNISRIIDQRREL---LKDFD-PLISMSTRRQAFKDGLQ  1427
              ELRPL+RML GS  PEFDLSG+IS+I++ RREL   LKD D P +  ST+R+AFKD LQ
Sbjct  361   YELRPLLRMLTGS-CPEFDLSGSISKILEGRRELRELLKDVDTPTVLASTKREAFKDILQ  419

Query  1428  QTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGP  1607
             Q IL +  I+VSFE FPYYLS+ TKNVLIAST+IHLKCN F K AS+LP+V PRILLSGP
Sbjct  420   QRILIAEKIDVSFETFPYYLSDTTKNVLIASTFIHLKCNGFGKYASDLPSVSPRILLSGP  479

Query  1608  AGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQ  1784
             AGSEIYQETL+KAL K+FGARLL+VDSL LPGGS +KE+D  KE+   E+  VF+++   
Sbjct  480   AGSEIYQETLSKALVKHFGARLLIVDSLSLPGGSPSKEVDSAKESYCAEKPSVFSRKKNL  539

Query  1785  AAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKNTFKTGDRVKYVGPLPTGFS  1964
                +  +KKPASSV A+I GG  + S A +K          T K GDRVK++G  P+  S
Sbjct  540   HTAMLQHKKPASSVNAEIIGGPMLISSASSKG--------TTLKKGDRVKFIGSFPSAVS  591

Query  1965  L--QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAAD-  2135
                   +RGP+YG +GKVLLAFE+NG SKIGVRFD+SIP+GNDLGGLCE+D GFFC+A+ 
Sbjct  592   SLPNYISRGPSYGSRGKVLLAFEDNGSSKIGVRFDKSIPDGNDLGGLCEDDRGFFCSANH  651

Query  2136  FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEK  2315
              LR+D S  DDLDK+AINE+FEVVS + KS  L+LF+KDIEK+M+GN   +   K K E 
Sbjct  652   LLRVDGSGGDDLDKVAINEIFEVVSNQSKSGALVLFIKDIEKAMIGN---YEILKSKFES  708

Query  2316  LPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKA  2495
             LP NVVV+ S+TQ DNRKEK+ PG  LFTKFGSNQTALLDLAFPDNF RLHDRSKE  K 
Sbjct  709   LPPNVVVVGSHTQLDNRKEKTQPGSLLFTKFGSNQTALLDLAFPDNFSRLHDRSKEISKV  768

Query  2496  IKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDI  2675
             +KQL+RLFPNKV IQ+PQDE LLSDWKQQLD DIETMK+QSN V+IR VL R+ LDCPD+
Sbjct  769   MKQLSRLFPNKVTIQLPQDEALLSDWKQQLDCDIETMKAQSNVVSIRLVLGRIGLDCPDL  828

Query  2676  ETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNE  2855
             ETLCIKD  LT ESVEKIIGWA+S+HFMHSSE+S ++ KL IS+ESI+YG ++LQG+QNE
Sbjct  829   ETLCIKDHTLTTESVEKIIGWAISYHFMHSSEASIRDSKLVISAESIKYGHNILQGIQNE  888

Query  2856  TKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPE  3035
              K++KKSLKDVVTENEFEKKLL DVIPP+DIGVTFDDIGALENVK+TLKELVMLPLQRPE
Sbjct  889   NKNMKKSLKDVVTENEFEKKLLTDVIPPTDIGVTFDDIGALENVKETLKELVMLPLQRPE  948

Query  3036  LFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVK  3215
             LF KGQL KPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVK
Sbjct  949   LFGKGQLAKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVK  1008

Query  3216  AVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVL  3395
             AVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKER+LVL
Sbjct  1009  AVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERILVL  1068

Query  3396  AATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGY  3575
             AATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKI+ +IL KEELAP+VD +AIANMT+GY
Sbjct  1069  AATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKIVSVILAKEELAPDVDFEAIANMTDGY  1128

Query  3576  SGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHE  3755
             SGSDLKNLCVTAAHCPIREILEKEKKE++LA++EN+PLP L +S+DIRPL M+DF YAHE
Sbjct  1129  SGSDLKNLCVTAAHCPIREILEKEKKERSLALTENQPLPQLCSSTDIRPLKMEDFIYAHE  1188

Query  3756  QVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             QVC SVSSESTNM ELLQWN+LYGEGGSRK ++LSYFM
Sbjct  1189  QVCVSVSSESTNMNELLQWNDLYGEGGSRKMRSLSYFM  1226



>gb|KDO87285.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1183

 Score =  1512 bits (3915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 783/1154 (68%), Positives = 925/1154 (80%), Gaps = 22/1154 (2%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  386
             KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27    KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  387   APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGTA--WGKLLSQYPQ  554
             A +  + LVSP   G++A+D +K KA G   N R KKR  K   +G+   W +L+SQ  Q
Sbjct  84    ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQ  143

Query  555   NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQV  734
             NSH+ +  + FTVG  RQCDL + DPS+SK+LC L+ I+   G S  LLEI+G KG V+V
Sbjct  144   NSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIE-NGGPSGALLEITGGKGEVEV  202

Query  735   NGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKG  914
             NG ++PK+S V L GGDE++F  SGKH+YIFQ+ +++ ++A  + P +SILEA S P+K 
Sbjct  203   NGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKT  262

Query  915   VNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDK  1094
             ++ EARSGDPS VA AS LASLSN++K+L L+PP      D  Q  E+ +L      P+ 
Sbjct  263   MHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVD-AQNSEIASLASGCDGPED  321

Query  1095  HDLDSDMKDVSDHNDVPLDEKSG-AISP--DSGNDNLNLENGAIDS-YDGEIGKVTGAPQ  1262
                D DMKD + +ND       G  + P  D+ N+N NL++  +D+  D EIGK+ GA  
Sbjct  322   RIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATY  381

Query  1263  ELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFD-PLISMSTRRQAFKDGLQQ  1430
             ELRPL+RMLAGSS+P+FD+SG IS+I+D++RE   LLKD D P + +S RRQAFKD LQ+
Sbjct  382   ELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQE  441

Query  1431  TILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPA  1610
              IL   NIEVSFE FPYYLS+ITKNVLIASTY+HLKCN F K AS+LPT+CPRILLSGPA
Sbjct  442   GILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPA  501

Query  1611  GSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAAQAA  1790
             GSEIYQETLAKALAK+F ARLL+VDSL+LPGGS+KE D VKE+ + E+  +F KRAA   
Sbjct  502   GSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAA---  558

Query  1791  VLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSL  1967
              L  ++KP SSVEADITGG+A+ S A  K E STASSKN TFK GDRVK+VG + +G ++
Sbjct  559   -LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTV  617

Query  1968  QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRL  2147
             Q   RGP  G++G+V+L FE+N FSKIGVRFDRSIPEGN+LGG CE+DHGFFC A  LRL
Sbjct  618   QPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRL  677

Query  2148  DNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPEN  2327
             D+S  D++DKLAINELFEV   E KSSPLI+FVKDIEKS+ GN +A+ A K KLE LP N
Sbjct  678   DSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSN  737

Query  2328  VVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQL  2507
             VVVI S+TQ D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNF RLHDRSKETPKA+KQ+
Sbjct  738   VVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQI  797

Query  2508  TRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLC  2687
             +RLFPNKV IQ+PQDE LLSDWKQQL+RD+ET+K QSN ++IR+VL+R  LDC D+E+LC
Sbjct  798   SRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLC  857

Query  2688  IKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSV  2867
             IKDQ LT E VEKI+GWALSHHFMH SE+  K+ KL IS+ESI YGL++LQG+Q+E+KS+
Sbjct  858   IKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSL  917

Query  2868  KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  3047
             KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK
Sbjct  918   KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  977

Query  3048  GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFT  3227
             GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+
Sbjct  978   GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS  1037

Query  3228  LASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  3407
             LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN
Sbjct  1038  LASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  1097

Query  3408  RPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSD  3587
             RPFDLDEAV+RRLPRRLMVNLPDAPNREKI+R+IL KEELA +VDL+ IANM +GYSGSD
Sbjct  1098  RPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSD  1157

Query  3588  LKNLCVTAAHCPIR  3629
             LKNLCVTAAHCPIR
Sbjct  1158  LKNLCVTAAHCPIR  1171



>ref|XP_006575112.1| PREDICTED: uncharacterized protein LOC100800938 isoform X1 [Glycine 
max]
Length=1225

 Score =  1509 bits (3908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 806/1221 (66%), Positives = 960/1221 (79%), Gaps = 56/1221 (5%)
 Frame = +3

Query  276   VNESGPESAEQEIRSADLDGASALKSPE---APVPEKLPEAPLGGEPLVSPMILGDSAID  446
             VN+SG    E E+R +DL   ++LK+ +   A +P+K   +P  GE LV P   G++A  
Sbjct  38    VNKSG----EPELRPSDLPDTASLKAVDVCDAVLPDK---SPSEGEALVPPRCAGETA--  88

Query  447   VDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVD  626
              +K K  G      KKR  KS   TAWGKLLSQ  +N HV + +  FTVGQG+ C+L + 
Sbjct  89    -EKSKVAGLPPRSVKKRAAKSCPKTAWGKLLSQCSKNPHVCMTEPIFTVGQGQHCNLWLK  147

Query  627   DPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSS  806
             DP++   LC L HI+R   +S  LLEI+G KG + VNGK Y KN+ + L+GGDEV+FGSS
Sbjct  148   DPTIGSVLCKLSHIER-GSSSGALLEITGSKGSIHVNGKTYRKNACLILSGGDEVVFGSS  206

Query  807   GKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsn  986
              K+AYIFQ+ TN  IS A +  SVSILEA S P+ G+  EARSGD S VA AS LASLSN
Sbjct  207   AKYAYIFQQLTNSIISTADIASSVSILEAQSAPINGMQVEARSGDLSAVAEASILASLSN  266

Query  987   lk-kellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDL-DSDMKDVSDHNDVPLDEKS  1160
                KEL LLPP+     +++Q  ++ +L    G+    D+ D++M D +++     DE +
Sbjct  267   NICKELSLLPPAAKTGKNVQQNTDISSLHSGCGD----DITDNEMSDTTNN-----DEPA  317

Query  1161  GAISPD--------SGNDNLNLENGAIDS-YDGEIGKVTGAPQELRPLIRMLAGSSTPEF  1313
             G  S D        + N+N NL +  +D+  D ++GK+T A  ELRPL+RML GS  PEF
Sbjct  318   GDFSADKTVLGSSTTVNENPNLGSAEVDTNIDADVGKMTTATYELRPLLRMLTGS-CPEF  376

Query  1314  DLSGNISRIID-QR--RELLKDFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPY  1481
             DLSG+IS+I++ QR  RELLKD D P +  ST+R AFKD LQQ IL +  I+VSFE FPY
Sbjct  377   DLSGSISKILEGQRELRELLKDVDTPTVLASTKRLAFKDSLQQRILKAEKIDVSFETFPY  436

Query  1482  YLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYF  1661
             YLS+ TKNVLIAST+IHLKC  F K AS+LP+V PRI+LSGPAGSEIYQETL+KAL K+F
Sbjct  437   YLSDTTKNVLIASTFIHLKCKGFGKYASDLPSVSPRIVLSGPAGSEIYQETLSKALVKHF  496

Query  1662  GARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFT-KRAAQAAVLRFNKKPASSVEAD  1835
             GARLL+VDSL LPGGS +KE+D  KE+   E+  VF+ KR  Q A+L+ +KKPASSV A+
Sbjct  497   GARLLIVDSLSLPGGSPSKEVDSAKESSGAEKPSVFSRKRNFQTAMLQ-HKKPASSVNAE  555

Query  1836  ITGGSAISSHAQTKQEASTASSKNTFKTGDRVKYVGPLPTGFSL--QTPARGPAYGYKGK  2009
             I GG  + S A +K          T + GDRVK++G  P+  S      +RGP+YG +GK
Sbjct  556   IIGGPMLISSASSKGA--------TLRKGDRVKFIGSFPSAVSSLPNYISRGPSYGSRGK  607

Query  2010  VLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAAD-FLRLDNSSIDDLDKLAI  2186
             VLLAFE+NG SKIGVRFD+SIP+GNDLGGLCE+DHGFFC+A+  L++D S  DDLDK+AI
Sbjct  608   VLLAFEDNGSSKIGVRFDKSIPDGNDLGGLCEDDHGFFCSANHLLQVDGSGGDDLDKVAI  667

Query  2187  NELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNR  2366
             NE+FEV S + KS  L+LF+KDI K+M+GN   +   K K E LP NVVV+ S+TQ DN+
Sbjct  668   NEIFEVASNQSKSGALVLFIKDIGKAMIGN---YEILKSKFESLPPNVVVVGSHTQLDNQ  724

Query  2367  KEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIP  2546
             KEK+ PG  LFTKFGSNQTALLDLAFPDNF RLHDRSKET K +KQL RLFPNKV IQ+P
Sbjct  725   KEKAQPGSLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETSKVMKQLNRLFPNKVTIQLP  784

Query  2547  QDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEK  2726
             QDE LLSDWKQQLDRDIETMK+QSN V+IR VLNR+ LDCPD+ETLCIKD  LT ESVEK
Sbjct  785   QDEALLSDWKQQLDRDIETMKAQSNVVSIRLVLNRIGLDCPDLETLCIKDHTLTTESVEK  844

Query  2727  IIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEF  2906
             IIGWALS+HFMHSSE+S ++ KL IS+ESI+YG  +LQG+QNE K++KKSLKDVVTENEF
Sbjct  845   IIGWALSYHFMHSSEASIRDSKLVISAESIKYGHKILQGIQNENKNMKKSLKDVVTENEF  904

Query  2907  EKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLF  3086
             EKKLL DVIPP+DIGVTFDDIGALENVK+TLKELVMLPLQRPELF KGQL KPCKGILLF
Sbjct  905   EKKLLTDVIPPTDIGVTFDDIGALENVKETLKELVMLPLQRPELFGKGQLAKPCKGILLF  964

Query  3087  GPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVD  3266
             GPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVD
Sbjct  965   GPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVD  1024

Query  3267  EVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRL  3446
             EVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKER+LVLAATNRPFDLDEAVIRRL
Sbjct  1025  EVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERILVLAATNRPFDLDEAVIRRL  1084

Query  3447  PRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPI  3626
             PRRLMVNLPDAPNR KI+R+IL KE+LAP+VD +AIANMT+GYSGSDLKNLCVTAA CPI
Sbjct  1085  PRRLMVNLPDAPNRGKIVRVILAKEDLAPDVDFEAIANMTDGYSGSDLKNLCVTAAQCPI  1144

Query  3627  ReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELL  3806
             R+ILEKEKKE++LA++EN+PLP L +S+D+RPL M+DFRYAHEQVCASVSSESTNM+ELL
Sbjct  1145  RQILEKEKKERSLALAENQPLPQLCSSTDVRPLKMEDFRYAHEQVCASVSSESTNMSELL  1204

Query  3807  QWNELYGEGGSRKKKALSYFM  3869
             QWN+LYGEGGSRK ++LSYFM
Sbjct  1205  QWNDLYGEGGSRKMRSLSYFM  1225



>ref|XP_002321014.1| AAA-type ATPase family protein [Populus trichocarpa]
 gb|EEE99329.1| AAA-type ATPase family protein [Populus trichocarpa]
Length=1231

 Score =  1508 bits (3904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 796/1146 (69%), Positives = 924/1146 (81%), Gaps = 37/1146 (3%)
 Frame = +3

Query  477   LNRGKKR---QLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKS  647
             LN+ KKR    +KS+   AWG+LLSQ  QN H  ++ + F+VGQ RQC+L ++DPS+S  
Sbjct  108   LNKSKKRVPKSVKSSAKAAWGQLLSQCSQNPHKLMNSTLFSVGQSRQCNLWLNDPSISTV  167

Query  648   LCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIF  827
             LC LKHI+R  G S+ LLEI+G KG VQVNGK+Y KN ++ LNGGDEVIF +SGKHAYIF
Sbjct  168   LCKLKHIER-GGASVVLLEITGGKGAVQVNGKLYQKNESLVLNGGDEVIFTTSGKHAYIF  226

Query  828   QKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkelll  1007
             Q+ T+ ++    MP SVSILEA S P+KG++ EAR  DPS  A AS LASLS+L      
Sbjct  227   QQLTSNNLGTPGMP-SVSILEAQSAPIKGIHIEARPRDPSDYAGASILASLSHLL-----  280

Query  1008  lPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND---VPLDEKSGAISPD  1178
              PP+     D +Q  +   LP      +    D +MKD + +ND   V   EK+   S +
Sbjct  281   -PPAAKTGEDTQQNTDFSILPSGCEASEDRIPDVEMKDGTCNNDTADVFPREKAAVPSSN  339

Query  1179  SGNDNLNLEN-GAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQR-  1352
             + ++N N+++ G+    D  IG++  +  EL+PL+RMLAGSS+ E D      +I D+R 
Sbjct  340   AASENANVDSMGSGACTDAVIGRIPNSTYELKPLLRMLAGSSS-ELD------KIFDERE  392

Query  1353  -RELLKDFDPL-ISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTY  1526
              RE+LKD DP  + MSTRRQ FKD LQ+ IL+   IEVSF+ FPYYLS+ TK VLI++ +
Sbjct  393   RREILKDLDPPPVLMSTRRQLFKDSLQKGILNPEEIEVSFDSFPYYLSDTTKKVLISAAF  452

Query  1527  IHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPG  1703
             IHLKC NK  K A +LPTV PR+LLSGPAGSEIYQETL KALAK  GARLL+VDSL LPG
Sbjct  453   IHLKCGNKVAKFACDLPTVSPRMLLSGPAGSEIYQETLTKALAKDVGARLLIVDSLQLPG  512

Query  1704  GSA-KELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQ  1880
             GS  KE D  +E+ K ER  VF KRA QAA+   +KKP SSVEADITG S  SSHA+ KQ
Sbjct  513   GSIPKEADSSRESSKSERVSVFAKRAVQAALQ--SKKPTSSVEADITGCSTFSSHARPKQ  570

Query  1881  EASTASSKN-TFKTGDRVKYVGP-LPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIG  2051
             E STASSKN TFKTGDRVK+VG  L +  S LQ P +GP  G +GKV+LAFE N  SKIG
Sbjct  571   ETSTASSKNYTFKTGDRVKFVGASLASAISSLQPPLKGPTIGLRGKVVLAFEGNDSSKIG  630

Query  2052  VRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSP  2231
             VRFDRSIPEGNDLGG CEEDH     A+ LRLD S  +D+D+LAINELFEV   E K+ P
Sbjct  631   VRFDRSIPEGNDLGGRCEEDH-----ANSLRLDISGGEDVDRLAINELFEVALNESKNGP  685

Query  2232  LILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFG  2411
             LILFVKD+EKS+VGN +A+S+ K KLE LPE VVV+  +TQ DNRKEKSH GG LFTKFG
Sbjct  686   LILFVKDLEKSVVGNQDAYSSLKSKLESLPEKVVVVGCHTQIDNRKEKSHAGGLLFTKFG  745

Query  2412  SNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDR  2591
              N TALLDLAFPD+FGRL DRSKETPKA+KQL+RLFPNKV +Q+PQDE LL DWKQQL+R
Sbjct  746   GNHTALLDLAFPDSFGRLSDRSKETPKAMKQLSRLFPNKVTVQLPQDEALLVDWKQQLER  805

Query  2592  DIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSE  2771
             DIET+K Q+N  ++R+VL+RV L CPD+ET+C+KDQAL  +SVEK++GWALSHHFM  SE
Sbjct  806   DIETLKVQANIASVRSVLSRVGLCCPDLETVCVKDQALATDSVEKMVGWALSHHFMQCSE  865

Query  2772  SSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIG  2951
             +S K+ KL ISSES+ YGLS+LQG+QNE KS+K SLKDVVTENEFEKKLLADVIPPSDIG
Sbjct  866   ASVKDSKLLISSESVMYGLSILQGIQNENKSLKNSLKDVVTENEFEKKLLADVIPPSDIG  925

Query  2952  VTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVA  3131
             VTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVA
Sbjct  926   VTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVA  985

Query  3132  TEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEH  3311
             TEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKI+PSVVFVDEVDSMLGRRE+PGEH
Sbjct  986   TEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKISPSVVFVDEVDSMLGRRENPGEH  1045

Query  3312  EAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRE  3491
             EAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRE
Sbjct  1046  EAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRE  1105

Query  3492  KILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalai  3671
             KI+R+IL KE+LAP+VDL+A+ANMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE+ LA+
Sbjct  1106  KIVRVILAKEDLAPDVDLEAVANMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERTLAL  1165

Query  3672  SENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKK  3851
             +EN PLP L++S+DIRPL M+DFRYAHEQVCASVSSESTNM ELLQWN+LYGEGGSRKKK
Sbjct  1166  AENSPLPILYSSADIRPLKMEDFRYAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKKK  1225

Query  3852  ALSYFM  3869
             +LSYFM
Sbjct  1226  SLSYFM  1231



>gb|KHN46576.1| Spastin [Glycine soja]
Length=1245

 Score =  1498 bits (3878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 804/1236 (65%), Positives = 957/1236 (77%), Gaps = 73/1236 (6%)
 Frame = +3

Query  294   ESAEQEIRSADLDGASALKSPE---APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKA  464
             +S E E+R +DL   ++LK+ +   A +P+K   +P  GE LV P   G++A   +K K 
Sbjct  39    KSGEPELRPSDLPDTASLKAVDVCDAVLPDK---SPSEGEALVPPRCAGETA---EKSKV  92

Query  465   NGSALNRGKKRQLKSNLGTAWGKLLSQ---------------------YPQNSHVPLDQS  581
              G      KKR  KS   TAWGKLLSQ                       QN HV + + 
Sbjct  93    AGLPPRSVKKRAAKSCPKTAWGKLLSQSGNGEEVYKKVSYLRRIYIKQVMQNPHVCMTEP  152

Query  582   TFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNS  761
              FTVGQG+ C+L + DP++   LC L HI+R   +S  LLEI+G KG + VNGK Y KN+
Sbjct  153   IFTVGQGQHCNLWLKDPTIGSVLCKLSHIER-GSSSGALLEITGSKGSIHVNGKTYRKNA  211

Query  762   TVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGD  941
              + L+GGDEV+FGSS K+AYIFQ+ TN  IS A +  SVSILEA S P+ G+  EARSGD
Sbjct  212   CLILSGGDEVVFGSSAKYAYIFQQLTNSIISTADIASSVSILEAQSAPINGMQVEARSGD  271

Query  942   PSTVAVASTlaslsnlk-kellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDL-DSDM  1115
              S VA AS LASLSN   KEL LLPP+     +++Q  ++ +L    G+    D+ D++M
Sbjct  272   LSAVAEASILASLSNNICKELSLLPPAAKTGKNVQQNTDISSLHSGCGD----DITDNEM  327

Query  1116  KDVSDHNDVPLDEKSGAISPD--------SGNDNLNLENGAIDS-YDGEIGKVTGAPQEL  1268
              D +++     DE +G  S D        + N+N NL +  +D+  D ++GK+T A  EL
Sbjct  328   SDTTNN-----DEPAGDFSADKTVLGSSTTVNENPNLGSAEVDTNIDADVGKMTTATYEL  382

Query  1269  RPLIRMLAGSSTPEFDLSGNISRIID-QR--RELLKDFD-PLISMSTRRQAFKDGLQQTI  1436
             RPL+RML GS  PEFDLSG+IS+I++ QR  RELLKD D P +  ST+R AFKD LQQ I
Sbjct  383   RPLLRMLTGS-CPEFDLSGSISKILEGQRELRELLKDVDTPTVLASTKRLAFKDSLQQRI  441

Query  1437  LDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGS  1616
             L +  I+VSFE FPYYLS+ TKNVLIAST+IHLKC  F K AS+LP+V PRI+LSGPAGS
Sbjct  442   LKAEKIDVSFETFPYYLSDTTKNVLIASTFIHLKCKGFGKYASDLPSVSPRIVLSGPAGS  501

Query  1617  EIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFT-KRAAQAA  1790
             EIYQETL+KAL K+FGARLL+VDSL LPGGS +KE+D  KE+   E+  VF+ KR  Q A
Sbjct  502   EIYQETLSKALVKHFGARLLIVDSLSLPGGSPSKEVDSAKESSGAEKPSVFSRKRNFQTA  561

Query  1791  VLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKNTFKTGDRVKYVGPLPTGFSL-  1967
             +L+ +KKPASSV A+I GG  + S A +K          T + GDRVK++G  P+  S  
Sbjct  562   MLQ-HKKPASSVNAEIIGGPMLISSASSKGA--------TLRKGDRVKFIGSFPSAVSSL  612

Query  1968  -QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAAD-FL  2141
                 +RGP+YG +GKVLLAFE+NG SKIGVRFD+SIP+GNDLGGLCE+DHGFFC+A+  L
Sbjct  613   PNYISRGPSYGSRGKVLLAFEDNGSSKIGVRFDKSIPDGNDLGGLCEDDHGFFCSANHLL  672

Query  2142  RLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLP  2321
             ++D S  DDLDK+AINE+FEV S + KS  L+LF+KDI K+M+GN   +   K K E LP
Sbjct  673   QVDGSGGDDLDKVAINEIFEVASNQSKSGALVLFIKDIGKAMIGN---YEILKSKFESLP  729

Query  2322  ENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIK  2501
              NVVV+ S+TQ DN+KEK+ PG  LFTKFGSNQTALLDLAFPDNF RLHDRSKET K +K
Sbjct  730   PNVVVVGSHTQLDNQKEKAQPGSLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETSKVMK  789

Query  2502  QLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIET  2681
             QL RLFPNKV IQ+PQDE LLSDWKQQLDRDIETMK+QSN V+IR VLNR+ LDCPD+ET
Sbjct  790   QLNRLFPNKVTIQLPQDEALLSDWKQQLDRDIETMKAQSNVVSIRLVLNRIGLDCPDLET  849

Query  2682  LCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETK  2861
             LCIKD  LT ESVEKIIGWALS+HFMHSSE+S ++ KL IS+ESI+YG  +LQG+QNE K
Sbjct  850   LCIKDHTLTTESVEKIIGWALSYHFMHSSEASIRDSKLVISAESIKYGHKILQGIQNENK  909

Query  2862  SVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELF  3041
             ++KKSLKDVVTENEFEKKLL DVIPP+DIGVTFDDIGALENVK+TLKELVMLPLQRPELF
Sbjct  910   NMKKSLKDVVTENEFEKKLLTDVIPPTDIGVTFDDIGALENVKETLKELVMLPLQRPELF  969

Query  3042  CKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAV  3221
              KGQL KPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAV
Sbjct  970   GKGQLAKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAV  1029

Query  3222  FTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAA  3401
             F+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKER+LVLAA
Sbjct  1030  FSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERILVLAA  1089

Query  3402  TNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSG  3581
             TNRPFDLDEAVIRRLPRRLMVNLPDAPNR KI+R+IL KE+LAP+VD +AIANMT+GYSG
Sbjct  1090  TNRPFDLDEAVIRRLPRRLMVNLPDAPNRGKIVRVILAKEDLAPDVDFEAIANMTDGYSG  1149

Query  3582  SDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQV  3761
             SDLKNLCVTAA CPIR+ILEKEKKE++LA++EN+PLP L +S+D+RPL M+DFRYAHEQV
Sbjct  1150  SDLKNLCVTAAQCPIRQILEKEKKERSLALAENQPLPQLCSSTDVRPLKMEDFRYAHEQV  1209

Query  3762  CASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             CASVSSESTNM+ELLQWN+LYGEGGSRK ++LSYFM
Sbjct  1210  CASVSSESTNMSELLQWNDLYGEGGSRKMRSLSYFM  1245



>ref|XP_009342114.1| PREDICTED: uncharacterized protein LOC103934131 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009342141.1| PREDICTED: uncharacterized protein LOC103934149 isoform X3 [Pyrus 
x bretschneideri]
Length=1229

 Score =  1493 bits (3865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 802/1244 (64%), Positives = 959/1244 (77%), Gaps = 56/1244 (5%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTP----GAVNESGPESAEQEIRSADLDGASALKSP---E  359
             N KRSKA+++ SS ++ +    P    G + ESG +S E E+R +D     +LK+    +
Sbjct  21    NPKRSKASDA-SSANNGVRSGPPAEPLGPIKESGSQSPELELRPSDPPTTDSLKASNGSD  79

Query  360   APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKK---RQLKSNLGTAWG  530
             A   E+ P+A   GE LVSP  LG++A+         + L R KK   +  KSN   AWG
Sbjct  80    ATALERSPDAVPEGEALVSPQPLGETAVR--------AGLKRAKKLPKKTAKSNSKAAWG  131

Query  531   KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEIS  710
              L+SQ  +N H+ +  + FTVGQ R+C LC+ DPS+S +LC LKH +RE G S   LEI 
Sbjct  132   MLISQCSKNPHLFICDTVFTVGQSRECHLCIKDPSISTTLCKLKHFKRE-GLSTAELEII  190

Query  711   GKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILE  890
             G    VQVN K Y +++ V LNGGDEV+F SSG+HAYIFQ  TN++  AA   PS+SI+E
Sbjct  191   GGDSDVQVNEKTYQRDTKVILNGGDEVVFSSSGRHAYIFQPLTNDNNIAAQGIPSISIIE  250

Query  891   AHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALP  1070
               + PV G++ EARSGDPS V  AS LAS+SN+  +L LLP      ++++Q  EM +LP
Sbjct  251   TQNAPVNGMHMEARSGDPSAVDGASILASMSNVPNDLSLLPEPAKAGDELQQDAEMTSLP  310

Query  1071  VASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVT  1250
              AS   D    D  MK+ ++ ND    +K     PD+  +N NL++ A+D  + E  KV+
Sbjct  311   SASRGSDDCTPDIVMKESTNVNDQVSGDKDIVQYPDTAKENSNLDSVALD-MNIETRKVS  369

Query  1251  GAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLISMSTRRQAFKDG  1421
             GA  ELRPL+RM  GSS+ +FDL+G+IS+I+D++RE   LL + DP + +STRRQAFK+ 
Sbjct  370   GATHELRPLLRMFGGSSSTDFDLTGSISKILDEQREIGELLHNLDPPMLISTRRQAFKEK  429

Query  1422  LQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLS  1601
             LQQ IL  ++I+VSFE FPYYLSE TK VLIAST+ +LKC+KF K  S LPT  PRILLS
Sbjct  430   LQQGILSPDDIDVSFESFPYYLSETTKKVLIASTHPNLKCSKFGKYFSSLPTGSPRILLS  489

Query  1602  GPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSA---KELDPVKEAPKPERTGVFTK  1772
             GPAGSEIYQETLAKALAK+FGARLL+VDSL+LPG  A   K+ D VKE P+PER  +F K
Sbjct  490   GPAGSEIYQETLAKALAKHFGARLLIVDSLLLPGVQAPPPKDSDSVKEVPRPERVSIFAK  549

Query  1773  RAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPL  1949
             RAA AA  + +KKP SSVEA+ITGGS +SS A  KQE STASS+  TFK GD+VK+VG +
Sbjct  550   RAAHAAGFK-HKKPTSSVEAEITGGSTVSSQALPKQETSTASSRGITFKQGDKVKFVGAI  608

Query  1950  PTG-FSLQTPA--RGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGF  2120
              +G   LQ+    RGP+YG +GKV+LAFEEN  +KIGVRFD+SIP+GNDLGGLCEED GF
Sbjct  609   SSGPLQLQSCPLLRGPSYGCRGKVVLAFEENEAAKIGVRFDKSIPDGNDLGGLCEEDRGF  668

Query  2121  FCAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAF  2297
             FC+A   L LD S  DD+DKLAI EL EV S E KS PLI+F+KDIEK M GNP+A+S  
Sbjct  669   FCSASHLLPLDVSGGDDIDKLAIGELLEVASHESKSLPLIVFLKDIEKVMAGNPDAYSVL  728

Query  2298  KLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRS  2477
             K KLE LPENVVVI S+TQ D RKEK + GG                       RLHDRS
Sbjct  729   KCKLENLPENVVVIGSHTQLDTRKEKDNLGG-----------------------RLHDRS  765

Query  2478  KETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVE  2657
             KETPK +KQL+R+FPNKV IQ+PQDETLLSDWKQQL+RD+ET+K+QSN V IR+VLNRV 
Sbjct  766   KETPKTMKQLSRIFPNKVTIQLPQDETLLSDWKQQLERDVETLKAQSNIVTIRSVLNRVA  825

Query  2658  LDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVL  2837
             +DCPD+E+LCI D AL  ESVEK++GWA+SHH MH S++  K+ KL IS+ES++ GL++L
Sbjct  826   VDCPDLESLCINDLALATESVEKVVGWAISHHLMHCSDALVKDDKLVISTESLKDGLNIL  885

Query  2838  QGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVML  3017
             QGVQNE KS+KKSLKDVVT NEFEKKLL DVIPPSDIGV+FDDIGALENVKDTLKELVML
Sbjct  886   QGVQNENKSIKKSLKDVVTGNEFEKKLLVDVIPPSDIGVSFDDIGALENVKDTLKELVML  945

Query  3018  PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE  3197
             PLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE
Sbjct  946   PLQRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE  1005

Query  3198  GEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDK  3377
             GEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDK
Sbjct  1006  GEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDK  1065

Query  3378  ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIA  3557
             ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKILR+IL KE+L P+VDL+A+A
Sbjct  1066  ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAQNREKILRVILAKEDLEPDVDLEAVA  1125

Query  3558  NMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDD  3737
             N+T+GYSGSDLKNLCV AAH PIREILEKEKKE++LA++ENRP+P L+ S+DIRPL M+D
Sbjct  1126  NLTDGYSGSDLKNLCVAAAHLPIREILEKEKKERSLALAENRPVPELYCSTDIRPLKMED  1185

Query  3738  FRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             F++AHEQVCASVSSESTNM ELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1186  FKHAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKKTSLSYFM  1229



>gb|AES61807.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1243

 Score =  1491 bits (3860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/1241 (64%), Positives = 961/1241 (77%), Gaps = 37/1241 (3%)
 Frame = +3

Query  201   NGKRSKATESLSSTD-DMLGEKTPGAVNESG-PESAEQEIRSADLDGASALKSPEAPVPE  374
             N KRSK ++  SST    +  K     NESG P+  +Q    +DL   ++L   +    +
Sbjct  22    NTKRSKVSQDASSTTLPSIPVKESAKRNESGKPDDIQQ---PSDLPETASLNVLDGGNTD  78

Query  375   KLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLG--TAWGKLLSQ  545
             K    P+   PL SP   G+SA   +K K     ++ R K R +   +    AWGKL+SQ
Sbjct  79    KSHSNPIQPNPL-SPQSPGESA---EKPKVAAPVVSSRRKPRSVAKLIAKPAAWGKLISQ  134

Query  546   YPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHI-QREKGNSITLLEISGKKG  722
               QN H+ +    FTVGQGRQ +L + DP++   LC L HI Q++ G+S+ LLEI+G KG
Sbjct  135   SSQNPHLSISDPIFTVGQGRQSNLVLKDPTIGNVLCKLSHIEQQQGGSSVALLEITGGKG  194

Query  723   CVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSG  902
              VQVNGK + + + + LNGGDEVIFG+SGKHAYIFQ   + ++S A  PPSVSILEA S 
Sbjct  195   VVQVNGKTFRRTTKMILNGGDEVIFGASGKHAYIFQLLKSNNVSTAGTPPSVSILEAQSA  254

Query  903   PVKGVNFEARSGDPSTVAVASTlaslsnlkk--ellllPPSVCNDNDIKQGPEMPALPVA  1076
              + G+  EARSGDPS V  AS LASLSN++K   L+  P   C     KQ  ++ +LP  
Sbjct  255   ALNGMQVEARSGDPSAVTGASILASLSNIRKDLSLISPPAKTCK----KQSADISSLPSG  310

Query  1077  SGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDS---GNDNLNLENGAIDS-YDGEIGK  1244
              G+   +  D++MKD +++++      SG   P S    N+N +L+   +D+  D ++GK
Sbjct  311   HGD---NVPDNEMKDTTNNDESAGVFSSGKDIPSSSTTANENPSLDTMDVDANADTDVGK  367

Query  1245  VTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKDFDPLISMSTRRQAFKDGL  1424
             +  A  ELRPL+ ML GS T EFDLSG+I +I++ +REL +   P I  STRRQAF+D L
Sbjct  368   MANANYELRPLLCMLTGSGT-EFDLSGSIHKILEDQRELRELDTPTILASTRRQAFRDSL  426

Query  1425  QQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSG  1604
             +Q IL +++I+VSFE FPYYLS+ TKNVL+ASTYIHLKCN   K AS+  ++CPRILLSG
Sbjct  427   EQRILKADDIDVSFETFPYYLSDTTKNVLVASTYIHLKCNGIGKYASDFSSLCPRILLSG  486

Query  1605  PAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAA  1781
             P+GSEIYQETL+KALAK+FGARLL+VDSL LPGG+ +KE+D  KE+ KPER  V  KR+ 
Sbjct  487   PSGSEIYQETLSKALAKHFGARLLIVDSLSLPGGTPSKEVDSAKESSKPERPAVLAKRSG  546

Query  1782  QAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKNT-FKTGDRVKYVGPLP-T  1955
             QA+ L  +KKP SSV+A+I GGS +SS A  KQE STASSK T  K GDRVK+VG  P T
Sbjct  547   QASTLH-HKKPTSSVDAEIIGGSTLSSQAMLKQEVSTASSKGTALKKGDRVKFVGNFPPT  605

Query  1956  GFSLQTPA---RGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFC  2126
               SLQ  A   RGP+YG++GKV+LAFE+N  SKIGVRFD+SIP+GNDLGG  E+DHGFFC
Sbjct  606   VSSLQNYASSSRGPSYGFRGKVVLAFEDNESSKIGVRFDKSIPDGNDLGGHIEDDHGFFC  665

Query  2127  AADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLK  2306
             +A+ L+   S+  D DK+AINE+FEV S +CK+  L+LF+KDIEK+M GN +     K K
Sbjct  666   SANHLQRIESAGGDDDKVAINEIFEVASNQCKTGALVLFIKDIEKAMAGNTDVL---KSK  722

Query  2307  LEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKET  2486
              E LP+N+VVI S TQ D+RKEK+HPGG LFTKFGSNQTALLDLAFPDNF +LHD++KE+
Sbjct  723   FETLPQNIVVIGSNTQLDSRKEKTHPGGLLFTKFGSNQTALLDLAFPDNFSKLHDKTKES  782

Query  2487  PKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDC  2666
              K +KQL RLFPNKV IQ PQDE LL DWKQQLDRDIETMK+ SN V +R+VL R   DC
Sbjct  783   SKLVKQLNRLFPNKVTIQGPQDEALLPDWKQQLDRDIETMKAHSNIVLLRSVLKRTGWDC  842

Query  2667  PDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGV  2846
              D+ET+CIKDQ LT E+VEKIIGWA+S+HFM S E+ST+EGK AIS+ESI+YG  + Q +
Sbjct  843   SDLETICIKDQTLTTENVEKIIGWAVSYHFMQSHEASTEEGKPAISAESIKYGFDIFQSI  902

Query  2847  QNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQ  3026
             QNE K+VKKSLKDVVTENEFEKKLL DVIPP++IGVTF+DIGALENVKDTLKELVMLPL+
Sbjct  903   QNENKNVKKSLKDVVTENEFEKKLLGDVIPPTEIGVTFEDIGALENVKDTLKELVMLPLK  962

Query  3027  RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK  3206
             RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK
Sbjct  963   RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK  1022

Query  3207  YVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERV  3386
             YVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTK+KER+
Sbjct  1023  YVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKEKERI  1082

Query  3387  LVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMT  3566
             LVLAATNRPFDLDEAVIRRLPRRLMV+LPDAPNR KILR+IL KE+LA +VDL+AIANMT
Sbjct  1083  LVLAATNRPFDLDEAVIRRLPRRLMVDLPDAPNRGKILRVILAKEDLAADVDLEAIANMT  1142

Query  3567  EGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRY  3746
             +GYSGSDLKNLCVTAAHCPIREILEKEKK+K+LA++EN+P P L +S+DIRPL M+DFRY
Sbjct  1143  DGYSGSDLKNLCVTAAHCPIREILEKEKKDKSLALAENKPEPELCSSADIRPLKMEDFRY  1202

Query  3747  AHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             AHEQVCASVSSESTNM EL QWN+LYGEGGSRK K+LSYFM
Sbjct  1203  AHEQVCASVSSESTNMNELQQWNDLYGEGGSRKMKSLSYFM  1243



>ref|XP_010269523.1| PREDICTED: uncharacterized protein LOC104606152 isoform X2 [Nelumbo 
nucifera]
Length=1248

 Score =  1490 bits (3857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 815/1248 (65%), Positives = 959/1248 (77%), Gaps = 49/1248 (4%)
 Frame = +3

Query  201   NGKRSKATESLSSTDD---MLGEKTPGAVNESGPESAEQEIRSAD---LDGASALKSPEA  362
             NGKRSK  E+ SS +    +L  +T G+  E G ES +QE R +D    D +    S +A
Sbjct  25    NGKRSKVAEASSSINGXPCVLPVETLGSSKEPGSESHDQEGRFSDPSVCDPSKEFDSCDA  84

Query  363   PVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLS  542
              + EK  +    GE LVSP  +G  A++ D V  N + +NR +KR +KS    AWGKLLS
Sbjct  85    VMLEKPQDVNGEGETLVSPSSIGAPAMEDDNV--NNAVMNRARKRSIKSRAKVAWGKLLS  142

Query  543   QYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKG  722
             Q  QN H+ +  S FTVGQ +QC+LC+ DPSVS  LC LKH++R  G SI LLEISG KG
Sbjct  143   QCSQNPHLLMCGSPFTVGQSQQCNLCLRDPSVSTVLCKLKHLER-GGTSIVLLEISGSKG  201

Query  723   CVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSG  902
              VQVNGK + KNS+  L+GGDE++F S+G+HAYIFQ+ TN+ +++   P SVSI  + S 
Sbjct  202   VVQVNGKAFGKNSSTILSGGDELVFSSTGQHAYIFQQLTNDSLASPLFPSSVSIPGSQSV  261

Query  903   PVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGP-EMPALPVAS  1079
             PVKG++FE RS DPS VA AS LASLSNL+K+L LLPP       ++Q   E   LP   
Sbjct  262   PVKGIHFETRSRDPSAVAGASILASLSNLRKDLSLLPPPAQTGEGVRQHDLERQMLPSGC  321

Query  1080  GE---PDKHDLDSDMKDVSDHND---VPLDEK-SGAISPDSGNDN-LNLENGAIDSY-DG  1232
              +   P+        KD+S HN+   +   EK +  IS D+  +N ++L++  + ++ D 
Sbjct  322   EDGLMPNIKVTCHGRKDISKHNEEAGISSSEKDTVVISSDTATNNRMHLDSTGLGAHLDA  381

Query  1233  EIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDF-DPLISMSTR  1400
             EIG ++G   ELRPL+RMLAGSS+P+FDLSG+I + ID++RE   LLK F  P    S++
Sbjct  382   EIGAISGTNYELRPLLRMLAGSSSPDFDLSGSILKTIDEQREIKELLKGFGQPRNLPSSK  441

Query  1401  RQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTV  1580
             +QAFKDGLQQ IL SN+I+VSF++FPYYLSE TKNVLI+STYIHLKC ++ K   +L +V
Sbjct  442   KQAFKDGLQQRILSSNDIDVSFDNFPYYLSETTKNVLISSTYIHLKCKEYSKYIKDLSSV  501

Query  1581  CPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERT  1757
              PRILLSGPAGSEIYQETL KALAK+F ARLL++D + L GG S ++ + VKE+   +  
Sbjct  502   SPRILLSGPAGSEIYQETLIKALAKHFEARLLIIDVVQLLGGLSPRDSESVKESRSEKSA  561

Query  1758  GVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVK  1934
              V  +R  QA  +   KKP SSVEADI G S   S A  KQEASTASSKN  FK GDRV+
Sbjct  562   TVPKQRTTQADAIHL-KKPTSSVEADIAGTSMFCSQALPKQEASTASSKNYKFKHGDRVR  620

Query  1935  YVGPLPTGFS---LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCE  2105
             Y+G          LQT +RGP++GY GKV+LAFEENG SK+GVRFDRSI E         
Sbjct  621   YIGGGVNSSGVPPLQTSSRGPSHGYLGKVVLAFEENGSSKVGVRFDRSITE---------  671

Query  2106  EDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEA  2285
                     AD LRLD+S  D    L I ELFE+   E K+ PLILF+KDIEKS+VGN EA
Sbjct  672   --------ADLLRLDSSGDD---DLDIYELFELAYIESKNGPLILFLKDIEKSLVGNMEA  720

Query  2286  FSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRL  2465
             +   K KL  LPEN+VVI S+TQ DNRKEKSHPGG LFTKFGSNQTALLD AFPDNFGRL
Sbjct  721   YIHLKFKLHNLPENIVVIGSHTQLDNRKEKSHPGGLLFTKFGSNQTALLDFAFPDNFGRL  780

Query  2466  HDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVL  2645
             HDR+KE  K  +QL RLFPNKV IQ+PQDE LL DWKQ+LDRD+ET+K QSN +NIR++L
Sbjct  781   HDRNKEVSKTTRQLNRLFPNKVTIQLPQDEALLLDWKQRLDRDVETLKVQSNIINIRSIL  840

Query  2646  NRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYG  2825
             NR  L+CPD+ETLCIKDQA T ESVEKIIGWALS+H M+S+E+S K+ KL ISSESI YG
Sbjct  841   NRNGLECPDLETLCIKDQAFTGESVEKIIGWALSYHLMNSNEASMKDDKLVISSESITYG  900

Query  2826  LSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKE  3005
             L++L  +Q+E+KS+KKSLKDVVT+NEFEK+LLADVIP +DIGVTFDDIGALE VKDTLKE
Sbjct  901   LNILHDIQSESKSLKKSLKDVVTDNEFEKRLLADVIPXNDIGVTFDDIGALETVKDTLKE  960

Query  3006  LVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK  3185
             LVM PLQRPELFC+GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK
Sbjct  961   LVMFPLQRPELFCRGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK  1020

Query  3186  WFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLR  3365
             WFGEGEKYVKAVFTLASKI+PSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLR
Sbjct  1021  WFGEGEKYVKAVFTLASKISPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLR  1080

Query  3366  TKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDL  3545
             TKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKILR+IL KEE+APNVDL
Sbjct  1081  TKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAANREKILRVILAKEEIAPNVDL  1140

Query  3546  DAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPL  3725
             +A+ANMTEGYSGSDLKNLCVTAAHCPIREILE EKK+KALA+SENRP PALH S DIRPL
Sbjct  1141  EAVANMTEGYSGSDLKNLCVTAAHCPIREILEMEKKDKALALSENRPPPALHGSEDIRPL  1200

Query  3726  NMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             NMDDF+YAHEQVCASVSSES NM ELLQWNELYGEGGSRKK++LSYFM
Sbjct  1201  NMDDFKYAHEQVCASVSSESANMNELLQWNELYGEGGSRKKRSLSYFM  1248



>ref|XP_009342115.1| PREDICTED: uncharacterized protein LOC103934131 isoform X4 [Pyrus 
x bretschneideri]
 ref|XP_009342142.1| PREDICTED: uncharacterized protein LOC103934149 isoform X4 [Pyrus 
x bretschneideri]
Length=1214

 Score =  1485 bits (3844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 803/1245 (64%), Positives = 953/1245 (77%), Gaps = 73/1245 (6%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTP----GAVNESGPESAEQEIRSADLDGASALKSP---E  359
             N KRSKA+++ SS ++ +    P    G + ESG +S E E+R +D     +LK+    +
Sbjct  21    NPKRSKASDA-SSANNGVRSGPPAEPLGPIKESGSQSPELELRPSDPPTTDSLKASNGSD  79

Query  360   APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKK---RQLKSNLGTAWG  530
             A   E+ P+A   GE LVSP  LG++A+         + L R KK   +  KSN   AWG
Sbjct  80    ATALERSPDAVPEGEALVSPQPLGETAVR--------AGLKRAKKLPKKTAKSNSKAAWG  131

Query  531   KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEIS  710
              L+SQ                                   C+     + +G S   LEI 
Sbjct  132   MLISQ-----------------------------------CS-----KREGLSTAELEII  151

Query  711   GKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILE  890
             G    VQVN K Y +++ V LNGGDEV+F SSG+HAYIFQ  TN++  AA   PS+SI+E
Sbjct  152   GGDSDVQVNEKTYQRDTKVILNGGDEVVFSSSGRHAYIFQPLTNDNNIAAQGIPSISIIE  211

Query  891   AHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALP  1070
               + PV G++ EARSGDPS V  AS LAS+SN+  +L LLP      ++++Q  EM +LP
Sbjct  212   TQNAPVNGMHMEARSGDPSAVDGASILASMSNVPNDLSLLPEPAKAGDELQQDAEMTSLP  271

Query  1071  VASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVT  1250
              AS   D    D  MK+ ++ ND    +K     PD+  +N NL++ A+D  + E  KV+
Sbjct  272   SASRGSDDCTPDIVMKESTNVNDQVSGDKDIVQYPDTAKENSNLDSVALD-MNIETRKVS  330

Query  1251  GAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLISMSTRRQAFKDG  1421
             GA  ELRPL+RM  GSS+ +FDL+G+IS+I+D++RE   LL + DP + +STRRQAFK+ 
Sbjct  331   GATHELRPLLRMFGGSSSTDFDLTGSISKILDEQREIGELLHNLDPPMLISTRRQAFKEK  390

Query  1422  LQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLS  1601
             LQQ IL  ++I+VSFE FPYYLSE TK VLIAST+ +LKC+KF K  S LPT  PRILLS
Sbjct  391   LQQGILSPDDIDVSFESFPYYLSETTKKVLIASTHPNLKCSKFGKYFSSLPTGSPRILLS  450

Query  1602  GPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSA---KELDPVKEAPKPERTGVFTK  1772
             GPAGSEIYQETLAKALAK+FGARLL+VDSL+LPG  A   K+ D VKE P+PER  +F K
Sbjct  451   GPAGSEIYQETLAKALAKHFGARLLIVDSLLLPGVQAPPPKDSDSVKEVPRPERVSIFAK  510

Query  1773  RAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPL  1949
             RAA AA  + +KKP SSVEA+ITGGS +SS A  KQE STASS+  TFK GD+VK+VG +
Sbjct  511   RAAHAAGFK-HKKPTSSVEAEITGGSTVSSQALPKQETSTASSRGITFKQGDKVKFVGAI  569

Query  1950  PTG-FSLQTPA--RGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGF  2120
              +G   LQ+    RGP+YG +GKV+LAFEEN  +KIGVRFD+SIP+GNDLGGLCEED GF
Sbjct  570   SSGPLQLQSCPLLRGPSYGCRGKVVLAFEENEAAKIGVRFDKSIPDGNDLGGLCEEDRGF  629

Query  2121  FCAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAF  2297
             FC+A   L LD S  DD+DKLAI EL EV S E KS PLI+F+KDIEK M GNP+A+S  
Sbjct  630   FCSASHLLPLDVSGGDDIDKLAIGELLEVASHESKSLPLIVFLKDIEKVMAGNPDAYSVL  689

Query  2298  KLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFG-RLHDR  2474
             K KLE LPENVVVI S+TQ D RKEKSHPG  LFTKFG NQTALLDLAFPDN G RLHDR
Sbjct  690   KCKLENLPENVVVIGSHTQLDTRKEKSHPGSLLFTKFGFNQTALLDLAFPDNLGGRLHDR  749

Query  2475  SKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRV  2654
             SKETPK +KQL+R+FPNKV IQ+PQDETLLSDWKQQL+RD+ET+K+QSN V IR+VLNRV
Sbjct  750   SKETPKTMKQLSRIFPNKVTIQLPQDETLLSDWKQQLERDVETLKAQSNIVTIRSVLNRV  809

Query  2655  ELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSV  2834
              +DCPD+E+LCI D AL  ESVEK++GWA+SHH MH S++  K+ KL IS+ES++ GL++
Sbjct  810   AVDCPDLESLCINDLALATESVEKVVGWAISHHLMHCSDALVKDDKLVISTESLKDGLNI  869

Query  2835  LQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVM  3014
             LQGVQNE KS+KKSLKDVVT NEFEKKLL DVIPPSDIGV+FDDIGALENVKDTLKELVM
Sbjct  870   LQGVQNENKSIKKSLKDVVTGNEFEKKLLVDVIPPSDIGVSFDDIGALENVKDTLKELVM  929

Query  3015  LPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG  3194
             LPLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG
Sbjct  930   LPLQRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG  989

Query  3195  EGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKD  3374
             EGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD
Sbjct  990   EGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKD  1049

Query  3375  KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAI  3554
             KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKILR+IL KE+L P+VDL+A+
Sbjct  1050  KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAQNREKILRVILAKEDLEPDVDLEAV  1109

Query  3555  ANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMD  3734
             AN+T+GYSGSDLKNLCV AAH PIREILEKEKKE++LA++ENRP+P L+ S+DIRPL M+
Sbjct  1110  ANLTDGYSGSDLKNLCVAAAHLPIREILEKEKKERSLALAENRPVPELYCSTDIRPLKME  1169

Query  3735  DFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             DF++AHEQVCASVSSESTNM ELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1170  DFKHAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKKTSLSYFM  1214



>gb|KDO87287.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1163

 Score =  1484 bits (3843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 771/1142 (68%), Positives = 913/1142 (80%), Gaps = 22/1142 (2%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  386
             KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27    KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  387   APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGTA--WGKLLSQYPQ  554
             A +  + LVSP   G++A+D +K KA G   N R KKR  K   +G+   W +L+SQ  Q
Sbjct  84    ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQ  143

Query  555   NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQV  734
             NSH+ +  + FTVG  RQCDL + DPS+SK+LC L+ I+   G S  LLEI+G KG V+V
Sbjct  144   NSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIE-NGGPSGALLEITGGKGEVEV  202

Query  735   NGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKG  914
             NG ++PK+S V L GGDE++F  SGKH+YIFQ+ +++ ++A  + P +SILEA S P+K 
Sbjct  203   NGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKT  262

Query  915   VNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDK  1094
             ++ EARSGDPS VA AS LASLSN++K+L L+PP      D  Q  E+ +L      P+ 
Sbjct  263   MHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVD-AQNSEIASLASGCDGPED  321

Query  1095  HDLDSDMKDVSDHNDVPLDEKSG-AISP--DSGNDNLNLENGAIDS-YDGEIGKVTGAPQ  1262
                D DMKD + +ND       G  + P  D+ N+N NL++  +D+  D EIGK+ GA  
Sbjct  322   RIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATY  381

Query  1263  ELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFD-PLISMSTRRQAFKDGLQQ  1430
             ELRPL+RMLAGSS+P+FD+SG IS+I+D++RE   LLKD D P + +S RRQAFKD LQ+
Sbjct  382   ELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQE  441

Query  1431  TILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPA  1610
              IL   NIEVSFE FPYYLS+ITKNVLIASTY+HLKCN F K AS+LPT+CPRILLSGPA
Sbjct  442   GILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPA  501

Query  1611  GSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAAQAA  1790
             GSEIYQETLAKALAK+F ARLL+VDSL+LPGGS+KE D VKE+ + E+  +F KRAA   
Sbjct  502   GSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAA---  558

Query  1791  VLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSL  1967
              L  ++KP SSVEADITGG+A+ S A  K E STASSKN TFK GDRVK+VG + +G ++
Sbjct  559   -LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTV  617

Query  1968  QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRL  2147
             Q   RGP  G++G+V+L FE+N FSKIGVRFDRSIPEGN+LGG CE+DHGFFC A  LRL
Sbjct  618   QPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRL  677

Query  2148  DNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPEN  2327
             D+S  D++DKLAINELFEV   E KSSPLI+FVKDIEKS+ GN +A+ A K KLE LP N
Sbjct  678   DSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSN  737

Query  2328  VVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQL  2507
             VVVI S+TQ D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNF RLHDRSKETPKA+KQ+
Sbjct  738   VVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQI  797

Query  2508  TRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLC  2687
             +RLFPNKV IQ+PQDE LLSDWKQQL+RD+ET+K QSN ++IR+VL+R  LDC D+E+LC
Sbjct  798   SRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLC  857

Query  2688  IKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSV  2867
             IKDQ LT E VEKI+GWALSHHFMH SE+  K+ KL IS+ESI YGL++LQG+Q+E+KS+
Sbjct  858   IKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSL  917

Query  2868  KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  3047
             KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK
Sbjct  918   KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  977

Query  3048  GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFT  3227
             GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+
Sbjct  978   GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS  1037

Query  3228  LASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  3407
             LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN
Sbjct  1038  LASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  1097

Query  3408  RPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSD  3587
             RPFDLDEAV+RRLPRRLMVNLPDAPNREKI+R+IL KEELA +VDL+ IANM +GYSGSD
Sbjct  1098  RPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLEGIANMADGYSGSD  1157

Query  3588  LK  3593
             LK
Sbjct  1158  LK  1159



>ref|XP_003591552.1| Katanin p60 ATPase-containing subunit [Medicago truncatula]
 gb|AES61803.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1237

 Score =  1480 bits (3832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 799/1240 (64%), Positives = 954/1240 (77%), Gaps = 48/1240 (4%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADL-----DGASALKSPEAPVP  371
             KRSK ++++SS  +     +P  VNESG    E+E R +DL     DG +          
Sbjct  27    KRSKVSKNVSSKVN----PSP-LVNESG----ERERRPSDLSEMAVDGNN----------  67

Query  372   EKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYP  551
             +K    P   E LVSP        +  KV      L+R KKR  KSN  +AWGKL+SQ+ 
Sbjct  68    DKSSSLPNEDEALVSPPQCIGQIAEKSKVLP---PLSRSKKRCTKSNSKSAWGKLISQFS  124

Query  552   QNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQ  731
             +N H+P+    +TVGQ RQC+L + DPSVS  LC L HI+   G+S+ LLEI G  G V+
Sbjct  125   ENPHLPMCDPIYTVGQCRQCNLWLKDPSVSNVLCKLSHIEH-GGSSVALLEIIGNCGAVK  183

Query  732   VNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVK  911
             VNGK+  K S   L+GGDEV+FG SGK AYIFQ+  N +I+ A++P  V+ILEA    + 
Sbjct  184   VNGKMCGKKSRHILSGGDEVVFGVSGKQAYIFQQLNN-NITTANIPSPVTILEAQGASIT  242

Query  912   GVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPD  1091
             G   +ARSGD S+VA AS LAS S L ++L ++ PS     +++Q  ++ +LP  +G+ D
Sbjct  243   GTQLDARSGDLSSVAGASILASFSELNEDLSMISPSSNTSKNMQQKTDVSSLPAGNGD-D  301

Query  1092  KHDLDSDMKDVSDHND-VPLDEKSGAISPDSGNDNLNLENGAIDS-YDGEIGKVTGAPQE  1265
             K + D     ++D  D V   E++G  S  + N++ N+    +++  D ++GK+T A  +
Sbjct  302   KANTDMKHNIINDEPDRVFSAEETGLPSSTTVNEDPNVVAVEVNAGVDADVGKMTAASCK  361

Query  1266  LRPLIRMLAGSSTPEFDLSGNISRIIDQRREL---LKDFD-PLISMSTRRQAFKDGLQQT  1433
             LRPL+  L+GS  PEFDLSGNI++I+++R+EL   LKD D P I  S ++QA KD LQ  
Sbjct  362   LRPLLHKLSGS-CPEFDLSGNIAKILEERKELKELLKDVDTPTILTSPKQQALKDSLQMR  420

Query  1434  ILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAG  1613
             IL++ NI+VSFE FPYYLS+ TKNVLI S YIHLKCN   K  SELP++ PRILLSGPAG
Sbjct  421   ILNAENIDVSFESFPYYLSDTTKNVLITSAYIHLKCNGSGKYVSELPSLSPRILLSGPAG  480

Query  1614  SEIYQETLAKALAKYFGARLLVVDSLVLPGGSA-KELDPVKEAPKP--ERTGVFTKRAAQ  1784
             SEIYQETL+KALAK+FGA LL+VDSL  PG +  KE+D  KE P P  ERT +FTKR+  
Sbjct  481   SEIYQETLSKALAKHFGAWLLIVDSLSPPGRTPLKEVDSTKEIPIPRTERTSMFTKRSTP  540

Query  1785  AAVLRF-NKKPASSVEADITGGSAISSHAQTKQEASTASSKNT-FKTGDRVKYVGPLPTG  1958
             AA +   +KKPASSV+A I GGS  SS A  KQE STASSK + FKTGDRVKYVG  P+ 
Sbjct  541   AATIHIQHKKPASSVDAQIIGGSTSSSQAVLKQEVSTASSKGSAFKTGDRVKYVGDFPSA  600

Query  1959  FSLQT--PARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAA  2132
              S     P+RGP+YG +GKVLLAFE NG SKIGVRF++SIP+GNDLGGLCE+D GFFC+A
Sbjct  601   ASSPQVFPSRGPSYGCRGKVLLAFENNGSSKIGVRFEKSIPDGNDLGGLCEDDRGFFCSA  660

Query  2133  DFLRL-DNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKL  2309
             + L L D    DD  K+AINE+FE+ S   KS  L+L +KDIEK + GN E     K K 
Sbjct  661   NHLVLVDGCGGDDSGKVAINEIFEIASSLSKSGALVLLIKDIEKGVAGNSEVL---KSKF  717

Query  2310  EKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETP  2489
               LP+NVVVI S+   DNRKEK+ PG  LFTKFG NQTALLDLAFPDNF RLHDRSKETP
Sbjct  718   ASLPQNVVVIGSHIHPDNRKEKTQPGSLLFTKFGGNQTALLDLAFPDNFTRLHDRSKETP  777

Query  2490  KAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCP  2669
             K +KQL R FPNKV IQ+PQDE LLSDWKQ L+RD+ETMK+QSN V+IR VLN+  LDCP
Sbjct  778   KVMKQLNRFFPNKVTIQLPQDEALLSDWKQHLERDVETMKAQSNVVSIRLVLNKFGLDCP  837

Query  2670  DIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQ  2849
             ++ETL IKDQ LT E+VEKIIGWA+S+HFMHSSE+ST+E K  IS+ESI+YG ++LQG+Q
Sbjct  838   ELETLSIKDQTLTTENVEKIIGWAISYHFMHSSEASTEESKPVISAESIQYGFNILQGIQ  897

Query  2850  NETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQR  3029
             NE KSVKKSLKDVVTENEFEKKLL DVIPP+DIGV+F+DIGALENVKDTLKELVMLPLQR
Sbjct  898   NENKSVKKSLKDVVTENEFEKKLLGDVIPPTDIGVSFNDIGALENVKDTLKELVMLPLQR  957

Query  3030  PELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY  3209
             PELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY
Sbjct  958   PELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY  1017

Query  3210  VKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVL  3389
             VKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD+ERVL
Sbjct  1018  VKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDRERVL  1077

Query  3390  VLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTE  3569
             VLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKI+R+IL KEELAP+VDL+A+ANMT+
Sbjct  1078  VLAATNRPFDLDEAVIRRLPRRLMVNLPDAANREKIMRVILAKEELAPDVDLEALANMTD  1137

Query  3570  GYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYA  3749
             GYSGSDLKNLCVTAAHCPIREILEKEKKE+  A++EN+PLP L +S+DIRPL ++DF+YA
Sbjct  1138  GYSGSDLKNLCVTAAHCPIREILEKEKKERTSALAENKPLPRLCSSADIRPLKIEDFKYA  1197

Query  3750  HEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             HEQVCASVSS+STNMTELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1198  HEQVCASVSSDSTNMTELLQWNDLYGEGGSRKKTSLSYFM  1237



>ref|XP_003591556.1| Katanin p60 ATPase-containing subunit A-like protein [Medicago 
truncatula]
Length=1242

 Score =  1479 bits (3829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 795/1242 (64%), Positives = 957/1242 (77%), Gaps = 40/1242 (3%)
 Frame = +3

Query  201   NGKRSKATESLSSTD-DMLGEKTPGAVNESG-PESAEQEIRSADLDGASALKSPEAPVPE  374
             N KRSK ++  SST    +  K     NESG P+  +Q    +DL   ++L   +    +
Sbjct  22    NTKRSKVSQDASSTTLPSIPVKESAKRNESGKPDDIQQ---PSDLPETASLNVLDGGNTD  78

Query  375   KLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLG--TAWGKLLSQ  545
             K    P+   PL SP   G+SA   +K K     ++ R K R +   +    AWGKL+SQ
Sbjct  79    KSHSNPIQPNPL-SPQSPGESA---EKPKVAAPVVSSRRKPRSVAKLIAKPAAWGKLISQ  134

Query  546   YPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGC  725
               QN H+ +    FTVGQGRQ +L + DP++   LC L HI  E G+S+ LLEI+G KG 
Sbjct  135   SSQNPHLSISDPIFTVGQGRQSNLVLKDPTIGNVLCKLSHI--EGGSSVALLEITGGKGV  192

Query  726   VQVNGKIYPKNSTVPLNGGDEVIFGSSGKH--AYIFQKFTNEDISAASMPPSVSILEAHS  899
             VQVNGK + + + + LNGGDEVIFG+SGKH    IFQ   + ++S A  PPSVSILEA S
Sbjct  193   VQVNGKTFRRTTKMILNGGDEVIFGASGKHHETQIFQLLKSNNVSTAGTPPSVSILEAQS  252

Query  900   GPVKGVNFEARSGDPSTVAVASTlaslsnlkk--ellllPPSVCNDNDIKQGPEMPALPV  1073
               + G+  EARSGDPS V  AS LASLSN++K   L+  P   C     KQ  ++ +LP 
Sbjct  253   AALNGMQVEARSGDPSAVTGASILASLSNIRKDLSLISPPAKTCK----KQSADISSLPS  308

Query  1074  ASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDS---GNDNLNLENGAIDS-YDGEIG  1241
               G+   +  D++MKD +++++      SG   P S    N+N +L+   +D+  D ++G
Sbjct  309   GHGD---NVPDNEMKDTTNNDESAGVFSSGKDIPSSSTTANENPSLDTMDVDANADTDVG  365

Query  1242  KVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKDFDPLISMSTRRQAFKDG  1421
             K+  A  ELRPL+ ML GS T EFDLSG+I +I++ +REL +   P I  STRRQAF+D 
Sbjct  366   KMANANYELRPLLCMLTGSGT-EFDLSGSIHKILEDQRELRELDTPTILASTRRQAFRDS  424

Query  1422  LQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLS  1601
             L+Q IL +++I+VSFE FPYYLS+ TKNVL+ASTYIHLKCN   K AS+  ++CPRILLS
Sbjct  425   LEQRILKADDIDVSFETFPYYLSDTTKNVLVASTYIHLKCNGIGKYASDFSSLCPRILLS  484

Query  1602  GPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRA  1778
             GP+GSEIYQETL+KALAK+FGARLL+VDSL LPGG+ +KE+D  KE+ KPER  V  KR+
Sbjct  485   GPSGSEIYQETLSKALAKHFGARLLIVDSLSLPGGTPSKEVDSAKESSKPERPAVLAKRS  544

Query  1779  AQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKNT-FKTGDRVKYVGPLP-  1952
              QA+ L  +KKP SSV+A+I GGS +SS A  KQE STASSK T  K GDRVK+VG  P 
Sbjct  545   GQASTLH-HKKPTSSVDAEIIGGSTLSSQAMLKQEVSTASSKGTALKKGDRVKFVGNFPP  603

Query  1953  TGFSLQTPA---RGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFF  2123
             T  SLQ  A   RGP+YG++GKV+LAFE+N  SKIGVRFD+SIP+GNDLGG  E+DHGFF
Sbjct  604   TVSSLQNYASSSRGPSYGFRGKVVLAFEDNESSKIGVRFDKSIPDGNDLGGHIEDDHGFF  663

Query  2124  CAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKL  2303
             C+A+ L+   S+  D DK+AINE+FEV S +CK+  L+LF+KDIEK+M GN +     K 
Sbjct  664   CSANHLQRIESAGGDDDKVAINEIFEVASNQCKTGALVLFIKDIEKAMAGNTDVL---KS  720

Query  2304  KLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKE  2483
             K E LP+N+VVI S TQ D+RKEK+HPGG LFTKFGSNQTALLDLAFPDNF +LHD++KE
Sbjct  721   KFETLPQNIVVIGSNTQLDSRKEKTHPGGLLFTKFGSNQTALLDLAFPDNFSKLHDKTKE  780

Query  2484  TPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELD  2663
             + K +KQL RLFPNKV IQ PQDE LL DWKQQLDRDIETMK+ SN V +R+VL R   D
Sbjct  781   SSKLVKQLNRLFPNKVTIQGPQDEALLPDWKQQLDRDIETMKAHSNIVLLRSVLKRTGWD  840

Query  2664  CPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQG  2843
             C D+ET+CIKDQ LT E+VEKIIGWA+S+HFM S E+ST+EGK AIS+ESI+YG  + Q 
Sbjct  841   CSDLETICIKDQTLTTENVEKIIGWAVSYHFMQSHEASTEEGKPAISAESIKYGFDIFQS  900

Query  2844  VQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPL  3023
             +QNE K+VKKSLKDVVTENEFEKKLL DVIPP++IGVTF+DIGALENVKDTLKELVMLPL
Sbjct  901   IQNENKNVKKSLKDVVTENEFEKKLLGDVIPPTEIGVTFEDIGALENVKDTLKELVMLPL  960

Query  3024  QRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  3203
             +RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE
Sbjct  961   KRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  1020

Query  3204  KYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKER  3383
             KYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTK+KER
Sbjct  1021  KYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKEKER  1080

Query  3384  VLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANM  3563
             +LVLAATNRPFDLDEAVIRRLPRRLMV+LPDAPNR KILR+IL KE+LA +VDL+AIANM
Sbjct  1081  ILVLAATNRPFDLDEAVIRRLPRRLMVDLPDAPNRGKILRVILAKEDLAADVDLEAIANM  1140

Query  3564  TEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFR  3743
             T+GYSGSDLKNLCVTAAHCPIREILEKEKK+K+LA++EN+P P L +S+DIRPL M+DFR
Sbjct  1141  TDGYSGSDLKNLCVTAAHCPIREILEKEKKDKSLALAENKPEPELCSSADIRPLKMEDFR  1200

Query  3744  YAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             YAHEQVCASVSSESTNM EL QWN+LYGEGGSRK K+LSYFM
Sbjct  1201  YAHEQVCASVSSESTNMNELQQWNDLYGEGGSRKMKSLSYFM  1242



>ref|XP_008368993.1| PREDICTED: uncharacterized protein LOC103432576 isoform X2 [Malus 
domestica]
Length=1214

 Score =  1479 bits (3828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/1245 (64%), Positives = 949/1245 (76%), Gaps = 73/1245 (6%)
 Frame = +3

Query  201   NGKRSKATESLSSTDDMLGEKTP----GAVNESGPESAEQEIRSADLDGASALKSP---E  359
             N KRSKA+++ SS+++ +    P    G + ESG +S E E+R +D     +LK+    +
Sbjct  21    NPKRSKASDA-SSSNNGVRSGPPAEPLGPIKESGSQSPELELRPSDPPTTDSLKASNGSD  79

Query  360   APVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKK---RQLKSNLGTAWG  530
             A   E+ P+A   GE LVSP  LG++A+         + L R KK   +  K N  +AWG
Sbjct  80    ATALERSPDAIPEGEALVSPQPLGETAVR--------AGLKRAKKLPKKTAKLNSKSAWG  131

Query  531   KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEIS  710
              L+SQ                                   C+     + +G S   LEI 
Sbjct  132   MLISQ-----------------------------------CS-----KREGLSTAELEII  151

Query  711   GKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILE  890
             G  G VQVN K Y K++ V LNGGDEV+F SSG+HAYIFQ+ TN++  AA   PS+SI+E
Sbjct  152   GGNGDVQVNEKTYQKDTKVILNGGDEVVFSSSGRHAYIFQQLTNDNNIAAQGIPSISIIE  211

Query  891   AHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALP  1070
               + PV G++ EARSGDPS V  AS LAS+SN+  +L LLP      ++++Q  EM +LP
Sbjct  212   TRNAPVNGMHMEARSGDPSAVDGASILASMSNVPNDLSLLPEPAKAGDELQQDAEMTSLP  271

Query  1071  VASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVT  1250
              A    D H LD  MK+ ++ ND    +K     PD   +N NL++ A+D  D E  KV+
Sbjct  272   SACRGSDDHTLDIVMKESTNINDQVSGDKDIVQYPDIAKENPNLDSVALD-MDTETRKVS  330

Query  1251  GAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLISMSTRRQAFKDG  1421
             GA  +LRPL+RM  GSS+  FDL+G+IS++ D++RE   LL + DP + +STRRQAFK+ 
Sbjct  331   GATHQLRPLLRMFGGSSSTNFDLTGSISKMFDEQREIRELLHNLDPPMLISTRRQAFKEK  390

Query  1422  LQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLS  1601
             LQQ IL  ++I+VSFE FPYYLSE TK VLIAST+ +LKC+KF K  S LPT  PRILLS
Sbjct  391   LQQGILSPDDIDVSFESFPYYLSETTKKVLIASTHPNLKCSKFGKYFSSLPTGSPRILLS  450

Query  1602  GPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSA---KELDPVKEAPKPERTGVFTK  1772
             GPAGSEIYQETLAKAL K+FGARLL+VDSL+LPG  A   K+ D VKE P+PER  +F K
Sbjct  451   GPAGSEIYQETLAKALTKHFGARLLIVDSLLLPGVQAPPPKDSDSVKEVPRPERVSIFAK  510

Query  1773  RAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPL  1949
             RAA AA  + +KKP SSVEA+ITGGS +SS A  KQE STASS+  TFK GD+VK+VG +
Sbjct  511   RAAHAAGFK-HKKPTSSVEAEITGGSTVSSQALPKQETSTASSRGITFKQGDKVKFVGAI  569

Query  1950  PTG-FSLQTPA--RGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGF  2120
              +G   LQ+    RGP+YG +GKV+LAFEEN  +KIGVRFD+SIP+GNDLGGLCEEDHGF
Sbjct  570   SSGPLQLQSCPLLRGPSYGCRGKVVLAFEENEAAKIGVRFDKSIPDGNDLGGLCEEDHGF  629

Query  2121  FCAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAF  2297
             FC+A   L LD S  DD+DKLAI EL EV S E KS PLI+F+KDIEK M GNP+A+S  
Sbjct  630   FCSASHLLPLDVSGGDDIDKLAIGELLEVASHESKSLPLIVFLKDIEKVMAGNPDAYSVL  689

Query  2298  KLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFG-RLHDR  2474
             K KLE LPENVVVI S+TQ D RKEKSHPG  LFTKFG NQTALLDLAFPDN G RLHDR
Sbjct  690   KSKLENLPENVVVIGSHTQLDTRKEKSHPGSLLFTKFGFNQTALLDLAFPDNLGGRLHDR  749

Query  2475  SKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRV  2654
             SKETPK +KQL+R+FPNKV IQ+PQDE LLSDWKQQL+RD ET+K+QSN V IR+V NRV
Sbjct  750   SKETPKTMKQLSRIFPNKVTIQLPQDEALLSDWKQQLERDGETLKAQSNIVTIRSVFNRV  809

Query  2655  ELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSV  2834
              +DCPD+E+LCI D ALT ESVEK+ GWA+SHH MH S++  K+ KL IS+ES++ GL++
Sbjct  810   AVDCPDLESLCINDLALTTESVEKVAGWAISHHLMHCSDALVKDDKLVISTESLKDGLNI  869

Query  2835  LQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVM  3014
             L G+QNE KS+KKSLKDVVT NEFEKKLL DVIPPSDIGV+FDDIGALENVKDTLKELVM
Sbjct  870   LHGIQNENKSMKKSLKDVVTGNEFEKKLLVDVIPPSDIGVSFDDIGALENVKDTLKELVM  929

Query  3015  LPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG  3194
             LPLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG
Sbjct  930   LPLQRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG  989

Query  3195  EGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKD  3374
             EGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD
Sbjct  990   EGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKD  1049

Query  3375  KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAI  3554
             KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKILR+IL KE+L  +VDL+A+
Sbjct  1050  KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAQNREKILRVILAKEDLEADVDLEAV  1109

Query  3555  ANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMD  3734
             AN+T+GYSGSDLKNLCV AAH PIREILEKEKKE++LA++ENRP+P L+ S+DIRPL M+
Sbjct  1110  ANLTDGYSGSDLKNLCVAAAHLPIREILEKEKKERSLALAENRPVPELYCSTDIRPLKME  1169

Query  3735  DFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             DF++AHEQVCASVSSESTNM ELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1170  DFKHAHEQVCASVSSESTNMNELLQWNDLYGEGGSRKKTSLSYFM  1214



>ref|XP_008805743.1| PREDICTED: uncharacterized protein LOC103718614 isoform X1 [Phoenix 
dactylifera]
Length=1253

 Score =  1476 bits (3820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 773/1148 (67%), Positives = 918/1148 (80%), Gaps = 24/1148 (2%)
 Frame = +3

Query  474   ALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  653
             AL   KKR  K     AW KLLSQ  QN H+ +    FTVGQ   C+L + DPS+S++LC
Sbjct  114   ALELPKKRVKKVQPKAAWAKLLSQCSQNPHLVICGYQFTVGQSPACNLTLKDPSISRTLC  173

Query  654   NLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQK  833
              LK+++RE G    LLEI GKKG VQVNGKI  KNS   L GGDEV+F SSGKHAYIFQ 
Sbjct  174   KLKYLERE-GPPGALLEIVGKKGIVQVNGKIMEKNSPTVLMGGDEVVFSSSGKHAYIFQP  232

Query  834   FTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllP  1013
               N+ ++  +   ++ ILEA + P+KG+ FE RSGDPS VA AS LASLSN KK+L   P
Sbjct  233   LANDKLTTPASSSALGILEAQAVPIKGIQFETRSGDPSAVAGASILASLSNHKKDL---P  289

Query  1014  PSVCNDNDIKQGPEMPALPVASG--EPDKHDLDSDM---KDVSDHN---DVPLDEKSGAI  1169
             PS     +  QG E PA+P A    E    DL+ +    K  ++HN   +VP  +K+  I
Sbjct  290   PSASTGENAHQGVERPAVPSACDVTEGCNSDLEKNCDARKGNTEHNGSTEVPSGDKAAVI  349

Query  1170  SPDSGNDNLNLENGAIDS---YDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRI  1340
                    N + ++  I S    D +IGK++G   E+RP ++M+AGSST E DL+G + ++
Sbjct  350   LSTDLGANESTQHDTIGSDAQLDADIGKISGTNYEIRPFLKMIAGSSTAELDLTGKVFKV  409

Query  1341  IDQRRELLKDFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIA  1517
              + +RELL+D D P    +TR QAFKDGL+Q I+++++I+VSFE FPYYLSE TKNVL++
Sbjct  410   FEAQRELLRDLDTPAALPTTRCQAFKDGLKQGIINASDIQVSFESFPYYLSENTKNVLLS  469

Query  1518  STYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVL  1697
               YIHL+C  F+K A+++ +V  RILL+GP GSEIYQETL KALAK+FGA LL++DSL+L
Sbjct  470   CGYIHLECKDFIKYATDISSVNQRILLTGPTGSEIYQETLVKALAKHFGASLLIIDSLLL  529

Query  1698  PGGSA-KELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQT  1874
             PGGS+ K+ + +KE  + E+    +KRAA   VL   +KP SSVEADI G S +SSH+  
Sbjct  530   PGGSSSKDSESLKEGGRIEKASFLSKRAA---VLDL-RKPTSSVEADILGTSMLSSHSLP  585

Query  1875  KQEASTASSKN-TFKTGDRVKYVGPLPTG-FSLQTPARGPAYGYKGKVLLAFEENGFSKI  2048
             KQEASTASSKN TFK GDRVK+VGP+P+  F LQ P RGP  GY+GKV+LAFEENG SK+
Sbjct  586   KQEASTASSKNYTFKEGDRVKFVGPVPSSSFPLQAPQRGPNIGYRGKVVLAFEENGASKV  645

Query  2049  GVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSS  2228
             GVRFD+ IP+GNDLGGLCEEDHGFFC AD LR D+S  +D ++LAINEL EVVS+E K+ 
Sbjct  646   GVRFDKQIPDGNDLGGLCEEDHGFFCTADLLRPDSSGGEDNERLAINELLEVVSEESKNG  705

Query  2229  PLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKF  2408
             PLI+ +KDIEKSM G  + +   + KL+ +P  V++I S+TQ DNRKEKSHPGG LFTKF
Sbjct  706   PLIILIKDIEKSMAGGTDTYLTLRSKLDLIPAGVLIIGSHTQMDNRKEKSHPGGLLFTKF  765

Query  2409  GSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLD  2588
             GSNQTALLD AFPDNFGRLH+RSKE PK +KQLTRLFPNKV IQ+PQDE  L DWKQQLD
Sbjct  766   GSNQTALLDFAFPDNFGRLHERSKEIPKTMKQLTRLFPNKVSIQLPQDEAQLLDWKQQLD  825

Query  2589  RDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSS  2768
             RDIET+K++SN ++IR+ LNR  LDC D+ET+ IKDQ LTNE+V+KI+G+ALSHH  ++ 
Sbjct  826   RDIETLKAKSNILSIRSFLNRSGLDCHDVETISIKDQTLTNENVDKIVGFALSHHLKNNK  885

Query  2769  -ESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSD  2945
              E+S K+ KL +SS+SI++GLS+LQ +QN+TKS KKSLKDVVTENEFEK+LLADVIPP+D
Sbjct  886   IEASAKDAKLVLSSDSIKHGLSMLQSIQNDTKSAKKSLKDVVTENEFEKRLLADVIPPND  945

Query  2946  IGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKA  3125
             IGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKA
Sbjct  946   IGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKA  1005

Query  3126  VATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPG  3305
             VATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PG
Sbjct  1006  VATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPG  1065

Query  3306  EHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPN  3485
             EHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA N
Sbjct  1066  EHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDASN  1125

Query  3486  REKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekal  3665
             R KILR+IL KEELAP++DL+ +ANMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE+ L
Sbjct  1126  RVKILRVILAKEELAPDIDLEVVANMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERIL  1185

Query  3666  aiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRK  3845
             A++E RPLPALH S DIR L+MDD +YAHEQVCASVSSESTNM+ELLQWNELYGEGGSRK
Sbjct  1186  ALAEGRPLPALHGSDDIRRLSMDDLKYAHEQVCASVSSESTNMSELLQWNELYGEGGSRK  1245

Query  3846  KKALSYFM  3869
             KKALSYFM
Sbjct  1246  KKALSYFM  1253



>ref|XP_006575113.1| PREDICTED: uncharacterized protein LOC100800938 isoform X2 [Glycine 
max]
Length=1104

 Score =  1472 bits (3811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 768/1126 (68%), Positives = 908/1126 (81%), Gaps = 43/1126 (4%)
 Frame = +3

Query  552   QNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQ  731
             QN HV + +  FTVGQG+ C+L + DP++   LC L HI+R   +S  LLEI+G KG + 
Sbjct  2     QNPHVCMTEPIFTVGQGQHCNLWLKDPTIGSVLCKLSHIER-GSSSGALLEITGSKGSIH  60

Query  732   VNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVK  911
             VNGK Y KN+ + L+GGDEV+FGSS K+AYIFQ+ TN  IS A +  SVSILEA S P+ 
Sbjct  61    VNGKTYRKNACLILSGGDEVVFGSSAKYAYIFQQLTNSIISTADIASSVSILEAQSAPIN  120

Query  912   GVNFEARSGDPSTVAVASTlaslsnlk-kellllPPSVCNDNDIKQGPEMPALPVASGEP  1088
             G+  EARSGD S VA AS LASLSN   KEL LLPP+     +++Q  ++ +L    G+ 
Sbjct  121   GMQVEARSGDLSAVAEASILASLSNNICKELSLLPPAAKTGKNVQQNTDISSLHSGCGD-  179

Query  1089  DKHDL-DSDMKDVSDHNDVPLDEKSGAISPD--------SGNDNLNLENGAIDS-YDGEI  1238
                D+ D++M D +++     DE +G  S D        + N+N NL +  +D+  D ++
Sbjct  180   ---DITDNEMSDTTNN-----DEPAGDFSADKTVLGSSTTVNENPNLGSAEVDTNIDADV  231

Query  1239  GKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIID-QR--RELLKDFD-PLISMSTRRQ  1406
             GK+T A  ELRPL+RML GS  PEFDLSG+IS+I++ QR  RELLKD D P +  ST+R 
Sbjct  232   GKMTTATYELRPLLRMLTGS-CPEFDLSGSISKILEGQRELRELLKDVDTPTVLASTKRL  290

Query  1407  AFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCP  1586
             AFKD LQQ IL +  I+VSFE FPYYLS+ TKNVLIAST+IHLKC  F K AS+LP+V P
Sbjct  291   AFKDSLQQRILKAEKIDVSFETFPYYLSDTTKNVLIASTFIHLKCKGFGKYASDLPSVSP  350

Query  1587  RILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGV  1763
             RI+LSGPAGSEIYQETL+KAL K+FGARLL+VDSL LPGGS +KE+D  KE+   E+  V
Sbjct  351   RIVLSGPAGSEIYQETLSKALVKHFGARLLIVDSLSLPGGSPSKEVDSAKESSGAEKPSV  410

Query  1764  FT-KRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKNTFKTGDRVKYV  1940
             F+ KR  Q A+L+ +KKPASSV A+I GG  + S A +K          T + GDRVK++
Sbjct  411   FSRKRNFQTAMLQ-HKKPASSVNAEIIGGPMLISSASSKGA--------TLRKGDRVKFI  461

Query  1941  GPLPTGFSL--QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDH  2114
             G  P+  S      +RGP+YG +GKVLLAFE+NG SKIGVRFD+SIP+GNDLGGLCE+DH
Sbjct  462   GSFPSAVSSLPNYISRGPSYGSRGKVLLAFEDNGSSKIGVRFDKSIPDGNDLGGLCEDDH  521

Query  2115  GFFCAAD-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFS  2291
             GFFC+A+  L++D S  DDLDK+AINE+FEV S + KS  L+LF+KDI K+M+GN   + 
Sbjct  522   GFFCSANHLLQVDGSGGDDLDKVAINEIFEVASNQSKSGALVLFIKDIGKAMIGN---YE  578

Query  2292  AFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHD  2471
               K K E LP NVVV+ S+TQ DN+KEK+ PG  LFTKFGSNQTALLDLAFPDNF RLHD
Sbjct  579   ILKSKFESLPPNVVVVGSHTQLDNQKEKAQPGSLLFTKFGSNQTALLDLAFPDNFSRLHD  638

Query  2472  RSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNR  2651
             RSKET K +KQL RLFPNKV IQ+PQDE LLSDWKQQLDRDIETMK+QSN V+IR VLNR
Sbjct  639   RSKETSKVMKQLNRLFPNKVTIQLPQDEALLSDWKQQLDRDIETMKAQSNVVSIRLVLNR  698

Query  2652  VELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLS  2831
             + LDCPD+ETLCIKD  LT ESVEKIIGWALS+HFMHSSE+S ++ KL IS+ESI+YG  
Sbjct  699   IGLDCPDLETLCIKDHTLTTESVEKIIGWALSYHFMHSSEASIRDSKLVISAESIKYGHK  758

Query  2832  VLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELV  3011
             +LQG+QNE K++KKSLKDVVTENEFEKKLL DVIPP+DIGVTFDDIGALENVK+TLKELV
Sbjct  759   ILQGIQNENKNMKKSLKDVVTENEFEKKLLTDVIPPTDIGVTFDDIGALENVKETLKELV  818

Query  3012  MLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWF  3191
             MLPLQRPELF KGQL KPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWF
Sbjct  819   MLPLQRPELFGKGQLAKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWF  878

Query  3192  GEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTK  3371
             GEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTK
Sbjct  879   GEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTK  938

Query  3372  DKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDA  3551
             DKER+LVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR KI+R+IL KE+LAP+VD +A
Sbjct  939   DKERILVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRGKIVRVILAKEDLAPDVDFEA  998

Query  3552  IANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNM  3731
             IANMT+GYSGSDLKNLCVTAA CPIR+ILEKEKKE++LA++EN+PLP L +S+D+RPL M
Sbjct  999   IANMTDGYSGSDLKNLCVTAAQCPIRQILEKEKKERSLALAENQPLPQLCSSTDVRPLKM  1058

Query  3732  DDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             +DFRYAHEQVCASVSSESTNM+ELLQWN+LYGEGGSRK ++LSYFM
Sbjct  1059  EDFRYAHEQVCASVSSESTNMSELLQWNDLYGEGGSRKMRSLSYFM  1104



>gb|KEH43221.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1194

 Score =  1469 bits (3802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 778/1236 (63%), Positives = 930/1236 (75%), Gaps = 76/1236 (6%)
 Frame = +3

Query  201   NGKRSKATESLSSTD-DMLGEKTPGAVNESG-PESAEQEIRSADLDGASALKSPEAPVPE  374
             N KRSK ++  SST    +  K     NESG P+  +Q    +DL   ++L   +    +
Sbjct  22    NTKRSKVSQDASSTTLPSIPVKESAKRNESGKPDDIQQ---PSDLPETASLNVLDGGNTD  78

Query  375   KLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLKSNLG--TAWGKLLSQ  545
             K    P+   PL SP   G+SA   +K K     ++ R K R +   +    AWGKL+SQ
Sbjct  79    KSHSNPIQPNPL-SPQSPGESA---EKPKVAAPVVSSRRKPRSVAKLIAKPAAWGKLISQ  134

Query  546   YPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHI-QREKGNSITLLEISGKKG  722
               QN H+ +    FTVGQGRQ +L + DP++   LC L HI Q++ G+S+ LLEI+G KG
Sbjct  135   SSQNPHLSISDPIFTVGQGRQSNLVLKDPTIGNVLCKLSHIEQQQGGSSVALLEITGGKG  194

Query  723   CVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSG  902
              VQVNGK + + + + LNGGDEVIFG+SGKHAYIFQ   + ++S A  PPSVSILEA S 
Sbjct  195   VVQVNGKTFRRTTKMILNGGDEVIFGASGKHAYIFQLLKSNNVSTAGTPPSVSILEAQSA  254

Query  903   PVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASG  1082
              + G+  EARSGDPS V                                           
Sbjct  255   ALNGMQVEARSGDPSAVT------------------------------------------  272

Query  1083  EPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDS-YDGEIGKVTGAP  1259
               D  + D      S   D+P        S  + N+N +L+   +D+  D ++GK+  A 
Sbjct  273   --DTTNNDESAGVFSSGKDIP-------SSSTTANENPSLDTMDVDANADTDVGKMANAN  323

Query  1260  QELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKDFDPLISMSTRRQAFKDGLQQTIL  1439
              ELRPL+ ML GS T EFDLSG+I +I++ +REL +   P I  STRRQAF+D L+Q IL
Sbjct  324   YELRPLLCMLTGSGT-EFDLSGSIHKILEDQRELRELDTPTILASTRRQAFRDSLEQRIL  382

Query  1440  DSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSE  1619
              +++I+VSFE FPYYLS+ TKNVL+ASTYIHLKCN   K AS+  ++CPRILLSGP+GSE
Sbjct  383   KADDIDVSFETFPYYLSDTTKNVLVASTYIHLKCNGIGKYASDFSSLCPRILLSGPSGSE  442

Query  1620  IYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVL  1796
             IYQETL+KALAK+FGARLL+VDSL LPGG+ +KE+D  KE+ KPER  V  KR+ QA+ L
Sbjct  443   IYQETLSKALAKHFGARLLIVDSLSLPGGTPSKEVDSAKESSKPERPAVLAKRSGQASTL  502

Query  1797  RFNKKPASSVEADITGGSAISSHAQTKQEASTASSKNT-FKTGDRVKYVGPLP-TGFSLQ  1970
               +KKP SSV+A+I GGS +SS A  KQE STASSK T  K GDRVK+VG  P T  SLQ
Sbjct  503   H-HKKPTSSVDAEIIGGSTLSSQAMLKQEVSTASSKGTALKKGDRVKFVGNFPPTVSSLQ  561

Query  1971  TPA---RGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFL  2141
               A   RGP+YG++GKV+LAFE+N  SKIGVRFD+SIP+GNDLGG  E+DHGFFC+A+ L
Sbjct  562   NYASSSRGPSYGFRGKVVLAFEDNESSKIGVRFDKSIPDGNDLGGHIEDDHGFFCSANHL  621

Query  2142  RLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLP  2321
             +   S+  D DK+AINE+FEV S +CK+  L+LF+KDIEK+M GN +     K K E LP
Sbjct  622   QRIESAGGDDDKVAINEIFEVASNQCKTGALVLFIKDIEKAMAGNTDVL---KSKFETLP  678

Query  2322  ENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIK  2501
             +N+VVI S TQ D+RKEK+HPGG LFTKFGSNQTALLDLAFPDNF +LHD++KE+ K +K
Sbjct  679   QNIVVIGSNTQLDSRKEKTHPGGLLFTKFGSNQTALLDLAFPDNFSKLHDKTKESSKLVK  738

Query  2502  QLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIET  2681
             QL RLFPNKV IQ PQDE LL DWKQQLDRDIETMK+ SN V +R+VL R   DC D+ET
Sbjct  739   QLNRLFPNKVTIQGPQDEALLPDWKQQLDRDIETMKAHSNIVLLRSVLKRTGWDCSDLET  798

Query  2682  LCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETK  2861
             +CIKDQ LT E+VEKIIGWA+S+HFM S E+ST+EGK AIS+ESI+YG  + Q +QNE K
Sbjct  799   ICIKDQTLTTENVEKIIGWAVSYHFMQSHEASTEEGKPAISAESIKYGFDIFQSIQNENK  858

Query  2862  SVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELF  3041
             +VKKSLKDVVTENEFEKKLL DVIPP++IGVTF+DIGALENVKDTLKELVMLPL+RPELF
Sbjct  859   NVKKSLKDVVTENEFEKKLLGDVIPPTEIGVTFEDIGALENVKDTLKELVMLPLKRPELF  918

Query  3042  CKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAV  3221
             CKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAV
Sbjct  919   CKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAV  978

Query  3222  FTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAA  3401
             F+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTK+KER+LVLAA
Sbjct  979   FSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKEKERILVLAA  1038

Query  3402  TNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSG  3581
             TNRPFDLDEAVIRRLPRRLMV+LPDAPNR KILR+IL KE+LA +VDL+AIANMT+GYSG
Sbjct  1039  TNRPFDLDEAVIRRLPRRLMVDLPDAPNRGKILRVILAKEDLAADVDLEAIANMTDGYSG  1098

Query  3582  SDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQV  3761
             SDLKNLCVTAAHCPIREILEKEKK+K+LA++EN+P P L +S+DIRPL M+DFRYAHEQV
Sbjct  1099  SDLKNLCVTAAHCPIREILEKEKKDKSLALAENKPEPELCSSADIRPLKMEDFRYAHEQV  1158

Query  3762  CASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             CASVSSESTNM EL QWN+LYGEGGSRK K+LSYFM
Sbjct  1159  CASVSSESTNMNELQQWNDLYGEGGSRKMKSLSYFM  1194



>ref|XP_010931645.1| PREDICTED: uncharacterized protein LOC105052512 [Elaeis guineensis]
Length=1249

 Score =  1465 bits (3793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 765/1143 (67%), Positives = 915/1143 (80%), Gaps = 23/1143 (2%)
 Frame = +3

Query  489   KKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHI  668
             KKR LK     AW KLLSQ  QN H+ +  S FTVGQG  C+L + D SVS++LC LK++
Sbjct  114   KKRVLKVQ-PKAWAKLLSQCSQNPHLVICGSQFTVGQGPSCNLSLKDLSVSRNLCKLKYL  172

Query  669   QREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNED  848
             +  +G    LLEI G+KG VQVNGKI  +NS + L GGDEVIFGSS +HAYIFQ   N+ 
Sbjct  173   EC-RGAPGALLEIVGRKGIVQVNGKIIEQNSQIILMGGDEVIFGSSRRHAYIFQPLANDK  231

Query  849   ISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCN  1028
             ++  +   +  IL+A   P+KG+ FE+RSGDPS VA AS LASLSN KK+  +LPP+   
Sbjct  232   LTTPASCSAPGILDAQDVPIKGIQFESRSGDPSAVAGASILASLSNHKKDPSVLPPASSG  291

Query  1029  DNDIKQGPEMPALPVAS--GEPDKHDLDSD---MKDVSDHN---DVPL-DEKSGAISPDS  1181
             DN   QG E PALP A    E    DLD +    K  + HN   +VP  DE +  ++ + 
Sbjct  292   DN-AHQGVEKPALPSACDVSEVCNSDLDKNCDATKGNTVHNGSTEVPSGDEDAVVLATNL  350

Query  1182  GNDNLNLEN--GAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR  1355
             G +     +  G+    D +IGK++GA  E+RPL++M+AGSST E DL+G+I ++   +R
Sbjct  351   GVNGATQHDTIGSDAQLDADIGKISGANYEIRPLLKMIAGSSTAELDLTGSIFKVFGDQR  410

Query  1356  ELLKDFDPLISM-STRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIH  1532
             ELL+D     S+ +TR QAFKDGL+Q I+D+++I+VSFE FPYYLSE TKNVL++  YIH
Sbjct  411   ELLRDLGTPASLPTTRCQAFKDGLKQGIVDASDIQVSFESFPYYLSENTKNVLLSCAYIH  470

Query  1533  LKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSA  1712
             L+C +F+K A+E+ +V PRILL+GP GSEIYQETL KALA++FGARLL++DSL LPGGS+
Sbjct  471   LECKEFIKYATEISSVNPRILLTGPTGSEIYQETLVKALARHFGARLLIIDSLQLPGGSS  530

Query  1713  -KELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEAS  1889
              K+ + +KE  + E+   F+KR A   VL   ++P SSVEA+I G S ++SH+  KQEAS
Sbjct  531   SKDSESLKEGGRVEKASFFSKRGA---VLDL-RRPTSSVEAEIMGTSMLNSHSLPKQEAS  586

Query  1890  TASSKN-TFKTGDRVKYVGP-LPTGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFD  2063
             TASSK  TFK GDRV+Y+G    +GF L  P  GP YGY+GKV+LAFEENG SKIGVRFD
Sbjct  587   TASSKKYTFKEGDRVRYIGSGTSSGFPLPAPQIGPNYGYRGKVVLAFEENGASKIGVRFD  646

Query  2064  RSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILF  2243
             + IPEGNDLGGLCEEDHGFFC AD LR D S  +D+++L INEL EVVS+E K+ PLI+ 
Sbjct  647   KQIPEGNDLGGLCEEDHGFFCTADLLRPDFSGGEDIERLGINELLEVVSEESKNGPLIIL  706

Query  2244  VKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQT  2423
             +KDIEKSM G  E +   K KLE +P  V+++ S+TQ DNRKEKSHPGG LFTKFGSNQT
Sbjct  707   IKDIEKSMAGGTETYLTLKSKLEFMPAGVLIMGSHTQIDNRKEKSHPGGLLFTKFGSNQT  766

Query  2424  ALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIET  2603
             ALLD AFPDNFGRLH+RSKE PK +KQLTRLFPNKV IQ+PQDE  L DWKQQL+RD+E 
Sbjct  767   ALLDFAFPDNFGRLHERSKEIPKTMKQLTRLFPNKVSIQLPQDEAQLLDWKQQLERDVEI  826

Query  2604  MKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSS-ESST  2780
             +K++SN ++IR+ LNR  LDC D+E + IKDQ LTNE+V+KI+G+ALSHH  ++  E+S 
Sbjct  827   LKAKSNILSIRSFLNRNGLDCNDLEMISIKDQTLTNENVDKIVGFALSHHLKNNKIEASA  886

Query  2781  KEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTF  2960
             K+ K  IS++SI++GL +LQ +Q++TKS KKSLKDVVTENEFEK+LLADVIPP DIGVTF
Sbjct  887   KDSKFVISNDSIKHGLCMLQSIQSDTKSTKKSLKDVVTENEFEKRLLADVIPPDDIGVTF  946

Query  2961  DDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEA  3140
             DDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEA
Sbjct  947   DDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEA  1006

Query  3141  GANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAM  3320
             GANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAM
Sbjct  1007  GANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAM  1066

Query  3321  RKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKIL  3500
             RKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLD+AVIRR PRRLMVNLPDA NREKIL
Sbjct  1067  RKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDDAVIRRFPRRLMVNLPDASNREKIL  1126

Query  3501  RIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSEN  3680
             R+IL KEELAP+VDL+A+ANMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE++LA++E 
Sbjct  1127  RVILAKEELAPDVDLEALANMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERSLALAEG  1186

Query  3681  RPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALS  3860
             RPLPAL  S DIRPL+M+D +YAHEQVCASVSSESTNM+ELLQWNELYGEGGSRKKKALS
Sbjct  1187  RPLPALRGSDDIRPLSMEDLKYAHEQVCASVSSESTNMSELLQWNELYGEGGSRKKKALS  1246

Query  3861  YFM  3869
             YFM
Sbjct  1247  YFM  1249



>ref|XP_006575114.1| PREDICTED: uncharacterized protein LOC100800938 isoform X3 [Glycine 
max]
Length=1097

 Score =  1465 bits (3793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 764/1120 (68%), Positives = 904/1120 (81%), Gaps = 43/1120 (4%)
 Frame = +3

Query  570   LDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIY  749
             + +  FTVGQG+ C+L + DP++   LC L HI+R   +S  LLEI+G KG + VNGK Y
Sbjct  1     MTEPIFTVGQGQHCNLWLKDPTIGSVLCKLSHIER-GSSSGALLEITGSKGSIHVNGKTY  59

Query  750   PKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEA  929
              KN+ + L+GGDEV+FGSS K+AYIFQ+ TN  IS A +  SVSILEA S P+ G+  EA
Sbjct  60    RKNACLILSGGDEVVFGSSAKYAYIFQQLTNSIISTADIASSVSILEAQSAPINGMQVEA  119

Query  930   RSGDPSTVAVASTlaslsnlk-kellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDL-  1103
             RSGD S VA AS LASLSN   KEL LLPP+     +++Q  ++ +L    G+    D+ 
Sbjct  120   RSGDLSAVAEASILASLSNNICKELSLLPPAAKTGKNVQQNTDISSLHSGCGD----DIT  175

Query  1104  DSDMKDVSDHNDVPLDEKSGAISPD--------SGNDNLNLENGAIDS-YDGEIGKVTGA  1256
             D++M D +++     DE +G  S D        + N+N NL +  +D+  D ++GK+T A
Sbjct  176   DNEMSDTTNN-----DEPAGDFSADKTVLGSSTTVNENPNLGSAEVDTNIDADVGKMTTA  230

Query  1257  PQELRPLIRMLAGSSTPEFDLSGNISRIID-QR--RELLKDFD-PLISMSTRRQAFKDGL  1424
               ELRPL+RML GS  PEFDLSG+IS+I++ QR  RELLKD D P +  ST+R AFKD L
Sbjct  231   TYELRPLLRMLTGS-CPEFDLSGSISKILEGQRELRELLKDVDTPTVLASTKRLAFKDSL  289

Query  1425  QQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSG  1604
             QQ IL +  I+VSFE FPYYLS+ TKNVLIAST+IHLKC  F K AS+LP+V PRI+LSG
Sbjct  290   QQRILKAEKIDVSFETFPYYLSDTTKNVLIASTFIHLKCKGFGKYASDLPSVSPRIVLSG  349

Query  1605  PAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFT-KRA  1778
             PAGSEIYQETL+KAL K+FGARLL+VDSL LPGGS +KE+D  KE+   E+  VF+ KR 
Sbjct  350   PAGSEIYQETLSKALVKHFGARLLIVDSLSLPGGSPSKEVDSAKESSGAEKPSVFSRKRN  409

Query  1779  AQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKNTFKTGDRVKYVGPLPTG  1958
              Q A+L+ +KKPASSV A+I GG  + S A +K          T + GDRVK++G  P+ 
Sbjct  410   FQTAMLQ-HKKPASSVNAEIIGGPMLISSASSKGA--------TLRKGDRVKFIGSFPSA  460

Query  1959  FSL--QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAA  2132
              S      +RGP+YG +GKVLLAFE+NG SKIGVRFD+SIP+GNDLGGLCE+DHGFFC+A
Sbjct  461   VSSLPNYISRGPSYGSRGKVLLAFEDNGSSKIGVRFDKSIPDGNDLGGLCEDDHGFFCSA  520

Query  2133  D-FLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKL  2309
             +  L++D S  DDLDK+AINE+FEV S + KS  L+LF+KDI K+M+GN   +   K K 
Sbjct  521   NHLLQVDGSGGDDLDKVAINEIFEVASNQSKSGALVLFIKDIGKAMIGN---YEILKSKF  577

Query  2310  EKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETP  2489
             E LP NVVV+ S+TQ DN+KEK+ PG  LFTKFGSNQTALLDLAFPDNF RLHDRSKET 
Sbjct  578   ESLPPNVVVVGSHTQLDNQKEKAQPGSLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETS  637

Query  2490  KAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCP  2669
             K +KQL RLFPNKV IQ+PQDE LLSDWKQQLDRDIETMK+QSN V+IR VLNR+ LDCP
Sbjct  638   KVMKQLNRLFPNKVTIQLPQDEALLSDWKQQLDRDIETMKAQSNVVSIRLVLNRIGLDCP  697

Query  2670  DIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQ  2849
             D+ETLCIKD  LT ESVEKIIGWALS+HFMHSSE+S ++ KL IS+ESI+YG  +LQG+Q
Sbjct  698   DLETLCIKDHTLTTESVEKIIGWALSYHFMHSSEASIRDSKLVISAESIKYGHKILQGIQ  757

Query  2850  NETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQR  3029
             NE K++KKSLKDVVTENEFEKKLL DVIPP+DIGVTFDDIGALENVK+TLKELVMLPLQR
Sbjct  758   NENKNMKKSLKDVVTENEFEKKLLTDVIPPTDIGVTFDDIGALENVKETLKELVMLPLQR  817

Query  3030  PELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY  3209
             PELF KGQL KPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY
Sbjct  818   PELFGKGQLAKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY  877

Query  3210  VKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVL  3389
             VKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKER+L
Sbjct  878   VKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERIL  937

Query  3390  VLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTE  3569
             VLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR KI+R+IL KE+LAP+VD +AIANMT+
Sbjct  938   VLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRGKIVRVILAKEDLAPDVDFEAIANMTD  997

Query  3570  GYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYA  3749
             GYSGSDLKNLCVTAA CPIR+ILEKEKKE++LA++EN+PLP L +S+D+RPL M+DFRYA
Sbjct  998   GYSGSDLKNLCVTAAQCPIRQILEKEKKERSLALAENQPLPQLCSSTDVRPLKMEDFRYA  1057

Query  3750  HEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             HEQVCASVSSESTNM+ELLQWN+LYGEGGSRK ++LSYFM
Sbjct  1058  HEQVCASVSSESTNMSELLQWNDLYGEGGSRKMRSLSYFM  1097



>ref|XP_004495973.1| PREDICTED: uncharacterized protein LOC101497938 [Cicer arietinum]
Length=1248

 Score =  1465 bits (3792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 778/1213 (64%), Positives = 942/1213 (78%), Gaps = 31/1213 (3%)
 Frame = +3

Query  294   ESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGS  473
             ESA+ +IRS+DL   S+L + +    +K     +  E L+SP+   DS  D+ +      
Sbjct  46    ESAKGDIRSSDLQETSSLNAVDCD-NDKSSSVAVKTEALMSPLRCLDSG-DIAEKSKGLP  103

Query  474   ALNRGKKRQLK--SNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKS  647
              + R KKR +K       AWGKL+SQ  +N H+ + +  +TVGQGRQC+L + DP++S  
Sbjct  104   PIARPKKRGIKLCPKAEDAWGKLISQSSENPHLSMCEPIYTVGQGRQCNLWLKDPALSHV  163

Query  648   LCNLKHIQ--REKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAY  821
             LC L HI+  +   +S+ LLEI G KG VQVNGK Y K S + L+GGDEV+FGSSGK AY
Sbjct  164   LCKLSHIEFAQHGSSSVALLEIVGSKGAVQVNGKSYGKKSCLILSGGDEVVFGSSGKEAY  223

Query  822   IFQKFTNED----ISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnl  989
             IFQ+ +N +     ++A++P  VSILEA   P+ G   +ARSGD S VA AS LAS  NL
Sbjct  224   IFQQLSNNNNNVTTASANVPSPVSILEAQGAPITGTQVDARSGDLSAVAGASILASFPNL  283

Query  990   kkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDH---NDVPLDEKS  1160
              KEL + PP      +++Q  ++ ++P ++G+      ++++K  ++H   N V   E++
Sbjct  284   DKELSVTPPPGNTSMNLQQNTDVASVPASNGD---ETPNTEVKQSTNHKESNGVFSSEET  340

Query  1161  GAISPDSGNDNLNLENGAIDS-YDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISR  1337
             G +S  + N++  +++  +++  D ++GK T     LRPL+  L+GS  P FDLSGNI+R
Sbjct  341   GLLSSATVNEDPKVDSLDVNAGVDTDVGKTTAPAGNLRPLLHKLSGS-CPAFDLSGNIAR  399

Query  1338  IIDQR---RELLKDFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKN  1505
             I+ +R   RELLKD D P      R+Q   D L+  IL + NI+VSFE FPYYLS+ TKN
Sbjct  400   ILGERKELRELLKDVDTPTALAPPRKQVSTDNLRLRILCAENIDVSFESFPYYLSDTTKN  459

Query  1506  VLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVD  1685
             VLIAS YIHLKCN   K  S+LP++ PRILLSGPAGSEIYQETL+KALAKYFGARLL+V+
Sbjct  460   VLIASVYIHLKCNGSGKFVSDLPSLSPRILLSGPAGSEIYQETLSKALAKYFGARLLIVN  519

Query  1686  SLVLPGGSA-KELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISS  1862
              L  PG +  K++D  KE+ +PER  VFTKR+ QA  L   K+P++SV+A I GGS++SS
Sbjct  520   YLSPPGRAPLKDVDSTKESSRPERPSVFTKRSTQAITLPL-KRPSTSVDAQIIGGSSLSS  578

Query  1863  HAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS--LQTPARGPAYGYKGKVLLAFEEN  2033
              A  KQE STASSK  T KTGDRVK+VG  P+  S     P+RGP+YG +GKVLLAFE N
Sbjct  579   PAIVKQEVSTASSKGITLKTGDRVKFVGDFPSAVSSPQDFPSRGPSYGCRGKVLLAFENN  638

Query  2034  GFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRL-DNSSIDDLDKLAINELFEVVS  2210
             G SKIGVRF++SIP+GNDLGGLCE+D GFFCAA+ L L D    D+  K+A++E+FE+ S
Sbjct  639   GSSKIGVRFEKSIPDGNDLGGLCEDDRGFFCAANHLVLVDGCGGDESSKIAVSEIFEIAS  698

Query  2211  QECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGG  2390
                K+  L++F+KDIEK + GN E     K +L  LP NVVVI S+ Q DNRKEK+ PG 
Sbjct  699   NLSKTGALVVFIKDIEKGVAGNSEVL---KSRLSNLPPNVVVIGSHIQPDNRKEKTQPGS  755

Query  2391  FLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSD  2570
              LFTKFG NQTALLDLAFPDNF RLHDRSKETPK +KQL RLFPN+V IQ+PQDE L+SD
Sbjct  756   LLFTKFGGNQTALLDLAFPDNFTRLHDRSKETPKVMKQLNRLFPNRVTIQLPQDEALISD  815

Query  2571  WKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSH  2750
             WKQQL+RDIETMK+QSN V+IR+VL R ELDCPD++TLCIKDQ LT E+ EKIIGWA+S+
Sbjct  816   WKQQLERDIETMKAQSNVVSIRSVLKRFELDCPDLDTLCIKDQTLTTENAEKIIGWAISY  875

Query  2751  HFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADV  2930
             HFMHSSE S  + K  IS+ESI+YG ++LQG+ NE KSVKKSLKDVVTENEFEKKLLADV
Sbjct  876   HFMHSSEPSFNDSKPLISAESIQYGFNILQGILNENKSVKKSLKDVVTENEFEKKLLADV  935

Query  2931  IPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKT  3110
             IPP+DIGV+FDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKT
Sbjct  936   IPPTDIGVSFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKT  995

Query  3111  MLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGR  3290
             MLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGR
Sbjct  996   MLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGR  1055

Query  3291  RESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNL  3470
             RE+PGEHEAMRKMKNEFMVNWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLPRRLMVNL
Sbjct  1056  RENPGEHEAMRKMKNEFMVNWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRRLMVNL  1115

Query  3471  PDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekek  3650
             PDA NREKI+R+IL KE+LAP+VDL+A+ANMT+GYSGSDLKNLCVTAAHCPIREILEKEK
Sbjct  1116  PDATNREKIMRVILAKEDLAPDVDLEALANMTDGYSGSDLKNLCVTAAHCPIREILEKEK  1175

Query  3651  kekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGE  3830
             KEK+LA++EN+P+P L  S+DIRPL M+DFRYAHEQVCASVSSESTNM ELLQWN+LYGE
Sbjct  1176  KEKSLALAENKPIPELCGSADIRPLKMEDFRYAHEQVCASVSSESTNMNELLQWNDLYGE  1235

Query  3831  GGSRKKKALSYFM  3869
             GGSRKK +LSYFM
Sbjct  1236  GGSRKKTSLSYFM  1248



>ref|XP_008800830.1| PREDICTED: uncharacterized protein LOC103715088 [Phoenix dactylifera]
Length=1257

 Score =  1462 bits (3786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 772/1213 (64%), Positives = 933/1213 (77%), Gaps = 47/1213 (4%)
 Frame = +3

Query  282   ESGPESAEQEIRSADLDG-ASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKV  458
             E+G  S EQE R  D  G +S L+ P      K     LG  PL                
Sbjct  75    EAGHGSPEQENRPEDGAGQSSVLQLPTQEQTAKADGEQLGAVPL----------------  118

Query  459   KANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSV  638
                       KKR LK     AW KLLSQ  QN H+ +  S FTVGQG  C+L + DPSV
Sbjct  119   -------ELSKKRDLKVQ-PKAWAKLLSQCSQNPHLVICGSQFTVGQGPSCNLSLKDPSV  170

Query  639   SKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHA  818
              ++LC LKH++  +G    LLEI G+KG VQVNGKI  + S V L GGDEV+FGSS +HA
Sbjct  171   GRTLCKLKHLEC-RGAPGALLEIIGRKGIVQVNGKIIEQISQVVLMGGDEVVFGSSRRHA  229

Query  819   YIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkke  998
             YIFQ   ++ ++  +   ++ IL+A   P K + FE+RSGDPS VA AS LASLSN KK+
Sbjct  230   YIFQPLASDKLTTPASCSALGILDAQDVPTKEIQFESRSGDPSAVAGASILASLSNHKKD  289

Query  999   llllPPSVCNDNDIKQGPEMPALPVAS--GEPDKHDLDSDM---KDVSDHN---DVPLDE  1154
             L +LPP+   DN   +G + PALP A    E    DLD +       ++HN   +VP  +
Sbjct  290   LSVLPPASSGDN-AHEGVQRPALPSACDVSEGCNSDLDKNCDAGTGNTEHNGSTEVPSGD  348

Query  1155  KSGAISPDSGNDNLNLENGAIDS---YDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSG  1325
             K+  +       N   ++G I S    DG+IGK +GA  E+RPL++M+AGSST E DL+G
Sbjct  349   KAAVVLSTDLGANEATQHGTIGSDAQLDGDIGKTSGANYEIRPLVKMIAGSSTAELDLTG  408

Query  1326  NISRIIDQRRELLKDFDPLISM-STRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITK  1502
             NI ++ + +RELL+D D   S+ +TR QAFKDGL+Q I+D+++I+VSFE FPYYLS+ TK
Sbjct  409   NIFKVFEDQRELLRDLDTPASLPTTRCQAFKDGLKQGIVDASDIQVSFESFPYYLSDNTK  468

Query  1503  NVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVV  1682
             N+L++  YIHL+C +F+K A+E+ +V PRILL+GP GSEIYQETL KALA++FGARLL++
Sbjct  469   NLLLSCAYIHLECKEFIKYATEISSVNPRILLTGPTGSEIYQETLVKALARHFGARLLII  528

Query  1683  DSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAIS  1859
             DSL LPGG S+K+ + +KE  + E+   F+KR A   +    ++P SSVEAD+ G S ++
Sbjct  529   DSLQLPGGPSSKDSESLKEGGRVEKASFFSKRGALLDL----RRPTSSVEADMMGTSMLN  584

Query  1860  SHAQTKQEASTASSKN-TFKTGDRVKYVGPLPT-GFSLQTPARGPAYGYKGKVLLAFEEN  2033
             S +  KQEAST SSK  TFK GDRV+YVG  P+ GF LQ P  GP Y Y+GKV+LAFEEN
Sbjct  585   SRSLPKQEASTTSSKKYTFKEGDRVRYVGSGPSSGFPLQAPESGPNYDYRGKVVLAFEEN  644

Query  2034  GFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQ  2213
             G SKIGVRFD+ I EGNDLGGLCEEDHGFFC AD LR ++S  +D+++LAINEL EVVS+
Sbjct  645   GASKIGVRFDKQILEGNDLGGLCEEDHGFFCTADLLRPESSGGEDIERLAINELLEVVSE  704

Query  2214  ECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGF  2393
             E K+ PLI+ +KDIEKSM G  + +   K KLE +P  V++I S+TQ DNRKEKSHPGG 
Sbjct  705   ESKNGPLIILIKDIEKSMAGGTDTYLTLKSKLELMPAGVLIIGSHTQIDNRKEKSHPGGL  764

Query  2394  LFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDW  2573
             LFTKFGSNQTALLD AFPDN GRLH+RSKE PK +KQLTRLFPNK+ IQ+PQDE  L DW
Sbjct  765   LFTKFGSNQTALLDFAFPDNLGRLHERSKEIPKTMKQLTRLFPNKLSIQLPQDEAQLLDW  824

Query  2574  KQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHH  2753
             K+QLDRD+ET+K++SN ++IR+ L+R  LDC D+ET+ IKDQ LTNE+V+KI+G+ALSHH
Sbjct  825   KEQLDRDVETLKAKSNILSIRSFLSRNGLDCNDLETISIKDQTLTNENVDKIVGFALSHH  884

Query  2754  FMHSS-ESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADV  2930
               ++  E+S K+ KL +S++SI++GL +LQ +Q++TKS KKSLKDVVTENEFEK+LLADV
Sbjct  885   LKNNKIEASAKDAKLVLSNDSIKHGLGMLQSIQSDTKSPKKSLKDVVTENEFEKRLLADV  944

Query  2931  IPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKT  3110
             IPP DIGVTF DIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKT
Sbjct  945   IPPDDIGVTFVDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKT  1004

Query  3111  MLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGR  3290
             MLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGR
Sbjct  1005  MLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGR  1064

Query  3291  RESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNL  3470
             RE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLD+AVIRR PRRLMVNL
Sbjct  1065  RENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDDAVIRRFPRRLMVNL  1124

Query  3471  PDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekek  3650
             PDA NREKILR+IL KEEL P+V L+A+ANMT+GYSGSDLKNLCVTAAHCPIRE+LEKEK
Sbjct  1125  PDASNREKILRVILAKEELTPDVALEALANMTDGYSGSDLKNLCVTAAHCPIREVLEKEK  1184

Query  3651  kekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGE  3830
             KE++ A++E RPLPALH S DIRPL+M+D +YAHEQVCASVSSESTNM+ELLQWNELYGE
Sbjct  1185  KERSSALAEGRPLPALHGSDDIRPLSMEDLKYAHEQVCASVSSESTNMSELLQWNELYGE  1244

Query  3831  GGSRKKKALSYFM  3869
             GGSRKKKALSYFM
Sbjct  1245  GGSRKKKALSYFM  1257



>ref|XP_006396457.1| hypothetical protein EUTSA_v10028366mg [Eutrema salsugineum]
 gb|ESQ37910.1| hypothetical protein EUTSA_v10028366mg [Eutrema salsugineum]
Length=1256

 Score =  1462 bits (3786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 782/1215 (64%), Positives = 927/1215 (76%), Gaps = 38/1215 (3%)
 Frame = +3

Query  270   GAVNESGPESAEQEIRSADLDGASALK--SPEAPVPEKLPEAPLGGEP--LVSPMILGDS  437
             G  ++ G ES E E+RS+D     A K  + + PV E  PE     E   L +P I G+ 
Sbjct  65    GPASDPGSESGEPELRSSDPQAMDAEKPVTADVPVMENSPETDANPEVEVLATPTIAGEV  124

Query  438   AIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDL  617
               D +K KA       GKKR         W KLLSQYPQN H  +    FTVG+ R CDL
Sbjct  125   VADAEKSKA-------GKKRA-----KAPWAKLLSQYPQNPHRIMRGPVFTVGR-RGCDL  171

Query  618   CVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIF  797
              + D S+  +LC LK      G S+  LEI G    VQVNGK Y K+S V L GGDEVIF
Sbjct  172   SIKDQSMPSTLCELKQ-SEHGGPSVASLEIIGSGLLVQVNGKCYQKSSCVHLRGGDEVIF  230

Query  798   GSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlas  977
              SSG+HAYIFQ   +E+++A     S+SI EA   P+KGV+ E R+GD S V  AS LAS
Sbjct  231   SSSGRHAYIFQPLKDENLAAPDRASSLSICEARGAPLKGVHAETRAGDSSAVDGASILAS  290

Query  978   lsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLD--  1151
             LS  +   LL  P +      +Q P++P +P +  +      D+DM D   +ND P+   
Sbjct  291   LSKYRNFHLL--PPIAKAAKRQQNPDVPVVPSSCNDCIS---DTDMNDADSNNDHPVIAS  345

Query  1152  -EKSGAISPDSGNDNLNLENGAIDSYDGEIGKVT-GAPQELRPLIRMLAGSSTPEFDLSG  1325
              EK+ A +  + N+NLN +   +D +    G  T G+  E+RP++R+L   S+  FD+ G
Sbjct  346   VEKTAASTSCTANENLNADGSGLDPFQEADGANTPGSGFEIRPILRLLGEPSS--FDIRG  403

Query  1326  NISRIIDQRREL---LKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEI  1496
              IS+++D+RRE+   L++FD   S+STRRQAFKD L+  +LD+ NI+VS E+FPY+LS  
Sbjct  404   -ISKLLDERREVREFLREFDLSSSISTRRQAFKDSLRGGVLDAQNIDVSLENFPYFLSAT  462

Query  1497  TKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARL  1673
             TK+VLIAS Y+H+K  +KF K AS+L T+CPRILLSGPAGSEIYQE LAKALAK F A+L
Sbjct  463   TKDVLIASMYVHMKGGSKFAKYASDLSTMCPRILLSGPAGSEIYQEMLAKALAKSFEAKL  522

Query  1674  LVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGS  1850
             ++VDSL+LPGGS AKE +  KE  + E+  +  KRA QAA    +KKP SSV+ADITGGS
Sbjct  523   MIVDSLLLPGGSPAKEAESSKEGSRREKLSMLAKRAVQAAQALQHKKPTSSVDADITGGS  582

Query  1851  AISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAF  2024
               SS A  KQE STA+SK+ TFK+GDRVK+VGP  +  S LQ   RGPA GY+GKV+LAF
Sbjct  583   T-SSQALPKQEVSTATSKSYTFKSGDRVKFVGPSSSAISSLQGSIRGPAIGYQGKVVLAF  641

Query  2025  EENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEV  2204
             E+N  SKIG+RFDR +P+GNDLGGLCEEDHGFFCAA  LRLD SS DD DKLA+NE+FEV
Sbjct  642   EDNCSSKIGIRFDRPVPDGNDLGGLCEEDHGFFCAASSLRLDGSSSDDADKLAVNEIFEV  701

Query  2205  VSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHP  2384
                E +   LILF+KDIEKS+VGN + ++  K KLE LPEN+VV+AS TQ D+RKEKSHP
Sbjct  702   AISESEGGSLILFLKDIEKSLVGNSDVYATMKSKLENLPENIVVVASQTQLDSRKEKSHP  761

Query  2385  GGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLL  2564
             GGFLFTKFG NQTALLDLAFPDNFG+LHDRSKETPK++KQ+TRLFPNKV IQ+PQDE LL
Sbjct  762   GGFLFTKFGGNQTALLDLAFPDNFGKLHDRSKETPKSLKQITRLFPNKVAIQLPQDEALL  821

Query  2565  SDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWAL  2744
              DWK++LDRD E +K Q+N  +I  VL +  LDCPD+ TLCIKDQ L +ESVEK++GWAL
Sbjct  822   LDWKEKLDRDTELLKVQANLTSILAVLTKNRLDCPDLGTLCIKDQTLPSESVEKVVGWAL  881

Query  2745  SHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLA  2924
             SHH M+ SE + K+ KL IS+ESI YGL +L GVQNE KS+KKSLKDVVTENEFEKKLL+
Sbjct  882   SHHLMNCSEPTVKDNKLVISAESITYGLQMLHGVQNENKSLKKSLKDVVTENEFEKKLLS  941

Query  2925  DVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTG  3104
             DVIPPSDIGV+FDDIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFGPPGTG
Sbjct  942   DVIPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPELFDKGQLTKPTKGILLFGPPGTG  1001

Query  3105  KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSML  3284
             KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSML
Sbjct  1002  KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSML  1061

Query  3285  GRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMV  3464
             GRRE+PGEHEAMRKMKNEFM+NWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLPRRLMV
Sbjct  1062  GRRENPGEHEAMRKMKNEFMINWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRRLMV  1121

Query  3465  NLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilek  3644
             NLPDA NR KIL +IL+KEE+AP+VDL+AIANMT+GYSGSDLKNLCVTAAH PIREILEK
Sbjct  1122  NLPDATNRSKILSVILSKEEIAPDVDLEAIANMTDGYSGSDLKNLCVTAAHLPIREILEK  1181

Query  3645  ekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELY  3824
             EKKEK +A +ENRP P L++ +DIRPL M DF+ AHEQVCASVSS+S+NM EL QWNELY
Sbjct  1182  EKKEKTVAQAENRPTPPLYSCTDIRPLTMTDFKVAHEQVCASVSSDSSNMNELQQWNELY  1241

Query  3825  GEGGSRKKKALSYFM  3869
             GEGGSRKK +LSYFM
Sbjct  1242  GEGGSRKKTSLSYFM  1256



>ref|XP_009414467.1| PREDICTED: uncharacterized protein LOC103995579 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1252

 Score =  1459 bits (3777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 764/1145 (67%), Positives = 924/1145 (81%), Gaps = 26/1145 (2%)
 Frame = +3

Query  492   KRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQ  671
             KR +K+    AW KL+SQ+ QN H+ L  S F+VGQ R C+L + DPS+SK LC L+H Q
Sbjct  115   KRVVKATQKAAWAKLISQHSQNPHLFLSGSQFSVGQSRSCNLWLKDPSISKILCRLRHSQ  174

Query  672   REKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDI  851
             R  G S+  LEI G+KG VQVNGK + +NS + L GGDE+IF SSGKHAYIFQ+  N D 
Sbjct  175   R-GGASVAFLEIVGRKGIVQVNGKTFERNSNIILTGGDELIFSSSGKHAYIFQQLKN-DK  232

Query  852   SAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCND  1031
             SA ++ PS+ + E+    ++    E R+GDPS V  AS LASLSN  K+L  +PP+  N 
Sbjct  233   SATAVLPSLGVQESKGTAIRESQTETRTGDPSAVTGASILASLSNDLKDLSAIPPA-SNA  291

Query  1032  NDIKQGPEMPALP---VASG----EPDKHDLDSDM----KDVSDHNDVPLDEKSGAISPD  1178
              + ++G E PAL    +AS     +P+K   DSD      +    +++  D     +S D
Sbjct  292   ENAQEGLENPALASMTIASDGCNPDPEK---DSDTCKESSETEGSSEIRSDNADAVMSSD  348

Query  1179  -SGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQR  1352
                N+ +  EN   D++ D EIGKV G   E+RPL+RM +GS     DLSGN+ ++ + +
Sbjct  349   LRVNEPVQPENIQPDAHPDAEIGKVPGTNSEIRPLLRMFSGSPISGLDLSGNVFKVFEDQ  408

Query  1353  RELLKDFDPLISM-STRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYI  1529
             RELLKD D   S+ +TR QAFKDGL+Q IL+ N+I VSFE FPYYLSE TK+VL++  +I
Sbjct  409   RELLKDLDLPSSLPTTRCQAFKDGLKQGILNPNDINVSFETFPYYLSENTKSVLMSCAFI  468

Query  1530  HLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPG-G  1706
             HL+C +FVK  +++ +V  RILLSGP GSEIYQETL KALAK+FGARLL++DSL+LPG  
Sbjct  469   HLECKEFVKYTTDISSVNHRILLSGPTGSEIYQETLVKALAKHFGARLLIIDSLLLPGVS  528

Query  1707  SAKELDPVKEAPKPERTGVFTK-RAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQE  1883
             S K+ + +KE  + E++ +F+K RAA A  ++  KKPASSVE DI G S +++ +  KQE
Sbjct  529   SLKDAELLKEGARIEKSSIFSKHRAALADAIQL-KKPASSVETDIVGASTLNTQSLPKQE  587

Query  1884  ASTASSKN-TFKTGDRVKYVGPLPT-GFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVR  2057
             ASTASSKN TFK GDRV+YVG +P+ GF LQTP RGP YGY+GKV+LAFEENG SK+GVR
Sbjct  588   ASTASSKNYTFKEGDRVRYVGSMPSSGFPLQTPQRGPNYGYRGKVVLAFEENGSSKVGVR  647

Query  2058  FDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLI  2237
             FD+ IPEGNDLGGLCEEDHGFFC AD LR D S  +D+++LA NEL EVV +E K+ PLI
Sbjct  648   FDKQIPEGNDLGGLCEEDHGFFCTADLLRPDFSGSEDVERLAANELLEVVLEESKNGPLI  707

Query  2238  LFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSN  2417
             + +KDIEKSM G+ +++   K KLE +P  V++I S++Q DNRKEKSHPGG LFTKFGSN
Sbjct  708   VLIKDIEKSMAGSTDSYITLKSKLELMPVGVLIIGSHSQIDNRKEKSHPGGLLFTKFGSN  767

Query  2418  QTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDI  2597
             QTALLD AFPDNFGRLH+RSKE PK +KQL+RLFPNKV+IQ+PQ+ET LS+WKQ LDRD+
Sbjct  768   QTALLDFAFPDNFGRLHERSKEIPKTMKQLSRLFPNKVLIQLPQEETQLSEWKQHLDRDV  827

Query  2598  ETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHS-SES  2774
             ET+K++SN ++IR+ LNR  LDC D+ET+ IKDQALTNESV+K++G+ALS+H  HS +E+
Sbjct  828   ETLKAKSNVLSIRSFLNRCGLDCNDLETISIKDQALTNESVDKVVGFALSYHLKHSRTEA  887

Query  2775  STKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGV  2954
             S+K+ KL +SSES+++GLS+LQ VQN+ KS+KKSLKDVVTENEFEK+LL DVIPP+DIGV
Sbjct  888   SSKDAKLMLSSESLKHGLSMLQSVQNDNKSIKKSLKDVVTENEFEKRLLTDVIPPNDIGV  947

Query  2955  TFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVAT  3134
             TFDDIGALENVK+TLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVAT
Sbjct  948   TFDDIGALENVKETLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVAT  1007

Query  3135  EAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHE  3314
             EAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSV+FVDEVDSMLGRRE+PGEHE
Sbjct  1008  EAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVIFVDEVDSMLGRRENPGEHE  1067

Query  3315  AMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREK  3494
             AMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPD  NREK
Sbjct  1068  AMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDTSNREK  1127

Query  3495  ILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiS  3674
             ILR+IL+KEELAP+VDL+A+ANMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE+ LA++
Sbjct  1128  ILRVILSKEELAPDVDLEALANMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERNLALA  1187

Query  3675  ENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKA  3854
             E R LP L+ S D+RPLNM+DF+YAHEQVCASVSSES+NM+ELLQWNELYGEGGSRKKKA
Sbjct  1188  EGRTLPTLYGSEDVRPLNMEDFKYAHEQVCASVSSESSNMSELLQWNELYGEGGSRKKKA  1247

Query  3855  LSYFM  3869
             LSYFM
Sbjct  1248  LSYFM  1252



>ref|XP_010542858.1| PREDICTED: uncharacterized protein LOC104815931 isoform X2 [Tarenaya 
hassleriana]
Length=1251

 Score =  1459 bits (3776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 795/1248 (64%), Positives = 951/1248 (76%), Gaps = 48/1248 (4%)
 Frame = +3

Query  207   KRSKATE-SLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKL-  380
             KRSKA E + SS+   +     G  ++ G ES ++E    D     A       V     
Sbjct  25    KRSKAAEPAGSSSTSEVPTGNQGPASDPGSESGDRESGRPDPQSTDAANPVTTDVAAAAA  84

Query  381   ------PEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLS  542
                   P+A    E LV+P   G+  +D +K KA        KKR  K+     WGKLLS
Sbjct  85    AETSPHPDADTEAEVLVTPTAAGEVLVDAEKPKAV-------KKRAGKA----PWGKLLS  133

Query  543   QYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSV-SKSLCNLKHIQREKGN-SITLLEISGK  716
             Q  QN H  +    FTVG+ R CDLC+ DPS+ S +LC L+  Q E+G+ S   LEI G 
Sbjct  134   QCSQNPHRVMKSPVFTVGR-RGCDLCIKDPSMPSTTLCELR--QTEQGDASAGSLEIMGN  190

Query  717   KGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAH  896
              G VQVNGK Y + + + L GGDE++F  SGKHAYIFQ   +++++A  +   +SILEA 
Sbjct  191   GGIVQVNGKNYERKANIHLRGGDELVFSPSGKHAYIFQPLKDDNLAARDIASPLSILEAQ  250

Query  897   SGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVA  1076
             S P+KG++ E R+GDPS V  AS LASLS+  +  LL  P      + +Q PE+P +P +
Sbjct  251   SAPLKGIHVETRAGDPSAVDGASILASLSDYHRFPLL--PPTAKRAEGQQNPEVPGVPSS  308

Query  1077  SGE--PDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAID-SYDGEIGKV  1247
               +  PD    D+D  +  DH  +   EK+ A +  + N+NL  +   ++   +   G V
Sbjct  309   YSDCIPDVDMTDADCSN--DHAAIASTEKTVASTSSAANNNLKADGSGMNPCQENGGGCV  366

Query  1248  TGAPQELRPLIRMLAGSSTPEFDLSGNISRIID-QR--RELLKDFDPLIS--MSTRRQAF  1412
               +  E+RP++R+    S+ EFDL G+IS+I+D QR  RELLK+FD L S  +STRRQA+
Sbjct  367   PLSAYEIRPVLRLFRDPSSSEFDLRGSISKILDDQREVRELLKEFD-LSSALLSTRRQAY  425

Query  1413  KDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPR  1589
             KD LQ  +L+  N++VS E FPY+LS  TK+VLIASTY+H+KC NKFVK AS+L T+CPR
Sbjct  426   KDSLQAGVLNPENLDVSLESFPYFLSTATKDVLIASTYVHMKCGNKFVKYASDLSTLCPR  485

Query  1590  ILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS--AKELDPV--KEAPKPERT  1757
             ILLSGPAGSEIYQE L KALAK+FGA+L++VDSL+LPGGS  AKE+D    KE+ + ER 
Sbjct  486   ILLSGPAGSEIYQEMLTKALAKHFGAKLMIVDSLLLPGGSSIAKEMDSSNPKESYRRERL  545

Query  1758  GVFTKRA---AQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGD  1925
              V  KRA   AQAA L+ ++KP SSVEADITGGS +SS A  KQE STA+SK+ TFKTGD
Sbjct  546   SVLAKRAIQVAQAAALQ-HRKPTSSVEADITGGSTLSSQAFPKQEVSTATSKSYTFKTGD  604

Query  1926  RVKYVGPLPTGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCE  2105
             RVK+VGP  +  SLQ P RGPA G++GKV+LAFE NG SKIGVRFDRSIP+GNDLGGLCE
Sbjct  605   RVKFVGP-SSALSLQGPLRGPAIGFQGKVVLAFEGNGSSKIGVRFDRSIPDGNDLGGLCE  663

Query  2106  EDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEA  2285
             EDHGFFC A  LRLD+S+ D+ DKLAINE+FEV   E +  PLILF+KDIEKS+VGN + 
Sbjct  664   EDHGFFCTASSLRLDSSTSDNADKLAINEIFEVAFGESERCPLILFLKDIEKSLVGNNDV  723

Query  2286  FSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRL  2465
             ++  K KLE LPEN+VVIAS TQ DNRKEKSHPGGFLFTKFGSNQTALLDLAF DNFGRL
Sbjct  724   YATLKSKLENLPENIVVIASQTQLDNRKEKSHPGGFLFTKFGSNQTALLDLAFSDNFGRL  783

Query  2466  HDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVL  2645
             HDRSKE PK++KQ+TRLFPNKV IQ+PQDE LL +WK++L+RD E +KSQ+N  +IR VL
Sbjct  784   HDRSKEMPKSMKQITRLFPNKVAIQLPQDEALLLEWKEKLERDTEILKSQANITSIRVVL  843

Query  2646  NRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYG  2825
             +R  L CP++E+L  KDQ L +ESVEKI+GWALSHHFMH SE + K+ KL IS+ES+ +G
Sbjct  844   SRNRLACPELESLAFKDQTLPHESVEKIVGWALSHHFMHFSEPTIKDNKLVISAESVSFG  903

Query  2826  LSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKE  3005
             L++L G+QNE+KSVKKSLKDVVTENEFEKKLL+DVIPPSDIGV+FDDIGALENVKDTLKE
Sbjct  904   LNILDGIQNESKSVKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKDTLKE  963

Query  3006  LVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK  3185
             LVMLPLQRPELF KGQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK
Sbjct  964   LVMLPLQRPELFGKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK  1023

Query  3186  WFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLR  3365
             WFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFM+NWDGLR
Sbjct  1024  WFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMINWDGLR  1083

Query  3366  TKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDL  3545
             TKD+ERVLVLAATNRPFDLDEAVIRRLPRRLMV+LPDA NRE+IL +IL KEE+A +VDL
Sbjct  1084  TKDRERVLVLAATNRPFDLDEAVIRRLPRRLMVDLPDAANRERILGVILAKEEMASDVDL  1143

Query  3546  DAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPL  3725
             +AIANMT GYSGSDLKNLCVTAAH PIRE+LEKEKKEK  A++E R  P L+ SSDIRPL
Sbjct  1144  EAIANMTNGYSGSDLKNLCVTAAHLPIRELLEKEKKEKVEAVAEKREFPPLYKSSDIRPL  1203

Query  3726  NMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
              M+DF+ AHEQVCASVSSES+NM EL QWNELYGEGGSRKK +LSYFM
Sbjct  1204  MMNDFKVAHEQVCASVSSESSNMNELQQWNELYGEGGSRKKTSLSYFM  1251



>ref|XP_010542859.1| PREDICTED: uncharacterized protein LOC104815931 isoform X3 [Tarenaya 
hassleriana]
Length=1263

 Score =  1458 bits (3775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 779/1182 (66%), Positives = 928/1182 (79%), Gaps = 40/1182 (3%)
 Frame = +3

Query  381   PEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNS  560
             P+A    E LV+P   G+  +D +K KA        KKR  K+     WGKLLSQ  QN 
Sbjct  103   PDADTEAEVLVTPTAAGEVLVDAEKPKAV-------KKRAGKA----PWGKLLSQCSQNP  151

Query  561   HVPLDQSTFTVGQGRQCDLCVDDPSV-SKSLCNLKHIQREKGN-SITLLEISGKKGCVQV  734
             H  +    FTVG+ R CDLC+ DPS+ S +LC L+  Q E+G+ S   LEI G  G VQV
Sbjct  152   HRVMKSPVFTVGR-RGCDLCIKDPSMPSTTLCELR--QTEQGDASAGSLEIMGNGGIVQV  208

Query  735   NGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKG  914
             NGK Y + + + L GGDE++F  SGKHAYIFQ   +++++A  +   +SILEA S P+KG
Sbjct  209   NGKNYERKANIHLRGGDELVFSPSGKHAYIFQPLKDDNLAARDIASPLSILEAQSAPLKG  268

Query  915   VNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGE--P  1088
             ++ E R+GDPS V  AS LASLS+  +  LL  P      + +Q PE+P +P +  +  P
Sbjct  269   IHVETRAGDPSAVDGASILASLSDYHRFPLL--PPTAKRAEGQQNPEVPGVPSSYSDCIP  326

Query  1089  DKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAID-SYDGEIGKVTGAPQE  1265
             D    D+D  +  DH  +   EK+ A +  + N+NL  +   ++   +   G V  +  E
Sbjct  327   DVDMTDADCSN--DHAAIASTEKTVASTSSAANNNLKADGSGMNPCQENGGGCVPLSAYE  384

Query  1266  LRPLIRMLAGSSTPEFDLSGNISRIID-QR--RELLKDFDPLIS--MSTRRQAFKDGLQQ  1430
             +RP++R+    S+ EFDL G+IS+I+D QR  RELLK+FD L S  +STRRQA+KD LQ 
Sbjct  385   IRPVLRLFRDPSSSEFDLRGSISKILDDQREVRELLKEFD-LSSALLSTRRQAYKDSLQA  443

Query  1431  TILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGP  1607
              +L+  N++VS E FPY+LS  TK+VLIASTY+H+KC NKFVK AS+L T+CPRILLSGP
Sbjct  444   GVLNPENLDVSLESFPYFLSTATKDVLIASTYVHMKCGNKFVKYASDLSTLCPRILLSGP  503

Query  1608  AGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS--AKELDPV--KEAPKPERTGVFTKR  1775
             AGSEIYQE L KALAK+FGA+L++VDSL+LPGGS  AKE+D    KE+ + ER  V  KR
Sbjct  504   AGSEIYQEMLTKALAKHFGAKLMIVDSLLLPGGSSIAKEMDSSNPKESYRRERLSVLAKR  563

Query  1776  A---AQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVG  1943
             A   AQAA L+ ++KP SSVEADITGGS +SS A  KQE STA+SK+ TFKTGDRVK+VG
Sbjct  564   AIQVAQAAALQ-HRKPTSSVEADITGGSTLSSQAFPKQEVSTATSKSYTFKTGDRVKFVG  622

Query  1944  PLPTGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFF  2123
             P  +  SLQ P RGPA G++GKV+LAFE NG SKIGVRFDRSIP+GNDLGGLCEEDHGFF
Sbjct  623   P-SSALSLQGPLRGPAIGFQGKVVLAFEGNGSSKIGVRFDRSIPDGNDLGGLCEEDHGFF  681

Query  2124  CAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKL  2303
             C A  LRLD+S+ D+ DKLAINE+FEV   E +  PLILF+KDIEKS+VGN + ++  K 
Sbjct  682   CTASSLRLDSSTSDNADKLAINEIFEVAFGESERCPLILFLKDIEKSLVGNNDVYATLKS  741

Query  2304  KLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKE  2483
             KLE LPEN+VVIAS TQ DNRKEKSHPGGFLFTKFGSNQTALLDLAF DNFGRLHDRSKE
Sbjct  742   KLENLPENIVVIASQTQLDNRKEKSHPGGFLFTKFGSNQTALLDLAFSDNFGRLHDRSKE  801

Query  2484  TPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELD  2663
              PK++KQ+TRLFPNKV IQ+PQDE LL +WK++L+RD E +KSQ+N  +IR VL+R  L 
Sbjct  802   MPKSMKQITRLFPNKVAIQLPQDEALLLEWKEKLERDTEILKSQANITSIRVVLSRNRLA  861

Query  2664  CPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQG  2843
             CP++E+L  KDQ L +ESVEKI+GWALSHHFMH SE + K+ KL IS+ES+ +GL++L G
Sbjct  862   CPELESLAFKDQTLPHESVEKIVGWALSHHFMHFSEPTIKDNKLVISAESVSFGLNILDG  921

Query  2844  VQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPL  3023
             +QNE+KSVKKSLKDVVTENEFEKKLL+DVIPPSDIGV+FDDIGALENVKDTLKELVMLPL
Sbjct  922   IQNESKSVKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKDTLKELVMLPL  981

Query  3024  QRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  3203
             QRPELF KGQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE
Sbjct  982   QRPELFGKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  1041

Query  3204  KYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKER  3383
             KYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKD+ER
Sbjct  1042  KYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMINWDGLRTKDRER  1101

Query  3384  VLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANM  3563
             VLVLAATNRPFDLDEAVIRRLPRRLMV+LPDA NRE+IL +IL KEE+A +VDL+AIANM
Sbjct  1102  VLVLAATNRPFDLDEAVIRRLPRRLMVDLPDAANRERILGVILAKEEMASDVDLEAIANM  1161

Query  3564  TEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFR  3743
             T GYSGSDLKNLCVTAAH PIRE+LEKEKKEK  A++E R  P L+ SSDIRPL M+DF+
Sbjct  1162  TNGYSGSDLKNLCVTAAHLPIRELLEKEKKEKVEAVAEKREFPPLYKSSDIRPLMMNDFK  1221

Query  3744  YAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
              AHEQVCASVSSES+NM EL QWNELYGEGGSRKK +LSYFM
Sbjct  1222  VAHEQVCASVSSESSNMNELQQWNELYGEGGSRKKTSLSYFM  1263



>gb|KDO87282.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
 gb|KDO87283.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1002

 Score =  1457 bits (3772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 746/1007 (74%), Positives = 855/1007 (85%), Gaps = 14/1007 (1%)
 Frame = +3

Query  876   VSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPE  1055
             +SILEA S P+K ++ EARSGDPS VA AS LASLSN++K+L L+PP      D  Q  E
Sbjct  1     MSILEAQSAPLKTMHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVD-AQNSE  59

Query  1056  MPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSG-AISP--DSGNDNLNLENGAIDS-  1223
             + +L      P+    D DMKD + +ND       G  + P  D+ N+N NL++  +D+ 
Sbjct  60    IASLASGCDGPEDRIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDAC  119

Query  1224  YDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFD-PLISM  1391
              D EIGK+ GA  ELRPL+RMLAGSS+P+FD+SG IS+I+D++RE   LLKD D P + +
Sbjct  120   VDAEIGKIPGATYELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLI  179

Query  1392  STRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASEL  1571
             S RRQAFKD LQ+ IL   NIEVSFE FPYYLS+ITKNVLIASTY+HLKCN F K AS+L
Sbjct  180   SARRQAFKDSLQEGILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDL  239

Query  1572  PTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPE  1751
             PT+CPRILLSGPAGSEIYQETLAKALAK+F ARLL+VDSL+LPGGS+KE D VKE+ + E
Sbjct  240   PTMCPRILLSGPAGSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTE  299

Query  1752  RTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDR  1928
             +  +F KRAA    L  ++KP SSVEADITGG+A+ S A  K E STASSKN TFK GDR
Sbjct  300   KASMFAKRAA----LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDR  355

Query  1929  VKYVGPLPTGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEE  2108
             VK+VG + +G ++Q   RGP  G++G+V+L FE+N FSKIGVRFDRSIPEGN+LGG CE+
Sbjct  356   VKFVGNVTSGTTVQPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCED  415

Query  2109  DHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAF  2288
             DHGFFC A  LRLD+S  D++DKLAINELFEV   E KSSPLI+FVKDIEKS+ GN +A+
Sbjct  416   DHGFFCTASSLRLDSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAY  475

Query  2289  SAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLH  2468
              A K KLE LP NVVVI S+TQ D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNF RLH
Sbjct  476   GALKSKLENLPSNVVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLH  535

Query  2469  DRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLN  2648
             DRSKETPKA+KQ++RLFPNKV IQ+PQDE LLSDWKQQL+RD+ET+K QSN ++IR+VL+
Sbjct  536   DRSKETPKALKQISRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLS  595

Query  2649  RVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGL  2828
             R  LDC D+E+LCIKDQ LT E VEKI+GWALSHHFMH SE+  K+ KL IS+ESI YGL
Sbjct  596   RNGLDCVDLESLCIKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGL  655

Query  2829  SVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKEL  3008
             ++LQG+Q+E+KS+KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKEL
Sbjct  656   NILQGIQSESKSLKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKEL  715

Query  3009  VMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKW  3188
             VMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKW
Sbjct  716   VMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKW  775

Query  3189  FGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRT  3368
             FGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRT
Sbjct  776   FGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRT  835

Query  3369  KDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLD  3548
             KDKERVLVLAATNRPFDLDEAV+RRLPRRLMVNLPDAPNREKI+R+IL KEELA +VDL+
Sbjct  836   KDKERVLVLAATNRPFDLDEAVVRRLPRRLMVNLPDAPNREKIIRVILAKEELASDVDLE  895

Query  3549  AIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLN  3728
              IANM +GYSGSDLKNLCVTAAHCPIREILEKEKKE+ALA++ENR  P L++S D+RPL 
Sbjct  896   GIANMADGYSGSDLKNLCVTAAHCPIREILEKEKKERALALAENRASPPLYSSVDVRPLK  955

Query  3729  MDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             MDDF+YAHEQVCASVSSESTNM ELLQWNELYGEGGSRK+K+LSYFM
Sbjct  956   MDDFKYAHEQVCASVSSESTNMNELLQWNELYGEGGSRKRKSLSYFM  1002



>ref|XP_010542857.1| PREDICTED: uncharacterized protein LOC104815931 isoform X1 [Tarenaya 
hassleriana]
Length=1255

 Score =  1457 bits (3771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 779/1182 (66%), Positives = 928/1182 (79%), Gaps = 40/1182 (3%)
 Frame = +3

Query  381   PEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNS  560
             P+A    E LV+P   G+  +D +K KA        KKR  K+     WGKLLSQ  QN 
Sbjct  95    PDADTEAEVLVTPTAAGEVLVDAEKPKAV-------KKRAGKA----PWGKLLSQCSQNP  143

Query  561   HVPLDQSTFTVGQGRQCDLCVDDPSV-SKSLCNLKHIQREKGN-SITLLEISGKKGCVQV  734
             H  +    FTVG+ R CDLC+ DPS+ S +LC L+  Q E+G+ S   LEI G  G VQV
Sbjct  144   HRVMKSPVFTVGR-RGCDLCIKDPSMPSTTLCELR--QTEQGDASAGSLEIMGNGGIVQV  200

Query  735   NGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKG  914
             NGK Y + + + L GGDE++F  SGKHAYIFQ   +++++A  +   +SILEA S P+KG
Sbjct  201   NGKNYERKANIHLRGGDELVFSPSGKHAYIFQPLKDDNLAARDIASPLSILEAQSAPLKG  260

Query  915   VNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGE--P  1088
             ++ E R+GDPS V  AS LASLS+  +  LL  P      + +Q PE+P +P +  +  P
Sbjct  261   IHVETRAGDPSAVDGASILASLSDYHRFPLL--PPTAKRAEGQQNPEVPGVPSSYSDCIP  318

Query  1089  DKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAID-SYDGEIGKVTGAPQE  1265
             D    D+D  +  DH  +   EK+ A +  + N+NL  +   ++   +   G V  +  E
Sbjct  319   DVDMTDADCSN--DHAAIASTEKTVASTSSAANNNLKADGSGMNPCQENGGGCVPLSAYE  376

Query  1266  LRPLIRMLAGSSTPEFDLSGNISRIID-QR--RELLKDFDPLIS--MSTRRQAFKDGLQQ  1430
             +RP++R+    S+ EFDL G+IS+I+D QR  RELLK+FD L S  +STRRQA+KD LQ 
Sbjct  377   IRPVLRLFRDPSSSEFDLRGSISKILDDQREVRELLKEFD-LSSALLSTRRQAYKDSLQA  435

Query  1431  TILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGP  1607
              +L+  N++VS E FPY+LS  TK+VLIASTY+H+KC NKFVK AS+L T+CPRILLSGP
Sbjct  436   GVLNPENLDVSLESFPYFLSTATKDVLIASTYVHMKCGNKFVKYASDLSTLCPRILLSGP  495

Query  1608  AGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS--AKELDPV--KEAPKPERTGVFTKR  1775
             AGSEIYQE L KALAK+FGA+L++VDSL+LPGGS  AKE+D    KE+ + ER  V  KR
Sbjct  496   AGSEIYQEMLTKALAKHFGAKLMIVDSLLLPGGSSIAKEMDSSNPKESYRRERLSVLAKR  555

Query  1776  A---AQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVG  1943
             A   AQAA L+ ++KP SSVEADITGGS +SS A  KQE STA+SK+ TFKTGDRVK+VG
Sbjct  556   AIQVAQAAALQ-HRKPTSSVEADITGGSTLSSQAFPKQEVSTATSKSYTFKTGDRVKFVG  614

Query  1944  PLPTGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFF  2123
             P  +  SLQ P RGPA G++GKV+LAFE NG SKIGVRFDRSIP+GNDLGGLCEEDHGFF
Sbjct  615   P-SSALSLQGPLRGPAIGFQGKVVLAFEGNGSSKIGVRFDRSIPDGNDLGGLCEEDHGFF  673

Query  2124  CAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKL  2303
             C A  LRLD+S+ D+ DKLAINE+FEV   E +  PLILF+KDIEKS+VGN + ++  K 
Sbjct  674   CTASSLRLDSSTSDNADKLAINEIFEVAFGESERCPLILFLKDIEKSLVGNNDVYATLKS  733

Query  2304  KLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKE  2483
             KLE LPEN+VVIAS TQ DNRKEKSHPGGFLFTKFGSNQTALLDLAF DNFGRLHDRSKE
Sbjct  734   KLENLPENIVVIASQTQLDNRKEKSHPGGFLFTKFGSNQTALLDLAFSDNFGRLHDRSKE  793

Query  2484  TPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELD  2663
              PK++KQ+TRLFPNKV IQ+PQDE LL +WK++L+RD E +KSQ+N  +IR VL+R  L 
Sbjct  794   MPKSMKQITRLFPNKVAIQLPQDEALLLEWKEKLERDTEILKSQANITSIRVVLSRNRLA  853

Query  2664  CPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQG  2843
             CP++E+L  KDQ L +ESVEKI+GWALSHHFMH SE + K+ KL IS+ES+ +GL++L G
Sbjct  854   CPELESLAFKDQTLPHESVEKIVGWALSHHFMHFSEPTIKDNKLVISAESVSFGLNILDG  913

Query  2844  VQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPL  3023
             +QNE+KSVKKSLKDVVTENEFEKKLL+DVIPPSDIGV+FDDIGALENVKDTLKELVMLPL
Sbjct  914   IQNESKSVKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKDTLKELVMLPL  973

Query  3024  QRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  3203
             QRPELF KGQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE
Sbjct  974   QRPELFGKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGE  1033

Query  3204  KYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKER  3383
             KYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKD+ER
Sbjct  1034  KYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMINWDGLRTKDRER  1093

Query  3384  VLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANM  3563
             VLVLAATNRPFDLDEAVIRRLPRRLMV+LPDA NRE+IL +IL KEE+A +VDL+AIANM
Sbjct  1094  VLVLAATNRPFDLDEAVIRRLPRRLMVDLPDAANRERILGVILAKEEMASDVDLEAIANM  1153

Query  3564  TEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFR  3743
             T GYSGSDLKNLCVTAAH PIRE+LEKEKKEK  A++E R  P L+ SSDIRPL M+DF+
Sbjct  1154  TNGYSGSDLKNLCVTAAHLPIRELLEKEKKEKVEAVAEKREFPPLYKSSDIRPLMMNDFK  1213

Query  3744  YAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
              AHEQVCASVSSES+NM EL QWNELYGEGGSRKK +LSYFM
Sbjct  1214  VAHEQVCASVSSESSNMNELQQWNELYGEGGSRKKTSLSYFM  1255



>ref|XP_009414468.1| PREDICTED: uncharacterized protein LOC103995579 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1247

 Score =  1455 bits (3767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 762/1144 (67%), Positives = 922/1144 (81%), Gaps = 29/1144 (3%)
 Frame = +3

Query  492   KRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQ  671
             KR +K+    AW KL+SQ+ QN H+ L  S F+VGQ R C+L + DPS+SK LC L+H Q
Sbjct  115   KRVVKATQKAAWAKLISQHSQNPHLFLSGSQFSVGQSRSCNLWLKDPSISKILCRLRHSQ  174

Query  672   REKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDI  851
             R  G S+  LEI G+KG VQVNGK + +NS + L GGDE+IF SSGKHAYIFQ+  N D 
Sbjct  175   R-GGASVAFLEIVGRKGIVQVNGKTFERNSNIILTGGDELIFSSSGKHAYIFQQLKN-DK  232

Query  852   SAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCND  1031
             SA ++ PS+ + E+    ++    E R+GDPS V  AS LASLSN  K+L  +PP+  N 
Sbjct  233   SATAVLPSLGVQESKGTAIRESQTETRTGDPSAVTGASILASLSNDLKDLSAIPPA-SNA  291

Query  1032  NDIKQGPEMPALP---VASG----EPDKHDLDSDM----KDVSDHNDVPLDEKSGAISPD  1178
              + ++G E PAL    +AS     +P+K   DSD      +    +++  D     +S D
Sbjct  292   ENAQEGLENPALASMTIASDGCNPDPEK---DSDTCKESSETEGSSEIRSDNADAVMSSD  348

Query  1179  -SGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQR  1352
                N+ +  EN   D++ D EIGKV G   E+RPL+RM +GS     DLSGN+ ++ + +
Sbjct  349   LRVNEPVQPENIQPDAHPDAEIGKVPGTNSEIRPLLRMFSGSPISGLDLSGNVFKVFEDQ  408

Query  1353  RELLKDFDPLISM-STRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYI  1529
             RELLKD D   S+ +TR QAFKDGL+Q IL+ N+I VSFE FPYYLSE TK+VL++  +I
Sbjct  409   RELLKDLDLPSSLPTTRCQAFKDGLKQGILNPNDINVSFETFPYYLSENTKSVLMSCAFI  468

Query  1530  HLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS  1709
             HL+C +FVK  +++ +V  RILLSGP GSEIYQETL KALAK+FGARLL++DSL+LPG  
Sbjct  469   HLECKEFVKYTTDISSVNHRILLSGPTGSEIYQETLVKALAKHFGARLLIIDSLLLPG--  526

Query  1710  AKELDPVKEAPKPERTGVFTK-RAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEA  1886
               + + +KE  + E++ +F+K RAA A  ++  KKPASSVE DI G S +++ +  KQEA
Sbjct  527   --DAELLKEGARIEKSSIFSKHRAALADAIQL-KKPASSVETDIVGASTLNTQSLPKQEA  583

Query  1887  STASSKN-TFKTGDRVKYVGPLPT-GFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRF  2060
             STASSKN TFK GDRV+YVG +P+ GF LQTP RGP YGY+GKV+LAFEENG SK+GVRF
Sbjct  584   STASSKNYTFKEGDRVRYVGSMPSSGFPLQTPQRGPNYGYRGKVVLAFEENGSSKVGVRF  643

Query  2061  DRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLIL  2240
             D+ IPEGNDLGGLCEEDHGFFC AD LR D S  +D+++LA NEL EVV +E K+ PLI+
Sbjct  644   DKQIPEGNDLGGLCEEDHGFFCTADLLRPDFSGSEDVERLAANELLEVVLEESKNGPLIV  703

Query  2241  FVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQ  2420
              +KDIEKSM G+ +++   K KLE +P  V++I S++Q DNRKEKSHPGG LFTKFGSNQ
Sbjct  704   LIKDIEKSMAGSTDSYITLKSKLELMPVGVLIIGSHSQIDNRKEKSHPGGLLFTKFGSNQ  763

Query  2421  TALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIE  2600
             TALLD AFPDNFGRLH+RSKE PK +KQL+RLFPNKV+IQ+PQ+ET LS+WKQ LDRD+E
Sbjct  764   TALLDFAFPDNFGRLHERSKEIPKTMKQLSRLFPNKVLIQLPQEETQLSEWKQHLDRDVE  823

Query  2601  TMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHS-SESS  2777
             T+K++SN ++IR+ LNR  LDC D+ET+ IKDQALTNESV+K++G+ALS+H  HS +E+S
Sbjct  824   TLKAKSNVLSIRSFLNRCGLDCNDLETISIKDQALTNESVDKVVGFALSYHLKHSRTEAS  883

Query  2778  TKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVT  2957
             +K+ KL +SSES+++GLS+LQ VQN+ KS+KKSLKDVVTENEFEK+LL DVIPP+DIGVT
Sbjct  884   SKDAKLMLSSESLKHGLSMLQSVQNDNKSIKKSLKDVVTENEFEKRLLTDVIPPNDIGVT  943

Query  2958  FDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATE  3137
             FDDIGALENVK+TLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATE
Sbjct  944   FDDIGALENVKETLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATE  1003

Query  3138  AGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEA  3317
             AGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSV+FVDEVDSMLGRRE+PGEHEA
Sbjct  1004  AGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVIFVDEVDSMLGRRENPGEHEA  1063

Query  3318  MRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKI  3497
             MRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPD  NREKI
Sbjct  1064  MRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDTSNREKI  1123

Query  3498  LRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSE  3677
             LR+IL+KEELAP+VDL+A+ANMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE+ LA++E
Sbjct  1124  LRVILSKEELAPDVDLEALANMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERNLALAE  1183

Query  3678  NRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKAL  3857
              R LP L+ S D+RPLNM+DF+YAHEQVCASVSSES+NM+ELLQWNELYGEGGSRKKKAL
Sbjct  1184  GRTLPTLYGSEDVRPLNMEDFKYAHEQVCASVSSESSNMSELLQWNELYGEGGSRKKKAL  1243

Query  3858  SYFM  3869
             SYFM
Sbjct  1244  SYFM  1247



>ref|XP_010914430.1| PREDICTED: uncharacterized protein LOC105039839 isoform X1 [Elaeis 
guineensis]
Length=1250

 Score =  1454 bits (3763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 767/1147 (67%), Positives = 917/1147 (80%), Gaps = 23/1147 (2%)
 Frame = +3

Query  474   ALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  653
             AL   KKR  K     AW KLLSQ  QN H+ +    FTVGQ   C+L + D S+S++LC
Sbjct  112   ALELPKKRVKKVQPKAAWAKLLSQSSQNPHLVICGYQFTVGQSPTCNLSLKDSSISRTLC  171

Query  654   NLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQK  833
              LK+++RE G    LLEI GKKG VQVNGKI  KNS   L GGDEV+F SSGKHAYIF  
Sbjct  172   KLKYLERE-GPPGALLEIVGKKGIVQVNGKIIEKNSPTVLMGGDEVVFSSSGKHAYIFLP  230

Query  834   FTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllP  1013
              TN+ ++A +   +  ILEA + P+KG+ FE RSGDPS VA AS LASLSN KK+L   P
Sbjct  231   LTNDKLTAPASSSAFGILEAQAVPIKGIQFETRSGDPSAVAGASILASLSNHKKDLS--P  288

Query  1014  PSVCNDNDIKQGPEMPALPVASGEPD--KHDLDSDM---KDVSDHN---DVPLDEKSGAI  1169
             P+   +N   QG + PALP A   P     DL+ +    K  ++H+   +VP  +K+  I
Sbjct  289   PASTGEN-AHQGVDGPALPSACDVPKGCNSDLEKNCDARKGNTEHDGSTEVPSGDKAAVI  347

Query  1170  -SPD-SGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRII  1343
              S D   N++   +    D+   + GKV+G   E+RPL++M+AGSST E DL+G + ++ 
Sbjct  348   LSTDLCANESTQHDTIGSDAQLDDFGKVSGTNYEIRPLLKMIAGSSTAELDLTGKVFKVF  407

Query  1344  DQRRELLKDFDPLISM-STRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIAS  1520
             + +RELL+D D   ++ +TR QAFKDGL+  I+++N+I+VSF  FPYYLSE TKNVL++ 
Sbjct  408   EDQRELLRDLDATAALPATRCQAFKDGLKLGIINANDIQVSFASFPYYLSENTKNVLLSC  467

Query  1521  TYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLP  1700
              YIHL+   F+K A+++ +V  RILL+GP GSEIYQETL KALAK+FGA LL++DSL+LP
Sbjct  468   GYIHLERKDFIKYATDISSVNQRILLTGPTGSEIYQETLVKALAKHFGASLLIIDSLLLP  527

Query  1701  GGSA-KELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTK  1877
             GGS+ K+ + +K+  + E+   F+KRAA   VL   +KP S VEADI G S ++SH+  K
Sbjct  528   GGSSTKDSESLKDGGRIEKASFFSKRAA---VLDL-RKPTSGVEADIMGTSMLNSHSLPK  583

Query  1878  QEASTASSKN-TFKTGDRVKYVGPLPT-GFSLQTPARGPAYGYKGKVLLAFEENGFSKIG  2051
             QEASTASSKN TFK GDRV+YVG +P+ GF LQ P RGP YGY+GKV+LAFEENG SKIG
Sbjct  584   QEASTASSKNYTFKEGDRVRYVGTVPSSGFPLQAPQRGPNYGYRGKVVLAFEENGASKIG  643

Query  2052  VRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSP  2231
             VRFD+ IP+GNDLGGLCEEDHGFFC AD LR D S  +D ++LAINEL EVVS+E K+ P
Sbjct  644   VRFDKQIPDGNDLGGLCEEDHGFFCTADLLRPDFSGGEDSERLAINELLEVVSEESKNGP  703

Query  2232  LILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFG  2411
             LI+ +K+IEKSM G  + +   + KL+ +P  V++I S+TQ DNRKEKSHPGG LFTKFG
Sbjct  704   LIILIKEIEKSMAGGTDTYLTLRSKLDLMPAGVLIIGSHTQIDNRKEKSHPGGLLFTKFG  763

Query  2412  SNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDR  2591
             SNQTALLD AFPDNFGRLH+RSKE PK +KQLTRLFPNKV IQ+PQDE  L DWKQQLDR
Sbjct  764   SNQTALLDFAFPDNFGRLHERSKEIPKTMKQLTRLFPNKVSIQLPQDEAQLLDWKQQLDR  823

Query  2592  DIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHF-MHSS  2768
             D+ET+K++SN ++IR+ LNR  LDC D+ET+ IKDQ L+NE+V+KI+G+ALSHH  ++  
Sbjct  824   DVETLKAKSNILSIRSFLNRSGLDCNDLETISIKDQTLSNENVDKIVGFALSHHLKINKI  883

Query  2769  ESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDI  2948
             E+S K+ KL +SS+SI++GLS+LQ +QN+TKS KKSLKDVVTENEFEK+LLADVIPP+DI
Sbjct  884   EASAKDAKLVLSSDSIKHGLSMLQSIQNDTKSTKKSLKDVVTENEFEKRLLADVIPPNDI  943

Query  2949  GVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAV  3128
             GVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAV
Sbjct  944   GVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAV  1003

Query  3129  ATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGE  3308
             ATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGE
Sbjct  1004  ATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGE  1063

Query  3309  HEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR  3488
             HEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR
Sbjct  1064  HEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR  1123

Query  3489  EKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekala  3668
              KILR+IL KEELAP+VDL+A+ANMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE+ LA
Sbjct  1124  VKILRVILAKEELAPDVDLEALANMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERILA  1183

Query  3669  iSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKK  3848
             ++E  PLPALH   DIRPL+M+D +YAHEQVCASVSSESTNM+ELLQWNELYGEGGSRKK
Sbjct  1184  LAEGSPLPALHGCDDIRPLSMEDMKYAHEQVCASVSSESTNMSELLQWNELYGEGGSRKK  1243

Query  3849  KALSYFM  3869
              ALSYFM
Sbjct  1244  TALSYFM  1250



>ref|XP_009391006.1| PREDICTED: uncharacterized protein LOC103977266 [Musa acuminata 
subsp. malaccensis]
Length=1243

 Score =  1443 bits (3736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 781/1214 (64%), Positives = 942/1214 (78%), Gaps = 33/1214 (3%)
 Frame = +3

Query  291   PESAEQEIRSADLDGASAL--KSPEAPVPEKLP-EAPLGGEPLVSPMILGDSAIDVDKVK  461
             P   E+E  +AD   A+ L  ++ +A V ++ P +AP  G P+  P      A+ V++ K
Sbjct  42    PVPKEEETPAADDQPAANLPAEAGDADVQDEKPVDAPGQGSPVQLPA--QKRAVKVERRK  99

Query  462   ANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVS  641
                 A     KR +K+   TAW KL+SQ+ Q  H+ L  S F+VGQ   C+LC+ DPSVS
Sbjct  100   LEVPA-----KRVVKAKQKTAWAKLISQHSQYPHIFLSGSRFSVGQSPSCNLCMKDPSVS  154

Query  642   KSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAY  821
             K+LC L+H QR  G S  LLE+ G+KG VQVNGK + +NS + +  GDEVIF  SGKHAY
Sbjct  155   KTLCRLRHTQR-GGASGALLEVVGRKGFVQVNGKTFERNSNIVITAGDEVIFSPSGKHAY  213

Query  822   IFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkel  1001
             I+Q+  NE  + A +  S+ I E      K +  E RSGD S VA AS LASLSN  K+L
Sbjct  214   IYQQLKNEKSATAMLQSSLDISELKGFSAKEIQIETRSGDSSAVAGASILASLSNNMKDL  273

Query  1002  lllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSD------HND----VPLD  1151
               +PP+  N  + ++G E P L  AS      D   D++  SD       ND    VP D
Sbjct  274   SAIPPA-SNAENAQEGLEKPVL--ASVCDASEDCSPDLEKGSDILKETFENDGGAVVPSD  330

Query  1152  EKSGAISPDSG-NDNLNLEN-GAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSG  1325
                   S D G N+ +  +N G     D +IGK +    E+R  IR  AGS + E DL+G
Sbjct  331   NTDAVTSSDLGANETIQHDNIGPHAHLDDDIGKNSSINYEIRSGIRTFAGSPSSEMDLTG  390

Query  1326  NISRIIDQRRELLKDFDPLISM-STRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITK  1502
             N+ ++I+ +RELLKD D   S+ +TR QAFKDGL+  ILDS +I+VSFE FPYYLSE TK
Sbjct  391   NVFKVIEDQRELLKDVDLPASLPTTRCQAFKDGLKHGILDSGDIQVSFERFPYYLSENTK  450

Query  1503  NVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVV  1682
             NVLI+  +IHL+C +F+K   ++ +V  RILLSGP GSEIYQETL KALAK+FG RLL++
Sbjct  451   NVLISCAFIHLECKEFIKYTMDISSVNHRILLSGPTGSEIYQETLVKALAKHFGVRLLII  510

Query  1683  DSLVLPGGSA-KELDPVKEAPKPERTGVFTK-RAAQAAVLRFNKKPASSVEADITGGSAI  1856
             D+L+LP GS+ K+ + +KE+ + E++ +F+K RAA    L+  +KPASSVEADI G S +
Sbjct  511   DTLLLPTGSSLKDAELLKESVRMEKSAIFSKHRAAVIDTLQL-RKPASSVEADIVGTSTL  569

Query  1857  SSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPT-GFSLQTPARGPAYGYKGKVLLAFEE  2030
             +S +  KQE STASSK  TFK GDRV+YVG +P+ GF LQ   RGP YGY+GKV+LAFEE
Sbjct  570   NSQSLPKQETSTASSKTYTFKEGDRVRYVGSIPSSGFPLQASQRGPNYGYRGKVVLAFEE  629

Query  2031  NGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVS  2210
             NG SKIGVRFD+ IPEGNDLGGLCEEDHGFFC AD LR D S  +D+ +LA+NEL EVV 
Sbjct  630   NGSSKIGVRFDKQIPEGNDLGGLCEEDHGFFCTADLLRPDFSGGEDVGRLAVNELLEVVL  689

Query  2211  QECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGG  2390
             +E KS PLI+ +KDIEKSM G+ ++++  K KLE +P+ V++I  ++Q DNRKEKSHPGG
Sbjct  690   EERKSGPLIVLLKDIEKSMSGSTDSYATLKNKLEFMPQGVLIIGLHSQVDNRKEKSHPGG  749

Query  2391  FLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSD  2570
              LFTKFGSNQTALLDLAFPDNFGRLH+RSKE PK +KQL+RLFPNKV+IQ+PQDET LS+
Sbjct  750   LLFTKFGSNQTALLDLAFPDNFGRLHERSKEIPKTMKQLSRLFPNKVVIQLPQDETQLSE  809

Query  2571  WKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSH  2750
             WKQQLDRD+ET+K++SN +++R+ LNR  LDC DIET+ IKDQALTNESV+K++G+ALS+
Sbjct  810   WKQQLDRDVETLKAKSNVLSLRSFLNRCGLDCNDIETVSIKDQALTNESVDKVVGFALSY  869

Query  2751  HFMHS-SESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLAD  2927
             H  HS +E+ +K+ KL +S+ES+++GLS+LQ  QN+ KS+KKSLKDVVTENEFEK+LLAD
Sbjct  870   HVKHSRNEALSKDAKLILSNESLKHGLSMLQSFQNDNKSLKKSLKDVVTENEFEKRLLAD  929

Query  2928  VIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGK  3107
             VIPP+DIGVTFDDIGALENVK+TLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGK
Sbjct  930   VIPPNDIGVTFDDIGALENVKETLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGK  989

Query  3108  TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLG  3287
             TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSV+FVDEVDSMLG
Sbjct  990   TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVIFVDEVDSMLG  1049

Query  3288  RRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVN  3467
             RRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVN
Sbjct  1050  RRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVN  1109

Query  3468  LPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReileke  3647
             LPDA NREKILR+IL+KEELAP VDL+  ANMT+GYSGSDLKNLCVTAAHCPIREILEKE
Sbjct  1110  LPDALNREKILRVILSKEELAPGVDLEVFANMTDGYSGSDLKNLCVTAAHCPIREILEKE  1169

Query  3648  kkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYG  3827
             KKEK LAI+E RPLP L+ S D+RPLNM+DF+YAHEQVCASVSSES+NM+EL QWNELYG
Sbjct  1170  KKEKNLAIAEGRPLPTLYASEDVRPLNMEDFKYAHEQVCASVSSESSNMSELQQWNELYG  1229

Query  3828  EGGSRKKKALSYFM  3869
             EGGSRKKKALSYFM
Sbjct  1230  EGGSRKKKALSYFM  1243



>ref|XP_010684533.1| PREDICTED: uncharacterized protein LOC104899096 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1236

 Score =  1432 bits (3706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 762/1202 (63%), Positives = 925/1202 (77%), Gaps = 41/1202 (3%)
 Frame = +3

Query  309   EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  488
             E+ SADL    ++K  +   P+K P          + + L D+ +D    K   SAL   
Sbjct  61    EVGSADLPPTDSIKPSDLNFPDKFPSVE-------AKVALEDAVVDEKDTK---SAL---  107

Query  489   KKRQLKSNLGT---AWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNL  659
             K+++LK N+ +   AW +L+SQ+ +N H  +  S FTVG GRQCDL ++DPS+SK LC L
Sbjct  108   KRQRLKKNIKSEQPAWAQLISQFSENPHEFVRGSQFTVGHGRQCDLWLNDPSISKMLCKL  167

Query  660   KHIQREKGNSITLLEISGKKGCVQVNGKIYPKNST-VPLNGGDEVIFGSSGKHAYIFQKF  836
             +  +R   +SI  LEI+G KG VQVNGK + K+S+ + L GGDE+IFGS GK+AYI Q+ 
Sbjct  168   QRTER-GASSIIKLEITGGKGSVQVNGKAHHKSSSPLTLTGGDELIFGSVGKYAYILQQL  226

Query  837   TNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTl--aslsnlkkellll  1010
             + + ++A  +P S++ILEAHS P  G + +AR  D S+ AVA     ASLS   K L  L
Sbjct  227   SMDTLAAPGLPSSLAILEAHSAPDTGKDTKARGRDSSSSAVAGASILASLSTFSKRLSRL  286

Query  1011  PPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKD---VSDHNDVPLDEKSGAISPDS  1181
             PPS  ND D        A+   SG  D    D DM D   + D+ D  L++K   + P S
Sbjct  287   PPSRGNDED-------SAMASLSGASDNGICDVDMNDSLELEDYRDASLNQKE--VCPVS  337

Query  1182  GNDNLNLENGAIDS-YDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIID---Q  1349
              ++N+N+ + A D+  + E G V G   ELRPL+++LA SST +FD SG++S++++   Q
Sbjct  338   -DENMNIVDVAKDTGLNTEEGLVPGTNSELRPLLQLLARSSTSDFDFSGSLSKLLEEQRQ  396

Query  1350  RRELLKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYI  1529
              RELLKD D    +STRRQAFKD L++ IL + +I+VS E FPYYLSE TKN+L+A+ ++
Sbjct  397   LRELLKDLDRPTLVSTRRQAFKDTLRKAILAACDIDVSLESFPYYLSENTKNLLVAAAFM  456

Query  1530  HLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS  1709
              LKC+  VK  S+L TV PRILLSGPAGSEIYQETLAKALAK+F A+LLVVDSL+LPG +
Sbjct  457   PLKCSHMVKFVSDLSTVSPRILLSGPAGSEIYQETLAKALAKHFSAKLLVVDSLLLPGST  516

Query  1710  AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEAS  1889
              KE D  +E  +PE+  +  KR++  A LR +KK ASSVEADIT GSA+ +    KQEAS
Sbjct  517   VKEADSSREHSRPEKASIHAKRSSVVASLR-HKKQASSVEADITNGSALLAQRLPKQEAS  575

Query  1890  TASSKN-TFKTGDRVKYVGPLPTGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDR  2066
             TASSK  TFK GDRVK+VG +P+G     P RGPAYG +GKV+L F+EN  SKIGVRFD 
Sbjct  576   TASSKKYTFKEGDRVKFVGSMPSGVPPLLPLRGPAYGNRGKVVLVFKENQSSKIGVRFDN  635

Query  2067  SIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFV  2246
             SIPEGN+LGG CE DHGFFCA D L L+NS  DD D+LA+NE+FEV   ECK+ P+IL++
Sbjct  636   SIPEGNNLGGRCETDHGFFCAGDLLCLENSGGDDADRLAVNEIFEVAKDECKNGPMILYL  695

Query  2247  KDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTA  2426
             KD+EK M GNP+A+   K KLE LPE ++VIAS+TQ D+RKEKSHPGG LFTKFGSN TA
Sbjct  696   KDMEKCMAGNPDAYGELKSKLENLPEKLIVIASHTQADSRKEKSHPGGLLFTKFGSNHTA  755

Query  2427  LLDLAFPDNFGRLHDRS-KETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIET  2603
             LLD AFPDNF R+ DR+ K+T K +KQLTRLF N+V IQ+PQDE LL +WKQ+L+RD ET
Sbjct  756   LLDFAFPDNFNRMSDRNNKDTSKTMKQLTRLFTNRVTIQMPQDENLLLEWKQKLERDTET  815

Query  2604  MKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTK  2783
             +K+QSN V+IR+VL RV ++C DIETL IKDQ L++E+ +K+IGWAL+HHFM+ +E+S  
Sbjct  816   LKAQSNIVSIRSVLTRVGIECHDIETLSIKDQTLSSENADKVIGWALTHHFMNGAEASLS  875

Query  2784  EGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFD  2963
             + K+ ISSESI +GL++L GVQNETKS KKSLKDV TENEFEKKLL DVIP S+IGVTFD
Sbjct  876   DSKVVISSESIMHGLNILHGVQNETKSTKKSLKDVATENEFEKKLLVDVIPASEIGVTFD  935

Query  2964  DIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAG  3143
             DIGAL+NVKDTLKELVMLPLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAG
Sbjct  936   DIGALDNVKDTLKELVMLPLQRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAG  995

Query  3144  ANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMR  3323
             ANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMR
Sbjct  996   ANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMR  1055

Query  3324  KMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR  3503
             KMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMV LPD  NR+KIL 
Sbjct  1056  KMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVGLPDVANRQKILS  1115

Query  3504  IILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENR  3683
             +IL KEELA +VDL  +ANMT+GYSGSDLKNLCVTAA+CPIREILE EKKEKALAI+ENR
Sbjct  1116  VILAKEELAADVDLAVVANMTDGYSGSDLKNLCVTAAYCPIREILETEKKEKALAIAENR  1175

Query  3684  PLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSY  3863
               P L++  D+RPLNM DF+YA EQVCAS S+ESTNM+EL+QWNELYGEGGSRKK +LSY
Sbjct  1176  S-PVLYSGDDVRPLNMSDFKYAQEQVCASFSAESTNMSELVQWNELYGEGGSRKKSSLSY  1234

Query  3864  FM  3869
             FM
Sbjct  1235  FM  1236



>ref|XP_003591553.1| Katanin p60 ATPase-containing subunit [Medicago truncatula]
Length=1229

 Score =  1431 bits (3705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 781/1239 (63%), Positives = 934/1239 (75%), Gaps = 54/1239 (4%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADL-----DGASALKSPEAPVP  371
             KRSK ++++SS  +     +P  VNESG    E+E R +DL     DG +          
Sbjct  27    KRSKVSKNVSSKVN----PSP-LVNESG----ERERRPSDLSEMAVDGNN----------  67

Query  372   EKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYP  551
             +K    P   E LVSP        +  KV      L+R KKR  KSN  +AWGKL+SQ+ 
Sbjct  68    DKSSSLPNEDEALVSPPQCIGQIAEKSKVLP---PLSRSKKRCTKSNSKSAWGKLISQFS  124

Query  552   QNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQ  731
             +N H+P+    +TVGQ RQC+L + DPSVS  LC L HI+   G+S+ LLEI G  G V+
Sbjct  125   ENPHLPMCDPIYTVGQCRQCNLWLKDPSVSNVLCKLSHIEH-GGSSVALLEIIGNCGAVK  183

Query  732   VNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVK  911
             VNGK+  K S   L+GGDEV+FG SGK AYIFQ+  N +I+ A++P  V+ILEA    + 
Sbjct  184   VNGKMCGKKSRHILSGGDEVVFGVSGKQAYIFQQLNN-NITTANIPSPVTILEAQGASIT  242

Query  912   GVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPD  1091
             G   +ARSGD S+VA AS LAS S L ++L ++ PS     +++Q  ++ +LP  +G+ D
Sbjct  243   GTQLDARSGDLSSVAGASILASFSELNEDLSMISPSSNTSKNMQQKTDVSSLPAGNGD-D  301

Query  1092  KHDLDSDMKDVSDHND-VPLDEKSGAISPDSGNDNLNLENGAIDS-YDGEIGKVTGAPQE  1265
             K + D     ++D  D V   E++G  S  + N++ N+    +++  D ++GK+T A  +
Sbjct  302   KANTDMKHNIINDEPDRVFSAEETGLPSSTTVNEDPNVVAVEVNAGVDADVGKMTAASCK  361

Query  1266  LRPLIRMLAGSSTPEFDLSGNISRIIDQRREL---LKDFD-PLISMSTRRQAFKDGLQQT  1433
             LRPL+  L+GS  PEFDLSGNI++I+++R+EL   LKD D P I  S ++QA KD LQ  
Sbjct  362   LRPLLHKLSGS-CPEFDLSGNIAKILEERKELKELLKDVDTPTILTSPKQQALKDSLQMR  420

Query  1434  ILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAG  1613
             IL++ NI+VSFE FPYYLS+ TKNVLI S YIHLKCN   K  SELP++ PRILLSGPAG
Sbjct  421   ILNAENIDVSFESFPYYLSDTTKNVLITSAYIHLKCNGSGKYVSELPSLSPRILLSGPAG  480

Query  1614  SEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKP--ERTGVFTKRAAQA  1787
             S I        LA  +  RL       +     KE+D  KE P P  ERT +FTKR+  A
Sbjct  481   SPII-------LALKYIRRLCQRHLQNILRTPLKEVDSTKEIPIPRTERTSMFTKRSTPA  533

Query  1788  AVLRF-NKKPASSVEADITGGSAISSHAQTKQEASTASSKNT-FKTGDRVKYVGPLPTGF  1961
             A +   +KKPASSV+A I GGS  SS A  KQE STASSK + FKTGDRVKYVG  P+  
Sbjct  534   ATIHIQHKKPASSVDAQIIGGSTSSSQAVLKQEVSTASSKGSAFKTGDRVKYVGDFPSAA  593

Query  1962  SLQT--PARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAAD  2135
             S     P+RGP+YG +GKVLLAFE NG SKIGVRF++SIP+GNDLGGLCE+D GFFC+A+
Sbjct  594   SSPQVFPSRGPSYGCRGKVLLAFENNGSSKIGVRFEKSIPDGNDLGGLCEDDRGFFCSAN  653

Query  2136  FLRL-DNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLE  2312
              L L D    DD  K+AINE+FE+ S   KS  L+L +KDIEK + GN E     K K  
Sbjct  654   HLVLVDGCGGDDSGKVAINEIFEIASSLSKSGALVLLIKDIEKGVAGNSEVL---KSKFA  710

Query  2313  KLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPK  2492
              LP+NVVVI S+   DNRKEK+ PG  LFTKFG NQTALLDLAFPDNF RLHDRSKETPK
Sbjct  711   SLPQNVVVIGSHIHPDNRKEKTQPGSLLFTKFGGNQTALLDLAFPDNFTRLHDRSKETPK  770

Query  2493  AIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPD  2672
              +KQL R FPNKV IQ+PQDE LLSDWKQ L+RD+ETMK+QSN V+IR VLN+  LDCP+
Sbjct  771   VMKQLNRFFPNKVTIQLPQDEALLSDWKQHLERDVETMKAQSNVVSIRLVLNKFGLDCPE  830

Query  2673  IETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQN  2852
             +ETL IKDQ LT E+VEKIIGWA+S+HFMHSSE+ST+E K  IS+ESI+YG ++LQG+QN
Sbjct  831   LETLSIKDQTLTTENVEKIIGWAISYHFMHSSEASTEESKPVISAESIQYGFNILQGIQN  890

Query  2853  ETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRP  3032
             E KSVKKSLKDVVTENEFEKKLL DVIPP+DIGV+F+DIGALENVKDTLKELVMLPLQRP
Sbjct  891   ENKSVKKSLKDVVTENEFEKKLLGDVIPPTDIGVSFNDIGALENVKDTLKELVMLPLQRP  950

Query  3033  ELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYV  3212
             ELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYV
Sbjct  951   ELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYV  1010

Query  3213  KAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLV  3392
             KAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD+ERVLV
Sbjct  1011  KAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDRERVLV  1070

Query  3393  LAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEG  3572
             LAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKI+R+IL KEELAP+VDL+A+ANMT+G
Sbjct  1071  LAATNRPFDLDEAVIRRLPRRLMVNLPDAANREKIMRVILAKEELAPDVDLEALANMTDG  1130

Query  3573  YSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAH  3752
             YSGSDLKNLCVTAAHCPIREILEKEKKE+  A++EN+PLP L +S+DIRPL ++DF+YAH
Sbjct  1131  YSGSDLKNLCVTAAHCPIREILEKEKKERTSALAENKPLPRLCSSADIRPLKIEDFKYAH  1190

Query  3753  EQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             EQVCASVSS+STNMTELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1191  EQVCASVSSDSTNMTELLQWNDLYGEGGSRKKTSLSYFM  1229



>ref|XP_003591554.1| Katanin p60 ATPase-containing subunit [Medicago truncatula]
Length=1211

 Score =  1429 bits (3700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 781/1240 (63%), Positives = 932/1240 (75%), Gaps = 74/1240 (6%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADL-----DGASALKSPEAPVP  371
             KRSK ++++SS  +     +P  VNESG    E+E R +DL     DG +          
Sbjct  27    KRSKVSKNVSSKVN----PSP-LVNESG----ERERRPSDLSEMAVDGNN----------  67

Query  372   EKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYP  551
             +K    P   E LVSP        +  KV      L+R KKR  KSN  +AWGKL+SQ+ 
Sbjct  68    DKSSSLPNEDEALVSPPQCIGQIAEKSKVLP---PLSRSKKRCTKSNSKSAWGKLISQFS  124

Query  552   QNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQ  731
             +N H+P+    +TVGQ RQC+L + DPSVS  LC L HI+   G+S+ LLEI G  G V+
Sbjct  125   ENPHLPMCDPIYTVGQCRQCNLWLKDPSVSNVLCKLSHIEH-GGSSVALLEIIGNCGAVK  183

Query  732   VNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVK  911
             VNGK+  K S   L+GGDEV+FG SGK AYIFQ+  N +I+ A++P  V+ILEA    + 
Sbjct  184   VNGKMCGKKSRHILSGGDEVVFGVSGKQAYIFQQLNN-NITTANIPSPVTILEAQGASIT  242

Query  912   GVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPD  1091
             G   +ARSGD S+VA AS LAS S L ++L ++ PS     +++Q  ++ +LP  +G+ D
Sbjct  243   GTQLDARSGDLSSVAGASILASFSELNEDLSMISPSSNTSKNMQQKTDVSSLPAGNGD-D  301

Query  1092  KHDLDSDMKDVSDHND-VPLDEKSGAISPDSGNDNLNLENGAIDS-YDGEIGKVTGAPQE  1265
             K + D     ++D  D V   E++G  S  + N++ N+    +++  D ++GK+T A  +
Sbjct  302   KANTDMKHNIINDEPDRVFSAEETGLPSSTTVNEDPNVVAVEVNAGVDADVGKMTAASCK  361

Query  1266  LRPLIRMLAGSSTPEFDLSGNISRIIDQRREL---LKDFD-PLISMSTRRQAFKDGLQQT  1433
             LRPL+  L+GS  PEFDLSGNI++I+++R+EL   LKD D P I  S ++QA KD LQ  
Sbjct  362   LRPLLHKLSGS-CPEFDLSGNIAKILEERKELKELLKDVDTPTILTSPKQQALKDSLQMR  420

Query  1434  ILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAG  1613
             IL++ NI+VSFE FPYYLS+ TKNVLI S YIHLKCN   K  SELP++ PRILLSGPAG
Sbjct  421   ILNAENIDVSFESFPYYLSDTTKNVLITSAYIHLKCNGSGKYVSELPSLSPRILLSGPAG  480

Query  1614  SEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKP--ERTGVFTKRAAQ  1784
             SEIYQETL+KALAK+FGA LL+VDSL  PG +  KE+D  KE P P  ERT +FTKR+  
Sbjct  481   SEIYQETLSKALAKHFGAWLLIVDSLSPPGRTPLKEVDSTKEIPIPRTERTSMFTKRSTP  540

Query  1785  AAVLRF-NKKPASSVEADITGGSAISSHAQTKQEASTASSKNT-FKTGDRVKYVGPLPTG  1958
             AA +   +KKPASSV+A I GGS  SS A  KQE STASSK + FKTGDRVKYVG  P+ 
Sbjct  541   AATIHIQHKKPASSVDAQIIGGSTSSSQAVLKQEVSTASSKGSAFKTGDRVKYVGDFPSA  600

Query  1959  FSLQT--PARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAA  2132
              S     P+RGP+YG +GKVLLAFE NG SKIGVRF++SIP+GNDLGGLCE+D GFFC+A
Sbjct  601   ASSPQVFPSRGPSYGCRGKVLLAFENNGSSKIGVRFEKSIPDGNDLGGLCEDDRGFFCSA  660

Query  2133  DFLRL-DNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKL  2309
             + L L D    DD  K+AINE+FE+ S   KS  L+L +KDIEK + GN E     K K 
Sbjct  661   NHLVLVDGCGGDDSGKVAINEIFEIASSLSKSGALVLLIKDIEKGVAGNSEVL---KSKF  717

Query  2310  EKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETP  2489
               LP+NVVVI S+   DNRKEK+ PG  LFTKFG NQTALLDLAFPDNF RLHDRSKETP
Sbjct  718   ASLPQNVVVIGSHIHPDNRKEKTQPGSLLFTKFGGNQTALLDLAFPDNFTRLHDRSKETP  777

Query  2490  KAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCP  2669
             K +KQL R FPNKV IQ+PQDE LLSDWKQ L+RD+ETMK+QSN V+IR VLN+  LDCP
Sbjct  778   KVMKQLNRFFPNKVTIQLPQDEALLSDWKQHLERDVETMKAQSNVVSIRLVLNKFGLDCP  837

Query  2670  DIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQ  2849
             ++ETL IKDQ LT E+VEKIIGWA+S+HF                          ++G+Q
Sbjct  838   ELETLSIKDQTLTTENVEKIIGWAISYHF--------------------------IEGIQ  871

Query  2850  NETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQR  3029
             NE KSVKKSLKDVVTENEFEKKLL DVIPP+DIGV+F+DIGALENVKDTLKELVMLPLQR
Sbjct  872   NENKSVKKSLKDVVTENEFEKKLLGDVIPPTDIGVSFNDIGALENVKDTLKELVMLPLQR  931

Query  3030  PELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY  3209
             PELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY
Sbjct  932   PELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY  991

Query  3210  VKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVL  3389
             VKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD+ERVL
Sbjct  992   VKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDRERVL  1051

Query  3390  VLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTE  3569
             VLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKI+R+IL KEELAP+VDL+A+ANMT+
Sbjct  1052  VLAATNRPFDLDEAVIRRLPRRLMVNLPDAANREKIMRVILAKEELAPDVDLEALANMTD  1111

Query  3570  GYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYA  3749
             GYSGSDLKNLCVTAAHCPIREILEKEKKE+  A++EN+PLP L +S+DIRPL ++DF+YA
Sbjct  1112  GYSGSDLKNLCVTAAHCPIREILEKEKKERTSALAENKPLPRLCSSADIRPLKIEDFKYA  1171

Query  3750  HEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             HEQVCASVSS+STNMTELLQWN+LYGEGGSRKK +LSYFM
Sbjct  1172  HEQVCASVSSDSTNMTELLQWNDLYGEGGSRKKTSLSYFM  1211



>ref|XP_010684534.1| PREDICTED: uncharacterized protein LOC104899096 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1233

 Score =  1428 bits (3696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 762/1202 (63%), Positives = 923/1202 (77%), Gaps = 44/1202 (4%)
 Frame = +3

Query  309   EIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRG  488
             E+ SADL    ++K  +   P+K P          S     D+ +D    K   SAL   
Sbjct  61    EVGSADLPPTDSIKPSDLNFPDKFP----------SVEAKEDAVVDEKDTK---SAL---  104

Query  489   KKRQLKSNLGT---AWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNL  659
             K+++LK N+ +   AW +L+SQ+ +N H  +  S FTVG GRQCDL ++DPS+SK LC L
Sbjct  105   KRQRLKKNIKSEQPAWAQLISQFSENPHEFVRGSQFTVGHGRQCDLWLNDPSISKMLCKL  164

Query  660   KHIQREKGNSITLLEISGKKGCVQVNGKIYPKNST-VPLNGGDEVIFGSSGKHAYIFQKF  836
             +  +R   +SI  LEI+G KG VQVNGK + K+S+ + L GGDE+IFGS GK+AYI Q+ 
Sbjct  165   QRTER-GASSIIKLEITGGKGSVQVNGKAHHKSSSPLTLTGGDELIFGSVGKYAYILQQL  223

Query  837   TNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTl--aslsnlkkellll  1010
             + + ++A  +P S++ILEAHS P  G + +AR  D S+ AVA     ASLS   K L  L
Sbjct  224   SMDTLAAPGLPSSLAILEAHSAPDTGKDTKARGRDSSSSAVAGASILASLSTFSKRLSRL  283

Query  1011  PPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKD---VSDHNDVPLDEKSGAISPDS  1181
             PPS  ND D        A+   SG  D    D DM D   + D+ D  L++K   + P S
Sbjct  284   PPSRGNDED-------SAMASLSGASDNGICDVDMNDSLELEDYRDASLNQKE--VCPVS  334

Query  1182  GNDNLNLENGAIDS-YDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIID---Q  1349
              ++N+N+ + A D+  + E G V G   ELRPL+++LA SST +FD SG++S++++   Q
Sbjct  335   -DENMNIVDVAKDTGLNTEEGLVPGTNSELRPLLQLLARSSTSDFDFSGSLSKLLEEQRQ  393

Query  1350  RRELLKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYI  1529
              RELLKD D    +STRRQAFKD L++ IL + +I+VS E FPYYLSE TKN+L+A+ ++
Sbjct  394   LRELLKDLDRPTLVSTRRQAFKDTLRKAILAACDIDVSLESFPYYLSENTKNLLVAAAFM  453

Query  1530  HLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS  1709
              LKC+  VK  S+L TV PRILLSGPAGSEIYQETLAKALAK+F A+LLVVDSL+LPG +
Sbjct  454   PLKCSHMVKFVSDLSTVSPRILLSGPAGSEIYQETLAKALAKHFSAKLLVVDSLLLPGST  513

Query  1710  AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEAS  1889
              KE D  +E  +PE+  +  KR++  A LR +KK ASSVEADIT GSA+ +    KQEAS
Sbjct  514   VKEADSSREHSRPEKASIHAKRSSVVASLR-HKKQASSVEADITNGSALLAQRLPKQEAS  572

Query  1890  TASSKN-TFKTGDRVKYVGPLPTGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDR  2066
             TASSK  TFK GDRVK+VG +P+G     P RGPAYG +GKV+L F+EN  SKIGVRFD 
Sbjct  573   TASSKKYTFKEGDRVKFVGSMPSGVPPLLPLRGPAYGNRGKVVLVFKENQSSKIGVRFDN  632

Query  2067  SIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFV  2246
             SIPEGN+LGG CE DHGFFCA D L L+NS  DD D+LA+NE+FEV   ECK+ P+IL++
Sbjct  633   SIPEGNNLGGRCETDHGFFCAGDLLCLENSGGDDADRLAVNEIFEVAKDECKNGPMILYL  692

Query  2247  KDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTA  2426
             KD+EK M GNP+A+   K KLE LPE ++VIAS+TQ D+RKEKSHPGG LFTKFGSN TA
Sbjct  693   KDMEKCMAGNPDAYGELKSKLENLPEKLIVIASHTQADSRKEKSHPGGLLFTKFGSNHTA  752

Query  2427  LLDLAFPDNFGRLHDRS-KETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIET  2603
             LLD AFPDNF R+ DR+ K+T K +KQLTRLF N+V IQ+PQDE LL +WKQ+L+RD ET
Sbjct  753   LLDFAFPDNFNRMSDRNNKDTSKTMKQLTRLFTNRVTIQMPQDENLLLEWKQKLERDTET  812

Query  2604  MKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTK  2783
             +K+QSN V+IR+VL RV ++C DIETL IKDQ L++E+ +K+IGWAL+HHFM+ +E+S  
Sbjct  813   LKAQSNIVSIRSVLTRVGIECHDIETLSIKDQTLSSENADKVIGWALTHHFMNGAEASLS  872

Query  2784  EGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFD  2963
             + K+ ISSESI +GL++L GVQNETKS KKSLKDV TENEFEKKLL DVIP S+IGVTFD
Sbjct  873   DSKVVISSESIMHGLNILHGVQNETKSTKKSLKDVATENEFEKKLLVDVIPASEIGVTFD  932

Query  2964  DIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAG  3143
             DIGAL+NVKDTLKELVMLPLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAG
Sbjct  933   DIGALDNVKDTLKELVMLPLQRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAG  992

Query  3144  ANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMR  3323
             ANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMR
Sbjct  993   ANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMR  1052

Query  3324  KMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR  3503
             KMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMV LPD  NR+KIL 
Sbjct  1053  KMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVGLPDVANRQKILS  1112

Query  3504  IILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENR  3683
             +IL KEELA +VDL  +ANMT+GYSGSDLKNLCVTAA+CPIREILE EKKEKALAI+ENR
Sbjct  1113  VILAKEELAADVDLAVVANMTDGYSGSDLKNLCVTAAYCPIREILETEKKEKALAIAENR  1172

Query  3684  PLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSY  3863
               P L++  D+RPLNM DF+YA EQVCAS S+ESTNM+EL+QWNELYGEGGSRKK +LSY
Sbjct  1173  S-PVLYSGDDVRPLNMSDFKYAQEQVCASFSAESTNMSELVQWNELYGEGGSRKKSSLSY  1231

Query  3864  FM  3869
             FM
Sbjct  1232  FM  1233



>ref|XP_009134429.1| PREDICTED: uncharacterized protein LOC103858761 [Brassica rapa]
Length=1254

 Score =  1422 bits (3681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 763/1217 (63%), Positives = 917/1217 (75%), Gaps = 44/1217 (4%)
 Frame = +3

Query  270   GAVNESGPESAEQEIRSADLDGASALKS--PEAPVPEKLPEAPLGGEP--LVSPMILGDS  437
             G V++ G ES E E+ S+D  G  A K    + PV E  PEA    E   L +P I G+ 
Sbjct  65    GPVSDPGSESGEPELGSSDPQGVDAEKPVLTDVPVMEISPEADANPEADVLATPAIAGEV  124

Query  438   AIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDL  617
               D +K KA       GKKR         W KLLSQY QN H  +    FTVG+ R CDL
Sbjct  125   VADGEKSKA-------GKKRA-----KAPWAKLLSQYSQNPHRIMRGPVFTVGR-RGCDL  171

Query  618   CVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIF  797
              + D S+  +LC LK      G S+  LEI+G    VQVNGK Y K++ V L GGDEVIF
Sbjct  172   SIKDQSMPSTLCELKQ-SDHGGPSVATLEITGNGVVVQVNGKCYQKSTCVHLRGGDEVIF  230

Query  798   GSSGKHAYIFQKFTNEDISAA-SMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTla  974
              + G+HAYIFQ   +E+++AA     SVS+ EA   P+KGV+ E R+GD S+ A  +++ 
Sbjct  231   TNFGRHAYIFQPLKDENLAAAPDRASSVSVCEARGAPLKGVHVETRAGD-SSAADGASIL  289

Query  975   slsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDV---SDHNDVP  1145
             +  +  +   LLPP +      +Q  E P +P +  +      D++M D    +DH D+ 
Sbjct  290   ASLSKYRNFHLLPP-IAKSAKKQQNQEAPVVPSSCNDCVS---DTEMNDADSNNDHADIA  345

Query  1146  LDEKSGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLS  1322
               EK+        N+NLN +   +D + +   G   G+  E+RP++R+L   S+   D+ 
Sbjct  346   SVEKTA-----DANENLNADGSGLDPFQEAADGNAPGSGYEIRPILRLLGEPSS--VDIR  398

Query  1323  GNISRIIDQRRE---LLKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSE  1493
             G IS+++D+RRE   LLK++D   ++STRRQAF D L++ +L   +I+VS EDFPY+LS 
Sbjct  399   G-ISKLLDERREVRELLKEYDLSSTISTRRQAFNDSLREGVLSGQDIDVSLEDFPYFLSA  457

Query  1494  ITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGAR  1670
              TK+VLIAS Y+H++  +KF K AS+L T CPRILLSGPAGSEIYQE LAKALAK FGA+
Sbjct  458   TTKDVLIASMYVHMEGGSKFAKYASDLSTTCPRILLSGPAGSEIYQEMLAKALAKRFGAK  517

Query  1671  LLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGG  1847
             L++VDSL+LPGGS AKE +  K+  + ER  +  KRA QAA    +KKP SSV+ADITGG
Sbjct  518   LMIVDSLLLPGGSPAKEAESSKDGSRRERLSMLAKRAVQAAQALQHKKPTSSVDADITGG  577

Query  1848  SAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQTPA-RGPAYGYKGKVLL  2018
             S +SS A  KQE STA+SK+  FK GDRVKYVGP  +  S LQ P  RGP+ G++GKVLL
Sbjct  578   STLSSQALPKQEVSTATSKSYIFKAGDRVKYVGPSSSAISSLQGPPLRGPSIGFQGKVLL  637

Query  2019  AFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELF  2198
             AFE+N  SK+G+RFDR +P+GNDLGGLCEEDHGFFCAA  LRLD SS DD DKLA+NE+F
Sbjct  638   AFEDNCSSKVGIRFDRPVPDGNDLGGLCEEDHGFFCAATSLRLDGSSSDDADKLAVNEVF  697

Query  2199  EVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKS  2378
             EV   E +   LILF+KDIEKS+VGN + ++  K K E LPEN+VV+AS TQ D+RKEKS
Sbjct  698   EVALSESEGGSLILFLKDIEKSLVGNSDVYATLKSKFENLPENIVVMASQTQLDSRKEKS  757

Query  2379  HPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDET  2558
             HPGGFLFTKFG NQTALLDLAFPDNF +LHDRSKETPK++KQ+TRLFPNKV IQ+PQDE 
Sbjct  758   HPGGFLFTKFGGNQTALLDLAFPDNFSKLHDRSKETPKSMKQITRLFPNKVAIQLPQDEA  817

Query  2559  LLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGW  2738
             LLSDWK++LDRD E +K Q+N  +I +VL +  LDCPD+ TL IKDQ L +ESVEK++GW
Sbjct  818   LLSDWKEKLDRDTELLKVQANITSILSVLTKNRLDCPDLGTLSIKDQTLPSESVEKVVGW  877

Query  2739  ALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKL  2918
             ALSHH M+ +E + K+ KL IS+ESI YGL +L GVQ+E KS+KKSLKDVVTENEFEKKL
Sbjct  878   ALSHHLMNCAEPTVKDNKLVISAESITYGLQMLHGVQDENKSLKKSLKDVVTENEFEKKL  937

Query  2919  LADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPG  3098
             L+DVIPPSDIGV+FDDIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFGPPG
Sbjct  938   LSDVIPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPELFDKGQLTKPTKGILLFGPPG  997

Query  3099  TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDS  3278
             TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDS
Sbjct  998   TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDS  1057

Query  3279  MLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRL  3458
             MLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLPRRL
Sbjct  1058  MLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRRL  1117

Query  3459  MVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReil  3638
             MVNLPDA NR KIL +IL+KEE+AP+VDL+AIANMT+GYSGSDLKNLCVTAAH PIREIL
Sbjct  1118  MVNLPDATNRSKILSVILSKEEIAPDVDLEAIANMTDGYSGSDLKNLCVTAAHLPIREIL  1177

Query  3639  ekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNE  3818
             EKEKKEK  A +ENRP P L++ +DIR L M DF+ AHEQVCASVS++S+NM EL QWNE
Sbjct  1178  EKEKKEKTAAEAENRPTPPLYSCTDIRSLTMADFKAAHEQVCASVSTDSSNMNELQQWNE  1237

Query  3819  LYGEGGSRKKKALSYFM  3869
             LYGEGGSRKK +LSYFM
Sbjct  1238  LYGEGGSRKKTSLSYFM  1254



>ref|XP_010069946.1| PREDICTED: uncharacterized protein LOC104456788 isoform X1 [Eucalyptus 
grandis]
 gb|KCW58475.1| hypothetical protein EUGRSUZ_H01157 [Eucalyptus grandis]
Length=1232

 Score =  1420 bits (3676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 734/1136 (65%), Positives = 887/1136 (78%), Gaps = 32/1136 (3%)
 Frame = +3

Query  522   AWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLL  701
             AWG+LLSQ  QN ++ +  S F VG G QC+LC+ DPS+S  LC LKHI R  G+S TLL
Sbjct  109   AWGQLLSQCNQNPNLLMRDSLFIVGHGSQCNLCLADPSISMVLCKLKHIVR-GGSSATLL  167

Query  702   EISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVS  881
             EI+G KG VQVNGKIYP+NSTV L GGDEV+F  SG H+Y+FQ F  +D  A    PS  
Sbjct  168   EITGGKGTVQVNGKIYPRNSTVLLCGGDEVVFTESGNHSYVFQPF--DDNVADVGIPSEC  225

Query  882   ILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMP  1061
             ILEA    +K ++ E+RS  PS V+ AS L+     +   LL PP   +  D++    +P
Sbjct  226   ILEAQGASMKELHIESRSEGPSAVSGASMLSLTDLQEDLSLLPPPGKSSP-DVQCNTGIP  284

Query  1062  ALPVASGEPDKHDLDSDMKDVS---DHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDG  1232
              +P      D  + + +++D S   D  DV   EKS + S +  ++N NL+    DS   
Sbjct  285   IVPSVCDTSDNQNGEVEIRDSSNNDDARDVSTREKSVSPSAECNDENANLDGAGFDSRAP  344

Query  1233  EIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQ----RRELLKDFDPLI-----  1385
                KV GA  ELRPL +M+   S P FD+   +S+I++     RR+LL++ D  +     
Sbjct  345   GDEKVPGAACELRPLWQMIG--SPPNFDI---LSKIVEDQREIRRKLLRNSDASLLKNND  399

Query  1386  ----SMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFV  1553
                 S +  R+AF++ L+Q I DS+NI+VSFE+FPYYLS+ TKNVLIASTY+ LK ++FV
Sbjct  400   MSSDSRTDWRKAFRESLEQAISDSDNIKVSFENFPYYLSDTTKNVLIASTYLRLKRSEFV  459

Query  1554  KCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPV  1730
             K + +LPT+CPRILLSGPAGSEIYQETL KALAK+FGARLL+VDSL+LPG    K++D +
Sbjct  460   KYSKDLPTLCPRILLSGPAGSEIYQETLTKALAKHFGARLLIVDSLLLPGDLMPKDVDSL  519

Query  1731  KEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-  1907
             KE  K E+T V  KRA Q++ +  ++KP SSVEADITGGS + S AQTKQE STA+SK  
Sbjct  520   KECVKSEKTSVHAKRAGQSSAVH-HRKPTSSVEADITGGSIVGSRAQTKQEVSTATSKTY  578

Query  1908  TFKTGDRVKYVGPLPTGFSLQTPARGPAYGYKGKVLLAFEEN--GFSKIGVRFDRSIPEG  2081
              FK GDRV++VG    G S   P RGP+ GY+GKV+LAFEEN    +K+GVRFD+ I EG
Sbjct  579   KFKKGDRVRFVGS--AGLSSLQPLRGPSDGYRGKVVLAFEENENDAAKVGVRFDKPILEG  636

Query  2082  NDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEK  2261
             N+LG  CE+DHGFFC+A+ LRL++S  ++ D LAI+E+FEV     KS PL++FVKD+EK
Sbjct  637   NNLGEHCEKDHGFFCSANSLRLESSGGEETDSLAIDEIFEVALSASKSCPLVIFVKDVEK  696

Query  2262  SMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLA  2441
             ++V +P+A   F+ KLE LP NVVVI S+ Q D+RKEKSH GG LFTKF  N TALLDLA
Sbjct  697   AVVASPDAGQVFRAKLENLPGNVVVIGSHIQLDSRKEKSHSGGLLFTKFAGNPTALLDLA  756

Query  2442  FPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSN  2621
             FPD+FGRLH+R KE+PK +KQL RLFPNKV IQ+PQDE LL DWKQQL+RD+ETM++QSN
Sbjct  757   FPDSFGRLHERGKESPKTMKQLARLFPNKVSIQLPQDEVLLLDWKQQLERDVETMRAQSN  816

Query  2622  AVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAI  2801
               ++R VLNR  +DCPDIET+CI DQ LT+ESVEKI+GWALSHHFM SSE+  K+ KL +
Sbjct  817   IASVRLVLNRSGMDCPDIETVCINDQTLTSESVEKIVGWALSHHFMCSSEAPVKDAKLVL  876

Query  2802  SSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALE  2981
             SSESIRYG+++ QG+ NE K  KKSLKDVVTENEFEKKLL DVIPP+DIGV+FDDIGALE
Sbjct  877   SSESIRYGINIFQGIHNENKGSKKSLKDVVTENEFEKKLLTDVIPPTDIGVSFDDIGALE  936

Query  2982  NVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINI  3161
             NVKDTLKELVMLPLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINI
Sbjct  937   NVKDTLKELVMLPLQRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINI  996

Query  3162  SMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEF  3341
             SMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEF
Sbjct  997   SMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEF  1056

Query  3342  MVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKE  3521
             MVNWDGLRTKDKERVLVL ATNRPFDLDEAVIRR PRRLMVNLPDA NRE+IL++IL KE
Sbjct  1057  MVNWDGLRTKDKERVLVLGATNRPFDLDEAVIRRFPRRLMVNLPDALNRERILKVILAKE  1116

Query  3522  ELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALH  3701
             EL  ++D +A+A MTEGYSGSDLKNLCV+AAHCPIREIL+KEKKE+ LA++ENRPLP+L+
Sbjct  1117  ELGSDIDFEAVAKMTEGYSGSDLKNLCVSAAHCPIREILDKEKKERTLAVAENRPLPSLY  1176

Query  3702  NSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             +  DIRPL MDDF+YAHEQVCASVSS+STNM EL+QWN+LYGEGG+RK+ +LSYFM
Sbjct  1177  SGMDIRPLKMDDFKYAHEQVCASVSSDSTNMNELVQWNDLYGEGGTRKRTSLSYFM  1232



>ref|XP_006418289.1| hypothetical protein EUTSA_v10006579mg [Eutrema salsugineum]
 ref|XP_006418291.1| hypothetical protein EUTSA_v10006579mg [Eutrema salsugineum]
 gb|ESQ36642.1| hypothetical protein EUTSA_v10006579mg [Eutrema salsugineum]
 gb|ESQ36644.1| hypothetical protein EUTSA_v10006579mg [Eutrema salsugineum]
Length=1266

 Score =  1419 bits (3672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 772/1220 (63%), Positives = 934/1220 (77%), Gaps = 45/1220 (4%)
 Frame = +3

Query  276   VNESGPESAEQEIRSADL---DGASALKSPEAPVPEKLPEAPLGGEP--LVSPMILGDSA  440
             V++ G ES E E+R++DL   D      + + P  E  P+  +  E   LV+P   G+  
Sbjct  70    VSDPGSESGEPELRTSDLQTNDAERPATATDVPAMENCPDTDMNPEVEGLVTPTPAGEVV  129

Query  441   IDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLC  620
              + +K+K+       GKKR  K+     W KLLSQ+PQN H  +  S FTVG+ R CDLC
Sbjct  130   AEAEKLKS-------GKKRIAKA----PWAKLLSQHPQNPHRVMRGSVFTVGR-RGCDLC  177

Query  621   VDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFG  800
             + D S+   LC L+  +   G S+  LEI G    VQVNGKIY +++ V L GGDEV+F 
Sbjct  178   IKDQSMPSVLCELRQSEH-GGPSVASLEIIGNGVLVQVNGKIYQRSTCVHLRGGDEVVFS  236

Query  801   SS-GKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlas  977
             S+ GKHAYIFQ   +E+++A     S+SI EA S P+KG++ E R+GD S+    S+L +
Sbjct  237   STPGKHAYIFQPLKDENLAAPDRASSLSIFEAQSAPLKGLHVETRAGD-SSSVDGSSLLA  295

Query  978   lsnlkkellllPPSVCNDNDIKQGPEMPALPVASGE--PDKHDLDSDMKDVSDHND---V  1142
                    +  LPP+  N    +Q  E+P LP +S +  PD      DM D   +ND   +
Sbjct  296   SLTKLHNVPFLPPTAKNVKR-QQNSEVPVLPSSSNDCIPD-----VDMNDADSNNDYAAI  349

Query  1143  PLDEKSGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDL  1319
                EK+ A +  + ND+ N +   +D + + E G + G+  E+RP++R+L   S  E DL
Sbjct  350   ASTEKTIASTSCAANDDQNADGNGMDPFQEAEGGNIHGSDYEIRPILRLLGDPS--ELDL  407

Query  1320  SGNISR-IIDQRRE---LLKDFDPL-ISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYY  1484
              G+IS+ ++D RRE   +LK++D    S+STRRQ  KD L+  +++  +IEVSFE FPY+
Sbjct  408   RGSISKKLVDNRREVKKILKEYDSSSASVSTRRQVHKDSLRAGVINPQDIEVSFESFPYF  467

Query  1485  LSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYF  1661
             LS  TK+VLI STY+H+KC +KF K AS L T+CPRILLSGPAGSEIYQE LAKALAK F
Sbjct  468   LSGTTKDVLITSTYVHMKCGSKFGKYASALSTMCPRILLSGPAGSEIYQEMLAKALAKNF  527

Query  1662  GARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADI  1838
             GA+L++VDSL+LPGGS AKE D  KE+ + ER  V  KRA QAAVL+ +KKP SSVEADI
Sbjct  528   GAKLMIVDSLLLPGGSTAKEADSTKESSRRERLSVLAKRAVQAAVLQ-HKKPTSSVEADI  586

Query  1839  TGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGF-SLQTPARGPAYGYKGKV  2012
             TGGS +SS A  +QE STA+SK+ TFKTGDRVK+VGP  +   +L +  RGPA G++GKV
Sbjct  587   TGGSTLSSQAVPRQEVSTATSKSYTFKTGDRVKFVGPSTSSLATLPSLLRGPAIGFQGKV  646

Query  2013  LLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINE  2192
             LLAFE+NG SKIGVRFDR I +GNDLGGLCEEDHGFFC A  LRLD+SS DD DKLAINE
Sbjct  647   LLAFEDNGSSKIGVRFDRPIADGNDLGGLCEEDHGFFCTASSLRLDSSSSDDADKLAINE  706

Query  2193  LFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKE  2372
             +FEV   E +   LILF+KDIEKS+ GN + +   K KLE LPEN+VVIAS TQ D+RKE
Sbjct  707   IFEVAFNESEKGSLILFLKDIEKSLAGNTDVYVTLKSKLENLPENIVVIASQTQLDSRKE  766

Query  2373  KSHPGGFLFTKFGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQ  2549
             KSHPGGFLFTKFGSNQTALLDLAFPDNFG RL DR+KE PK++KQ+TRLFPNKV IQ+P+
Sbjct  767   KSHPGGFLFTKFGSNQTALLDLAFPDNFGGRLQDRNKEMPKSVKQITRLFPNKVAIQLPE  826

Query  2550  DETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKI  2729
             DE LL DWK++L+RD E +K+Q+N  +IR VL++  LDCPD+ETLCIKDQ L ++SVEK+
Sbjct  827   DEALLLDWKEKLERDTEILKAQANITSIRAVLSKNRLDCPDLETLCIKDQTLPSDSVEKV  886

Query  2730  IGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFE  2909
             +GWA SHH M  SE + K+ KL IS+ESI  GL VL G+QNE KS KKSLKDVVTENEFE
Sbjct  887   VGWAFSHHLMSCSEPTVKDNKLIISAESITSGLQVLHGIQNENKSTKKSLKDVVTENEFE  946

Query  2910  KKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFG  3089
             KKLL+DVIPPSDIGV+F+DIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFG
Sbjct  947   KKLLSDVIPPSDIGVSFNDIGALENVKDTLKELVMLPLQRPELFGKGQLTKPTKGILLFG  1006

Query  3090  PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDE  3269
             PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDE
Sbjct  1007  PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDE  1066

Query  3270  VDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLP  3449
             VDSMLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLP
Sbjct  1067  VDSMLGRRENPGEHEAMRKMKNEFMINWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLP  1126

Query  3450  RRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIR  3629
             RRLMVNLPD+ NR KIL +IL KEE+A +VDL+AIANMT+GYSGSDLKNLCVTAAH PIR
Sbjct  1127  RRLMVNLPDSANRSKILSVILAKEEMAEDVDLEAIANMTDGYSGSDLKNLCVTAAHRPIR  1186

Query  3630  eilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQ  3809
             EILEKEKKE+++A +ENRP+P L+NS+DIRPL+M+DF+ AHEQVCASVSS+S+NM EL Q
Sbjct  1187  EILEKEKKERSVAEAENRPMPKLYNSTDIRPLSMNDFKAAHEQVCASVSSDSSNMNELQQ  1246

Query  3810  WNELYGEGGSRKKKALSYFM  3869
             WNELYGEGGSRKK +LSYFM
Sbjct  1247  WNELYGEGGSRKKASLSYFM  1266



>ref|XP_006418290.1| hypothetical protein EUTSA_v10006579mg [Eutrema salsugineum]
 gb|ESQ36643.1| hypothetical protein EUTSA_v10006579mg [Eutrema salsugineum]
Length=1253

 Score =  1418 bits (3671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 772/1220 (63%), Positives = 934/1220 (77%), Gaps = 45/1220 (4%)
 Frame = +3

Query  276   VNESGPESAEQEIRSADL---DGASALKSPEAPVPEKLPEAPLGGE--PLVSPMILGDSA  440
             V++ G ES E E+R++DL   D      + + P  E  P+  +  E   LV+P   G+  
Sbjct  57    VSDPGSESGEPELRTSDLQTNDAERPATATDVPAMENCPDTDMNPEVEGLVTPTPAGEVV  116

Query  441   IDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLC  620
              + +K+K+       GKKR  K+     W KLLSQ+PQN H  +  S FTVG+ R CDLC
Sbjct  117   AEAEKLKS-------GKKRIAKA----PWAKLLSQHPQNPHRVMRGSVFTVGR-RGCDLC  164

Query  621   VDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFG  800
             + D S+   LC L+  +   G S+  LEI G    VQVNGKIY +++ V L GGDEV+F 
Sbjct  165   IKDQSMPSVLCELRQSEH-GGPSVASLEIIGNGVLVQVNGKIYQRSTCVHLRGGDEVVFS  223

Query  801   SS-GKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlas  977
             S+ GKHAYIFQ   +E+++A     S+SI EA S P+KG++ E R+GD S+    S+L +
Sbjct  224   STPGKHAYIFQPLKDENLAAPDRASSLSIFEAQSAPLKGLHVETRAGD-SSSVDGSSLLA  282

Query  978   lsnlkkellllPPSVCNDNDIKQGPEMPALPVASGE--PDKHDLDSDMKDVSDHND---V  1142
                    +  LPP+  N    +Q  E+P LP +S +  PD      DM D   +ND   +
Sbjct  283   SLTKLHNVPFLPPTAKNVKR-QQNSEVPVLPSSSNDCIPD-----VDMNDADSNNDYAAI  336

Query  1143  PLDEKSGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDL  1319
                EK+ A +  + ND+ N +   +D + + E G + G+  E+RP++R+L   S  E DL
Sbjct  337   ASTEKTIASTSCAANDDQNADGNGMDPFQEAEGGNIHGSDYEIRPILRLLGDPS--ELDL  394

Query  1320  SGNISR-IIDQRRE---LLKDFDPL-ISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYY  1484
              G+IS+ ++D RRE   +LK++D    S+STRRQ  KD L+  +++  +IEVSFE FPY+
Sbjct  395   RGSISKKLVDNRREVKKILKEYDSSSASVSTRRQVHKDSLRAGVINPQDIEVSFESFPYF  454

Query  1485  LSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYF  1661
             LS  TK+VLI STY+H+KC +KF K AS L T+CPRILLSGPAGSEIYQE LAKALAK F
Sbjct  455   LSGTTKDVLITSTYVHMKCGSKFGKYASALSTMCPRILLSGPAGSEIYQEMLAKALAKNF  514

Query  1662  GARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADI  1838
             GA+L++VDSL+LPGGS AKE D  KE+ + ER  V  KRA QAAVL+ +KKP SSVEADI
Sbjct  515   GAKLMIVDSLLLPGGSTAKEADSTKESSRRERLSVLAKRAVQAAVLQ-HKKPTSSVEADI  573

Query  1839  TGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGF-SLQTPARGPAYGYKGKV  2012
             TGGS +SS A  +QE STA+SK+ TFKTGDRVK+VGP  +   +L +  RGPA G++GKV
Sbjct  574   TGGSTLSSQAVPRQEVSTATSKSYTFKTGDRVKFVGPSTSSLATLPSLLRGPAIGFQGKV  633

Query  2013  LLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINE  2192
             LLAFE+NG SKIGVRFDR I +GNDLGGLCEEDHGFFC A  LRLD+SS DD DKLAINE
Sbjct  634   LLAFEDNGSSKIGVRFDRPIADGNDLGGLCEEDHGFFCTASSLRLDSSSSDDADKLAINE  693

Query  2193  LFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKE  2372
             +FEV   E +   LILF+KDIEKS+ GN + +   K KLE LPEN+VVIAS TQ D+RKE
Sbjct  694   IFEVAFNESEKGSLILFLKDIEKSLAGNTDVYVTLKSKLENLPENIVVIASQTQLDSRKE  753

Query  2373  KSHPGGFLFTKFGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQ  2549
             KSHPGGFLFTKFGSNQTALLDLAFPDNFG RL DR+KE PK++KQ+TRLFPNKV IQ+P+
Sbjct  754   KSHPGGFLFTKFGSNQTALLDLAFPDNFGGRLQDRNKEMPKSVKQITRLFPNKVAIQLPE  813

Query  2550  DETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKI  2729
             DE LL DWK++L+RD E +K+Q+N  +IR VL++  LDCPD+ETLCIKDQ L ++SVEK+
Sbjct  814   DEALLLDWKEKLERDTEILKAQANITSIRAVLSKNRLDCPDLETLCIKDQTLPSDSVEKV  873

Query  2730  IGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFE  2909
             +GWA SHH M  SE + K+ KL IS+ESI  GL VL G+QNE KS KKSLKDVVTENEFE
Sbjct  874   VGWAFSHHLMSCSEPTVKDNKLIISAESITSGLQVLHGIQNENKSTKKSLKDVVTENEFE  933

Query  2910  KKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFG  3089
             KKLL+DVIPPSDIGV+F+DIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFG
Sbjct  934   KKLLSDVIPPSDIGVSFNDIGALENVKDTLKELVMLPLQRPELFGKGQLTKPTKGILLFG  993

Query  3090  PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDE  3269
             PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDE
Sbjct  994   PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDE  1053

Query  3270  VDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLP  3449
             VDSMLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLP
Sbjct  1054  VDSMLGRRENPGEHEAMRKMKNEFMINWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLP  1113

Query  3450  RRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIR  3629
             RRLMVNLPD+ NR KIL +IL KEE+A +VDL+AIANMT+GYSGSDLKNLCVTAAH PIR
Sbjct  1114  RRLMVNLPDSANRSKILSVILAKEEMAEDVDLEAIANMTDGYSGSDLKNLCVTAAHRPIR  1173

Query  3630  eilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQ  3809
             EILEKEKKE+++A +ENRP+P L+NS+DIRPL+M+DF+ AHEQVCASVSS+S+NM EL Q
Sbjct  1174  EILEKEKKERSVAEAENRPMPKLYNSTDIRPLSMNDFKAAHEQVCASVSSDSSNMNELQQ  1233

Query  3810  WNELYGEGGSRKKKALSYFM  3869
             WNELYGEGGSRKK +LSYFM
Sbjct  1234  WNELYGEGGSRKKASLSYFM  1253



>ref|NP_567238.2| AAA-type ATPase family protein [Arabidopsis thaliana]
 dbj|BAF01763.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82177.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=1265

 Score =  1411 bits (3653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/1218 (61%), Positives = 907/1218 (74%), Gaps = 36/1218 (3%)
 Frame = +3

Query  270   GAVNESGPESAEQEIRSAD---LDGASALKSPEAPVPEKLPEAPLGGEP--LVSPMILGD  434
             G  ++ G ES E E+ S+D   +D    + + + PV E  PE     E   L +P + G+
Sbjct  66    GPASDPGSESGEPELGSSDPQAMDAEKPVVTTDVPVMENSPETDANPEVEVLATPTVAGE  125

Query  435   SAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCD  614
             +  D DK KA      +             W KLLSQY QN H  +    FTVG+ R CD
Sbjct  126   AVADADKSKAAKKRALK-----------APWAKLLSQYSQNPHRVIRGPVFTVGR-RGCD  173

Query  615   LCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVI  794
             L + D ++  +LC LK  +   G S+  LEI G    V VNGK Y K++ V L GGDEVI
Sbjct  174   LSIRDQAMPSTLCELKQSEH-GGPSVASLEILGNGVIVHVNGKCYQKSTCVHLRGGDEVI  232

Query  795   FGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVA-VASTl  971
             F  +GKHAYIFQ   +E+++A     S+SI EA   P+KGV+ E R+GD    + V    
Sbjct  233   FSLNGKHAYIFQPVKDENLAAPDRASSLSICEARGAPLKGVHVETRAGDVDGASDVDGAS  292

Query  972   aslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND----  1139
                S  K     L P +      +Q P +P +P +  +      D+DM D   +ND    
Sbjct  293   ILASLSKLRSFHLLPPIAKAGKRQQNPAVPVVPSSFNDCIS---DTDMNDADSNNDHAAV  349

Query  1140  VPLDEKSGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFD  1316
               +++ + A +P + N+NLN++   +D + + + G V  A  E+RP++ +L  SS+  FD
Sbjct  350   ASVEKIAAASTPGTANENLNVDGSGLDPFQEADGGNVPAAGYEIRPIVHLLGESSS--FD  407

Query  1317  LSGNISRIIDQRREL---LKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYL  1487
             + G+ISR++D+RRE+   L++FD   ++STRRQAFKD L+  +L++ NI++SFE+FPYYL
Sbjct  408   IRGSISRLLDERREVKEFLREFDLSSTISTRRQAFKDSLRGGVLNAQNIDISFENFPYYL  467

Query  1488  SEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFG  1664
             S  TK VL+ S Y+H+   +K+   A++L T CPRILLSGP+GSEIYQE LAKALAK FG
Sbjct  468   SATTKGVLMISMYVHMNGGSKYANFATDLTTACPRILLSGPSGSEIYQEMLAKALAKQFG  527

Query  1665  ARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADIT  1841
             A+L++VDSL+LPGGS A+E +  KE  + ER  +  KRA QAA +  +KKP SSV+ADIT
Sbjct  528   AKLMIVDSLLLPGGSPAREAESSKEGSRRERLSMLAKRAVQAAQVLQHKKPTSSVDADIT  587

Query  1842  GGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVL  2015
             GGS +SS A  KQE STA+SK+ TFK GDRVK+VGP  +  S LQ   RGPA G +GKV 
Sbjct  588   GGSTLSSQALPKQEVSTATSKSYTFKAGDRVKFVGPSASAISSLQGQLRGPAIGSQGKVA  647

Query  2016  LAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINEL  2195
             LAFE+N  SKIG+RFDR + +GNDLGGLCEEDHGFFCAA  LRL+ SS DD DKLA+NE+
Sbjct  648   LAFEDNCASKIGIRFDRPVQDGNDLGGLCEEDHGFFCAASSLRLEGSSSDDADKLAVNEI  707

Query  2196  FEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEK  2375
             FEV   E +   LILF+KDIEKS+VGN + ++  K KLE LPEN+VVIAS TQ D+RKEK
Sbjct  708   FEVALSESEGGSLILFLKDIEKSLVGNSDVYATLKSKLETLPENIVVIASQTQLDSRKEK  767

Query  2376  SHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDE  2555
             SHPGGFLFTKFG NQTALLDLAFPDNFG+LHDRSKETPK++KQ+TRLFPNK+ IQ+PQ+E
Sbjct  768   SHPGGFLFTKFGGNQTALLDLAFPDNFGKLHDRSKETPKSMKQITRLFPNKIAIQLPQEE  827

Query  2556  TLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIG  2735
              LLSDWK++LDRD E +K Q+N  +I  VL + +LDCPD+ TLCIKDQ L +ESVEK++G
Sbjct  828   ALLSDWKEKLDRDTEILKVQANITSILAVLAKNKLDCPDLGTLCIKDQTLPSESVEKVVG  887

Query  2736  WALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKK  2915
             WA  HH M  +E   K+ KL IS+ESI YGL  L  +QNE KS+KKSLKDVVTENEFEKK
Sbjct  888   WAFGHHLMICTEPIVKDNKLVISAESISYGLQTLHDIQNENKSLKKSLKDVVTENEFEKK  947

Query  2916  LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPP  3095
             LL+DVIPPSDIGV+FDDIGALENVK+TLKELVMLPLQRPELF KGQLTKP KGILLFGPP
Sbjct  948   LLSDVIPPSDIGVSFDDIGALENVKETLKELVMLPLQRPELFDKGQLTKPTKGILLFGPP  1007

Query  3096  GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVD  3275
             GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVD
Sbjct  1008  GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVD  1067

Query  3276  SMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRR  3455
             SMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLPRR
Sbjct  1068  SMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRR  1127

Query  3456  LMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIRei  3635
             LMVNLPDA NR KIL +IL KEE+AP+VDL+AIANMT+GYSGSDLKNLCVTAAH PIREI
Sbjct  1128  LMVNLPDATNRSKILSVILAKEEIAPDVDLEAIANMTDGYSGSDLKNLCVTAAHFPIREI  1187

Query  3636  lekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWN  3815
             LEKEKKEK  A +ENRP P L++ +D+R L M+DF+ AH+QVCASVSS+S+NM EL QWN
Sbjct  1188  LEKEKKEKTAAQAENRPTPPLYSCTDVRSLTMNDFKAAHDQVCASVSSDSSNMNELQQWN  1247

Query  3816  ELYGEGGSRKKKALSYFM  3869
             ELYGEGGSRKK +LSYFM
Sbjct  1248  ELYGEGGSRKKTSLSYFM  1265



>ref|XP_010422583.1| PREDICTED: uncharacterized protein LOC104707848 isoform X2 [Camelina 
sativa]
Length=1248

 Score =  1409 bits (3648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 758/1245 (61%), Positives = 927/1245 (74%), Gaps = 51/1245 (4%)
 Frame = +3

Query  207   KRSKATE----SLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPE  374
             KRSKA      S S+++  +  + P +  + G ES E E+ S+D     A    E PVP 
Sbjct  31    KRSKAAAEPAGSSSASEVPIENQVPAS--DPGSESGEPELGSSDPQPMDA----EKPVPT  84

Query  375   KLP--------EAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWG  530
              +P        +A    E L +P I  + A D +K KA     ++             W 
Sbjct  85    DVPVIENSPETDANPQVEVLATPTIAAEVATDAEKSKAAKKRASK-----------APWA  133

Query  531   KLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGN-SITLLEI  707
             KLLSQY  N H  +    FTVG+ R CDL + D S+  +LC LK  Q E G  ++  LEI
Sbjct  134   KLLSQYSLNPHRIMRSPVFTVGR-RGCDLSIKDQSMPTTLCELK--QSEPGGPTVASLEI  190

Query  708   SGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSIL  887
              G    VQVNGK Y KN+ V L GGDEV+F  S KH+YIFQ   +E+++A     S++I 
Sbjct  191   IGNGVLVQVNGKCYQKNACVNLRGGDEVVFSVSAKHSYIFQPIKDENLAAPDRSSSLNIC  250

Query  888   EAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPAL  1067
             EA   P+KGV+ E R+GD S V  AS LASLS  +   LL  P +      +Q PE+P +
Sbjct  251   EARGSPLKGVHVETRAGDSSAVDGASILASLSKYRNFHLL--PPIAKAAKRQQNPEVPVV  308

Query  1068  PVASGEPDKHDLDSDMKDVSDHND---VPLDEKSGAISPDSGNDNLNLENGAIDSY-DGE  1235
             P +  +      D+DM D   +ND   +   EK+ A +  + N+NLN++   +D + + +
Sbjct  309   PSSCNDCIS---DTDMNDADSNNDQAAIAAVEKNAASTSCTANENLNVDGSGLDPFQEAD  365

Query  1236  IGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRREL---LKDFDPLISMSTRRQ  1406
              G V G+  E+RP++ +L  SS+  FD+ G+IS+++D+RRE+   L++FD   ++STRRQ
Sbjct  366   GGNVPGSGYEIRPIMHLLGESSS--FDIRGSISKLLDERREVREFLREFDLSSTISTRRQ  423

Query  1407  AFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELPTVC  1583
             AFKD L+  +L++ NIEVSFE+FPY+LS +TK+VLI S ++H+   NK+ K  S+L T C
Sbjct  424   AFKDSLRGGVLNAENIEVSFENFPYFLSAMTKDVLITSMFVHMNGGNKYAKYGSDLTTTC  483

Query  1584  PRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTG  1760
             PRILLSGPAGSEIYQE LAKA AK FGA+L++VDSL+LPGGS A+E +  KE  + E+  
Sbjct  484   PRILLSGPAGSEIYQEMLAKAFAKNFGAKLMIVDSLLLPGGSPAREAESSKEGSRREKLS  543

Query  1761  VFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKY  1937
             +  KRA QAA    +KKP SSV+ADITGGS +SS A  KQE STA+SK+ TFK GDRV++
Sbjct  544   MLAKRAVQAAQALQHKKPTSSVDADITGGSTLSSQALPKQEVSTATSKSYTFKAGDRVRF  603

Query  1938  VGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDH  2114
              G   +  S LQ   RGP+ G +GKVLLAFE+N  SKIG+RFDR + +GNDLGGLCEE+H
Sbjct  604   AGFSSSAVSSLQGSLRGPSIGSQGKVLLAFEDNSASKIGIRFDRPVQDGNDLGGLCEEEH  663

Query  2115  GFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSA  2294
             GFFCAA  LRLD SS DD DKLA+NE+FEV   E +   LILF+KDIEKS+VGN + ++ 
Sbjct  664   GFFCAASSLRLDGSSSDDADKLAVNEIFEVAYSESEGGSLILFLKDIEKSLVGNSDVYAT  723

Query  2295  FKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDR  2474
              K KLE LPEN+VV+AS TQ D+RKEKSHPGGFLFTKFG NQTALLDLAFPDNFG+LHDR
Sbjct  724   LKSKLETLPENIVVMASQTQLDSRKEKSHPGGFLFTKFGGNQTALLDLAFPDNFGKLHDR  783

Query  2475  SKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRV  2654
             SKETPK++KQ+TRLFPNK+ IQ+PQDE LL DWK++L+RD E +K Q+N  +I  VL + 
Sbjct  784   SKETPKSMKQITRLFPNKIAIQLPQDEALLLDWKEKLERDTEILKVQANITSILAVLTKN  843

Query  2655  ELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSV  2834
              LDCPD+ TL IKDQ L +ESVEK++GWA  HH ++ SE + K+ KL IS+ESI YGL +
Sbjct  844   RLDCPDLGTLSIKDQTLPSESVEKVVGWAYGHHLINCSEPTVKDNKLVISAESIAYGLQM  903

Query  2835  LQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVM  3014
             L G+QNE KS+KKSLKDVVTENEFEKKLL+DVIPPSDIGV+FDDIGALENVKDTLKELVM
Sbjct  904   LHGIQNENKSLKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKDTLKELVM  963

Query  3015  LPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG  3194
             LPLQRPELF KGQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG
Sbjct  964   LPLQRPELFDKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG  1023

Query  3195  EGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKD  3374
             EGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKD
Sbjct  1024  EGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMINWDGLRTKD  1083

Query  3375  KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAI  3554
             +ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NR KIL +IL KE++AP+VDL+AI
Sbjct  1084  RERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDATNRSKILSVILAKEDIAPDVDLEAI  1143

Query  3555  ANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMD  3734
             ANMT+GYSGSDLKNLCVTAAH PIREILEKEKKEK  A +ENRP P L++ +D+RPL M+
Sbjct  1144  ANMTDGYSGSDLKNLCVTAAHLPIREILEKEKKEKTAAQAENRPTPPLYSCTDVRPLTMN  1203

Query  3735  DFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             DF+ AH+QVCASVSS+S+NM EL QWNELYGEGGSRKK +LSYFM
Sbjct  1204  DFKAAHDQVCASVSSDSSNMNELQQWNELYGEGGSRKKTSLSYFM  1248



>ref|XP_009111283.1| PREDICTED: uncharacterized protein LOC103836743 [Brassica rapa]
Length=1261

 Score =  1409 bits (3648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 766/1221 (63%), Positives = 910/1221 (75%), Gaps = 48/1221 (4%)
 Frame = +3

Query  270   GAVNESGPESAEQEIRSAD-LDGASALKSP----EAPVPEKLPEAPLGGEP--LVSPMIL  428
             G  ++ G ES E E+RS+D   G  A + P    + P+ E  PE     E   L +P + 
Sbjct  68    GPGSDPGSESGEPELRSSDPQQGVDAAEKPVVLTDVPLREASPETDANPEVDVLATPAVA  127

Query  429   GDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQ  608
              +   D +K KA       GKKR         W KLLSQYPQN H  +    FTVG+ R 
Sbjct  128   EEVVADGEKTKA-------GKKRA-----KAPWAKLLSQYPQNPHRIMRGPVFTVGR-RG  174

Query  609   CDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDE  788
             CDL + D S+  +LC LK  +   G S+  LEI+G    VQVNGK Y K + V L GGDE
Sbjct  175   CDLSIKDQSMPSTLCELKQAE-NGGPSVATLEITGNGVLVQVNGKCYQKGALVHLRGGDE  233

Query  789   VIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVAST  968
             VIF  SG+HAYIFQ   +E+ +A     S  + EA  G V     E R+G+ S V  AS 
Sbjct  234   VIFNISGRHAYIFQPLKDENQAAPDRASSQILFEARGGRVHS---ETRAGESSAVDGASI  290

Query  969   laslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDL--DSDMKDV---SDH  1133
             LASLS  +   L   P +      +Q PE+P  P     P  +D   D++M DV   +DH
Sbjct  291   LASLSKYRNLHLR--PPIAKSAKRQQNPEVPQEP-----PSCNDCISDTEMNDVDSNNDH  343

Query  1134  NDVPLDEKSGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPE  1310
               +   EK+ A +  + N+NLN     +D + + + G    +  E+RP++R+L  SS+  
Sbjct  344   AAIASVEKAVASTSYTANENLNAGGSGLDPFQEADGGNPPASGFEIRPILRLLGESSS--  401

Query  1311  FDLSGNISRIIDQRRE---LLKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPY  1481
              D+ G IS+++D+RRE   LLK+FD   ++STRRQAFKD L+  IL S NI+VS ++FPY
Sbjct  402   LDIRG-ISKLLDERREVRELLKEFDISSTISTRRQAFKDSLRGGILISQNIDVSLDNFPY  460

Query  1482  YLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKY  1658
             +LS  TK+VLIAS Y+H++  +KF K AS+LPT  PRILLSGPAGSEIYQE LAKALAK 
Sbjct  461   FLSATTKDVLIASMYVHMEGGSKFAKYASDLPTTSPRILLSGPAGSEIYQEMLAKALAKN  520

Query  1659  FGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEAD  1835
             FGA+L++VDSL+LPGGS A+E +  KE  + ER  +  KRA QAA    +KKP SSV+AD
Sbjct  521   FGAKLMIVDSLLLPGGSPAREAESSKEGSRRERLSMLAKRAVQAAQALQHKKPTSSVDAD  580

Query  1836  ITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQTPA-RGPAYGYKG  2006
             ITGGS +SS A  KQE STA+SK+ TFK GDRVK++GP  +  S LQ P  RGP  G++G
Sbjct  581   ITGGSMLSSQALPKQEVSTATSKSYTFKAGDRVKFLGPSSSAISSLQGPPLRGPTIGFQG  640

Query  2007  KVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAI  2186
             KV+LAFE+N  SKIG+RFDR +P+GNDLGGLCEEDHGFFCAA  LRLD SS DD DKLA+
Sbjct  641   KVVLAFEDNSSSKIGIRFDRPVPDGNDLGGLCEEDHGFFCAASSLRLDGSSGDDADKLAV  700

Query  2187  NELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNR  2366
             NE+FEV   E +   LILF+KDIEKS+VGN + ++  K KLE LP+N+VV+AS TQ D R
Sbjct  701   NEIFEVALSEAEGGSLILFLKDIEKSLVGNSDVYATLKSKLENLPDNIVVMASQTQLDTR  760

Query  2367  KEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIP  2546
             KEKSHPGGFLFTKFG NQTALLDLAFPDNF +LHDRSKETPK++KQ+TRLFPNKV IQ+P
Sbjct  761   KEKSHPGGFLFTKFGGNQTALLDLAFPDNFSKLHDRSKETPKSMKQITRLFPNKVAIQLP  820

Query  2547  QDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEK  2726
             QDE LLSDWK++LDRD E +K Q+N  +I  VL +  LDCPD+ TLCIKDQ L  ES EK
Sbjct  821   QDEALLSDWKEKLDRDTELLKVQANITSILGVLTKNRLDCPDLGTLCIKDQTLLPESAEK  880

Query  2727  IIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEF  2906
             ++GWA SHH M+ SE + K+ KL IS+ESI YGL +L GVQNE KS+KKSLKDVVTENEF
Sbjct  881   VVGWAFSHHLMNCSEPTVKDNKLVISAESITYGLQMLLGVQNENKSLKKSLKDVVTENEF  940

Query  2907  EKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLF  3086
             EKKLL+DVIPPSDIGV+FDDIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLF
Sbjct  941   EKKLLSDVIPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPELFDKGQLTKPTKGILLF  1000

Query  3087  GPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVD  3266
             GPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVD
Sbjct  1001  GPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVD  1060

Query  3267  EVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRL  3446
             EVDSMLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRL
Sbjct  1061  EVDSMLGRRENPGEHEAMRKMKNEFMINWDGLRTKDRERVLVLAATNRPFDLDEAVIRRL  1120

Query  3447  PRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPI  3626
             PRRLMVNLPDA NR KIL +IL KEE++P+VDL AIANMT+GYSGSDLKNLCVTAAH PI
Sbjct  1121  PRRLMVNLPDATNRAKILSVILAKEEISPDVDLGAIANMTDGYSGSDLKNLCVTAAHLPI  1180

Query  3627  ReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELL  3806
             REILEKEKKEK  A +ENRP P L++ +DIRPL M DF+ AHEQVCASVS++S+NM EL 
Sbjct  1181  REILEKEKKEKTAAEAENRPTPPLYSCTDIRPLTMTDFKAAHEQVCASVSTDSSNMNELQ  1240

Query  3807  QWNELYGEGGSRKKKALSYFM  3869
             QWNELYGEGGSRKK +LSYFM
Sbjct  1241  QWNELYGEGGSRKKTSLSYFM  1261



>gb|KDO87286.1| hypothetical protein CISIN_1g000858mg [Citrus sinensis]
Length=1116

 Score =  1409 bits (3646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 735/1099 (67%), Positives = 872/1099 (79%), Gaps = 22/1099 (2%)
 Frame = +3

Query  207   KRSKATESLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPE  386
             KRSKAT++  ST DM       A ++SG ES E E+RS+DLD     K  +    +K  +
Sbjct  27    KRSKATDAPPSTGDMPVAPPSEAASKSGSESREPELRSSDLDLTDDAKPADV---DKSVD  83

Query  387   APLGGEPLVSPMILGDSAIDVDKVKANGSALN-RGKKRQLK-SNLGTA--WGKLLSQYPQ  554
             A +  + LVSP   G++A+D +K KA G   N R KKR  K   +G+   W +L+SQ  Q
Sbjct  84    ADVEADALVSPPTPGETAVDAEKSKAVGVVFNGRVKKRATKLGKVGSRIPWARLISQCSQ  143

Query  555   NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQV  734
             NSH+ +  + FTVG  RQCDL + DPS+SK+LC L+ I+   G S  LLEI+G KG V+V
Sbjct  144   NSHLSMTGAVFTVGHNRQCDLYLKDPSISKNLCRLRRIE-NGGPSGALLEITGGKGEVEV  202

Query  735   NGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKG  914
             NG ++PK+S V L GGDE++F  SGKH+YIFQ+ +++ ++A  + P +SILEA S P+K 
Sbjct  203   NGNVHPKDSQVVLRGGDELVFSPSGKHSYIFQQLSDDTLAAPGIHPPMSILEAQSAPLKT  262

Query  915   VNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDK  1094
             ++ EARSGDPS VA AS LASLSN++K+L L+PP      D  Q  E+ +L      P+ 
Sbjct  263   MHIEARSGDPSAVAGASILASLSNIQKDLSLIPPPTKAGVD-AQNSEIASLASGCDGPED  321

Query  1095  HDLDSDMKDVSDHNDVPLDEKSG-AISP--DSGNDNLNLENGAIDS-YDGEIGKVTGAPQ  1262
                D DMKD + +ND       G  + P  D+ N+N NL++  +D+  D EIGK+ GA  
Sbjct  322   RIPDVDMKDATSNNDDAGSSSRGKTVVPQSDAANENPNLDSIGLDACVDAEIGKIPGATY  381

Query  1263  ELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFD-PLISMSTRRQAFKDGLQQ  1430
             ELRPL+RMLAGSS+P+FD+SG IS+I+D++RE   LLKD D P + +S RRQAFKD LQ+
Sbjct  382   ELRPLLRMLAGSSSPDFDISGGISKILDEQREIRELLKDSDRPTVLISARRQAFKDSLQE  441

Query  1431  TILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPA  1610
              IL   NIEVSFE FPYYLS+ITKNVLIASTY+HLKCN F K AS+LPT+CPRILLSGPA
Sbjct  442   GILGPENIEVSFESFPYYLSDITKNVLIASTYVHLKCNNFAKYASDLPTMCPRILLSGPA  501

Query  1611  GSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAAQAA  1790
             GSEIYQETLAKALAK+F ARLL+VDSL+LPGGS+KE D VKE+ + E+  +F KRAA   
Sbjct  502   GSEIYQETLAKALAKHFSARLLIVDSLLLPGGSSKEADSVKESSRTEKASMFAKRAA---  558

Query  1791  VLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSL  1967
              L  ++KP SSVEADITGG+A+ S A  K E STASSKN TFK GDRVK+VG + +G ++
Sbjct  559   -LLQHRKPTSSVEADITGGTAVGSQALPKPEISTASSKNYTFKKGDRVKFVGNVTSGTTV  617

Query  1968  QTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRL  2147
             Q   RGP  G++G+V+L FE+N FSKIGVRFDRSIPEGN+LGG CE+DHGFFC A  LRL
Sbjct  618   QPTLRGPGIGFRGRVILPFEDNDFSKIGVRFDRSIPEGNNLGGFCEDDHGFFCTASSLRL  677

Query  2148  DNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPEN  2327
             D+S  D++DKLAINELFEV   E KSSPLI+FVKDIEKS+ GN +A+ A K KLE LP N
Sbjct  678   DSSLGDEVDKLAINELFEVALNESKSSPLIVFVKDIEKSLTGNNDAYGALKSKLENLPSN  737

Query  2328  VVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQL  2507
             VVVI S+TQ D+RKEKSHPGG LFTKFGSNQTALLDLAFPDNF RLHDRSKETPKA+KQ+
Sbjct  738   VVVIGSHTQLDSRKEKSHPGGLLFTKFGSNQTALLDLAFPDNFSRLHDRSKETPKALKQI  797

Query  2508  TRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLC  2687
             +RLFPNKV IQ+PQDE LLSDWKQQL+RD+ET+K QSN ++IR+VL+R  LDC D+E+LC
Sbjct  798   SRLFPNKVTIQLPQDEALLSDWKQQLERDVETLKGQSNIISIRSVLSRNGLDCVDLESLC  857

Query  2688  IKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSV  2867
             IKDQ LT E VEKI+GWALSHHFMH SE+  K+ KL IS+ESI YGL++LQG+Q+E+KS+
Sbjct  858   IKDQTLTTEGVEKIVGWALSHHFMHCSEAPGKDAKLKISTESIMYGLNILQGIQSESKSL  917

Query  2868  KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  3047
             KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK
Sbjct  918   KKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCK  977

Query  3048  GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFT  3227
             GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+
Sbjct  978   GQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFS  1037

Query  3228  LASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  3407
             LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN
Sbjct  1038  LASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATN  1097

Query  3408  RPFDLDEAVIRRLPRRLMV  3464
             RPFDLDEAV+RRLPRR  V
Sbjct  1098  RPFDLDEAVVRRLPRRTCV  1116



>ref|XP_010429758.1| PREDICTED: uncharacterized protein LOC104714166 isoform X2 [Camelina 
sativa]
Length=1248

 Score =  1408 bits (3645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 754/1237 (61%), Positives = 921/1237 (74%), Gaps = 35/1237 (3%)
 Frame = +3

Query  207   KRSKATE----SLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKSPEAPVPE  374
             KRSKAT     S S+++  +  + P +  + G ES E E+ S+D     A    E PVP 
Sbjct  31    KRSKATAEPAGSSSASEVPIENQVPAS--DPGSESGEPELGSSDPQPMDA----EKPVPT  84

Query  375   KLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQ  554
              +P      E   +P +     +    + A  +      K   K      W KLLSQY  
Sbjct  85    DVPVIENSPETDANPQV---QVLATPTIAAEVATDAEKSKAAKKRASKAPWAKLLSQYSL  141

Query  555   NSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGN-SITLLEISGKKGCVQ  731
             N H  +    FTVG+ R CDL + D S+  +LC LK  Q E G  ++  LEI G    VQ
Sbjct  142   NPHRIMRSPVFTVGR-RGCDLSIKDQSMPATLCELK--QSEPGGPTVASLEIIGNGVLVQ  198

Query  732   VNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVK  911
             VNGK Y KN+ V L GGDEV+F  S KH+YIFQ   +E+++A     S++I EA   P+K
Sbjct  199   VNGKCYQKNACVNLRGGDEVVFSVSAKHSYIFQPIKDENLAAPDRSSSLNICEARGSPLK  258

Query  912   GVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPD  1091
             GV+ E R+GD S V  AS LASLS  +   LL  P +      +Q PE+P +P +  +  
Sbjct  259   GVHVETRAGDSSAVDGASILASLSKYRNFHLL--PPIAKAAKRQQNPEVPVVPSSCNDCI  316

Query  1092  KHDLDSDMKDVSDHND---VPLDEKSGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAP  1259
                 D++M D   +ND   +   EK+ A +  + N+NLN++   +D + + + G V G+ 
Sbjct  317   S---DTEMNDADSNNDQAAIAAVEKNVASTSCTANENLNVDGSGLDPFQEADGGNVPGSG  373

Query  1260  QELRPLIRMLAGSSTPEFDLSGNISRIIDQRREL---LKDFDPLISMSTRRQAFKDGLQQ  1430
              E+RP+  +L  SS+  FD+ G+IS+++D+RRE+   L++FD   ++STRRQAFKD L+ 
Sbjct  374   FEIRPITHLLGESSS--FDIRGSISKLLDERREVREFLREFDLSSTISTRRQAFKDSLRG  431

Query  1431  TILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGP  1607
              +L++ NIEVSFE+FPYYLS +TK+VLI S ++H+   NK+ K  S+L T CPRILLSGP
Sbjct  432   GVLNAENIEVSFENFPYYLSAMTKDVLITSMFVHMNGGNKYAKYGSDLTTTCPRILLSGP  491

Query  1608  AGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQ  1784
             AGSEIYQE LAKA AK FGA+L++VDSL+LPGGS A+E +  KE  + E+  +  KRA Q
Sbjct  492   AGSEIYQEMLAKAFAKNFGAKLMIVDSLLLPGGSPAREAESSKEGSRREKLSMLAKRAVQ  551

Query  1785  AAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGF  1961
             AA    +KKP SSV+ADITGGS +SS A  KQE STA+SK+ TFK GDRV++ GP  +  
Sbjct  552   AAQALQHKKPTSSVDADITGGSTLSSQALPKQEVSTATSKSYTFKAGDRVRFAGPSSSAV  611

Query  1962  S-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADF  2138
             S LQ   RGP+ G +GKVLLAFE+N  SKIG+RFDR + +GNDLGGLCEE+HGFFCAA  
Sbjct  612   SSLQGTLRGPSIGSQGKVLLAFEDNSASKIGIRFDRPVQDGNDLGGLCEEEHGFFCAASS  671

Query  2139  LRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKL  2318
             LRLD SS DD DKLA+NE+FEV   E +   LILF+KDIEKS+VGN + ++  K KLE L
Sbjct  672   LRLDGSSSDDADKLAVNEIFEVAYSESEGGSLILFLKDIEKSLVGNSDVYATLKSKLETL  731

Query  2319  PENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAI  2498
             PEN+VV+AS TQ D+RKEKSHPGGFLFTKFG NQTALLDLAFPDNFG+LHDRSKETPK++
Sbjct  732   PENIVVMASQTQLDSRKEKSHPGGFLFTKFGGNQTALLDLAFPDNFGKLHDRSKETPKSM  791

Query  2499  KQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIE  2678
             KQLTRLFPNK+ IQ+PQDE LL DWK++L+RD E +K Q+N  +I  VL +  LDCPD+ 
Sbjct  792   KQLTRLFPNKIAIQLPQDEALLLDWKEKLERDTEILKVQANITSILAVLTKNRLDCPDLG  851

Query  2679  TLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNET  2858
             TL IKDQ L +ESVEK++GWA  HH ++  + + K+ KL IS+ESI YGL +L G+QNE 
Sbjct  852   TLSIKDQTLPSESVEKVVGWAYGHHLINCKDPTVKDNKLVISAESIAYGLQMLHGIQNEN  911

Query  2859  KSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPEL  3038
             KS+KKSLKDVVTENEFEKKLL+DVIPPSDIGV+FDDIGALENVKDTLKELVMLPLQRPEL
Sbjct  912   KSLKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPEL  971

Query  3039  FCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA  3218
             F KGQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA
Sbjct  972   FDKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA  1031

Query  3219  VFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLA  3398
             VF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKD+ERVLVLA
Sbjct  1032  VFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMINWDGLRTKDRERVLVLA  1091

Query  3399  ATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYS  3578
             ATNRPFDLDEAVIRRLPRRLMVNLPDA NR KIL +IL KE++AP+VDL+AIANMT+GYS
Sbjct  1092  ATNRPFDLDEAVIRRLPRRLMVNLPDATNRSKILSVILAKEDIAPDVDLEAIANMTDGYS  1151

Query  3579  GSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQ  3758
             GSDLKNLCVTAAH PIREILEKEKKEK  A +ENRP P L++ +D+RPL M+DF+ AH+Q
Sbjct  1152  GSDLKNLCVTAAHLPIREILEKEKKEKTAAHAENRPTPPLYSCTDVRPLTMNDFKAAHDQ  1211

Query  3759  VCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             VCASVSS+S+NM EL QWNELYGEGGSRKK +LSYFM
Sbjct  1212  VCASVSSDSSNMNELQQWNELYGEGGSRKKTSLSYFM  1248



>gb|AAM13995.1| unknown protein [Arabidopsis thaliana]
Length=1265

 Score =  1408 bits (3645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 744/1218 (61%), Positives = 906/1218 (74%), Gaps = 36/1218 (3%)
 Frame = +3

Query  270   GAVNESGPESAEQEIRSAD---LDGASALKSPEAPVPEKLPEAPLGGEP--LVSPMILGD  434
             G  ++ G ES E E+ S+D   +D    + + + PV E  PE     E   L +P + G+
Sbjct  66    GPASDPGSESGEPELGSSDPQAMDAEKPVVTTDVPVMENSPETDANPEVEVLATPTVAGE  125

Query  435   SAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCD  614
             +  D DK KA      +             W KLLSQY QN H  +    FTVG+ R CD
Sbjct  126   AVADADKSKAAKKRALK-----------APWAKLLSQYSQNPHRVIRGPVFTVGR-RGCD  173

Query  615   LCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVI  794
             L + D ++  +LC LK  +   G S+  LEI G    V VNGK Y K++ V L GGDEVI
Sbjct  174   LSIRDQAMPSTLCELKQSEH-GGPSVASLEILGNGVIVHVNGKCYQKSTCVHLRGGDEVI  232

Query  795   FGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVA-VASTl  971
             F  +GKHAYIFQ   +E+++A     S+SI EA   P+KGV+ E R+GD    + V    
Sbjct  233   FSLNGKHAYIFQPVKDENLAAPDRASSLSICEARGAPLKGVHVETRAGDVDGASDVDGAS  292

Query  972   aslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND----  1139
                S  K     L P +      +Q P +P +P +  +      D+DM D   +ND    
Sbjct  293   ILASLSKLRSFHLLPPIAKAGKRQQNPAVPVVPSSFNDCIS---DTDMNDADSNNDHAAV  349

Query  1140  VPLDEKSGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFD  1316
               +++ + A +P + N+NLN++   +D + + + G V  A  E+RP++ +L  SS+  FD
Sbjct  350   ASVEKIAAASTPGTANENLNVDGSGLDPFQEADGGNVPAAGYEIRPIVHLLGESSS--FD  407

Query  1317  LSGNISRIIDQRREL---LKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYL  1487
             + G+ISR++D+RRE+   L++FD   ++STRRQAFKD L+  +L++ NI++SFE+FPYYL
Sbjct  408   IRGSISRLLDERREVKEFLREFDLSSTISTRRQAFKDSLRGGVLNAQNIDISFENFPYYL  467

Query  1488  SEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFG  1664
             S  TK VL+ S Y+H+   +K+   A++L T CPRILLSGP+ SEIYQE LAKALAK FG
Sbjct  468   SATTKGVLMISMYVHMNGGSKYANFATDLTTACPRILLSGPSSSEIYQEMLAKALAKQFG  527

Query  1665  ARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADIT  1841
             A+L++VDSL+LPGGS A+E +  KE  + ER  +  KRA QAA +  +KKP SSV+ADIT
Sbjct  528   AKLMIVDSLLLPGGSPAREAESSKEGSRRERLSMLAKRAVQAAQVLQHKKPTSSVDADIT  587

Query  1842  GGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVL  2015
             GGS +SS A  KQE STA+SK+ TFK GDRVK+VGP  +  S LQ   RGPA G +GKV 
Sbjct  588   GGSTLSSQALPKQEVSTATSKSYTFKAGDRVKFVGPSASAISSLQGQLRGPAIGSQGKVA  647

Query  2016  LAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINEL  2195
             LAFE+N  SKIG+RFDR + +GNDLGGLCEEDHGFFCAA  LRL+ SS DD DKLA+NE+
Sbjct  648   LAFEDNCASKIGIRFDRPVQDGNDLGGLCEEDHGFFCAASSLRLEGSSSDDADKLAVNEI  707

Query  2196  FEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEK  2375
             FEV   E +   LILF+KDIEKS+VGN + ++  K KLE LPEN+VVIAS TQ D+RKEK
Sbjct  708   FEVALSESEGGSLILFLKDIEKSLVGNSDVYATLKSKLETLPENIVVIASQTQLDSRKEK  767

Query  2376  SHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDE  2555
             SHPGGFLFTKFG NQTALLDLAFPDNFG+LHDRSKETPK++KQ+TRLFPNK+ IQ+PQ+E
Sbjct  768   SHPGGFLFTKFGGNQTALLDLAFPDNFGKLHDRSKETPKSMKQITRLFPNKIAIQLPQEE  827

Query  2556  TLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIG  2735
              LLSDWK++LDRD E +K Q+N  +I  VL + +LDCPD+ TLCIKDQ L +ESVEK++G
Sbjct  828   ALLSDWKEKLDRDTEILKVQANITSILAVLAKNKLDCPDLGTLCIKDQTLPSESVEKVVG  887

Query  2736  WALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKK  2915
             WA  HH M  +E   K+ KL IS+ESI YGL  L  +QNE KS+KKSLKDVVTENEFEKK
Sbjct  888   WAFGHHLMICTEPIVKDNKLVISAESISYGLQTLHDIQNENKSLKKSLKDVVTENEFEKK  947

Query  2916  LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPP  3095
             LL+DVIPPSDIGV+FDDIGALENVK+TLKELVMLPLQRPELF KGQLTKP KGILLFGPP
Sbjct  948   LLSDVIPPSDIGVSFDDIGALENVKETLKELVMLPLQRPELFDKGQLTKPTKGILLFGPP  1007

Query  3096  GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVD  3275
             GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVD
Sbjct  1008  GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVD  1067

Query  3276  SMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRR  3455
             SMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLPRR
Sbjct  1068  SMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRR  1127

Query  3456  LMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIRei  3635
             LMVNLPDA NR KIL +IL KEE+AP+VDL+AIANMT+GYSGSDLKNLCVTAAH PIREI
Sbjct  1128  LMVNLPDATNRSKILSVILAKEEIAPDVDLEAIANMTDGYSGSDLKNLCVTAAHFPIREI  1187

Query  3636  lekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWN  3815
             LEKEKKEK  A +ENRP P L++ +D+R L M+DF+ AH+QVCASVSS+S+NM EL QWN
Sbjct  1188  LEKEKKEKTAAQAENRPTPPLYSCTDVRSLTMNDFKAAHDQVCASVSSDSSNMNELQQWN  1247

Query  3816  ELYGEGGSRKKKALSYFM  3869
             ELYGEGGSRKK +LSYFM
Sbjct  1248  ELYGEGGSRKKTSLSYFM  1265



>ref|XP_010422582.1| PREDICTED: uncharacterized protein LOC104707848 isoform X1 [Camelina 
sativa]
Length=1261

 Score =  1408 bits (3644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 750/1214 (62%), Positives = 912/1214 (75%), Gaps = 45/1214 (4%)
 Frame = +3

Query  288   GPESAEQEIRSADLDGASALKSPEAPVPEKLP--------EAPLGGEPLVSPMILGDSAI  443
             G ES E E+ S+D     A    E PVP  +P        +A    E L +P I  + A 
Sbjct  73    GSESGEPELGSSDPQPMDA----EKPVPTDVPVIENSPETDANPQVEVLATPTIAAEVAT  128

Query  444   DVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCV  623
             D +K KA     ++             W KLLSQY  N H  +    FTVG+ R CDL +
Sbjct  129   DAEKSKAAKKRASK-----------APWAKLLSQYSLNPHRIMRSPVFTVGR-RGCDLSI  176

Query  624   DDPSVSKSLCNLKHIQREKGN-SITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFG  800
              D S+  +LC LK  Q E G  ++  LEI G    VQVNGK Y KN+ V L GGDEV+F 
Sbjct  177   KDQSMPTTLCELK--QSEPGGPTVASLEIIGNGVLVQVNGKCYQKNACVNLRGGDEVVFS  234

Query  801   SSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlasl  980
              S KH+YIFQ   +E+++A     S++I EA   P+KGV+ E R+GD S V  AS LASL
Sbjct  235   VSAKHSYIFQPIKDENLAAPDRSSSLNICEARGSPLKGVHVETRAGDSSAVDGASILASL  294

Query  981   snlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND---VPLD  1151
             S  +   LL  P +      +Q PE+P +P +  +      D+DM D   +ND   +   
Sbjct  295   SKYRNFHLL--PPIAKAAKRQQNPEVPVVPSSCNDCIS---DTDMNDADSNNDQAAIAAV  349

Query  1152  EKSGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGN  1328
             EK+ A +  + N+NLN++   +D + + + G V G+  E+RP++ +L  SS+  FD+ G+
Sbjct  350   EKNAASTSCTANENLNVDGSGLDPFQEADGGNVPGSGYEIRPIMHLLGESSS--FDIRGS  407

Query  1329  ISRIIDQRREL---LKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEIT  1499
             IS+++D+RRE+   L++FD   ++STRRQAFKD L+  +L++ NIEVSFE+FPY+LS +T
Sbjct  408   ISKLLDERREVREFLREFDLSSTISTRRQAFKDSLRGGVLNAENIEVSFENFPYFLSAMT  467

Query  1500  KNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLL  1676
             K+VLI S ++H+   NK+ K  S+L T CPRILLSGPAGSEIYQE LAKA AK FGA+L+
Sbjct  468   KDVLITSMFVHMNGGNKYAKYGSDLTTTCPRILLSGPAGSEIYQEMLAKAFAKNFGAKLM  527

Query  1677  VVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSA  1853
             +VDSL+LPGGS A+E +  KE  + E+  +  KRA QAA    +KKP SSV+ADITGGS 
Sbjct  528   IVDSLLLPGGSPAREAESSKEGSRREKLSMLAKRAVQAAQALQHKKPTSSVDADITGGST  587

Query  1854  ISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFE  2027
             +SS A  KQE STA+SK+ TFK GDRV++ G   +  S LQ   RGP+ G +GKVLLAFE
Sbjct  588   LSSQALPKQEVSTATSKSYTFKAGDRVRFAGFSSSAVSSLQGSLRGPSIGSQGKVLLAFE  647

Query  2028  ENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVV  2207
             +N  SKIG+RFDR + +GNDLGGLCEE+HGFFCAA  LRLD SS DD DKLA+NE+FEV 
Sbjct  648   DNSASKIGIRFDRPVQDGNDLGGLCEEEHGFFCAASSLRLDGSSSDDADKLAVNEIFEVA  707

Query  2208  SQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPG  2387
               E +   LILF+KDIEKS+VGN + ++  K KLE LPEN+VV+AS TQ D+RKEKSHPG
Sbjct  708   YSESEGGSLILFLKDIEKSLVGNSDVYATLKSKLETLPENIVVMASQTQLDSRKEKSHPG  767

Query  2388  GFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLS  2567
             GFLFTKFG NQTALLDLAFPDNFG+LHDRSKETPK++KQ+TRLFPNK+ IQ+PQDE LL 
Sbjct  768   GFLFTKFGGNQTALLDLAFPDNFGKLHDRSKETPKSMKQITRLFPNKIAIQLPQDEALLL  827

Query  2568  DWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALS  2747
             DWK++L+RD E +K Q+N  +I  VL +  LDCPD+ TL IKDQ L +ESVEK++GWA  
Sbjct  828   DWKEKLERDTEILKVQANITSILAVLTKNRLDCPDLGTLSIKDQTLPSESVEKVVGWAYG  887

Query  2748  HHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLAD  2927
             HH ++ SE + K+ KL IS+ESI YGL +L G+QNE KS+KKSLKDVVTENEFEKKLL+D
Sbjct  888   HHLINCSEPTVKDNKLVISAESIAYGLQMLHGIQNENKSLKKSLKDVVTENEFEKKLLSD  947

Query  2928  VIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGK  3107
             VIPPSDIGV+FDDIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFGPPGTGK
Sbjct  948   VIPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPELFDKGQLTKPTKGILLFGPPGTGK  1007

Query  3108  TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLG  3287
             TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLG
Sbjct  1008  TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLG  1067

Query  3288  RRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVN  3467
             RRE+PGEHEAMRKMKNEFM+NWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLPRRLMVN
Sbjct  1068  RRENPGEHEAMRKMKNEFMINWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRRLMVN  1127

Query  3468  LPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReileke  3647
             LPDA NR KIL +IL KE++AP+VDL+AIANMT+GYSGSDLKNLCVTAAH PIREILEKE
Sbjct  1128  LPDATNRSKILSVILAKEDIAPDVDLEAIANMTDGYSGSDLKNLCVTAAHLPIREILEKE  1187

Query  3648  kkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYG  3827
             KKEK  A +ENRP P L++ +D+RPL M+DF+ AH+QVCASVSS+S+NM EL QWNELYG
Sbjct  1188  KKEKTAAQAENRPTPPLYSCTDVRPLTMNDFKAAHDQVCASVSSDSSNMNELQQWNELYG  1247

Query  3828  EGGSRKKKALSYFM  3869
             EGGSRKK +LSYFM
Sbjct  1248  EGGSRKKTSLSYFM  1261



>ref|XP_010456024.1| PREDICTED: uncharacterized protein LOC104737518 isoform X1 [Camelina 
sativa]
 ref|XP_010456025.1| PREDICTED: uncharacterized protein LOC104737518 isoform X2 [Camelina 
sativa]
Length=1264

 Score =  1405 bits (3637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 749/1214 (62%), Positives = 911/1214 (75%), Gaps = 45/1214 (4%)
 Frame = +3

Query  288   GPESAEQEIRSADLDGASALKSPEAPVPEKLP--------EAPLGGEPLVSPMILGDSAI  443
             G ES E E+ S+D     A    E PVP  +P        +A    E L +P I  + A 
Sbjct  76    GSESGEPELGSSDPQPMDA----EKPVPTDVPVIENSPETDANPQVEVLATPTIAAEVAT  131

Query  444   DVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCV  623
             D +K KA     ++             W KLLSQY  N H  +    FTVG+ R CDL +
Sbjct  132   DAEKSKAAKKRASK-----------APWAKLLSQYSLNPHRIMRSPVFTVGR-RGCDLSI  179

Query  624   DDPSVSKSLCNLKHIQREKGN-SITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFG  800
              D S+  +LC LK  Q E G  ++  LEI G    VQVNGK Y KN+ V L GGDEV+F 
Sbjct  180   KDQSMPTTLCELK--QSEPGGPTVASLEIIGNGVLVQVNGKCYQKNACVNLRGGDEVVFS  237

Query  801   SSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlasl  980
              S KH+YIFQ   +E+++A     S++I EA   P+KGV+ E R+GD S V  AS LASL
Sbjct  238   VSAKHSYIFQPIKDENLAAPDRSSSLNICEARGSPLKGVHVETRAGDSSAVDGASILASL  297

Query  981   snlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND---VPLD  1151
             S  +   LL  P +      +Q PE+P +P +  +      D++M D   +ND   +   
Sbjct  298   SKYRNFHLL--PPIAKAAKRQQNPEVPVVPSSCNDCIS---DTEMNDADSNNDQAAIAAL  352

Query  1152  EKSGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGN  1328
             EK+ A +  + N+NLN +   +D + + + G V G+  E+RP+  +L  SS+  FD+ G+
Sbjct  353   EKNAASTSCTANENLNGDGSGLDPFQEADGGNVPGSGYEIRPITHLLGESSS--FDIRGS  410

Query  1329  ISRIIDQRREL---LKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEIT  1499
             IS+++D+RRE+   L++FD   ++STRRQAFKD L+  +L++ NIEVSFE+FPY+LS +T
Sbjct  411   ISKLLDERREVREFLREFDLSSTISTRRQAFKDSLRGGVLNAENIEVSFENFPYFLSAMT  470

Query  1500  KNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLL  1676
             K+VLI S ++H+   NK+ K  S+L T CPRILLSGPAGSEIYQE LAKA AK FGA+L+
Sbjct  471   KDVLITSMFVHMNGGNKYAKYGSDLTTTCPRILLSGPAGSEIYQEMLAKAFAKNFGAKLM  530

Query  1677  VVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSA  1853
             +VDSL+LPGGS A+E +  KE  + E+  +  KRA QAA    +KKP SSV+ADITGGS 
Sbjct  531   IVDSLLLPGGSPAREAESSKEGSRREKLSMLAKRAVQAAQALQHKKPTSSVDADITGGST  590

Query  1854  ISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFE  2027
             +SS A  KQE STA+SK+ TFK GDRV++ GP  +  S LQ   RGP+ G +GKVLLAFE
Sbjct  591   LSSQALPKQEVSTATSKSYTFKAGDRVRFAGPSSSAVSSLQGTLRGPSIGSQGKVLLAFE  650

Query  2028  ENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVV  2207
             +N  SKIG+RFDR + +GNDLGGLCEE+HGFFCAA  LRLD SS DD DKLA+NE+FEV 
Sbjct  651   DNSASKIGIRFDRPVQDGNDLGGLCEEEHGFFCAASSLRLDGSSSDDADKLAVNEIFEVA  710

Query  2208  SQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPG  2387
               E +   LILF+KDIEKS+VGN + ++  K KLE LPEN+VV+AS TQ D+RKEKSHPG
Sbjct  711   YNESEGGSLILFLKDIEKSLVGNSDVYATLKSKLETLPENIVVMASQTQLDSRKEKSHPG  770

Query  2388  GFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLS  2567
             GFLFTKFG NQTALLDLAFPDNFG+LHDRSKETPK++KQ+TRLFPNK+ IQ+PQDE LL 
Sbjct  771   GFLFTKFGGNQTALLDLAFPDNFGKLHDRSKETPKSMKQITRLFPNKIAIQLPQDEALLL  830

Query  2568  DWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALS  2747
             DWK++L+RD + +K Q+N  +I  VL +  LDCPD+ TL IKDQ L +ESVEK++GWA  
Sbjct  831   DWKEKLERDTQILKVQANITSILAVLTKNRLDCPDLGTLSIKDQTLPSESVEKVVGWAYG  890

Query  2748  HHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLAD  2927
             HH ++ SE + K+ KL IS+ESI YGL +L G+QNE KS+KKSLKDVVTENEFEKKLL+D
Sbjct  891   HHLINCSEPTVKDNKLVISAESIAYGLQMLHGIQNENKSLKKSLKDVVTENEFEKKLLSD  950

Query  2928  VIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGK  3107
             VIPPSDIGV+FDDIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFGPPGTGK
Sbjct  951   VIPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPELFDKGQLTKPTKGILLFGPPGTGK  1010

Query  3108  TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLG  3287
             TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLG
Sbjct  1011  TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLG  1070

Query  3288  RRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVN  3467
             RRE+PGEHEAMRKMKNEFM+NWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLPRRLMVN
Sbjct  1071  RRENPGEHEAMRKMKNEFMINWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRRLMVN  1130

Query  3468  LPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReileke  3647
             LPDA NR KIL +IL KE++AP+VDL+AIANMT+GYSGSDLKNLCVTAAH PIREILEKE
Sbjct  1131  LPDATNRSKILSVILAKEDIAPDVDLEAIANMTDGYSGSDLKNLCVTAAHLPIREILEKE  1190

Query  3648  kkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYG  3827
             KKEK  A +ENRP P L++ +D+RPL M+DF+ AH+QVCASVSS+S+NM EL QWNELYG
Sbjct  1191  KKEKTAAQAENRPTPPLYSCTDVRPLTMNDFKAAHDQVCASVSSDSSNMNELQQWNELYG  1250

Query  3828  EGGSRKKKALSYFM  3869
             EGGSRKK +LSYFM
Sbjct  1251  EGGSRKKTSLSYFM  1264



>ref|XP_010429750.1| PREDICTED: uncharacterized protein LOC104714166 isoform X1 [Camelina 
sativa]
Length=1261

 Score =  1405 bits (3637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/1206 (62%), Positives = 905/1206 (75%), Gaps = 29/1206 (2%)
 Frame = +3

Query  288   GPESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKAN  467
             G ES E E+ S+D     A    E PVP  +P      E   +P +     +    + A 
Sbjct  73    GSESGEPELGSSDPQPMDA----EKPVPTDVPVIENSPETDANPQV---QVLATPTIAAE  125

Query  468   GSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKS  647
              +      K   K      W KLLSQY  N H  +    FTVG+ R CDL + D S+  +
Sbjct  126   VATDAEKSKAAKKRASKAPWAKLLSQYSLNPHRIMRSPVFTVGR-RGCDLSIKDQSMPAT  184

Query  648   LCNLKHIQREKGN-SITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYI  824
             LC LK  Q E G  ++  LEI G    VQVNGK Y KN+ V L GGDEV+F  S KH+YI
Sbjct  185   LCELK--QSEPGGPTVASLEIIGNGVLVQVNGKCYQKNACVNLRGGDEVVFSVSAKHSYI  242

Query  825   FQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkell  1004
             FQ   +E+++A     S++I EA   P+KGV+ E R+GD S V  AS LASLS  +   L
Sbjct  243   FQPIKDENLAAPDRSSSLNICEARGSPLKGVHVETRAGDSSAVDGASILASLSKYRNFHL  302

Query  1005  llPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND---VPLDEKSGAISP  1175
             L  P +      +Q PE+P +P +  +      D++M D   +ND   +   EK+ A + 
Sbjct  303   L--PPIAKAAKRQQNPEVPVVPSSCNDCIS---DTEMNDADSNNDQAAIAAVEKNVASTS  357

Query  1176  DSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQR  1352
              + N+NLN++   +D + + + G V G+  E+RP+  +L  SS+  FD+ G+IS+++D+R
Sbjct  358   CTANENLNVDGSGLDPFQEADGGNVPGSGFEIRPITHLLGESSS--FDIRGSISKLLDER  415

Query  1353  REL---LKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIAST  1523
             RE+   L++FD   ++STRRQAFKD L+  +L++ NIEVSFE+FPYYLS +TK+VLI S 
Sbjct  416   REVREFLREFDLSSTISTRRQAFKDSLRGGVLNAENIEVSFENFPYYLSAMTKDVLITSM  475

Query  1524  YIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLP  1700
             ++H+   NK+ K  S+L T CPRILLSGPAGSEIYQE LAKA AK FGA+L++VDSL+LP
Sbjct  476   FVHMNGGNKYAKYGSDLTTTCPRILLSGPAGSEIYQEMLAKAFAKNFGAKLMIVDSLLLP  535

Query  1701  GGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTK  1877
             GGS A+E +  KE  + E+  +  KRA QAA    +KKP SSV+ADITGGS +SS A  K
Sbjct  536   GGSPAREAESSKEGSRREKLSMLAKRAVQAAQALQHKKPTSSVDADITGGSTLSSQALPK  595

Query  1878  QEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIG  2051
             QE STA+SK+ TFK GDRV++ GP  +  S LQ   RGP+ G +GKVLLAFE+N  SKIG
Sbjct  596   QEVSTATSKSYTFKAGDRVRFAGPSSSAVSSLQGTLRGPSIGSQGKVLLAFEDNSASKIG  655

Query  2052  VRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSP  2231
             +RFDR + +GNDLGGLCEE+HGFFCAA  LRLD SS DD DKLA+NE+FEV   E +   
Sbjct  656   IRFDRPVQDGNDLGGLCEEEHGFFCAASSLRLDGSSSDDADKLAVNEIFEVAYSESEGGS  715

Query  2232  LILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFG  2411
             LILF+KDIEKS+VGN + ++  K KLE LPEN+VV+AS TQ D+RKEKSHPGGFLFTKFG
Sbjct  716   LILFLKDIEKSLVGNSDVYATLKSKLETLPENIVVMASQTQLDSRKEKSHPGGFLFTKFG  775

Query  2412  SNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDR  2591
              NQTALLDLAFPDNFG+LHDRSKETPK++KQLTRLFPNK+ IQ+PQDE LL DWK++L+R
Sbjct  776   GNQTALLDLAFPDNFGKLHDRSKETPKSMKQLTRLFPNKIAIQLPQDEALLLDWKEKLER  835

Query  2592  DIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSE  2771
             D E +K Q+N  +I  VL +  LDCPD+ TL IKDQ L +ESVEK++GWA  HH ++  +
Sbjct  836   DTEILKVQANITSILAVLTKNRLDCPDLGTLSIKDQTLPSESVEKVVGWAYGHHLINCKD  895

Query  2772  SSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIG  2951
              + K+ KL IS+ESI YGL +L G+QNE KS+KKSLKDVVTENEFEKKLL+DVIPPSDIG
Sbjct  896   PTVKDNKLVISAESIAYGLQMLHGIQNENKSLKKSLKDVVTENEFEKKLLSDVIPPSDIG  955

Query  2952  VTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVA  3131
             V+FDDIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFGPPGTGKTMLAKAVA
Sbjct  956   VSFDDIGALENVKDTLKELVMLPLQRPELFDKGQLTKPTKGILLFGPPGTGKTMLAKAVA  1015

Query  3132  TEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEH  3311
             TEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEH
Sbjct  1016  TEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEH  1075

Query  3312  EAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRE  3491
             EAMRKMKNEFM+NWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NR 
Sbjct  1076  EAMRKMKNEFMINWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDATNRS  1135

Query  3492  KILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalai  3671
             KIL +IL KE++AP+VDL+AIANMT+GYSGSDLKNLCVTAAH PIREILEKEKKEK  A 
Sbjct  1136  KILSVILAKEDIAPDVDLEAIANMTDGYSGSDLKNLCVTAAHLPIREILEKEKKEKTAAH  1195

Query  3672  SENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKK  3851
             +ENRP P L++ +D+RPL M+DF+ AH+QVCASVSS+S+NM EL QWNELYGEGGSRKK 
Sbjct  1196  AENRPTPPLYSCTDVRPLTMNDFKAAHDQVCASVSSDSSNMNELQQWNELYGEGGSRKKT  1255

Query  3852  ALSYFM  3869
             +LSYFM
Sbjct  1256  SLSYFM  1261



>dbj|BAF02143.1| hypothetical protein [Arabidopsis thaliana]
Length=1135

 Score =  1405 bits (3636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 724/1129 (64%), Positives = 872/1129 (77%), Gaps = 22/1129 (2%)
 Frame = +3

Query  525   WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGN-SITLL  701
             W KLLSQY QN H  +    FTVG+ R CDL + D ++  +LC LK  Q E G  S+  L
Sbjct  15    WAKLLSQYSQNPHRVIRGPVFTVGR-RGCDLSIRDQAMPSTLCELK--QSEHGGPSVASL  71

Query  702   EISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVS  881
             EI G    V VNGK Y K++ V L GGDEVIF  +GKHAYIFQ   +E+++A     S+S
Sbjct  72    EILGNGVIVHVNGKCYQKSTCVHLRGGDEVIFSLNGKHAYIFQPVKDENLAAPDRASSLS  131

Query  882   ILEAHSGPVKGVNFEARSGDPSTVA-VASTlaslsnlkkellllPPSVCNDNDIKQGPEM  1058
             I EA   P+KGV+ E R+GD    + V       S  K     L P +      +Q P +
Sbjct  132   ICEARGAPLKGVHVETRAGDVDGASDVDGASILASLSKLRSFHLLPPIAKAGKRQQNPAV  191

Query  1059  PALPVASGEPDKHDLDSDMKDVSDHND----VPLDEKSGAISPDSGNDNLNLENGAIDSY  1226
             P +P +  +      D+DM D   +ND      +++ + A +P + N+NLN++   +D +
Sbjct  192   PVVPSSFNDCIS---DTDMNDADSNNDHAAVASVEKIAAASTPGTANENLNVDGSGLDPF  248

Query  1227  -DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRREL---LKDFDPLISMS  1394
              + + G V  A  E+RP++ +L  SS+  FD+ G+ISR++D+RRE+   L++FD   ++S
Sbjct  249   QEADGGNVPAAGYEIRPIVHLLGESSS--FDIRGSISRLLDERREVKEFLREFDLSSTIS  306

Query  1395  TRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASEL  1571
             TRRQAFKD L+  +L++ NI++SFE+FPYYLS  TK VL+ S Y+H+   +K+   A++L
Sbjct  307   TRRQAFKDSLRGGVLNAQNIDISFENFPYYLSATTKGVLMISMYVHMNGGSKYANFATDL  366

Query  1572  PTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKP  1748
              T CPRILLSGP+GSEIYQE LAKALAK FGA+L++VDSL+LPGGS A+E +  KE  + 
Sbjct  367   TTACPRILLSGPSGSEIYQEMLAKALAKQFGAKLMIVDSLLLPGGSPAREAESSKEGSRR  426

Query  1749  ERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGD  1925
             ER  +  KRA QAA +  +KKP SSV+ADITGGS +SS A  KQE STA+SK+ TFK GD
Sbjct  427   ERLSMLAKRAVQAAQVLQHKKPTSSVDADITGGSTLSSQALPKQEVSTATSKSYTFKAGD  486

Query  1926  RVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLC  2102
             RVK+VGP  +  S LQ   RGPA G +GKV LAFE+N  SKIG+RFDR + +GNDLGGLC
Sbjct  487   RVKFVGPSASAISSLQGQLRGPAIGSQGKVALAFEDNCASKIGIRFDRPVQDGNDLGGLC  546

Query  2103  EEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPE  2282
             EEDHGFFCAA  LRL+ SS DD DKLA+NE+FEV   E +   LILF+KDIEKS+VGN +
Sbjct  547   EEDHGFFCAASSLRLEGSSSDDADKLAVNEIFEVALSESEGGSLILFLKDIEKSLVGNSD  606

Query  2283  AFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGR  2462
              ++  K KLE LPEN+VVIAS TQ D+RKEKSHPGGFLFTKFG NQTALLDLAFPDNFG+
Sbjct  607   VYATLKSKLETLPENIVVIASQTQLDSRKEKSHPGGFLFTKFGGNQTALLDLAFPDNFGK  666

Query  2463  LHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNV  2642
             LHDRSKETPK++KQ+TRLFPNK+ IQ+PQ+E LLSDWK++LDRD E +K Q+N  +I  V
Sbjct  667   LHDRSKETPKSMKQITRLFPNKIAIQLPQEEALLSDWKEKLDRDTEILKVQANITSILAV  726

Query  2643  LNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRY  2822
             L + +LDCPD+ TLCIKDQ L +ESVEK++GWA  HH M  +E   K+ KL IS+ESI Y
Sbjct  727   LAKNKLDCPDLGTLCIKDQTLPSESVEKVVGWAFGHHLMICTEPIVKDNKLVISAESISY  786

Query  2823  GLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLK  3002
             GL  L  +QNE KS+KKSLKDVVTENEFEKKLL+DVIPPSDIGV+FDDIGALENVK+TLK
Sbjct  787   GLQTLHDIQNENKSLKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKETLK  846

Query  3003  ELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITS  3182
             ELVMLPLQRPELF KGQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITS
Sbjct  847   ELVMLPLQRPELFDKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITS  906

Query  3183  KWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGL  3362
             KWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGL
Sbjct  907   KWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGL  966

Query  3363  RTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVD  3542
             RTKD+ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NR KIL +IL KEE+AP+VD
Sbjct  967   RTKDRERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDATNRSKILSVILAKEEIAPDVD  1026

Query  3543  LDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRP  3722
             L+AIANMT+GYSGSDLKNLCVTAAH PIREILEKEKKEK  A +ENRP P L++ +D+R 
Sbjct  1027  LEAIANMTDGYSGSDLKNLCVTAAHFPIREILEKEKKEKTAAQAENRPTPPLYSCTDVRS  1086

Query  3723  LNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             L M+DF+ AH+QVCASVSS+S+NM EL QWNELYGEGGSRKK +LSYFM
Sbjct  1087  LTMNDFKAAHDQVCASVSSDSSNMNELQQWNELYGEGGSRKKTSLSYFM  1135



>ref|XP_002872834.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49093.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]
Length=1258

 Score =  1404 bits (3634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 753/1215 (62%), Positives = 908/1215 (75%), Gaps = 38/1215 (3%)
 Frame = +3

Query  270   GAVNESGPESAEQEIRSAD---LDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSA  440
             G  ++ G ES E E+ S+D   +D    +   + PV E  PE     E  V         
Sbjct  67    GPASDPGSESGEPELGSSDPQAMDAEKPVVITDVPVMENSPETDANPEVEV---------  117

Query  441   IDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLC  620
             +    V A   A     K   K  L   W KLLSQY Q  H  +    FTVG+ + CDL 
Sbjct  118   LATPTVAAEVMADAEKSKAAKKRALKAPWAKLLSQYSQTPHRIMRGPVFTVGR-KGCDLS  176

Query  621   VDDPSVSKSLCNLKHIQREKGN-SITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIF  797
             + D ++  +LC LK  Q E G  S+  LEI G    VQVNGK Y K++ V L GGDEVIF
Sbjct  177   IRDQTMPSTLCELK--QSENGGPSVASLEIIGNGVIVQVNGKCYQKSTCVHLRGGDEVIF  234

Query  798   GSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlas  977
               + KH+YIFQ   +E+++A     S+SI EA   P+KGV+ E R+GD S V  AS LAS
Sbjct  235   SIAAKHSYIFQPLKDENLAAPDRASSLSICEARGAPLKGVHVETRAGDSSAVDGASILAS  294

Query  978   lsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDV---SDHNDVPL  1148
             LS  +   LL  P +      +Q P +P +P  S   D +  D+DM D    +DH  V  
Sbjct  295   LSKYRNLHLL--PPIAKAAKRQQNPAVPVVP--SSFNDYYISDTDMNDADSNNDHAAVAS  350

Query  1149  DEKSGAISPD-SGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLS  1322
              EK+ A S   + N+NLN++   +D + + + G V G   E+RP++ +L  SS+  FD+ 
Sbjct  351   VEKTAAASTSCTANENLNVDGSGLDPFQEADGGNVPGPGYEIRPIVHLLGESSS--FDIR  408

Query  1323  GNISRIIDQRREL---LKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSE  1493
             G+IS+++D+RRE+   L++FD   ++STRRQAFKD L+  +L++ NIE+SFE+FPYYLS 
Sbjct  409   GSISKLLDERREVREFLREFDLSSTISTRRQAFKDSLRGGVLNAQNIEISFENFPYYLSA  468

Query  1494  ITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGAR  1670
              TK VL+ S ++H+   +K+   A++L T CPR+LLSGP+GSEIYQE L KALAK FGA+
Sbjct  469   TTKGVLMTSMFVHMNGGSKYANFATDLTTACPRVLLSGPSGSEIYQEMLVKALAKNFGAK  528

Query  1671  LLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGG  1847
             L++VDSL+LPGGS A+E +  KE  + ER  +  KRA QAA +  +KKP SSV+ADITGG
Sbjct  529   LMIVDSLLLPGGSPAREAESSKEGSRRERLSMLAKRAVQAAQVLQHKKPTSSVDADITGG  588

Query  1848  SAISSHAQTKQEASTASSKNTFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAF  2024
             S +SS A  KQE STA+SK+     DRVK+VGP  +  S LQ P RGPA G++GKVLLAF
Sbjct  589   STLSSQALPKQEVSTATSKS-----DRVKFVGPSASAISSLQGPLRGPAPGFQGKVLLAF  643

Query  2025  EENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEV  2204
             E+N  SKIG+RFDRS+ +GNDLGGLCEEDHGFFCAA  LRL+ SS DD DKLAINE+FEV
Sbjct  644   EDNCASKIGIRFDRSVQDGNDLGGLCEEDHGFFCAASSLRLEGSSSDDADKLAINEIFEV  703

Query  2205  VSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHP  2384
                E +   LILF+KDIEKS+VGN + ++  K KLE LPEN+VV+AS TQ D+RKEKSHP
Sbjct  704   AYSESEGGSLILFLKDIEKSLVGNSDVYATLKSKLETLPENIVVMASQTQLDSRKEKSHP  763

Query  2385  GGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLL  2564
             GGFLFTKFG NQTALLDLAFPDNFG+LHDRSKETPK++KQ+TRLFPNKV IQ+PQDE LL
Sbjct  764   GGFLFTKFGGNQTALLDLAFPDNFGKLHDRSKETPKSMKQITRLFPNKVPIQLPQDEALL  823

Query  2565  SDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWAL  2744
             SDWK++LDRD E +K Q+N  +I  VL +  LDCPD+ TLCIKDQ L +ESVEK++GWA 
Sbjct  824   SDWKEKLDRDTEILKVQANITSILAVLAKNRLDCPDLGTLCIKDQTLPSESVEKVVGWAF  883

Query  2745  SHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLA  2924
              HH M   E   K+ KL IS+ESI YGL +L  +QNE KS+KKSLKDVVTENEFEKKLL+
Sbjct  884   GHHLMICKEPIVKDNKLVISAESITYGLQMLHDLQNENKSLKKSLKDVVTENEFEKKLLS  943

Query  2925  DVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTG  3104
             DVIPPSDIGV+FDDIGALENVK+TLKELVMLPLQRPELF KGQLTKP KGILLFGPPGTG
Sbjct  944   DVIPPSDIGVSFDDIGALENVKETLKELVMLPLQRPELFGKGQLTKPTKGILLFGPPGTG  1003

Query  3105  KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSML  3284
             KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSML
Sbjct  1004  KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSML  1063

Query  3285  GRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMV  3464
             GRRE+PGEHEAMRKMKNEFM+NWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLPRRLMV
Sbjct  1064  GRRENPGEHEAMRKMKNEFMINWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRRLMV  1123

Query  3465  NLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilek  3644
             NLPDA NR KIL +IL KEE+AP+VDL+AIANMT+GYSGSDLKNLCVTAAH PIREILEK
Sbjct  1124  NLPDATNRSKILSVILAKEEIAPDVDLEAIANMTDGYSGSDLKNLCVTAAHLPIREILEK  1183

Query  3645  ekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELY  3824
             EKKEK +A +ENRP P L++ +D+RPL M+DF+ AH+QVCASVSS+S+NM EL QWNELY
Sbjct  1184  EKKEKTVAQAENRPTPPLYSCTDVRPLTMNDFKAAHDQVCASVSSDSSNMNELQQWNELY  1243

Query  3825  GEGGSRKKKALSYFM  3869
             GEGGSRKK +LSYFM
Sbjct  1244  GEGGSRKKTSLSYFM  1258



>ref|XP_006286693.1| hypothetical protein CARUB_v10002740mg [Capsella rubella]
 gb|EOA19591.1| hypothetical protein CARUB_v10002740mg [Capsella rubella]
Length=1260

 Score =  1402 bits (3630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 732/1127 (65%), Positives = 876/1127 (78%), Gaps = 22/1127 (2%)
 Frame = +3

Query  525   WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLE  704
             W KLLSQY QN H  +    FTVG+ R CDL + D S+  +LC +K      G S+  LE
Sbjct  144   WAKLLSQYSQNPHRIMRGPVFTVGR-RGCDLSIKDQSMPTTLCEIKQ-SEHGGPSVASLE  201

Query  705   ISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSI  884
             I G    VQVNGK Y KN+ V L GGDEVIF  + KH+YIFQ   +E+++A     S++I
Sbjct  202   IIGNGVLVQVNGKCYQKNTCVHLRGGDEVIFSIAAKHSYIFQPVKDENLAAPDRSTSLNI  261

Query  885   LEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPA  1064
              EA   P+KGV+ E R+GD S V  AS LASLS  +   LL  P +      +Q PE+P 
Sbjct  262   CEARGAPLKGVHVETRAGDSSAVDGASILASLSKYRNFHLL--PPIAKAAKRQQNPEVPV  319

Query  1065  LPVASGEPDKHDLDSDMKDVSDHND----VPLDEKSGAISPDSGNDNLNLENGAIDSY-D  1229
             +P  SG  D    D+DM D   +ND     P+ EK+ A +  + N+NLN + G +D + +
Sbjct  320   VP--SGCNDCIS-DTDMNDADSNNDQAAIAPV-EKNAASTSCTANENLNADGGGLDPFQE  375

Query  1230  GEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRREL---LKDFDPLISMSTR  1400
              + G V G+  E+RP+  +L  SS+  FD+ G+IS+++D+RRE+   L++FD   ++S R
Sbjct  376   ADAGNVPGSSYEIRPIAHLLGESSS--FDIRGSISKLLDERREVREFLREFDLSSTISIR  433

Query  1401  RQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELPT  1577
             RQAFKD L+  +L++ NIEVSFE FPY+LS +TK+VLI S ++H+   NK+ K  S+L T
Sbjct  434   RQAFKDSLRGGVLNAENIEVSFESFPYFLSAMTKDVLITSIFVHMNGGNKYGKFGSDLTT  493

Query  1578  VCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPER  1754
              CPRILLSGPAGSEIYQE LAKALAK FGA+L++VDSL+LPGGS A+E +  KE  + E+
Sbjct  494   TCPRILLSGPAGSEIYQEMLAKALAKNFGAKLMIVDSLLLPGGSPARETESSKEGSRREK  553

Query  1755  TGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRV  1931
               +  KRA QAA    +KKP SSV+ADITGGS +SS A  KQE STA+SK+ TFK GDRV
Sbjct  554   LSMLAKRAVQAAQALQHKKPTSSVDADITGGSTLSSQALPKQEVSTATSKSYTFKAGDRV  613

Query  1932  KYVGPLPTGFSLQT-PARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEE  2108
             K+VGP  +  S    P RGP  G++GKV+LAFE+N  SKIG+RFDR + +GNDLGGLCEE
Sbjct  614   KFVGPSSSAISSLQSPLRGPTIGFQGKVVLAFEDNCASKIGIRFDRPVQDGNDLGGLCEE  673

Query  2109  DHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAF  2288
             DHGFFCAA  LRLD SS DD DKLA+NE+FEV   E +   LILF+KDIEKS+VGN + +
Sbjct  674   DHGFFCAASSLRLDGSSSDDADKLAVNEIFEVAYSESEGGSLILFLKDIEKSLVGNSDVY  733

Query  2289  SAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLH  2468
             +  K KLE LPEN+VV+AS TQ D+RKEKSHPGGFLFTKFG NQTALLDLAFPDNFG+LH
Sbjct  734   ATLKSKLETLPENIVVMASQTQLDSRKEKSHPGGFLFTKFGGNQTALLDLAFPDNFGKLH  793

Query  2469  DRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLN  2648
             DRSKETPK++KQ+TRLFPNK+ IQ+PQDE LL DWK++L+RD E +K Q+N  +I  VL 
Sbjct  794   DRSKETPKSMKQITRLFPNKIAIQLPQDEALLLDWKEKLERDTEILKVQANITSILAVLT  853

Query  2649  RVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGL  2828
             +  LDCP++  L IKDQ L +ESVEK++GWA  HH MH  E   K+ KL IS+ESI YGL
Sbjct  854   KNRLDCPELGNLSIKDQTLQSESVEKVVGWAYGHHLMHCKEPIVKDNKLVISAESITYGL  913

Query  2829  SVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKEL  3008
              +L G+QNE KS+KKSLKDVVTENEFEKKLL+DVIPPSDIGV+FDDIGALENVKDTLKEL
Sbjct  914   QMLHGIQNENKSLKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKDTLKEL  973

Query  3009  VMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKW  3188
             VMLPLQRPELF KGQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKW
Sbjct  974   VMLPLQRPELFDKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKW  1033

Query  3189  FGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRT  3368
             FGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFM+NWDGLRT
Sbjct  1034  FGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMINWDGLRT  1093

Query  3369  KDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLD  3548
             KD+ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NR KIL +IL KEE+AP+VDL+
Sbjct  1094  KDRERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDATNRSKILSVILAKEEIAPDVDLE  1153

Query  3549  AIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLN  3728
             AIANMT+GYSGSDLKNLCVTAAH PIREILEKEKKEK  A +ENRP P L++ +D+R L 
Sbjct  1154  AIANMTDGYSGSDLKNLCVTAAHLPIREILEKEKKEKTAAEAENRPTPPLYSCTDVRSLT  1213

Query  3729  MDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             M+DF+ AH+QVCASVSS+S+NM EL QWNELYGEGGSRKK +LSYFM
Sbjct  1214  MNDFKAAHDQVCASVSSDSSNMNELQQWNELYGEGGSRKKTSLSYFM  1260



>ref|XP_006848423.1| hypothetical protein AMTR_s00013p00232570 [Amborella trichopoda]
 gb|ERN10004.1| hypothetical protein AMTR_s00013p00232570 [Amborella trichopoda]
Length=1280

 Score =  1401 bits (3627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 758/1177 (64%), Positives = 910/1177 (77%), Gaps = 38/1177 (3%)
 Frame = +3

Query  408   LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  587
             + SPM+L       DK K++ S   R  K+    +    WGKLLSQY QN HVPL  + F
Sbjct  119   VASPMVL-------DKPKSSLS-WGRYGKQSATWHASNVWGKLLSQYSQNPHVPLCNAIF  170

Query  588   TVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTV  767
             T+G  + C+LC+ D SVS  LC LK   R+ G+ + LLE +G KG VQVNG+   +NS  
Sbjct  171   TIGSNKTCNLCLKDSSVSGMLCRLKQFPRD-GSIVALLECAGSKGFVQVNGRTIKRNSHC  229

Query  768   PLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPS  947
              L  GDE+IF ++G HAYIFQ+ TNE++S  S+P +V I+E  S PVKG++FEARSGDPS
Sbjct  230   ILKAGDELIFSATGNHAYIFQQVTNENVSP-SLPSTVGIMEGPS-PVKGLHFEARSGDPS  287

Query  948   TVAVASTlaslsnlkk-ellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDM---  1115
              VA AS LASLS+L++   +  PP+   D   +QG   P +      P     D D+   
Sbjct  288   AVAGASILASLSSLRQDLSVTSPPAQNADETPQQGAGRPPIAPPCEAPSACIGDIDVESQ  347

Query  1116  --KDVSDHNDVPLDEKSGA-ISPDSG--NDNLNLENGAIDS-YDGEIGKVTGAPQELRPL  1277
               K V D +   L EK+   +S D G  N+NL L+N + D+  D E  K+TG P+ L+ L
Sbjct  348   ERKKVPDADVSSLGEKAAVMLSADIGVTNENLQLDNMSPDTPLDHETLKLTGDPEALK-L  406

Query  1278  IRMLAGSSTPEFDLSGNI-SRIIDQRRELLKDFDP--LISMSTRRQAFKDGLQQTILDSN  1448
             IR++ GS+  + D + +I  ++++++RE  KD D   + SM+ + QAFK+ L   +LD  
Sbjct  407   IRIIQGSTGCDLDKNSSIVKQLLEEKREQDKDSDAATISSMAAKCQAFKEELHAGVLDGT  466

Query  1449  NIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQ  1628
              I+VSFEDFPYYLSE TKNVLIAS YIHLK  +F K  S+LPTV PRILLSGP+GSEIYQ
Sbjct  467   EIQVSFEDFPYYLSENTKNVLIASVYIHLKRKEFSKYTSDLPTVSPRILLSGPSGSEIYQ  526

Query  1629  ETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNK  1808
             E L+KALAK+FGA+LLV D+  L G   K+++P KE  K E++ V  K+ +  A     K
Sbjct  527   EMLSKALAKHFGAKLLVFDTNSL-GLCTKDMEPSKEGLKAEKSCVCIKQRSGHA--DAAK  583

Query  1809  KPASSVEADITGG-SAISSHAQTKQEASTASS------KN-TFKTGDRVKYVGPLP-TGF  1961
                S  E+D+ G  +A+SS    K +++  SS      KN  FK GDRV++VG  P +G+
Sbjct  584   TVPSGPESDLAGSVNALSSFGLPKHDSTMVSSFSASSSKNYIFKKGDRVRFVGVAPGSGY  643

Query  1962  S-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADF  2138
             S LQ P+RGP+YG++GKV+L FEEN  SKIGVRFD+ IPEG DLGGLCEEDHGFFC A  
Sbjct  644   SSLQNPSRGPSYGFRGKVILDFEENIQSKIGVRFDKPIPEGIDLGGLCEEDHGFFCNASD  703

Query  2139  LRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKL  2318
             LRL+    +DLDKL IN LFEVVS E K++PLILF+KD+EKS++GN +++  FK KLEKL
Sbjct  704   LRLEGPGGEDLDKLVINALFEVVSTESKTAPLILFMKDVEKSIIGNTDSYPTFKNKLEKL  763

Query  2319  PENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAI  2498
             P+ V+VI S+TQ DNRKEKSHPGG LFTKFGSNQTALLD AFPDNFGRLH+R KE PK++
Sbjct  764   PDGVIVIGSHTQIDNRKEKSHPGGLLFTKFGSNQTALLDFAFPDNFGRLHERGKEIPKSM  823

Query  2499  KQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIE  2678
             K L++LFPN+V IQ+PQ+ETLL DWK QLDRD+ET+K++ N V++R VLNR  L+C ++E
Sbjct  824   KLLSKLFPNRVTIQLPQEETLLVDWKHQLDRDVETLKAKGNLVHMRTVLNRNGLECTELE  883

Query  2679  TLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNET  2858
              +CIKDQALTNES EKI+GWALS+H M ++     E KLA+S +SI+YGL +LQ +Q+E+
Sbjct  884   NICIKDQALTNESAEKIVGWALSYHLMQNANVDITETKLALSGDSIQYGLGILQSIQSES  943

Query  2859  KSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPEL  3038
             KS+KKSLKDVVTENEFEK+LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPEL
Sbjct  944   KSLKKSLKDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPEL  1003

Query  3039  FCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA  3218
             FCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA
Sbjct  1004  FCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA  1063

Query  3219  VFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLA  3398
             VF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLA
Sbjct  1064  VFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLA  1123

Query  3399  ATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYS  3578
             ATNRPFDLDEAVIRRLPRRLMVNLPDA NR KILR+IL KE+LAP+VDLDA+ANMTEGYS
Sbjct  1124  ATNRPFDLDEAVIRRLPRRLMVNLPDAANRAKILRVILAKEDLAPDVDLDAVANMTEGYS  1183

Query  3579  GSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQ  3758
             GSDLKNLCVTAAHCPIREILEKEKKEKALA+SE R  PAL  S+DIRPL+MDDF+YA+EQ
Sbjct  1184  GSDLKNLCVTAAHCPIREILEKEKKEKALAVSEGRSPPALSGSADIRPLSMDDFKYANEQ  1243

Query  3759  VCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             VCASVSSES NM ELLQWNELYGEGGSR+KKALSYFM
Sbjct  1244  VCASVSSESANMNELLQWNELYGEGGSRRKKALSYFM  1280



>gb|KCW58476.1| hypothetical protein EUGRSUZ_H01157 [Eucalyptus grandis]
Length=1108

 Score =  1400 bits (3624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 725/1120 (65%), Positives = 875/1120 (78%), Gaps = 32/1120 (3%)
 Frame = +3

Query  570   LDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIY  749
             +  S F VG G QC+LC+ DPS+S  LC LKHI R  G+S TLLEI+G KG VQVNGKIY
Sbjct  1     MRDSLFIVGHGSQCNLCLADPSISMVLCKLKHIVR-GGSSATLLEITGGKGTVQVNGKIY  59

Query  750   PKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEA  929
             P+NSTV L GGDEV+F  SG H+Y+FQ F  +D  A    PS  ILEA    +K ++ E+
Sbjct  60    PRNSTVLLCGGDEVVFTESGNHSYVFQPF--DDNVADVGIPSECILEAQGASMKELHIES  117

Query  930   RSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDS  1109
             RS  PS V+ AS L+     +   LL PP   +  D++    +P +P      D  + + 
Sbjct  118   RSEGPSAVSGASMLSLTDLQEDLSLLPPPGKSSP-DVQCNTGIPIVPSVCDTSDNQNGEV  176

Query  1110  DMKDVS---DHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLI  1280
             +++D S   D  DV   EKS + S +  ++N NL+    DS      KV GA  ELRPL 
Sbjct  177   EIRDSSNNDDARDVSTREKSVSPSAECNDENANLDGAGFDSRAPGDEKVPGAACELRPLW  236

Query  1281  RMLAGSSTPEFDLSGNISRIIDQ----RRELLKDFDPLI---------SMSTRRQAFKDG  1421
             +M+   S P FD+   +S+I++     RR+LL++ D  +         S +  R+AF++ 
Sbjct  237   QMIG--SPPNFDI---LSKIVEDQREIRRKLLRNSDASLLKNNDMSSDSRTDWRKAFRES  291

Query  1422  LQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLS  1601
             L+Q I DS+NI+VSFE+FPYYLS+ TKNVLIASTY+ LK ++FVK + +LPT+CPRILLS
Sbjct  292   LEQAISDSDNIKVSFENFPYYLSDTTKNVLIASTYLRLKRSEFVKYSKDLPTLCPRILLS  351

Query  1602  GPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFTKRA  1778
             GPAGSEIYQETL KALAK+FGARLL+VDSL+LPG    K++D +KE  K E+T V  KRA
Sbjct  352   GPAGSEIYQETLTKALAKHFGARLLIVDSLLLPGDLMPKDVDSLKECVKSEKTSVHAKRA  411

Query  1779  AQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPT  1955
              Q++ +  ++KP SSVEADITGGS + S AQTKQE STA+SK   FK GDRV++VG    
Sbjct  412   GQSSAVH-HRKPTSSVEADITGGSIVGSRAQTKQEVSTATSKTYKFKKGDRVRFVGS--A  468

Query  1956  GFSLQTPARGPAYGYKGKVLLAFEEN--GFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCA  2129
             G S   P RGP+ GY+GKV+LAFEEN    +K+GVRFD+ I EGN+LG  CE+DHGFFC+
Sbjct  469   GLSSLQPLRGPSDGYRGKVVLAFEENENDAAKVGVRFDKPILEGNNLGEHCEKDHGFFCS  528

Query  2130  ADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKL  2309
             A+ LRL++S  ++ D LAI+E+FEV     KS PL++FVKD+EK++V +P+A   F+ KL
Sbjct  529   ANSLRLESSGGEETDSLAIDEIFEVALSASKSCPLVIFVKDVEKAVVASPDAGQVFRAKL  588

Query  2310  EKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETP  2489
             E LP NVVVI S+ Q D+RKEKSH GG LFTKF  N TALLDLAFPD+FGRLH+R KE+P
Sbjct  589   ENLPGNVVVIGSHIQLDSRKEKSHSGGLLFTKFAGNPTALLDLAFPDSFGRLHERGKESP  648

Query  2490  KAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCP  2669
             K +KQL RLFPNKV IQ+PQDE LL DWKQQL+RD+ETM++QSN  ++R VLNR  +DCP
Sbjct  649   KTMKQLARLFPNKVSIQLPQDEVLLLDWKQQLERDVETMRAQSNIASVRLVLNRSGMDCP  708

Query  2670  DIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQ  2849
             DIET+CI DQ LT+ESVEKI+GWALSHHFM SSE+  K+ KL +SSESIRYG+++ QG+ 
Sbjct  709   DIETVCINDQTLTSESVEKIVGWALSHHFMCSSEAPVKDAKLVLSSESIRYGINIFQGIH  768

Query  2850  NETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQR  3029
             NE K  KKSLKDVVTENEFEKKLL DVIPP+DIGV+FDDIGALENVKDTLKELVMLPLQR
Sbjct  769   NENKGSKKSLKDVVTENEFEKKLLTDVIPPTDIGVSFDDIGALENVKDTLKELVMLPLQR  828

Query  3030  PELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY  3209
             PELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY
Sbjct  829   PELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY  888

Query  3210  VKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVL  3389
             VKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVL
Sbjct  889   VKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVL  948

Query  3390  VLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTE  3569
             VL ATNRPFDLDEAVIRR PRRLMVNLPDA NRE+IL++IL KEEL  ++D +A+A MTE
Sbjct  949   VLGATNRPFDLDEAVIRRFPRRLMVNLPDALNRERILKVILAKEELGSDIDFEAVAKMTE  1008

Query  3570  GYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYA  3749
             GYSGSDLKNLCV+AAHCPIREIL+KEKKE+ LA++ENRPLP+L++  DIRPL MDDF+YA
Sbjct  1009  GYSGSDLKNLCVSAAHCPIREILDKEKKERTLAVAENRPLPSLYSGMDIRPLKMDDFKYA  1068

Query  3750  HEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             HEQVCASVSS+STNM EL+QWN+LYGEGG+RK+ +LSYFM
Sbjct  1069  HEQVCASVSSDSTNMNELVQWNDLYGEGGTRKRTSLSYFM  1108



>ref|XP_010556748.1| PREDICTED: uncharacterized protein LOC104825975 [Tarenaya hassleriana]
Length=1244

 Score =  1399 bits (3620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 749/1133 (66%), Positives = 896/1133 (79%), Gaps = 31/1133 (3%)
 Frame = +3

Query  525   WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSV-SKSLCNLKHIQREKGNSITLL  701
             WGKLLSQ  +N H  +    FTVG+ R CDL + D S+ + +LC LK +   +G S   L
Sbjct  125   WGKLLSQCSKNPHRVMKAPVFTVGR-RGCDLSIKDSSIPNTTLCELK-LSEHEGTSAASL  182

Query  702   EISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVS  881
             EI G  G VQVNGK Y + +++ L GGDE++F SS KHAYIFQ   +++++  +   S++
Sbjct  183   EIIGNGGIVQVNGKNYHRKASIQLRGGDELVFSSSRKHAYIFQPLKDDNLATQNRASSLN  242

Query  882   ILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMP  1061
             I E  S P+K      R+GD + V  AS LASLSN +   LL  P       ++Q PE+P
Sbjct  243   IFETQSAPLK-----IRAGDSTAVDGASILASLSNYRNFPLL--PVTAKHVKVQQTPEVP  295

Query  1062  ALPVASGEPDKHDLDSDMKD---VSDHNDVPLDEKSGAISPDSGNDNLNLE-NGAIDSYD  1229
              +P  SG  D    D DM D   ++DH  +   EK+ A +  +   NLN + NG     +
Sbjct  296   VVP--SGCNDCIP-DVDMNDAGSMNDHAALASAEKTVASTSGAAIQNLNSDCNGMDPCQE  352

Query  1230  GEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIID-QR--RELLKDFDPLISM-ST  1397
              ++GKV G+  E+RP++ +    S+ EFD+ G+IS+I+D QR  RELLK+FD   ++ ST
Sbjct  353   TDVGKVPGSGSEIRPILPLFEDPSS-EFDIRGSISKILDDQREVRELLKEFDLSTALLST  411

Query  1398  RRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELP  1574
             RRQ +KD L+  +L   N++VSFE+FPY+LS  TK+VLIASTY+H+KC +KF K AS+L 
Sbjct  412   RRQTYKDSLRAGVLSPQNMDVSFENFPYFLSTKTKDVLIASTYVHMKCGSKFAKYASDLS  471

Query  1575  TVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPV--KEAPK  1745
             T+CPRILLSGPAGSEIYQE LAKALAK+ GA+L++V SL+LPG S  KE D    KE+ +
Sbjct  472   TLCPRILLSGPAGSEIYQEMLAKALAKHSGAKLMIVSSLLLPGRSLTKEADSSNSKESFR  531

Query  1746  PERTGVFTKRAAQAAVLRF--NKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFK  1916
              ER  +  KRA QAA      +K+P SSVEADITGGS +SS A  KQE STA+SK+ TFK
Sbjct  532   RERLSMLAKRAVQAAQAAALQHKRPTSSVEADITGGSTLSSQALPKQEVSTATSKSYTFK  591

Query  1917  TGDRVKYVGPLPTGF--SLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDL  2090
             TGDRVK+VGP P+    S Q P RGP  G++GKV+LAFE NG SKIGVRFDRSIP+GNDL
Sbjct  592   TGDRVKFVGPSPSVALSSPQAPLRGPTIGFQGKVVLAFEGNGSSKIGVRFDRSIPDGNDL  651

Query  2091  GGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMV  2270
             GGLCEEDHGFFC A  LRLD+S+ DD +KLAINE+FEV   E +   LILF+KD+EKS+ 
Sbjct  652   GGLCEEDHGFFCTASSLRLDSSTSDDAEKLAINEVFEVAFGESERGSLILFLKDVEKSLA  711

Query  2271  GNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPD  2450
             GN + ++  K KLE LPENVVVIAS TQ D+RKEKSHPGGFLFTKFGS+QTALLDLAFPD
Sbjct  712   GNTDVYTTLKSKLENLPENVVVIASQTQLDSRKEKSHPGGFLFTKFGSSQTALLDLAFPD  771

Query  2451  NFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVN  2630
             NFGRLHDRSKETPK++KQ+TRLFPNKV IQ+PQDETLL +WK++L+RD E +K+++N  +
Sbjct  772   NFGRLHDRSKETPKSMKQITRLFPNKVAIQLPQDETLLLEWKEKLERDTEILKARANITS  831

Query  2631  IRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSE  2810
             IR VL+R  LDCPD+E LCIKDQ L +ESVEKI+GWALSHHFMH SE + K+ KL IS+E
Sbjct  832   IRAVLSRNRLDCPDLEILCIKDQTLPHESVEKIVGWALSHHFMHCSEPTFKDNKLVISAE  891

Query  2811  SIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVK  2990
             S  +GL VL G+QNE+KS+KKSLKDVVTENEFEKKL++DVIPPSDIGV+FDDIGALENVK
Sbjct  892   SFTFGLDVLHGIQNESKSLKKSLKDVVTENEFEKKLISDVIPPSDIGVSFDDIGALENVK  951

Query  2991  DTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMS  3170
             DTLKELVMLPLQRPELF KGQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMS
Sbjct  952   DTLKELVMLPLQRPELFGKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMS  1011

Query  3171  SITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVN  3350
             SITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFM+N
Sbjct  1012  SITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMIN  1071

Query  3351  WDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELA  3530
             WDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NREKILR+I++KEE++
Sbjct  1072  WDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAVNREKILRVIMSKEEMS  1131

Query  3531  PNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSS  3710
             P +DL+A+ANMT GYSGSDLKNLCVTAAH PIREILEKEKKEK  A++EN PLP L++SS
Sbjct  1132  PYMDLEALANMTNGYSGSDLKNLCVTAAHLPIREILEKEKKEKNAALAENLPLPPLYSSS  1191

Query  3711  DIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             DIRPL M+DFR AHEQVCASVSS+S+NM EL QWNELYGEGGSRKK +LSYFM
Sbjct  1192  DIRPLTMNDFRVAHEQVCASVSSDSSNMNELQQWNELYGEGGSRKKTSLSYFM  1244



>ref|XP_007050881.1| ATP binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOX95038.1| ATP binding protein, putative isoform 3 [Theobroma cacao]
Length=1007

 Score =  1392 bits (3603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 712/1022 (70%), Positives = 831/1022 (81%), Gaps = 37/1022 (4%)
 Frame = +3

Query  441   IDVDKVKANGSALN-RGKKRQLK---SNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQ  608
             +DV+K KA G+    R KKR  K   S     WGKLLSQ+ QN H+ +  + FTVGQ RQ
Sbjct  1     MDVEKAKAVGAGFTGRVKKRPTKPAKSGSKVPWGKLLSQHSQNPHLVMCGTLFTVGQSRQ  60

Query  609   CDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDE  788
             C+LC+ DP+VS  LC +KHI+ + G SI LLEISG KG VQVNG+IY K++++ LN GDE
Sbjct  61    CNLCLKDPNVSTVLCKVKHIESD-GTSIALLEISGGKGSVQVNGRIYRKSNSLILNAGDE  119

Query  789   VIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVAST  968
             +IF S+G HAYIFQ+ TN++++A  +P SVSILEA + P+KG+   ARSGDPS VA A+T
Sbjct  120   LIFTSTGNHAYIFQQLTNDNLAAPGIPSSVSILEAQAAPIKGI-IAARSGDPSAVAGAAT  178

Query  969   laslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND---  1139
                              +      K+  +M  LP      D    + DMKD + +ND   
Sbjct  179   -----------------ILASLSTKENSDMSTLPSGCDVSDDRVPEVDMKDSASNNDPAT  221

Query  1140  VPLDEKSGAISPDSGNDNLNLEN-GAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFD  1316
             V   EK+ A  P++ N+N NL+  G  D+ D +  KV GA   LRPL+R+LAG+S+ +FD
Sbjct  222   VSSREKTVAPPPEAANENPNLDRLGLDDTMDADNSKVPGAGYPLRPLLRILAGTSSTDFD  281

Query  1317  LSGNISRIIDQRRE---LLKDFDP-LISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYY  1484
             LSG+I++I+D++RE   +LK+FDP ++ +ST+RQAFKD LQ+ IL+ +NI+VSFE+FPYY
Sbjct  282   LSGSIAKILDEQREFREMLKEFDPPMVLISTKRQAFKDSLQEGILNPDNIDVSFENFPYY  341

Query  1485  LSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFG  1664
             LS+ TKNVLIASTY+HLKCNKF K AS+LPT+ PRILLSGPAGSEIYQETLAKALAK+FG
Sbjct  342   LSDTTKNVLIASTYVHLKCNKFAKYASDLPTMSPRILLSGPAGSEIYQETLAKALAKHFG  401

Query  1665  ARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFN--KKPASSVEAD  1835
             ARLL+VDSL+LPGGS +KE D VKE  + ER  ++ KRAAQA+       K+P SSVEAD
Sbjct  402   ARLLIVDSLLLPGGSTSKEADGVKETSRAERASIYAKRAAQASAAAALQQKRPTSSVEAD  461

Query  1836  ITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPL-PTGFS-LQTPARGPAYGYKG  2006
             ITGGS++SS A  KQE STA+SKN TFK GDRVK+VG   P+G S LQ   RGP  G++G
Sbjct  462   ITGGSSLSSQALPKQEVSTATSKNYTFKKGDRVKFVGATAPSGLSSLQPALRGPTIGFRG  521

Query  2007  KVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAI  2186
             KV+LAFEENG SKIGVRFDRSIPEGNDLGGLCEEDHGFFCAA  LRLD+S  DD+DKLA+
Sbjct  522   KVVLAFEENGSSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAASSLRLDSSGGDDVDKLAV  581

Query  2187  NELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNR  2366
             NELFEV   E K SPLILFVKDIEKSM GN + +SA K K+EKLP NVVVI S+TQ DNR
Sbjct  582   NELFEVALNESKGSPLILFVKDIEKSMAGNTDVYSALKCKVEKLPANVVVIGSHTQMDNR  641

Query  2367  KEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIP  2546
             KEKSHPGG LFTKFG+NQTALLDLAFPDNFGRLHDRSKETPK +KQ+TRLFPNKV IQ+P
Sbjct  642   KEKSHPGGLLFTKFGANQTALLDLAFPDNFGRLHDRSKETPKTMKQVTRLFPNKVTIQLP  701

Query  2547  QDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEK  2726
             QDE LL DWKQQL+RDIET+K+QSN V+IR+VLNR  LDCPD+ETLCIKDQ LTNESVEK
Sbjct  702   QDEALLLDWKQQLERDIETLKAQSNIVSIRSVLNRNGLDCPDLETLCIKDQTLTNESVEK  761

Query  2727  IIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEF  2906
             ++GWALSHHFMHSSE+   + KL +S+ESI+YGL++LQG+Q+E+KS+KKSLKDVVTENEF
Sbjct  762   VVGWALSHHFMHSSEALVNDAKLVVSTESIKYGLNILQGIQSESKSLKKSLKDVVTENEF  821

Query  2907  EKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLF  3086
             EKKLLADVIPPSDIGV+FDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLF
Sbjct  822   EKKLLADVIPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLF  881

Query  3087  GPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVD  3266
             GPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSVVFVD
Sbjct  882   GPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVD  941

Query  3267  EVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRL  3446
             EVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRL
Sbjct  942   EVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRL  1001

Query  3447  PR  3452
             PR
Sbjct  1002  PR  1003



>ref|XP_010474879.1| PREDICTED: uncharacterized protein LOC104754393 [Camelina sativa]
Length=1245

 Score =  1391 bits (3600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 750/1218 (62%), Positives = 917/1218 (75%), Gaps = 40/1218 (3%)
 Frame = +3

Query  276   VNESGPESAEQEIRSAD---LDGASALKSPEAPV--PEKLPEAPLGGEPLVSPMI-LGDS  437
             +   G ES E E+R+ D    D    L + + P    E +PE     E LV P+   G+ 
Sbjct  48    IENRGSESGEPELRTPDPQTHDAERPLTTTDVPAMETETVPEV----EALVPPITPAGEV  103

Query  438   AIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDL  617
              ++ +K K++       KKR  K+     W KL+SQY QN H+ +  S FTVG+ R CDL
Sbjct  104   VVEPEKSKSS-------KKRTAKAQ--APWAKLISQYSQNPHIIIRGSVFTVGR-RGCDL  153

Query  618   CVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIF  797
             C+ D S+   LC +K  +   G  +  LEI G    VQVNGKIY ++S V L GGDEV+F
Sbjct  154   CIKDHSMPTVLCEIKQYEH-GGPLVASLEIRGNSLLVQVNGKIYQRSSCVNLRGGDEVVF  212

Query  798   GSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlas  977
              + GKHAYIFQ   +E+++      S+S  E  + P+KG++ E R+GD S V  AS LAS
Sbjct  213   STPGKHAYIFQPLKDENLATPDRASSLSFFETQTAPLKGLHIETRAGDSSPVDGASLLAS  272

Query  978   lsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEK  1157
             +S L     L P S       +Q  E+P LP +  +       +D     DH  +   +K
Sbjct  273   ISKLHNVPFLPPTSKSVKR--QQNSEVPVLPSSCNDCILDVDMNDDDINDDHAAIASTDK  330

Query  1158  SGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNIS  1334
             + A +  + ND+ N +   +D + + E G + G+  E+RP+  +L   S  EFDL G+IS
Sbjct  331   TAASTSCAANDDQNADGNGMDPFQEAEGGNIPGSRFEIRPIFSLLGDPS--EFDLRGSIS  388

Query  1335  RI-IDQRRELL---KDFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEIT  1499
             +I +D RREL    K +D P   +S RRQA KD L+  +L+  +I+VSFEDFPY+LS IT
Sbjct  389   KILVDDRRELRQAPKAYDRPSALVSARRQAHKDTLRAGVLNPQDIQVSFEDFPYFLSGIT  448

Query  1500  KNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLL  1676
             K++L  STY+H+KC +K+VK  S+L T CPRILLSGPAGSEIYQETL KALAK FGA+L+
Sbjct  449   KDILRTSTYVHMKCESKYVKYGSDLSTSCPRILLSGPAGSEIYQETLVKALAKSFGAKLM  508

Query  1677  VVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRA---AQAAVLRFNKKPASSVEADITG  1844
             +VDSL+LPGGS AKE D  KE+ + E+  V  KRA   AQAAV++ +KKP SSVEA+ITG
Sbjct  509   IVDSLLLPGGSKAKEADSTKESSRHEKISVLAKRAVQVAQAAVMQ-HKKPTSSVEANITG  567

Query  1845  GSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGF-SLQTPARGPAYGYKGKVLL  2018
             GS +SS A  +QE STA+SK+  FK GDRVK+VGPL +   S+Q P RGPAYG++GKVLL
Sbjct  568   GSTLSSQAIPRQEVSTATSKSYAFKAGDRVKFVGPLTSLLASIQAPLRGPAYGFQGKVLL  627

Query  2019  AFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELF  2198
              FE+NG SKIGVRFD+S+P+GNDLGGLCE+DHGFFC A  LRL++SS DD DKLAINE+F
Sbjct  628   VFEDNGSSKIGVRFDKSVPDGNDLGGLCEDDHGFFCTASSLRLESSSSDDADKLAINEIF  687

Query  2199  EVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKS  2378
             EV   E +   LILF+KDIEKS+ GN + +   K KLE LPEN+VVIAS TQ D+RKEKS
Sbjct  688   EVAFNEIERGSLILFLKDIEKSVSGNSDVYITLKSKLENLPENIVVIASQTQLDSRKEKS  747

Query  2379  HPGGFLFTKFGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDE  2555
             HPGGFLFTKFGSNQTALLDLAFPDNFG RL DR+KE PK++KQ+TRLFPNKV IQ+P+DE
Sbjct  748   HPGGFLFTKFGSNQTALLDLAFPDNFGGRLQDRNKEMPKSVKQITRLFPNKVAIQLPEDE  807

Query  2556  TLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIG  2735
              LL DWK +L+RD E +K+++N  +IR VL++  L CPD+ETLCIKDQ   ++SVEK++G
Sbjct  808   ALLVDWKNKLERDAEILKAKANITSIRAVLSKNHLVCPDLETLCIKDQTFPSDSVEKVVG  867

Query  2736  WALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKK  2915
             WA  HH M+ S+ + K+ KL IS+ESI Y L +L  +QNE KS KKSLKDVVTENEFEKK
Sbjct  868   WAYGHHLMNCSDPTVKDNKLIISAESITYSLQMLHEIQNENKSTKKSLKDVVTENEFEKK  927

Query  2916  LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPP  3095
             LL+DVIPPSDIGV+F+DIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFGPP
Sbjct  928   LLSDVIPPSDIGVSFNDIGALENVKDTLKELVMLPLQRPELFGKGQLTKPTKGILLFGPP  987

Query  3096  GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVD  3275
             GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVD
Sbjct  988   GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVD  1047

Query  3276  SMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRR  3455
             SMLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRR
Sbjct  1048  SMLGRRENPGEHEAMRKMKNEFMINWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRR  1107

Query  3456  LMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIRei  3635
             LMVNLPD+ NR KIL +IL KE++A +V+L+AIAN+T+GYSGSDLKNLCVTAAH PIREI
Sbjct  1108  LMVNLPDSANRSKILSVILAKEDMAQDVNLEAIANLTDGYSGSDLKNLCVTAAHLPIREI  1167

Query  3636  lekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWN  3815
             LEKEKKE+ +A +ENRP+P L++S+DIRPL M+DF+ AH+QVCASVSS+S+NM EL QWN
Sbjct  1168  LEKEKKERGVAEAENRPMPKLYSSTDIRPLTMNDFKAAHDQVCASVSSDSSNMNELQQWN  1227

Query  3816  ELYGEGGSRKKKALSYFM  3869
             ELYGEGGSRKK +LSYFM
Sbjct  1228  ELYGEGGSRKKTSLSYFM  1245



>ref|XP_002892133.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68392.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]
Length=1238

 Score =  1387 bits (3591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 753/1222 (62%), Positives = 916/1222 (75%), Gaps = 54/1222 (4%)
 Frame = +3

Query  270   GAVNESGPESAEQEIRSADL---DGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSA  440
             G V++ G ES EQE+R++D    D    + +   P  E      + G  LV+P   G+  
Sbjct  49    GPVSDPGSESGEQELRTSDPQSNDAERPVNNTAVPAMETDTNPEVEG--LVTPTPAGEVV  106

Query  441   IDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLC  620
             ++ +K K++       KKR  K+     W KLLSQYPQN H  +  S FTVG+ R CDLC
Sbjct  107   VEAEKSKSS-------KKRIAKA----PWAKLLSQYPQNPHCVMRGSVFTVGR-RGCDLC  154

Query  621   VDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFG  800
             + D S+   LC L+  +   G S+  LEI G    VQVNGKIY +++ V L GGDE+IF 
Sbjct  155   IRDHSMPNVLCELRQSEH-GGPSVASLEIIGNGVLVQVNGKIYQRSTCVHLRGGDEIIFS  213

Query  801   SSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlasl  980
             + GKHAYIFQ   +E+++      S+SI EA S P+KG++ E R+GD S++  + +    
Sbjct  214   TPGKHAYIFQPLKDENLATPDRASSLSIFEAQSAPLKGLHVETRAGDSSSLLASISKLHN  273

Query  981   snlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND---VPLD  1151
                        P       I+Q  E+P LP +  +     LD DM D   HND   +   
Sbjct  274   VPFL-------PPTAKSVKIQQNSEVPVLPSSCND---CILDVDMNDDDSHNDHAAIAST  323

Query  1152  EKSGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGN  1328
             EK+ A +  + ND+LN +   +D + + E G + G+  E+RP++ +L   S  EFDL+G+
Sbjct  324   EKTVASTSCAANDDLNADGNGMDPFQEAEGGNIPGSGYEIRPILSLLGDPS--EFDLTGS  381

Query  1329  ISRI-IDQRRE---LLKDFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSE  1493
             IS+I +++RRE   +LK+ + P  S+ TRRQA KD L+  IL   +IEVSFE+FPY+LS 
Sbjct  382   ISKILVEERREVREMLKENERPSASVLTRRQAHKDSLRGGILKPQDIEVSFENFPYFLSG  441

Query  1494  ITKNVLIASTYIHLKCNK-FVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGAR  1670
              TK+VL+ STY H+K  + + K AS+LPT CPRILLSGP+GSEIYQE LAKALAK FGA+
Sbjct  442   TTKDVLMISTYAHMKYGREYAKYASDLPTACPRILLSGPSGSEIYQEMLAKALAKKFGAK  501

Query  1671  LLVVDSLVLPGGSA-KELDPVKEAPKPERTGVFTKRAAQAAVLRF--NKKPASSVEADIT  1841
             L++VDSL+LPGGS  KE D  KE+ + ER  V  KRA QAA      +KKP SSVEADIT
Sbjct  502   LMIVDSLLLPGGSTPKEADSTKESSRRERLSVLAKRAVQAAQAAVLQHKKPISSVEADIT  561

Query  1842  GGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSLQT----PARGPAYGYKG  2006
             GGSA+SS A  +QE STA+SK+ TFK GDRV+++GP  +  +       P RGPA G++G
Sbjct  562   GGSALSSQAVPRQEVSTATSKSYTFKAGDRVRFLGPSTSSLASLASLQAPPRGPATGFQG  621

Query  2007  KVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAI  2186
             KVLLAFE NG SKIGVRFDRSIP+GNDLGGLCEEDH     A  LRL++SS DD DKLAI
Sbjct  622   KVLLAFEGNGSSKIGVRFDRSIPDGNDLGGLCEEDH-----ASSLRLESSSSDDADKLAI  676

Query  2187  NELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNR  2366
             NE+FEV   E +   LILF+KDIEKS+ GN + +   K KLE LPEN+VVIAS TQ D+R
Sbjct  677   NEIFEVAFSESERGSLILFLKDIEKSVSGNTDVYITLKSKLENLPENIVVIASQTQLDSR  736

Query  2367  KEKSHPGGFLFTKFGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQI  2543
             KEKSHPGGFLFTKFGSNQTALLDLAFPDNFG RL DR+KE PK++KQ+TRLFPNKV IQ+
Sbjct  737   KEKSHPGGFLFTKFGSNQTALLDLAFPDNFGGRLQDRNKEMPKSVKQITRLFPNKVTIQL  796

Query  2544  PQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVE  2723
             P+DE LL DWK +L+RD E +K+Q+N  +IR VL++  L CPD+ETLCIKDQ L ++SVE
Sbjct  797   PEDEALLVDWKDKLERDTEILKAQANITSIRAVLSKNHLVCPDLETLCIKDQTLPSDSVE  856

Query  2724  KIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENE  2903
             K++G+A +HH M+ +E + K+ KL IS+ESI YGL +L G+QNE KS KKSLKDVVTENE
Sbjct  857   KVVGFAFNHHLMNCAEPTVKDDKLIISAESITYGLELLHGIQNENKSTKKSLKDVVTENE  916

Query  2904  FEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILL  3083
             FEKKLL+DVIPPSDIGV+F DIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILL
Sbjct  917   FEKKLLSDVIPPSDIGVSFSDIGALENVKDTLKELVMLPLQRPELFGKGQLTKPTKGILL  976

Query  3084  FGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFV  3263
             FGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FV
Sbjct  977   FGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFV  1036

Query  3264  DEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRR  3443
             DEVDSMLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKDKERVLVLAATNRPFDLDEAVIRR
Sbjct  1037  DEVDSMLGRRENPGEHEAMRKMKNEFMINWDGLRTKDKERVLVLAATNRPFDLDEAVIRR  1096

Query  3444  LPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCP  3623
             LPRRLMVNLPD+ NR KIL +IL KEE+A +VDL+AIANMT+GYSGSDLKNLCVTAAH P
Sbjct  1097  LPRRLMVNLPDSANRSKILSVILAKEEMAEDVDLEAIANMTDGYSGSDLKNLCVTAAHLP  1156

Query  3624  IReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTEL  3803
             IREILEKEKKE+++A SE+RP+P L++S DIRPLNM+DF+ AH+QVCASVSS+S+NM EL
Sbjct  1157  IREILEKEKKERSVAQSESRPMPQLYSSRDIRPLNMNDFKAAHDQVCASVSSDSSNMNEL  1216

Query  3804  LQWNELYGEGGSRKKKALSYFM  3869
              QWNELYGEGGSRKK +LSYFM
Sbjct  1217  QQWNELYGEGGSRKKTSLSYFM  1238



>ref|XP_010457286.1| PREDICTED: uncharacterized protein LOC104738781 isoform X1 [Camelina 
sativa]
 ref|XP_010457287.1| PREDICTED: uncharacterized protein LOC104738781 isoform X2 [Camelina 
sativa]
Length=1253

 Score =  1385 bits (3586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 752/1220 (62%), Positives = 919/1220 (75%), Gaps = 42/1220 (3%)
 Frame = +3

Query  270   GAVNESGPESAEQEIRSAD---LDGASALKSPEAPVPEK--LPEAPLGGEPLVSPMI-LG  431
             G V++ G ES E E+R+ D    D    L + + P  E   +PE     E LV+P    G
Sbjct  56    GPVSDPGSESGEAELRTPDPQTHDAERPLTTTDVPAMETDTIPEV----EALVAPSTPAG  111

Query  432   DSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQC  611
             +  ++ +K K++       KKR  K+     W KL+SQY QN H+ +  S FTVG+ R C
Sbjct  112   EVVVEPEKSKSS-------KKRIAKA----PWAKLISQYSQNPHIFIRGSVFTVGR-RGC  159

Query  612   DLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEV  791
             DLC+ D S+   LC +K  +   G  +  LEI G    VQVNGKIY ++S V L GGDEV
Sbjct  160   DLCIRDHSMPTVLCEIKQYEH-GGPLVASLEIRGNSLLVQVNGKIYQRSSCVNLRGGDEV  218

Query  792   IFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTl  971
             +F + GKHAYIFQ   +E+++      S+S  E  + P+KG++ E R+GD S V  AS L
Sbjct  219   VFSTPGKHAYIFQPLKDENLATPDRASSLSFFETQTAPLKGLHIETRAGDSSPVDGASLL  278

Query  972   aslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLD  1151
             AS+SNL     L P S       +Q  E+P LP +  +       +D     DH  +   
Sbjct  279   ASISNLHNVPFLPPTSKSVKR--QQNSEVPVLPSSCNDCILDVDMNDDDINDDHAAIAST  336

Query  1152  EKSGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGN  1328
             EK+ A +  + ND+ N +   +D + + E G + G   E+RP++ +L   S  EFDL G+
Sbjct  337   EKTAASTSCAANDDQNADGNGMDPFQEAEGGNIPGPRFEIRPILSLLGDPS--EFDLRGS  394

Query  1329  ISRI-IDQRRELL---KDFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSE  1493
             +S+I +D RREL    K +D P   +S RRQA KD L+  +L+  +I+VSFEDFPY+LS+
Sbjct  395   VSKILVDDRRELRQAPKAYDRPSALVSARRQAHKDTLRTGVLNPQDIQVSFEDFPYFLSD  454

Query  1494  ITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGAR  1670
             ITK++L  STY+H+KC +K+VK  S+  T CPRILLSGPAGSEIYQE L KALAK FGA+
Sbjct  455   ITKDILRTSTYVHMKCESKYVKYGSDFSTSCPRILLSGPAGSEIYQEMLVKALAKSFGAK  514

Query  1671  LLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRA---AQAAVLRFNKKPASSVEADI  1838
             L++VDSL+LPGGS AKE D  KE+ + E+  V  KRA   AQAAV++ +KKP SSVEA+I
Sbjct  515   LMIVDSLLLPGGSKAKEADFTKESSRREKISVLAKRAVQVAQAAVMQ-HKKPTSSVEANI  573

Query  1839  TGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGF-SLQTPARGPAYGYKGKV  2012
             TGGS +SS A  +QE STA SK+  FK GDRVK+VGPL T   SLQ P RGPA+G+ GKV
Sbjct  574   TGGSTLSSQAIPRQEVSTAPSKSYAFKAGDRVKFVGPLTTLLASLQAPLRGPAFGFHGKV  633

Query  2013  LLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINE  2192
             LLAFE+NG SKIGVRFD+S+P+GNDLGGLCE+DHGFFC A  LRL++SS DD D+LAINE
Sbjct  634   LLAFEDNGSSKIGVRFDKSVPDGNDLGGLCEDDHGFFCTASSLRLESSSSDDADRLAINE  693

Query  2193  LFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKE  2372
             +FEV   E +   LILF+KDIEKS+ GN + +   K KLE LPEN+VVIAS TQ D+RKE
Sbjct  694   IFEVAFNEIERGSLILFLKDIEKSVSGNSDVYITLKSKLENLPENIVVIASQTQLDSRKE  753

Query  2373  KSHPGGFLFTKFGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQ  2549
             KSHPGGFLFTKFGSNQTALLDLAFPDNFG +L DR+KE PK++KQ+TRLFPNKV IQ+P+
Sbjct  754   KSHPGGFLFTKFGSNQTALLDLAFPDNFGGKLQDRNKEMPKSVKQITRLFPNKVTIQLPE  813

Query  2550  DETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKI  2729
             DE LL DWK +L+RD E +K+++N  +IR VL++  L CPD+ETLCIKDQ   ++SVEK+
Sbjct  814   DEALLVDWKDKLERDAEILKAKANITSIRAVLSKNNLVCPDLETLCIKDQTFPSDSVEKV  873

Query  2730  IGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFE  2909
             +GWA  HH M+ S+ + K+ KL IS+ESI Y L +L  +QNE KS KKSLKDVVTENEFE
Sbjct  874   VGWAYGHHLMNCSDPTVKDNKLIISAESITYSLQMLHEIQNENKSTKKSLKDVVTENEFE  933

Query  2910  KKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFG  3089
             KKLL+DVIPPSDIGV+F+DIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFG
Sbjct  934   KKLLSDVIPPSDIGVSFNDIGALENVKDTLKELVMLPLQRPELFGKGQLTKPTKGILLFG  993

Query  3090  PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDE  3269
             PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDE
Sbjct  994   PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDE  1053

Query  3270  VDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLP  3449
             VDSMLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLP
Sbjct  1054  VDSMLGRRENPGEHEAMRKMKNEFMINWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLP  1113

Query  3450  RRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIR  3629
             RRLMVNL D+ NR KIL +IL KEE+A +V+L+AIANMT+GYSGSDLKNLCVTAAH PIR
Sbjct  1114  RRLMVNLSDSANRSKILSVILAKEEMAQDVNLEAIANMTDGYSGSDLKNLCVTAAHLPIR  1173

Query  3630  eilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQ  3809
             EILEKEKKE+++A +ENRP+P L++S+DIRPL M+DF+ AH+QVCASVSS+S+NM EL Q
Sbjct  1174  EILEKEKKERSVAEAENRPMPKLYSSTDIRPLTMNDFKAAHDQVCASVSSDSSNMNELQQ  1233

Query  3810  WNELYGEGGSRKKKALSYFM  3869
             WNELYGEGGSRKK +LSYFM
Sbjct  1234  WNELYGEGGSRKKTSLSYFM  1253



>ref|XP_010069947.1| PREDICTED: uncharacterized protein LOC104456788 isoform X2 [Eucalyptus 
grandis]
Length=1205

 Score =  1378 bits (3566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 717/1134 (63%), Positives = 866/1134 (76%), Gaps = 55/1134 (5%)
 Frame = +3

Query  522   AWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLL  701
             AWG+LLSQ  QN ++ +  S F VG G QC+LC+ DPS+S  LC LKHI R  G+S TLL
Sbjct  109   AWGQLLSQCNQNPNLLMRDSLFIVGHGSQCNLCLADPSISMVLCKLKHIVR-GGSSATLL  167

Query  702   EISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVS  881
             EI+G KG VQVNGKIYP+NSTV L GGDEV+F  SG H+Y+FQ F  +D  A    PS  
Sbjct  168   EITGGKGTVQVNGKIYPRNSTVLLCGGDEVVFTESGNHSYVFQPF--DDNVADVGIPSEC  225

Query  882   ILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMP  1061
             ILEA    +K ++ E+RS  PS V+ AS L+     +   LL PP   +  D++    +P
Sbjct  226   ILEAQGASMKELHIESRSEGPSAVSGASMLSLTDLQEDLSLLPPPGKSSP-DVQCNTGIP  284

Query  1062  ALPVASGEPDKHDLDSDMKDVS---DHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDG  1232
              +P      D  + + +++D S   D  DV   EKS + S +  ++N NL+    DS   
Sbjct  285   IVPSVCDTSDNQNGEVEIRDSSNNDDARDVSTREKSVSPSAECNDENANLDGAGFDSRAP  344

Query  1233  EIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQ----RRELLKDFDPLI-----  1385
                KV GA  ELRPL +M+   S P FD+   +S+I++     RR+LL++ D  +     
Sbjct  345   GDEKVPGAACELRPLWQMIG--SPPNFDI---LSKIVEDQREIRRKLLRNSDASLLKNND  399

Query  1386  ----SMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFV  1553
                 S +  R+AF++ L+Q I DS+NI+VSFE+FPYYLS+ TKNVLIASTY+ LK ++FV
Sbjct  400   MSSDSRTDWRKAFRESLEQAISDSDNIKVSFENFPYYLSDTTKNVLIASTYLRLKRSEFV  459

Query  1554  KCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPV  1730
             K + +LPT+CPRILLSGPAGSEIYQETL KALAK+FGARLL+VDSL+LPG    K++D +
Sbjct  460   KYSKDLPTLCPRILLSGPAGSEIYQETLTKALAKHFGARLLIVDSLLLPGDLMPKDVDSL  519

Query  1731  KEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-  1907
             KE  K E+T V  KRA Q++ +  ++KP SSVEADITGGS + S AQTKQE STA+SK  
Sbjct  520   KECVKSEKTSVHAKRAGQSSAVH-HRKPTSSVEADITGGSIVGSRAQTKQEVSTATSKTY  578

Query  1908  TFKTGDRVKYVGPLPTGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGND  2087
              FK GDRV++VG    G S   P RGP+ GY+G                         N+
Sbjct  579   KFKKGDRVRFVGS--AGLSSLQPLRGPSDGYRG-------------------------NN  611

Query  2088  LGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSM  2267
             LG  CE+DHGFFC+A+ LRL++S  ++ D LAI+E+FEV     KS PL++FVKD+EK++
Sbjct  612   LGEHCEKDHGFFCSANSLRLESSGGEETDSLAIDEIFEVALSASKSCPLVIFVKDVEKAV  671

Query  2268  VGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFP  2447
             V +P+A   F+ KLE LP NVVVI S+ Q D+RKEKSH GG LFTKF  N TALLDLAFP
Sbjct  672   VASPDAGQVFRAKLENLPGNVVVIGSHIQLDSRKEKSHSGGLLFTKFAGNPTALLDLAFP  731

Query  2448  DNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAV  2627
             D+FGRLH+R KE+PK +KQL RLFPNKV IQ+PQDE LL DWKQQL+RD+ETM++QSN  
Sbjct  732   DSFGRLHERGKESPKTMKQLARLFPNKVSIQLPQDEVLLLDWKQQLERDVETMRAQSNIA  791

Query  2628  NIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISS  2807
             ++R VLNR  +DCPDIET+CI DQ LT+ESVEKI+GWALSHHFM SSE+  K+ KL +SS
Sbjct  792   SVRLVLNRSGMDCPDIETVCINDQTLTSESVEKIVGWALSHHFMCSSEAPVKDAKLVLSS  851

Query  2808  ESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENV  2987
             ESIRYG+++ QG+ NE K  KKSLKDVVTENEFEKKLL DVIPP+DIGV+FDDIGALENV
Sbjct  852   ESIRYGINIFQGIHNENKGSKKSLKDVVTENEFEKKLLTDVIPPTDIGVSFDDIGALENV  911

Query  2988  KDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISM  3167
             KDTLKELVMLPLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISM
Sbjct  912   KDTLKELVMLPLQRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISM  971

Query  3168  SSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMV  3347
             SSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMV
Sbjct  972   SSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMV  1031

Query  3348  NWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEEL  3527
             NWDGLRTKDKERVLVL ATNRPFDLDEAVIRR PRRLMVNLPDA NRE+IL++IL KEEL
Sbjct  1032  NWDGLRTKDKERVLVLGATNRPFDLDEAVIRRFPRRLMVNLPDALNRERILKVILAKEEL  1091

Query  3528  APNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNS  3707
               ++D +A+A MTEGYSGSDLKNLCV+AAHCPIREIL+KEKKE+ LA++ENRPLP+L++ 
Sbjct  1092  GSDIDFEAVAKMTEGYSGSDLKNLCVSAAHCPIREILDKEKKERTLAVAENRPLPSLYSG  1151

Query  3708  SDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
              DIRPL MDDF+YAHEQVCASVSS+STNM EL+QWN+LYGEGG+RK+ +LSYFM
Sbjct  1152  MDIRPLKMDDFKYAHEQVCASVSSDSTNMNELVQWNDLYGEGGTRKRTSLSYFM  1205



>ref|NP_171788.3| AAA-type ATPase family protein [Arabidopsis thaliana]
 gb|AEE27492.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=1246

 Score =  1378 bits (3566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 746/1217 (61%), Positives = 918/1217 (75%), Gaps = 40/1217 (3%)
 Frame = +3

Query  276   VNESGPESAEQEIRSADL---DGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAID  446
             V++ G  S + E+R++D    D    + + + P  E      L G  LV+P   G+  ++
Sbjct  51    VSDPGSISGDPELRTSDPQSNDAERPVTTTDVPAMETDTNPELEG--LVTPTPAGEVVVE  108

Query  447   VDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVD  626
              +K K++       KKR  K+     W KLLSQ+PQN H+ +  S FTVG+ R CDLC+ 
Sbjct  109   AEKSKSS-------KKRIAKA----PWAKLLSQFPQNPHLVMRGSVFTVGR-RACDLCIR  156

Query  627   DPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSS  806
             D S+   LC L+  +   G S+  LEI G    VQVNGKIY +++ V L GGDE+IF + 
Sbjct  157   DHSMPNVLCELRQSE-HGGPSVASLEIIGNGVLVQVNGKIYQRSTCVHLRGGDEIIFTTP  215

Query  807   GKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsn  986
             GKHAYIFQ   +E+++A     S+S+ EA S P+KG++ E R+ D S+V   ++L +  +
Sbjct  216   GKHAYIFQPLKDENLAAPDRTSSLSLFEAQSAPLKGLHVETRARDSSSVDGTASLLASIS  275

Query  987   lkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDV---SDHNDVPLDEK  1157
               + +  LPP+       +Q  E+P LP +    D   LD D+ D    +DH  +   EK
Sbjct  276   KLQNVPFLPPT-AKSVKRQQNSEVPVLPSSC---DDFILDVDLNDADSNNDHAAIASMEK  331

Query  1158  SGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNIS  1334
             + A +  + ND+ + +   +D + + E G +     E+RP++ +L   S  EFDL G+IS
Sbjct  332   TVASTSCAANDDHDADGNGMDPFQEPEAGNIPDPAYEIRPILSLLGDPS--EFDLRGSIS  389

Query  1335  RI-IDQRRELL---KDFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEIT  1499
             +I +D+RRE+    K+++ P  S+ TRRQA KD L+  IL+  +IEVSFE+FPY+LS  T
Sbjct  390   KILVDERREVREMPKEYERPSASVLTRRQAHKDSLRGGILNPQDIEVSFENFPYFLSGTT  449

Query  1500  KNVLIASTYIHLKCNK-FVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLL  1676
             K+VL+ STY H+K  K + + AS+LPT CPRILLSGP+GSEIYQE LAKALAK  GA+L+
Sbjct  450   KDVLMISTYAHIKYGKEYAEYASDLPTACPRILLSGPSGSEIYQEMLAKALAKQCGAKLM  509

Query  1677  VVDSLVLPGGSA-KELDPVKEAPKPERTGVFTKRAAQAAVLRF--NKKPASSVEADITGG  1847
             +VDSL+LPGGS  KE D  KE+ + ER  V  KRA QAA      +KKP SSVEA ITGG
Sbjct  510   IVDSLLLPGGSTPKEADTTKESSRRERLSVLAKRAVQAAQAAVLQHKKPISSVEAGITGG  569

Query  1848  SAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGF-SLQTPARGPAYGYKGKVLLA  2021
             S +SS A  +QE STA+SK+ TFK GDRV+++GP  +   SL+ P RGPA G++GKVLLA
Sbjct  570   STLSSQAVRRQEVSTATSKSYTFKAGDRVRFLGPSTSSLASLRAPPRGPATGFQGKVLLA  629

Query  2022  FEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFE  2201
             FE NG SKIGVRFDRSIP+GNDLGGLCEEDHGFFC A  LRL++SS DD DKLAINE+FE
Sbjct  630   FEGNGSSKIGVRFDRSIPDGNDLGGLCEEDHGFFCTASSLRLESSSSDDADKLAINEIFE  689

Query  2202  VVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSH  2381
             V   E +   LILF+KDIEKS+ GN + +   K KLE LPEN+VVIAS TQ DNRKEKSH
Sbjct  690   VAFNESERGSLILFLKDIEKSVSGNTDVYITLKSKLENLPENIVVIASQTQLDNRKEKSH  749

Query  2382  PGGFLFTKFGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDET  2558
             PGGFLFTKFGSNQTALLDLAFPD FG RL DR+ E PKA+KQ+TRLFPNKV IQ+P+DE 
Sbjct  750   PGGFLFTKFGSNQTALLDLAFPDTFGGRLQDRNTEMPKAVKQITRLFPNKVTIQLPEDEA  809

Query  2559  LLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGW  2738
              L DWK +L+RD E +K+Q+N  +IR VL++ +L CPDIE LCIKDQ L ++SVEK++G+
Sbjct  810   SLVDWKDKLERDTEILKAQANITSIRAVLSKNQLVCPDIEILCIKDQTLPSDSVEKVVGF  869

Query  2739  ALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKL  2918
             A +HH M+ SE + K+ KL IS+ESI YGL +L  +QNE KS KKSLKDVVTENEFEKKL
Sbjct  870   AFNHHLMNCSEPTVKDNKLIISAESITYGLQLLHEIQNENKSTKKSLKDVVTENEFEKKL  929

Query  2919  LADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPG  3098
             L+DVIPPSDIGV+F DIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFGPPG
Sbjct  930   LSDVIPPSDIGVSFSDIGALENVKDTLKELVMLPLQRPELFGKGQLTKPTKGILLFGPPG  989

Query  3099  TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDS  3278
             TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDS
Sbjct  990   TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDS  1049

Query  3279  MLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRL  3458
             MLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRL
Sbjct  1050  MLGRRENPGEHEAMRKMKNEFMINWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRL  1109

Query  3459  MVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReil  3638
             MVNLPD+ NR KIL +IL KEE+A +VDL+AIANMT+GYSGSDLKNLCVTAAH PIREIL
Sbjct  1110  MVNLPDSANRSKILSVILAKEEMAEDVDLEAIANMTDGYSGSDLKNLCVTAAHLPIREIL  1169

Query  3639  ekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNE  3818
             EKEKKE+++A +ENR +P L++S+D+RPLNM+DF+ AH+QVCASV+S+S+NM EL QWNE
Sbjct  1170  EKEKKERSVAQAENRAMPQLYSSTDVRPLNMNDFKTAHDQVCASVASDSSNMNELQQWNE  1229

Query  3819  LYGEGGSRKKKALSYFM  3869
             LYGEGGSRKK +LSYFM
Sbjct  1230  LYGEGGSRKKTSLSYFM  1246



>emb|CDY22053.1| BnaA09g00820D [Brassica napus]
Length=1229

 Score =  1376 bits (3561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 751/1220 (62%), Positives = 886/1220 (73%), Gaps = 78/1220 (6%)
 Frame = +3

Query  270   GAVNESGPESAEQEIRSAD-LDGASALKSP----EAPVPEKLPEAPLGGEP--LVSPMIL  428
             G  ++ G ES E E+RS+D   G  A + P    + P+ E  PE     E   L +P + 
Sbjct  68    GPGSDPGSESGEPELRSSDPQQGVDAAEKPVVLTDVPLREASPETDANPEVDVLATPTVA  127

Query  429   GDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQ  608
              +   D +K KA       GKKR         W KLLSQYPQN H  +    FTVG+ R 
Sbjct  128   EEVVADGEKSKA-------GKKRA-----KAPWAKLLSQYPQNPHRIMRGPVFTVGR-RG  174

Query  609   CDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDE  788
             CDL + D S+  SLC LK  +   G S+  LEI+G    VQVNGK Y K + V L GGDE
Sbjct  175   CDLSIKDQSMPSSLCELKQAE-NGGPSVATLEITGNGVLVQVNGKCYQKGALVHLRGGDE  233

Query  789   VIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVAST  968
             VIF  SG+HAYIFQ   +E+ +A     S  + EA  G V     E R+G+ S V  AS 
Sbjct  234   VIFNISGRHAYIFQPLKDENQAAPDRASSQILFEARGGRVHS---ETRAGESSAVDGASI  290

Query  969   laslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDL--DSDMKDVSDHND-  1139
             LASLS  +   L   P +      +Q PE+P  P     P  +D   D+DM D   +ND 
Sbjct  291   LASLSKYRNLHLR--PPIAKSAKRQQNPEVPQEP-----PSCNDCTSDTDMNDADSNNDH  343

Query  1140  ---VPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPE  1310
                +   EK+ A +  + N+NLN +   +D +    G                       
Sbjct  344   AAAIASVEKAAASTSYTANENLNADGSGLDPFQEADG-----------------------  380

Query  1311  FDLSGNISRIIDQRRE---LLKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPY  1481
                   IS+++D+RRE   LLK+FD   ++STRRQAFKD L+  +L + NI+VS ++FPY
Sbjct  381   ------ISKLLDERREVRELLKEFDISSTISTRRQAFKDSLRGGVLMAQNIDVSLDNFPY  434

Query  1482  YLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKY  1658
             +LS  TK+VLIAS Y+H+K  +KF K AS+LPT  PRILLSGPAGSEIYQE LAKALAK 
Sbjct  435   FLSATTKDVLIASMYVHMKGGSKFAKYASDLPTTSPRILLSGPAGSEIYQEMLAKALAKN  494

Query  1659  FGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEAD  1835
             FGA+L++VDSL+LPGGS A+E +  KE  + ER  +  KRA QAA    +KKP SSV+AD
Sbjct  495   FGAKLMIVDSLLLPGGSPAREAESSKEGSRRERLSMLAKRAVQAAQALQHKKPTSSVDAD  554

Query  1836  ITGGSAISSHAQTKQEASTASSKNTFKTGDRVKYVGPLPTGFS-LQTPA-RGPAYGYKGK  2009
             ITGGS + S A  KQE STA+SK+     DRVK++GP  +  S LQ P  RGP  G++GK
Sbjct  555   ITGGSTLGSQALPKQEVSTATSKS-----DRVKFLGPSSSAISSLQGPPLRGPTIGFQGK  609

Query  2010  VLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAIN  2189
             V+LAFE+N  SKIG+RFDR +P+GNDLGGLCEEDHGFFCAA  LRLD SS DD DKLAIN
Sbjct  610   VVLAFEDNSSSKIGIRFDRPVPDGNDLGGLCEEDHGFFCAASSLRLDGSSGDDADKLAIN  669

Query  2190  ELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRK  2369
             E+FEV   E +   LILF+KDIEKS+VGN + ++  K KLE LPEN+VV+AS TQ D RK
Sbjct  670   EIFEVALSEAEGGSLILFLKDIEKSLVGNSDVYATLKGKLESLPENIVVMASQTQLDTRK  729

Query  2370  EKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQ  2549
             EK+HPGGFLFTKFG NQTALLDLAFPDNF +LHDRSKETPK++KQ+TRLFPNKV IQ+PQ
Sbjct  730   EKAHPGGFLFTKFGGNQTALLDLAFPDNFSKLHDRSKETPKSMKQITRLFPNKVAIQLPQ  789

Query  2550  DETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKI  2729
             DE LL DWK++LDRD E +K Q+N  +I  VL +  LDCPD+ TLCIKDQ L  ES EK+
Sbjct  790   DEALLVDWKEKLDRDTELLKVQANITSILGVLTKNRLDCPDLGTLCIKDQTLLPESAEKV  849

Query  2730  IGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFE  2909
             +GWA SHH M+ SE   K+ KL IS+ESI YGL +LQGVQNE KS+KKSLKDVVTENEFE
Sbjct  850   VGWAFSHHLMNCSEPIVKDNKLVISAESITYGLQMLQGVQNENKSLKKSLKDVVTENEFE  909

Query  2910  KKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFG  3089
             KKLL+DVIPPSDIGV+FDDIGAL+NVKDTLKELVMLPLQRPELF KGQLTKP KGILLFG
Sbjct  910   KKLLSDVIPPSDIGVSFDDIGALKNVKDTLKELVMLPLQRPELFDKGQLTKPTKGILLFG  969

Query  3090  PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDE  3269
             PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDE
Sbjct  970   PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDE  1029

Query  3270  VDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLP  3449
             VDSMLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLP
Sbjct  1030  VDSMLGRRENPGEHEAMRKMKNEFMINWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLP  1089

Query  3450  RRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIR  3629
             RRLMVNLPDA NR KIL +IL KEE+ P+VDL+AIANMT+GYSGSDLKNLCVTAAH PIR
Sbjct  1090  RRLMVNLPDATNRAKILSVILAKEEIGPDVDLEAIANMTDGYSGSDLKNLCVTAAHLPIR  1149

Query  3630  eilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQ  3809
             EILEKEKKEK  A +ENRP P L++ +DIRPL M DF+ AH+QVCASVS++S+NM EL Q
Sbjct  1150  EILEKEKKEKTAAEAENRPTPPLYSCTDIRPLTMTDFKAAHDQVCASVSTDSSNMNELQQ  1209

Query  3810  WNELYGEGGSRKKKALSYFM  3869
             WNELYGEGGSRKK +LSYFM
Sbjct  1210  WNELYGEGGSRKKTSLSYFM  1229



>gb|KFK42647.1| hypothetical protein AALP_AA1G022100 [Arabis alpina]
Length=1240

 Score =  1375 bits (3559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 760/1241 (61%), Positives = 930/1241 (75%), Gaps = 48/1241 (4%)
 Frame = +3

Query  207   KRSKATE----SLSSTDDMLGEKTPGAVNESGPESAEQEIRSADLDGASALKS---PEAP  365
             KRSKA      S S+++  +  + PG+  + G ES E E+R++D       +S    +  
Sbjct  28    KRSKAAAEPAGSSSASEVPIENQIPGS--DPGSESGEPELRTSDPQSNGVERSVVKTDVV  85

Query  366   VPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQ  545
               E  P+  + G  LV+P   G+   D +K K+        KKR  K+     W KLLSQ
Sbjct  86    AMENCPDTEVEG--LVTPNPAGEVVADAEKSKS-------AKKRIAKA----PWAKLLSQ  132

Query  546   YPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGC  725
             Y QN H  +  S +TVG+ + CDLC+ D S+   LC L+  +   G S+  LEI G    
Sbjct  133   YSQNPHRVIRSSVYTVGR-KGCDLCIKDQSMPSVLCELRQSEH-GGPSVASLEIIGSGVL  190

Query  726   VQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGP  905
             VQVNGK+Y +++ V L GGDEV+F + GKHAYIFQ   +E+ +      S+SI EA S P
Sbjct  191   VQVNGKVYQRSTCVHLRGGDEVVFSTPGKHAYIFQPLKDENPAVPDRASSLSIFEAQSAP  250

Query  906   VKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGE  1085
             +KG++ E R+GD S+   AS           +  LPP+  N    +Q  E+P LP +  +
Sbjct  251   LKGLHVETRAGDSSSADGAS--LLSLTKLHNVPFLPPTAKNVKR-QQNSEVPVLPSSCND  307

Query  1086  --PDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGA  1256
               PD    D+D  +  DH  +   +K+ A +  + ND+ N +   +D + + E G + G 
Sbjct  308   CIPDVDINDADSNN--DHAAIASTDKTVASTSCAANDDQNADGNGMDPFQEAETGNIPG-  364

Query  1257  PQELRPLIRMLAGSSTPEFDLSGNISR-IIDQRRE--LLKDFD-PLISMSTRRQAFKDGL  1424
               E+RP++R+  G++T EFDL G+IS+ ++D+RRE  +L++ D P +S+STRRQA KD L
Sbjct  365   -YEIRPILRLF-GANTSEFDLRGSISKMLVDERREIEMLREHDRPSVSVSTRRQAHKDSL  422

Query  1425  QQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLS  1601
             Q  +L+  +IEVSFE+FPY+LS  TK+VLI S Y+H+KC +K+ K AS+L T+ PRILLS
Sbjct  423   QAGVLNPQDIEVSFENFPYFLSGTTKDVLITSAYVHMKCGSKYAKYASDLSTMSPRILLS  482

Query  1602  GPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTGVFTKRAA  1781
             GPAGSEIYQE +AKALAK+FGA+L++VDSL+LPG +AKE D  K+  + ER  V  KRA 
Sbjct  483   GPAGSEIYQEMVAKALAKHFGAKLMIVDSLLLPG-AAKETDSAKDIRR-ERLTVIAKRAV  540

Query  1782  QAAVLRF--NKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLP  1952
             QAA      +KKP SSVEADITGGS +SS A  +QE STA+SK+ TFK GDRVK+V P  
Sbjct  541   QAAQAAVLQHKKPTSSVEADITGGSTLSSQAVPRQEVSTATSKSYTFKAGDRVKFVCPST  600

Query  1953  TGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCA  2129
             +  + LQ P RGP  GY+GKVLLAFE+NG SKIGVRFD  IP GNDLGGLCEE HGFFC 
Sbjct  601   SSLAALQAPLRGPTIGYQGKVLLAFEDNGSSKIGVRFDNPIPGGNDLGGLCEEGHGFFCT  660

Query  2130  ADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKL  2309
             A  LRLD+SS D  D+LAI E+FEV S+E +  PLILF+KDIEKS+ G  + +   K KL
Sbjct  661   ASSLRLDSSSSDSADRLAITEIFEVASKESEKGPLILFLKDIEKSLSGT-DVYVTLKSKL  719

Query  2310  EKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFG-RLHDRSKET  2486
             EKL EN+VVIAS TQ D+RKEKS PGGFLFTKFGSNQTALLDLAFPDNFG RL DR+KE 
Sbjct  720   EKLKENIVVIASQTQLDSRKEKSLPGGFLFTKFGSNQTALLDLAFPDNFGGRLQDRNKEM  779

Query  2487  PKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDC  2666
             PK++KQ+TRLFPNKV IQ+P+DE LL DWK++L+RD E +K+Q+N  +IR VL +  L C
Sbjct  780   PKSVKQVTRLFPNKVTIQLPEDEALLVDWKEKLERDTEILKAQANITSIRAVLTKNHLAC  839

Query  2667  PDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGV  2846
             PD+ETLCIKDQ L ++SVEK++GWALSHH M  SE + K+ KL IS+ESI  GL VL G+
Sbjct  840   PDLETLCIKDQTLPSDSVEKVVGWALSHHLMSCSEPTVKDNKLIISAESITSGLEVLHGI  899

Query  2847  QNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQ  3026
             QNE KS KKSLKDVVTENEFEKKLL+DVIPPSDIGV+F+DIGALENVKDTLKELVMLPLQ
Sbjct  900   QNENKSTKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFNDIGALENVKDTLKELVMLPLQ  959

Query  3027  RPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK  3206
             RPELF KGQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK
Sbjct  960   RPELFGKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEK  1019

Query  3207  YVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERV  3386
             YVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKD+ERV
Sbjct  1020  YVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMLNWDGLRTKDRERV  1079

Query  3387  LVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMT  3566
             LVLAATNRPFDLDEAVIRRLPRRLMVNLPD+ NR KIL +IL KEE+A +VDL+AIA+MT
Sbjct  1080  LVLAATNRPFDLDEAVIRRLPRRLMVNLPDSANRSKILSVILGKEEMAQDVDLEAIASMT  1139

Query  3567  EGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRY  3746
             +GYSGSDLKNLCVTAAH PIRE+LEKEKKEK +A +ENRP+P L++S+DIRPLNM+DF+ 
Sbjct  1140  DGYSGSDLKNLCVTAAHLPIRELLEKEKKEKTVAEAENRPVPDLYSSTDIRPLNMNDFKA  1199

Query  3747  AHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             AHEQVCASVSS+S+NM EL QWNELYGEGGSRKK +LSYFM
Sbjct  1200  AHEQVCASVSSDSSNMNELQQWNELYGEGGSRKKTSLSYFM  1240



>gb|KCW58477.1| hypothetical protein EUGRSUZ_H01157 [Eucalyptus grandis]
Length=1084

 Score =  1371 bits (3549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 712/1094 (65%), Positives = 858/1094 (78%), Gaps = 32/1094 (3%)
 Frame = +3

Query  648   LCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIF  827
             LC LKHI R  G+S TLLEI+G KG VQVNGKIYP+NSTV L GGDEV+F  SG H+Y+F
Sbjct  3     LCKLKHIVR-GGSSATLLEITGGKGTVQVNGKIYPRNSTVLLCGGDEVVFTESGNHSYVF  61

Query  828   QKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkelll  1007
             Q F  +D  A    PS  ILEA    +K ++ E+RS  PS V+ AS L+     +   LL
Sbjct  62    QPF--DDNVADVGIPSECILEAQGASMKELHIESRSEGPSAVSGASMLSLTDLQEDLSLL  119

Query  1008  lPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVS---DHNDVPLDEKSGAISPD  1178
              PP   +  D++    +P +P      D  + + +++D S   D  DV   EKS + S +
Sbjct  120   PPPGKSSP-DVQCNTGIPIVPSVCDTSDNQNGEVEIRDSSNNDDARDVSTREKSVSPSAE  178

Query  1179  SGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQ---  1349
               ++N NL+    DS      KV GA  ELRPL +M+   S P FD+   +S+I++    
Sbjct  179   CNDENANLDGAGFDSRAPGDEKVPGAACELRPLWQMIG--SPPNFDI---LSKIVEDQRE  233

Query  1350  -RRELLKDFDPLI---------SMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEIT  1499
              RR+LL++ D  +         S +  R+AF++ L+Q I DS+NI+VSFE+FPYYLS+ T
Sbjct  234   IRRKLLRNSDASLLKNNDMSSDSRTDWRKAFRESLEQAISDSDNIKVSFENFPYYLSDTT  293

Query  1500  KNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLV  1679
             KNVLIASTY+ LK ++FVK + +LPT+CPRILLSGPAGSEIYQETL KALAK+FGARLL+
Sbjct  294   KNVLIASTYLRLKRSEFVKYSKDLPTLCPRILLSGPAGSEIYQETLTKALAKHFGARLLI  353

Query  1680  VDSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAI  1856
             VDSL+LPG    K++D +KE  K E+T V  KRA Q++ +  ++KP SSVEADITGGS +
Sbjct  354   VDSLLLPGDLMPKDVDSLKECVKSEKTSVHAKRAGQSSAVH-HRKPTSSVEADITGGSIV  412

Query  1857  SSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSLQTPARGPAYGYKGKVLLAFEEN  2033
              S AQTKQE STA+SK   FK GDRV++VG    G S   P RGP+ GY+GKV+LAFEEN
Sbjct  413   GSRAQTKQEVSTATSKTYKFKKGDRVRFVGS--AGLSSLQPLRGPSDGYRGKVVLAFEEN  470

Query  2034  --GFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVV  2207
                 +K+GVRFD+ I EGN+LG  CE+DHGFFC+A+ LRL++S  ++ D LAI+E+FEV 
Sbjct  471   ENDAAKVGVRFDKPILEGNNLGEHCEKDHGFFCSANSLRLESSGGEETDSLAIDEIFEVA  530

Query  2208  SQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPG  2387
                 KS PL++FVKD+EK++V +P+A   F+ KLE LP NVVVI S+ Q D+RKEKSH G
Sbjct  531   LSASKSCPLVIFVKDVEKAVVASPDAGQVFRAKLENLPGNVVVIGSHIQLDSRKEKSHSG  590

Query  2388  GFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLS  2567
             G LFTKF  N TALLDLAFPD+FGRLH+R KE+PK +KQL RLFPNKV IQ+PQDE LL 
Sbjct  591   GLLFTKFAGNPTALLDLAFPDSFGRLHERGKESPKTMKQLARLFPNKVSIQLPQDEVLLL  650

Query  2568  DWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALS  2747
             DWKQQL+RD+ETM++QSN  ++R VLNR  +DCPDIET+CI DQ LT+ESVEKI+GWALS
Sbjct  651   DWKQQLERDVETMRAQSNIASVRLVLNRSGMDCPDIETVCINDQTLTSESVEKIVGWALS  710

Query  2748  HHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLAD  2927
             HHFM SSE+  K+ KL +SSESIRYG+++ QG+ NE K  KKSLKDVVTENEFEKKLL D
Sbjct  711   HHFMCSSEAPVKDAKLVLSSESIRYGINIFQGIHNENKGSKKSLKDVVTENEFEKKLLTD  770

Query  2928  VIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGK  3107
             VIPP+DIGV+FDDIGALENVKDTLKELVMLPLQRPELF KGQLTKPCKGILLFGPPGTGK
Sbjct  771   VIPPTDIGVSFDDIGALENVKDTLKELVMLPLQRPELFSKGQLTKPCKGILLFGPPGTGK  830

Query  3108  TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLG  3287
             TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLG
Sbjct  831   TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLG  890

Query  3288  RRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVN  3467
             RRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVL ATNRPFDLDEAVIRR PRRLMVN
Sbjct  891   RRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLGATNRPFDLDEAVIRRFPRRLMVN  950

Query  3468  LPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReileke  3647
             LPDA NRE+IL++IL KEEL  ++D +A+A MTEGYSGSDLKNLCV+AAHCPIREIL+KE
Sbjct  951   LPDALNRERILKVILAKEELGSDIDFEAVAKMTEGYSGSDLKNLCVSAAHCPIREILDKE  1010

Query  3648  kkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYG  3827
             KKE+ LA++ENRPLP+L++  DIRPL MDDF+YAHEQVCASVSS+STNM EL+QWN+LYG
Sbjct  1011  KKERTLAVAENRPLPSLYSGMDIRPLKMDDFKYAHEQVCASVSSDSTNMNELVQWNDLYG  1070

Query  3828  EGGSRKKKALSYFM  3869
             EGG+RK+ +LSYFM
Sbjct  1071  EGGTRKRTSLSYFM  1084



>ref|XP_009119599.1| PREDICTED: uncharacterized protein LOC103844551 isoform X1 [Brassica 
rapa]
Length=1241

 Score =  1368 bits (3542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 776/1275 (61%), Positives = 942/1275 (74%), Gaps = 63/1275 (5%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATES----LSSTDDMLGEKTPGAVNESGPES  299
             MVETRRSSS+SKR  P  SS     KRSKAT +     SS  D   E     V+  G ES
Sbjct  1     MVETRRSSSASKRNSPPESSSSRPTKRSKATAAEPAGSSSASDAPIENNQNPVSVPGSES  60

Query  300   AE-QEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSA  476
              E  ++ + D   A+    P+A   +++       + LV+P   G+   + DK K     
Sbjct  61    GEPSKLGTNDPVIANDASCPDADTNQQV-------QGLVTPTPTGEVVAEADKSK-----  108

Query  477   LNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCN  656
               + +K  LK      W KL+SQYPQN H  +    FTVG+ R CDL +   S+   LC 
Sbjct  109   --KAEKLWLKRT-KAPWAKLISQYPQNPHRVMKGPVFTVGR-RGCDLSIKYQSMPNVLCE  164

Query  657   LKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKF  836
             L+ ++ + G S+  LEI GK   V+VNGKIY K++ V L GGDEVIF +  KHAYIFQ  
Sbjct  165   LRQME-QAGPSVASLEIIGKGVLVEVNGKIYQKSTCVHLRGGDEVIFNTPVKHAYIFQPL  223

Query  837   TNEDISAASMPPSVSILEAHS-GPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllP  1013
              +E+++A     SVSI EA S  P+KG++ E R+GD S+ ++ ++L  + NL       P
Sbjct  224   KDENLAAPDRASSVSIFEAQSTAPLKGLHVETRAGDSSSCSLLASLRKIHNLPFL----P  279

Query  1014  PSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDV---SDHNDVPLDEKSGAISPD-S  1181
             P   N    +Q PE+  LP +S   D    D DM D    +DH  +   +KS  +SP  +
Sbjct  280   PPAKNGKK-QQNPEVSVLPSSS---DDCIPDVDMNDADSSNDHAAIASADKS-VVSPSLT  334

Query  1182  GNDNLNLENGAID-SYDGEIG-KVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRR  1355
              ND+LN +   +D S + E G  + G   E+RP++R+L        DL GN+S+I+    
Sbjct  335   ANDDLNADGNGMDPSQETEEGVSIPGPGYEIRPILRLL--------DLRGNVSKILKDDG  386

Query  1356  ELLKDF-----DPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIAS  1520
               +K+          S++TRRQA KD L+  +L+  +IEVSFE+FPY+LS  TK+VL+AS
Sbjct  387   REVKEVPKECGSSSASVATRRQAHKDFLRAGVLNPQDIEVSFENFPYFLSGTTKDVLVAS  446

Query  1521  TYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVL  1697
             TY+H+K  +KF K AS+L TVCPRILLSGPAGSEIYQE LAKALAK +GA+L++VD+L+L
Sbjct  447   TYVHMKSESKFAKYASDLSTVCPRILLSGPAGSEIYQEALAKALAKNYGAKLMIVDTLLL  506

Query  1698  PGG-SAKELDPVKEAPKPERTGVFTKRAAQAA--VLRFNKKPASSVEADITGGSAISSHA  1868
             PGG +AKE D  K++ + ER  V  KRA QAA   +  +KKP SSVEADITGGS ++S A
Sbjct  507   PGGPTAKEADSSKDSSRRERLTVIAKRAVQAAHAAVMQHKKPTSSVEADITGGSTLNSQA  566

Query  1869  QTKQEASTASSKN-TFKTGDRVKYVGPLPTGF-SLQTP-----ARGPAYGYKGKVLLAFE  2027
               +QE STA+SK+ TFKTGDRVK+VGP  +   S  T      +RGP  G +GKVLLAFE
Sbjct  567   VMRQEVSTATSKSYTFKTGDRVKFVGPATSSVTSFHTAHSAILSRGPTTGLQGKVLLAFE  626

Query  2028  ENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVV  2207
             +N  SKIGVRFDR I +GNDLGGLCE+D GFFC A  LRLD+SS D+ D+LAINE+FEV+
Sbjct  627   DNVSSKIGVRFDRPIVDGNDLGGLCEKDRGFFCTATSLRLDSSSSDNADRLAINEIFEVL  686

Query  2208  SQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPG  2387
             + E +   LILF+KDI+KS+ GN E +   K KLEKLPENVVVIAS TQ DNRKEKSHPG
Sbjct  687   TNESEKGSLILFLKDIDKSVSGNTEVYVTLKSKLEKLPENVVVIASQTQLDNRKEKSHPG  746

Query  2388  GFLFTKFGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLL  2564
             GFLFTKFGSNQT LLDLAFPDNFG RL DR+KE PK++KQ+TRLFPNKV I++P DE LL
Sbjct  747   GFLFTKFGSNQTTLLDLAFPDNFGGRLQDRNKEMPKSLKQITRLFPNKVTIKLPDDEALL  806

Query  2565  SDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWAL  2744
              DWK++L+RD E +K+Q+N  +IR VL++  L+CPDIETLCI DQ+L  +SVEK++GWA 
Sbjct  807   LDWKEKLERDTEILKAQANLTSIRAVLSKNRLECPDIETLCINDQSLPTDSVEKVVGWAF  866

Query  2745  SHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLA  2924
             SHH M  SE + K+ KL IS+E+I YGL VL G+QNE KS+KKSLKDVVTENEFEKKLL+
Sbjct  867   SHHLMTCSEPTVKDNKLIISAENITYGLQVLHGIQNENKSIKKSLKDVVTENEFEKKLLS  926

Query  2925  DVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTG  3104
             DVIPPSDIGV+FDDIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFGPPGTG
Sbjct  927   DVIPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPELFGKGQLTKPTKGILLFGPPGTG  986

Query  3105  KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSML  3284
             KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSML
Sbjct  987   KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSML  1046

Query  3285  GRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMV  3464
             GRRE+PGEHEAMRKMKNEFM+NWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMV
Sbjct  1047  GRRENPGEHEAMRKMKNEFMINWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMV  1106

Query  3465  NLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilek  3644
             NLPD+ NR KIL +IL KEE+A +VDL+AIANMT+GYSGSDLKNLCVTAAH PIREILEK
Sbjct  1107  NLPDSANRSKILSVILAKEEMAEDVDLEAIANMTDGYSGSDLKNLCVTAAHLPIREILEK  1166

Query  3645  ekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELY  3824
             EKKE+++A +ENRP+P L+NS+DIRPLNM DF+ AHEQVCASVS++S+NM EL QWNELY
Sbjct  1167  EKKERSVAQAENRPMPQLYNSTDIRPLNMKDFKSAHEQVCASVSTDSSNMNELQQWNELY  1226

Query  3825  GEGGSRKKKALSYFM  3869
             GEGGSRKK +LSYFM
Sbjct  1227  GEGGSRKKTSLSYFM  1241



>ref|XP_010248968.1| PREDICTED: uncharacterized protein LOC104591697 isoform X1 [Nelumbo 
nucifera]
Length=1253

 Score =  1367 bits (3538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 735/1195 (62%), Positives = 889/1195 (74%), Gaps = 26/1195 (2%)
 Frame = +3

Query  321   ADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQ  500
              D  GA AL S +    EK  +      P+ +P+  G S I  DK + + S+ +  +K+ 
Sbjct  73    CDGSGADALDSGKG---EKEDKGASPAVPVSTPIAEGSSTIVGDKTRTSFSSWSLYQKQN  129

Query  501   LKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREK  680
                +  T W KLLS+YPQN HVP+    FT+G  R C+L + DP++S  LC +KH QR+ 
Sbjct  130   SSFDTSTPWCKLLSEYPQNPHVPIYSPLFTIGSSRNCNLSLKDPNISAVLCKIKHTQRDN  189

Query  681   GNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAA  860
              + I ++E +G KG V +NGK+  KNS+  LN GDEVIFG +G HAYIFQ    E +  A
Sbjct  190   -SVIAMIESTGSKGTVHINGKLQKKNSSCVLNSGDEVIFGLAGNHAYIFQLLVPEFV--A  246

Query  861   SMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDI  1040
              +P SV + E  S   KG+N E RSGDPS VA AS LASLS L+++L LL P   N  + 
Sbjct  247   KVPSSVGVAEP-SCVGKGLNLERRSGDPSAVAGASILASLSGLREDLSLLTPPAQNPGET  305

Query  1041  KQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAID  1220
              QG E P   +A  E    DLD      +       D+ S A    + N + +L+N    
Sbjct  306   PQGTEGPTSQLARPE---IDLDGPQGKGNPDPSAGSDKVSEA---GATNKSFHLDNNHDS  359

Query  1221  SYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNI-SRIIDQRRELLKDFDPLIS--M  1391
               + +I K++G    LRP +RMLAGSS+ + +LS +I  +++++R+E  +D     +  +
Sbjct  360   GVESDIVKLSGVNDSLRPFLRMLAGSSSCDLELSKHIFKQVLEERKEWTRDSHQASTSGV  419

Query  1392  STRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASEL  1571
             S +  AFK+ +Q  ILD   IEV+F++FPYYLS  TKNVLI + +IHLK  ++ K  S+L
Sbjct  420   SPKCAAFKEDIQAGILDGREIEVTFDNFPYYLSSSTKNVLINAAFIHLKRGEYAKYTSDL  479

Query  1572  PTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKP  1748
             PTV PRILLSGPAGSEIYQE L+KALA YFGA+LL+ D+    GG S+K+ D +K+  K 
Sbjct  480   PTVSPRILLSGPAGSEIYQEMLSKALANYFGAKLLIFDTHSFLGGLSSKDSDVLKDGLKA  539

Query  1749  ERTGVFTK-RAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK------N  1907
             E+    +K R   A V + N   A   +   +  +     +QTK E +TA S       +
Sbjct  540   EKICSCSKQRPGHADVAKINIPLAGEADMPDSSSTPCGLDSQTKLETNTAPSTSGTTKTH  599

Query  1908  TFKTGDRVKYVGPLP-TGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGN  2084
              FK GDRVK+VG +  T +S   PARGP YGYKGKVLL FE+N  SKIGVRFD+ IPEG 
Sbjct  600   LFKMGDRVKFVGMVHNTSYSATLPARGPTYGYKGKVLLPFEDNMASKIGVRFDKPIPEGV  659

Query  2085  DLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKS  2264
             DLGGLCE  HGFFC  + L L++   +DLDKL IN LFEV+S E +++P ILF+KD+EKS
Sbjct  660   DLGGLCEGTHGFFCNVNDLCLESPGTEDLDKLLINTLFEVLSSESRNTPFILFMKDVEKS  719

Query  2265  MVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAF  2444
             +VGN E+ S FK KLEKLP+NVV+I S+TQTD+RKEKSHPGG LFTKFGSNQTALLD AF
Sbjct  720   IVGNSESASTFKSKLEKLPDNVVIIGSHTQTDSRKEKSHPGGLLFTKFGSNQTALLDFAF  779

Query  2445  PDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNA  2624
             PD+FGRLHDR+KE PK  K L +LFPNKV I IPQDE +L+ WK QLDRD ET+K++ N 
Sbjct  780   PDSFGRLHDRNKEIPKTTKMLAKLFPNKVTIHIPQDEAVLASWKNQLDRDAETLKAKGNL  839

Query  2625  VNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAIS  2804
              N+RNVL+R  LDC  +ETLCIKD +LT ES EK++GWALSHH MH+++    E K  +S
Sbjct  840   NNLRNVLSRSGLDCDGLETLCIKDISLTPESAEKVVGWALSHHLMHNTKL-VAEAKPVLS  898

Query  2805  SESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALEN  2984
             SESI+YG+ +LQ +Q+E+KS+KKSLKD+VTENEFEK+LL DVIPPSDIGVTFDDIGALEN
Sbjct  899   SESIQYGIGILQAIQSESKSLKKSLKDIVTENEFEKRLLTDVIPPSDIGVTFDDIGALEN  958

Query  2985  VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINIS  3164
             VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINIS
Sbjct  959   VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINIS  1018

Query  3165  MSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFM  3344
             MSSITSKWFGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFM
Sbjct  1019  MSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFM  1078

Query  3345  VNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEE  3524
             VNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR KIL++IL KE+
Sbjct  1079  VNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILKVILAKED  1138

Query  3525  LAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHN  3704
             L+P++DLD IA+MT+GYSGSDLKNLCVTAAHCPIREILEKEKKE+A A++E RP PAL  
Sbjct  1139  LSPDIDLDVIASMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERAAAMAEGRPPPALSG  1198

Query  3705  SSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             S DIRPL+MDDFRYAHEQVCASVSSES NM+ELLQWNELYGEGGSRKK+ALSYFM
Sbjct  1199  SEDIRPLSMDDFRYAHEQVCASVSSESVNMSELLQWNELYGEGGSRKKRALSYFM  1253



>ref|XP_010522784.1| PREDICTED: uncharacterized protein LOC104801270 isoform X1 [Tarenaya 
hassleriana]
Length=1253

 Score =  1366 bits (3536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 737/1141 (65%), Positives = 881/1141 (77%), Gaps = 53/1141 (5%)
 Frame = +3

Query  519   TAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKS-LCNLKHIQREKGN-SI  692
             T WGKLLSQ  QN H  +    FT+GQ R CDL + D S+ ++ LC L+  Q E G+ S 
Sbjct  142   TPWGKLLSQCSQNPHRVMKAPVFTIGQ-RGCDLSIKDSSMPRTTLCELR--QSEHGDPSA  198

Query  693   TLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPP  872
               LEI G +G VQVNGK Y + +T+ L GGDE++F SSGKHAYIF  F +++++A+    
Sbjct  199   ASLEIIGNRGIVQVNGKNYQRKATIQLRGGDELVFSSSGKHAYIFLPFKDDNLAASDRAS  258

Query  873   SVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGP  1052
             S+SI+EA S P+KG++ EAR GDPS +  AS LASLSN     LL PP+  N    ++ P
Sbjct  259   SLSIIEARSAPLKGLHIEARPGDPSALDGASMLASLSNYHNFPLL-PPTHANRQPNREVP  317

Query  1053  EMPALPVASGEPDKHDL--DSDMKDVSDHNDVPL---DEKSGAISPDSGNDNLNLENGAI  1217
              +P        P  +D   D DM D   ++D+      EK+ A +  + N++LN E   +
Sbjct  318   VVP--------PICNDCIPDVDMNDADSNDDIAAIASMEKTVASTSGAANNSLNSEGNGM  369

Query  1218  D---SYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDP  1379
             D   S  G  G V G+  E+RP++ M    S+ EFDL G+IS+I+D++RE    LK FD 
Sbjct  370   DPCQSTGG--GNVPGSSYEIRPILHMHGDPSSSEFDLKGSISKILDEQREARNFLKGFD-  426

Query  1380  LIS---MSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC-NK  1547
              IS   +S+RRQA+KD L+  +L    IEVS E+FPY+LS  TK+VL  S Y+H+KC +K
Sbjct  427   -ISSALLSSRRQAYKDSLRAGVLSPQKIEVSLENFPYFLSTTTKDVLTGSIYVHMKCGSK  485

Query  1548  FVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELD  1724
             F K AS L T+ PRILLSGP GSE+YQE LAKAL+K+FGA+L++VDSL+LPGGS  KE+D
Sbjct  486   FAKYASGLSTMRPRILLSGPVGSEVYQEMLAKALSKHFGAKLMIVDSLLLPGGSLTKEVD  545

Query  1725  PV--KEAPKPERTGVFTKRAAQAAVLRF--NKKPASSVEADITGGSAISSHAQTKQEAST  1892
                 +E  + ER  +  +RA +AA      +KK AS VEADITGGS             T
Sbjct  546   SSNSREGSRRERLSMLAQRAVRAAQAAALQHKKSASIVEADITGGS-------------T  592

Query  1893  ASSK-NTFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDR  2066
             A+SK  TFKTGDRVK+VGP P+  S LQ P RGPA G++GKV+LAFE NG SKIGVRFDR
Sbjct  593   ATSKVYTFKTGDRVKFVGPSPSALSSLQGPLRGPAIGFQGKVVLAFEGNGSSKIGVRFDR  652

Query  2067  SIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFV  2246
             SI +GNDLGGLCEEDHGFFC A  LRLD+S+ DD DKLAINE+FEV   E +  PLILF+
Sbjct  653   SIADGNDLGGLCEEDHGFFCTAGSLRLDSSTSDDADKLAINEIFEVAFGEREGGPLILFL  712

Query  2247  KDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTA  2426
             KD+EKS+VGN + ++  K KL+ LPE +VVIAS TQ D+RKEKS PGG LFTKFG N T+
Sbjct  713   KDVEKSLVGNTDVYATLKSKLQNLPEGIVVIASQTQLDSRKEKSLPGGLLFTKFGGNPTS  772

Query  2427  LLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETM  2606
             LLDLAFP+N GRLHDRSKE PK++KQLTRLFPNKV IQ+PQDE LL +WK++L+RD+  +
Sbjct  773   LLDLAFPNNLGRLHDRSKEMPKSMKQLTRLFPNKVAIQLPQDEALLLEWKEKLERDMLIL  832

Query  2607  KSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKE  2786
             K+Q+N  +IR VL++  L C D+ETLCIKDQ L +ESVEKI+GWALSHH MH SE + K+
Sbjct  833   KAQANISSIRAVLSKNRLVCLDLETLCIKDQILPHESVEKIVGWALSHHSMHCSEFTIKD  892

Query  2787  GKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDD  2966
              +L IS++SI +GL VL G+QNE+KS+KKSLKDVVTENEFEKKLL+DVIPPSDIGV+FDD
Sbjct  893   NQLVISAKSITFGLDVLHGIQNESKSIKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDD  952

Query  2967  IGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGA  3146
             IGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFGPPGTGKTMLAKAVATEAGA
Sbjct  953   IGALENVKDTLKELVMLPLQRPELFGKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGA  1012

Query  3147  NFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRK  3326
             NFINISMSSITSKWFGEGEKYVKAVF+LASKIAP V+FVDEVD MLGRRE+PGEHEAMRK
Sbjct  1013  NFINISMSSITSKWFGEGEKYVKAVFSLASKIAPCVIFVDEVDGMLGRRENPGEHEAMRK  1072

Query  3327  MKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRI  3506
             MKNEFMVNWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLPRR+MVNLPDA NREKILR+
Sbjct  1073  MKNEFMVNWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRRMMVNLPDAANREKILRV  1132

Query  3507  ILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRP  3686
             IL KEE+ P+VDL+A+ANMT GYSGSDLKNLCVTAAH PIREILEKEKKEK  +++ENRP
Sbjct  1133  ILAKEEMLPDVDLEALANMTNGYSGSDLKNLCVTAAHRPIREILEKEKKEKNASVAENRP  1192

Query  3687  LPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYF  3866
             LP L+NSSDIRPL M+DF  AHEQVCASVSS+S NM+EL QWNELYGEGGSRKK +LSYF
Sbjct  1193  LPPLYNSSDIRPLTMNDFMIAHEQVCASVSSDSLNMSELQQWNELYGEGGSRKKTSLSYF  1252

Query  3867  M  3869
             M
Sbjct  1253  M  1253



>ref|XP_009144560.1| PREDICTED: uncharacterized protein LOC103868207 isoform X2 [Brassica 
rapa]
Length=1210

 Score =  1360 bits (3520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 732/1180 (62%), Positives = 883/1180 (75%), Gaps = 51/1180 (4%)
 Frame = +3

Query  357   EAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKL  536
             + PV E  PE     E L +P + G+      + KA       GKKR         W KL
Sbjct  73    DVPVMENSPE---DDEVLATPTLAGE------RSKA-------GKKRA-----NAPWAKL  111

Query  537   LSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGK  716
             LSQYPQN H  +    FTVG+   C+L + D S+  +LC LK   +    S+  LEI+G 
Sbjct  112   LSQYPQNPHRIMRGPVFTVGR-LGCNLSIKDHSMPSTLCELKQ-AKHGAPSVASLEITGN  169

Query  717   KGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAH  896
                VQVNGK Y K+S V L GGDEVIF  SG+HAYIFQ   +E+++A     SV++ EA 
Sbjct  170   GFLVQVNGKCYQKSSCVHLRGGDEVIFSVSGRHAYIFQPLKDENLAAPDKASSVNLCEAR  229

Query  897   SGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVA  1076
               P    + E R+GD S    AS LASLS  +   LL  P +      ++ PE+P +P +
Sbjct  230   GAP----HLETRAGDSSAGDGASILASLSKYRNLRLL--PPIAKSAKRQKNPEVPVIPSS  283

Query  1077  SGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGA  1256
               +       +D    +D   +   EK+ A + D+ +++LN +   +D +  + G  T A
Sbjct  284   CNDCISDTDMNDADSDNDDAAITSVEKAAASTSDTASEDLNADGSGLDPFQEDDGGNTPA  343

Query  1257  P-QELRPLIRMLAGSSTPEFDLSGNISRIIDQRREL---LKDFDPLISMSTRRQAFKDGL  1424
                E+R ++           D+ G IS+++D+RRE+   L+D D   ++STRRQ FKD L
Sbjct  344   SGYEVRSVL-----------DIRG-ISKLLDERREVRESLRDSDISSTISTRRQEFKDSL  391

Query  1425  QQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLS  1601
             +  +L + +IEVS E FPY+LS  TK+VLIAS Y+H+   +KF K AS+LPT CPRILLS
Sbjct  392   RGGVLKAQDIEVSLEKFPYFLSATTKDVLIASMYVHMNGGSKFAKYASDLPTTCPRILLS  451

Query  1602  GPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRA  1778
             GPAGS+IYQE LAKALAK  GA++++VDSL+LPGGS A+E +  KE+P+ ER     KRA
Sbjct  452   GPAGSDIYQEMLAKALAKNLGAKVMIVDSLLLPGGSPAREAESSKESPRRERLSTLAKRA  511

Query  1779  AQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPT  1955
              Q A    +KK  SSV+ADITGGS +SS A  KQE STA+SK+ TFK GDRVK++GP  +
Sbjct  512   VQDAQALQHKKSTSSVDADITGGSTLSSQALPKQEVSTATSKSYTFKAGDRVKFLGPPSS  571

Query  1956  GFS-LQ-TPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCA  2129
               S LQ +P RGP  G++GKV+LAFE+N  SKIG+RFDR +P+GNDLGGLCEEDHGFFCA
Sbjct  572   AVSSLQGSPLRGPTIGFRGKVVLAFEDNCSSKIGIRFDRPVPDGNDLGGLCEEDHGFFCA  631

Query  2130  ADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKL  2309
             A  LRLD SS DD D+LA+NE+FEV   E +   LILF+KDIEKS+VGN + ++  K KL
Sbjct  632   ASSLRLDGSSGDDADRLAVNEIFEVALSEGEGGSLILFLKDIEKSLVGNSDVYATLKSKL  691

Query  2310  EKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETP  2489
             E LPEN+VV+AS TQ D+RKEKSHPGGFLFTKFG NQTALLDLAFPD  G+LH++SKE  
Sbjct  692   ENLPENIVVMASQTQLDSRKEKSHPGGFLFTKFGGNQTALLDLAFPD-IGKLHEKSKEAS  750

Query  2490  KAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCP  2669
             K++KQ+TRLFPNKV IQ+PQDE LL DWK++LDRD E +K Q N  +I  +L +  LDCP
Sbjct  751   KSVKQITRLFPNKVAIQLPQDEALLLDWKEKLDRDTELLKVQGNITSILGILTKNRLDCP  810

Query  2670  DIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQ  2849
             D+ETLCIKDQ+L  ESVEK++GWA SHH M+ SE + K+ KL IS+ESI YGL +L GVQ
Sbjct  811   DLETLCIKDQSLLPESVEKVVGWAFSHHLMNCSEPTIKDNKLVISAESITYGLQMLHGVQ  870

Query  2850  NETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQR  3029
             NE KS+KKSLKDVVTENEFEKKLL+DVIPPSDIGV+FDDIGALENVKDTLKELVMLPLQR
Sbjct  871   NENKSLKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKDTLKELVMLPLQR  930

Query  3030  PELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY  3209
             PELF KGQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY
Sbjct  931   PELFGKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY  990

Query  3210  VKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVL  3389
             VKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD+ERVL
Sbjct  991   VKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDRERVL  1050

Query  3390  VLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTE  3569
             VLAATNRPFDLDEAVIRRLPRRLMVNLPDA NR KIL +IL+KEE+AP+VDL+AIANMT+
Sbjct  1051  VLAATNRPFDLDEAVIRRLPRRLMVNLPDATNRSKILSVILSKEEMAPDVDLEAIANMTD  1110

Query  3570  GYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYA  3749
             GYSGSDLKNLCVTAAH PIREILEKEKKEK +A +ENRP P L++ +DIRPL M+DF+ A
Sbjct  1111  GYSGSDLKNLCVTAAHLPIREILEKEKKEKTVAEAENRPKPPLYSCTDIRPLTMNDFKAA  1170

Query  3750  HEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             HEQVCASVS++S+NM EL QWNELYGEGGSRKK +LSYFM
Sbjct  1171  HEQVCASVSTDSSNMNELQQWNELYGEGGSRKKTSLSYFM  1210



>ref|XP_009144559.1| PREDICTED: uncharacterized protein LOC103868207 isoform X1 [Brassica 
rapa]
Length=1219

 Score =  1360 bits (3520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 732/1180 (62%), Positives = 883/1180 (75%), Gaps = 51/1180 (4%)
 Frame = +3

Query  357   EAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKL  536
             + PV E  PE     E L +P + G+      + KA       GKKR         W KL
Sbjct  82    DVPVMENSPE---DDEVLATPTLAGE------RSKA-------GKKRA-----NAPWAKL  120

Query  537   LSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGK  716
             LSQYPQN H  +    FTVG+   C+L + D S+  +LC LK   +    S+  LEI+G 
Sbjct  121   LSQYPQNPHRIMRGPVFTVGR-LGCNLSIKDHSMPSTLCELKQ-AKHGAPSVASLEITGN  178

Query  717   KGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAH  896
                VQVNGK Y K+S V L GGDEVIF  SG+HAYIFQ   +E+++A     SV++ EA 
Sbjct  179   GFLVQVNGKCYQKSSCVHLRGGDEVIFSVSGRHAYIFQPLKDENLAAPDKASSVNLCEAR  238

Query  897   SGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVA  1076
               P    + E R+GD S    AS LASLS  +   LL  P +      ++ PE+P +P +
Sbjct  239   GAP----HLETRAGDSSAGDGASILASLSKYRNLRLL--PPIAKSAKRQKNPEVPVIPSS  292

Query  1077  SGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGA  1256
               +       +D    +D   +   EK+ A + D+ +++LN +   +D +  + G  T A
Sbjct  293   CNDCISDTDMNDADSDNDDAAITSVEKAAASTSDTASEDLNADGSGLDPFQEDDGGNTPA  352

Query  1257  P-QELRPLIRMLAGSSTPEFDLSGNISRIIDQRREL---LKDFDPLISMSTRRQAFKDGL  1424
                E+R ++           D+ G IS+++D+RRE+   L+D D   ++STRRQ FKD L
Sbjct  353   SGYEVRSVL-----------DIRG-ISKLLDERREVRESLRDSDISSTISTRRQEFKDSL  400

Query  1425  QQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLS  1601
             +  +L + +IEVS E FPY+LS  TK+VLIAS Y+H+   +KF K AS+LPT CPRILLS
Sbjct  401   RGGVLKAQDIEVSLEKFPYFLSATTKDVLIASMYVHMNGGSKFAKYASDLPTTCPRILLS  460

Query  1602  GPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRA  1778
             GPAGS+IYQE LAKALAK  GA++++VDSL+LPGGS A+E +  KE+P+ ER     KRA
Sbjct  461   GPAGSDIYQEMLAKALAKNLGAKVMIVDSLLLPGGSPAREAESSKESPRRERLSTLAKRA  520

Query  1779  AQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPT  1955
              Q A    +KK  SSV+ADITGGS +SS A  KQE STA+SK+ TFK GDRVK++GP  +
Sbjct  521   VQDAQALQHKKSTSSVDADITGGSTLSSQALPKQEVSTATSKSYTFKAGDRVKFLGPPSS  580

Query  1956  GFS-LQ-TPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCA  2129
               S LQ +P RGP  G++GKV+LAFE+N  SKIG+RFDR +P+GNDLGGLCEEDHGFFCA
Sbjct  581   AVSSLQGSPLRGPTIGFRGKVVLAFEDNCSSKIGIRFDRPVPDGNDLGGLCEEDHGFFCA  640

Query  2130  ADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKL  2309
             A  LRLD SS DD D+LA+NE+FEV   E +   LILF+KDIEKS+VGN + ++  K KL
Sbjct  641   ASSLRLDGSSGDDADRLAVNEIFEVALSEGEGGSLILFLKDIEKSLVGNSDVYATLKSKL  700

Query  2310  EKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETP  2489
             E LPEN+VV+AS TQ D+RKEKSHPGGFLFTKFG NQTALLDLAFPD  G+LH++SKE  
Sbjct  701   ENLPENIVVMASQTQLDSRKEKSHPGGFLFTKFGGNQTALLDLAFPD-IGKLHEKSKEAS  759

Query  2490  KAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCP  2669
             K++KQ+TRLFPNKV IQ+PQDE LL DWK++LDRD E +K Q N  +I  +L +  LDCP
Sbjct  760   KSVKQITRLFPNKVAIQLPQDEALLLDWKEKLDRDTELLKVQGNITSILGILTKNRLDCP  819

Query  2670  DIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQ  2849
             D+ETLCIKDQ+L  ESVEK++GWA SHH M+ SE + K+ KL IS+ESI YGL +L GVQ
Sbjct  820   DLETLCIKDQSLLPESVEKVVGWAFSHHLMNCSEPTIKDNKLVISAESITYGLQMLHGVQ  879

Query  2850  NETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQR  3029
             NE KS+KKSLKDVVTENEFEKKLL+DVIPPSDIGV+FDDIGALENVKDTLKELVMLPLQR
Sbjct  880   NENKSLKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKDTLKELVMLPLQR  939

Query  3030  PELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY  3209
             PELF KGQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY
Sbjct  940   PELFGKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY  999

Query  3210  VKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVL  3389
             VKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD+ERVL
Sbjct  1000  VKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDRERVL  1059

Query  3390  VLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTE  3569
             VLAATNRPFDLDEAVIRRLPRRLMVNLPDA NR KIL +IL+KEE+AP+VDL+AIANMT+
Sbjct  1060  VLAATNRPFDLDEAVIRRLPRRLMVNLPDATNRSKILSVILSKEEMAPDVDLEAIANMTD  1119

Query  3570  GYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYA  3749
             GYSGSDLKNLCVTAAH PIREILEKEKKEK +A +ENRP P L++ +DIRPL M+DF+ A
Sbjct  1120  GYSGSDLKNLCVTAAHLPIREILEKEKKEKTVAEAENRPKPPLYSCTDIRPLTMNDFKAA  1179

Query  3750  HEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             HEQVCASVS++S+NM EL QWNELYGEGGSRKK +LSYFM
Sbjct  1180  HEQVCASVSTDSSNMNELQQWNELYGEGGSRKKTSLSYFM  1219



>ref|XP_008805744.1| PREDICTED: uncharacterized protein LOC103718614 isoform X2 [Phoenix 
dactylifera]
Length=1165

 Score =  1358 bits (3516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 707/1032 (69%), Positives = 841/1032 (81%), Gaps = 23/1032 (2%)
 Frame = +3

Query  822   IFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkel  1001
             IFQ   N+ ++  +   ++ ILEA + P+KG+ FE RSGDPS VA AS LASLSN KK+L
Sbjct  141   IFQPLANDKLTTPASSSALGILEAQAVPIKGIQFETRSGDPSAVAGASILASLSNHKKDL  200

Query  1002  lllPPSVCNDNDIKQGPEMPALPVASG--EPDKHDLDSDM---KDVSDHN---DVPLDEK  1157
                PPS     +  QG E PA+P A    E    DL+ +    K  ++HN   +VP  +K
Sbjct  201   ---PPSASTGENAHQGVERPAVPSACDVTEGCNSDLEKNCDARKGNTEHNGSTEVPSGDK  257

Query  1158  SGAISPDSGNDNLNLENGAIDS---YDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGN  1328
             +  I       N + ++  I S    D +IGK++G   E+RP ++M+AGSST E DL+G 
Sbjct  258   AAVILSTDLGANESTQHDTIGSDAQLDADIGKISGTNYEIRPFLKMIAGSSTAELDLTGK  317

Query  1329  ISRIIDQRRELLKDFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKN  1505
             + ++ + +RELL+D D P    +TR QAFKDGL+Q I+++++I+VSFE FPYYLSE TKN
Sbjct  318   VFKVFEAQRELLRDLDTPAALPTTRCQAFKDGLKQGIINASDIQVSFESFPYYLSENTKN  377

Query  1506  VLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVD  1685
             VL++  YIHL+C  F+K A+++ +V  RILL+GP GSEIYQETL KALAK+FGA LL++D
Sbjct  378   VLLSCGYIHLECKDFIKYATDISSVNQRILLTGPTGSEIYQETLVKALAKHFGASLLIID  437

Query  1686  SLVLPGGSA-KELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISS  1862
             SL+LPGGS+ K+ + +KE  + E+    +KRAA   VL   +KP SSVEADI G S +SS
Sbjct  438   SLLLPGGSSSKDSESLKEGGRIEKASFLSKRAA---VLDL-RKPTSSVEADILGTSMLSS  493

Query  1863  HAQTKQEASTASSKN-TFKTGDRVKYVGPLPTG-FSLQTPARGPAYGYKGKVLLAFEENG  2036
             H+  KQEASTASSKN TFK GDRVK+VGP+P+  F LQ P RGP  GY+GKV+LAFEENG
Sbjct  494   HSLPKQEASTASSKNYTFKEGDRVKFVGPVPSSSFPLQAPQRGPNIGYRGKVVLAFEENG  553

Query  2037  FSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQE  2216
              SK+GVRFD+ IP+GNDLGGLCEEDHGFFC AD LR D+S  +D ++LAINEL EVVS+E
Sbjct  554   ASKVGVRFDKQIPDGNDLGGLCEEDHGFFCTADLLRPDSSGGEDNERLAINELLEVVSEE  613

Query  2217  CKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFL  2396
              K+ PLI+ +KDIEKSM G  + +   + KL+ +P  V++I S+TQ DNRKEKSHPGG L
Sbjct  614   SKNGPLIILIKDIEKSMAGGTDTYLTLRSKLDLIPAGVLIIGSHTQMDNRKEKSHPGGLL  673

Query  2397  FTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWK  2576
             FTKFGSNQTALLD AFPDNFGRLH+RSKE PK +KQLTRLFPNKV IQ+PQDE  L DWK
Sbjct  674   FTKFGSNQTALLDFAFPDNFGRLHERSKEIPKTMKQLTRLFPNKVSIQLPQDEAQLLDWK  733

Query  2577  QQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHF  2756
             QQLDRDIET+K++SN ++IR+ LNR  LDC D+ET+ IKDQ LTNE+V+KI+G+ALSHH 
Sbjct  734   QQLDRDIETLKAKSNILSIRSFLNRSGLDCHDVETISIKDQTLTNENVDKIVGFALSHHL  793

Query  2757  MHSS-ESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVI  2933
              ++  E+S K+ KL +SS+SI++GLS+LQ +QN+TKS KKSLKDVVTENEFEK+LLADVI
Sbjct  794   KNNKIEASAKDAKLVLSSDSIKHGLSMLQSIQNDTKSAKKSLKDVVTENEFEKRLLADVI  853

Query  2934  PPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTM  3113
             PP+DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTM
Sbjct  854   PPNDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTM  913

Query  3114  LAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRR  3293
             LAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRR
Sbjct  914   LAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRR  973

Query  3294  ESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLP  3473
             E+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLP
Sbjct  974   ENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLP  1033

Query  3474  DAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekk  3653
             DA NR KILR+IL KEELAP++DL+ +ANMT+GYSGSDLKNLCVTAAHCPIREILEKEKK
Sbjct  1034  DASNRVKILRVILAKEELAPDIDLEVVANMTDGYSGSDLKNLCVTAAHCPIREILEKEKK  1093

Query  3654  ekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEG  3833
             E+ LA++E RPLPALH S DIR L+MDD +YAHEQVCASVSSESTNM+ELLQWNELYGEG
Sbjct  1094  ERILALAEGRPLPALHGSDDIRRLSMDDLKYAHEQVCASVSSESTNMSELLQWNELYGEG  1153

Query  3834  GSRKKKALSYFM  3869
             GSRKKKALSYFM
Sbjct  1154  GSRKKKALSYFM  1165



>gb|EYU42216.1| hypothetical protein MIMGU_mgv1a001073mg [Erythranthe guttata]
Length=895

 Score =  1356 bits (3509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 689/925 (74%), Positives = 781/925 (84%), Gaps = 36/925 (4%)
 Frame = +3

Query  1113  MKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLA  1292
             MKD S HND       GA      N+ LN+        D EIGK+          +  L 
Sbjct  1     MKDSSLHND-------GA-----SNEKLNI--------DTEIGKIVNGES-----LHFLT  35

Query  1293  GSSTPEFDLSGNISRIIDQRR---ELLKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVS  1463
              S   ++D++G ISRII++     ++ K   P IS S+RRQ FKD LQ+ ++DS  I V+
Sbjct  36    AS---KYDIAGRISRIIEEHTKFTDMRKGSHPPISTSSRRQEFKDRLQRGLIDSKEINVT  92

Query  1464  FEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAK  1643
             FE+FPYYLSE TKNVLI+STYI LKCNKF K  S+LPT+ PRI+LSGPAGSEIYQETL K
Sbjct  93    FENFPYYLSETTKNVLISSTYIPLKCNKFAKFTSDLPTLSPRIMLSGPAGSEIYQETLTK  152

Query  1644  ALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPAS  1820
             A+AK+FG RLL+VD+++LPGG   KE+D VKE+ KP+R  V +KR+  +      KKP S
Sbjct  153   AIAKHFGTRLLIVDTVLLPGGPIMKEVDSVKESSKPDRASVLSKRSFGSGF--HLKKPTS  210

Query  1821  SVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAY  1994
             SV+ADITGGSA+SS AQ KQEASTA+SK  TF+ GDRVKYVG LP GFS  QT  RGP  
Sbjct  211   SVDADITGGSALSSQAQPKQEASTATSKKYTFRKGDRVKYVGSLPLGFSPAQTTIRGPTN  270

Query  1995  GYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLD  2174
             GYKGKV+LAFEENG SKIGVRFD++IPEGNDLGGLCEEDHGFFCAAD LRLD+S+ DD+D
Sbjct  271   GYKGKVVLAFEENGSSKIGVRFDKTIPEGNDLGGLCEEDHGFFCAADLLRLDSSNSDDMD  330

Query  2175  KLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQ  2354
             KLAINELFEV S E K+SPLILF+KDIEKSM GN EA+++FK+KLE+LPENVV+IAS+TQ
Sbjct  331   KLAINELFEVASTESKTSPLILFLKDIEKSMAGNAEAYASFKVKLEQLPENVVIIASHTQ  390

Query  2355  TDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVM  2534
             TD+RKEK H GG LFTKFG NQTALLDL+FPDNFGRLHDRSKE PK  KQL+RLFPNKV 
Sbjct  391   TDSRKEKPHHGGLLFTKFGGNQTALLDLSFPDNFGRLHDRSKEIPKTQKQLSRLFPNKVT  450

Query  2535  IQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNE  2714
             IQIPQDE  L +WK QLDRDIE MKS+SN  +I +VLNR+ L CPD++TLCIKDQAL +E
Sbjct  451   IQIPQDEIALVEWKIQLDRDIEIMKSKSNIASILSVLNRIGLSCPDLDTLCIKDQALNSE  510

Query  2715  SVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVT  2894
             SVEKI+GWALSHHFMH  E+S +E K  IS ESIRYGL++LQG+QNE KS KKSLKDV T
Sbjct  511   SVEKIVGWALSHHFMHFYEASPEESKFVISIESIRYGLNILQGIQNENKSSKKSLKDVAT  570

Query  2895  ENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKG  3074
             EN+FEKKLLA+VIPP DIGV+FDDIGALENVK+TLKELVMLPLQRPELF KGQLTKPCKG
Sbjct  571   ENDFEKKLLAEVIPPGDIGVSFDDIGALENVKETLKELVMLPLQRPELFTKGQLTKPCKG  630

Query  3075  ILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSV  3254
             ILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV
Sbjct  631   ILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSV  690

Query  3255  VFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAV  3434
             VFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAV
Sbjct  691   VFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAV  750

Query  3435  IRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAA  3614
             IRRLPRRLMVNLPDA NREKIL++IL KEE+APN+DL+A+ANMT+GYSGSDLKNLCVTAA
Sbjct  751   IRRLPRRLMVNLPDAQNREKILKVILAKEEMAPNMDLEAVANMTDGYSGSDLKNLCVTAA  810

Query  3615  HCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNM  3794
             HCPIREILEKEKKEKALA +ENRP PALH+SSD+R LN+DDF+YAHEQVCASVSS+S NM
Sbjct  811   HCPIREILEKEKKEKALAEAENRPTPALHSSSDVRSLNVDDFKYAHEQVCASVSSDSRNM  870

Query  3795  TELLQWNELYGEGGSRKKKALSYFM  3869
              EL+QWNELYGEGGSRKK++LSYFM
Sbjct  871   NELVQWNELYGEGGSRKKESLSYFM  895



>gb|KCW58478.1| hypothetical protein EUGRSUZ_H01157 [Eucalyptus grandis]
Length=1206

 Score =  1355 bits (3508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/1100 (64%), Positives = 853/1100 (78%), Gaps = 32/1100 (3%)
 Frame = +3

Query  522   AWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLL  701
             AWG+LLSQ  QN ++ +  S F VG G QC+LC+ DPS+S  LC LKHI R  G+S TLL
Sbjct  109   AWGQLLSQCNQNPNLLMRDSLFIVGHGSQCNLCLADPSISMVLCKLKHIVR-GGSSATLL  167

Query  702   EISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVS  881
             EI+G KG VQVNGKIYP+NSTV L GGDEV+F  SG H+Y+FQ F  +D  A    PS  
Sbjct  168   EITGGKGTVQVNGKIYPRNSTVLLCGGDEVVFTESGNHSYVFQPF--DDNVADVGIPSEC  225

Query  882   ILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMP  1061
             ILEA    +K ++ E+RS  PS V+ AS L+     +   LL PP   +  D++    +P
Sbjct  226   ILEAQGASMKELHIESRSEGPSAVSGASMLSLTDLQEDLSLLPPPGKSSP-DVQCNTGIP  284

Query  1062  ALPVASGEPDKHDLDSDMKDVS---DHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDG  1232
              +P      D  + + +++D S   D  DV   EKS + S +  ++N NL+    DS   
Sbjct  285   IVPSVCDTSDNQNGEVEIRDSSNNDDARDVSTREKSVSPSAECNDENANLDGAGFDSRAP  344

Query  1233  EIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQ----RRELLKDFDPLI-----  1385
                KV GA  ELRPL +M+   S P FD+   +S+I++     RR+LL++ D  +     
Sbjct  345   GDEKVPGAACELRPLWQMIG--SPPNFDI---LSKIVEDQREIRRKLLRNSDASLLKNND  399

Query  1386  ----SMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFV  1553
                 S +  R+AF++ L+Q I DS+NI+VSFE+FPYYLS+ TKNVLIASTY+ LK ++FV
Sbjct  400   MSSDSRTDWRKAFRESLEQAISDSDNIKVSFENFPYYLSDTTKNVLIASTYLRLKRSEFV  459

Query  1554  KCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPV  1730
             K + +LPT+CPRILLSGPAGSEIYQETL KALAK+FGARLL+VDSL+LPG    K++D +
Sbjct  460   KYSKDLPTLCPRILLSGPAGSEIYQETLTKALAKHFGARLLIVDSLLLPGDLMPKDVDSL  519

Query  1731  KEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-  1907
             KE  K E+T V  KRA Q++ +  ++KP SSVEADITGGS + S AQTKQE STA+SK  
Sbjct  520   KECVKSEKTSVHAKRAGQSSAVH-HRKPTSSVEADITGGSIVGSRAQTKQEVSTATSKTY  578

Query  1908  TFKTGDRVKYVGPLPTGFSLQTPARGPAYGYKGKVLLAFEEN--GFSKIGVRFDRSIPEG  2081
              FK GDRV++VG    G S   P RGP+ GY+GKV+LAFEEN    +K+GVRFD+ I EG
Sbjct  579   KFKKGDRVRFVGS--AGLSSLQPLRGPSDGYRGKVVLAFEENENDAAKVGVRFDKPILEG  636

Query  2082  NDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEK  2261
             N+LG  CE+DHGFFC+A+ LRL++S  ++ D LAI+E+FEV     KS PL++FVKD+EK
Sbjct  637   NNLGEHCEKDHGFFCSANSLRLESSGGEETDSLAIDEIFEVALSASKSCPLVIFVKDVEK  696

Query  2262  SMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLA  2441
             ++V +P+A   F+ KLE LP NVVVI S+ Q D+RKEKSH GG LFTKF  N TALLDLA
Sbjct  697   AVVASPDAGQVFRAKLENLPGNVVVIGSHIQLDSRKEKSHSGGLLFTKFAGNPTALLDLA  756

Query  2442  FPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSN  2621
             FPD+FGRLH+R KE+PK +KQL RLFPNKV IQ+PQDE LL DWKQQL+RD+ETM++QSN
Sbjct  757   FPDSFGRLHERGKESPKTMKQLARLFPNKVSIQLPQDEVLLLDWKQQLERDVETMRAQSN  816

Query  2622  AVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAI  2801
               ++R VLNR  +DCPDIET+CI DQ LT+ESVEKI+GWALSHHFM SSE+  K+ KL +
Sbjct  817   IASVRLVLNRSGMDCPDIETVCINDQTLTSESVEKIVGWALSHHFMCSSEAPVKDAKLVL  876

Query  2802  SSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALE  2981
             SSESIRYG+++ QG+ NE K  KKSLKDVVTENEFEKKLL DVIPP+DIGV+FDDIGALE
Sbjct  877   SSESIRYGINIFQGIHNENKGSKKSLKDVVTENEFEKKLLTDVIPPTDIGVSFDDIGALE  936

Query  2982  NVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINI  3161
             NVKDTLKELVMLPLQRPELF KGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINI
Sbjct  937   NVKDTLKELVMLPLQRPELFSKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINI  996

Query  3162  SMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEF  3341
             SMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEF
Sbjct  997   SMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEF  1056

Query  3342  MVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKE  3521
             MVNWDGLRTKDKERVLVL ATNRPFDLDEAVIRR PRRLMVNLPDA NRE+IL++IL KE
Sbjct  1057  MVNWDGLRTKDKERVLVLGATNRPFDLDEAVIRRFPRRLMVNLPDALNRERILKVILAKE  1116

Query  3522  ELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALH  3701
             EL  ++D +A+A MTEGYSGSDLKNLCV+AAHCPIREIL+KEKKE+ LA++ENRPLP+L+
Sbjct  1117  ELGSDIDFEAVAKMTEGYSGSDLKNLCVSAAHCPIREILDKEKKERTLAVAENRPLPSLY  1176

Query  3702  NSSDIRPLNMDDFRYAHEQV  3761
             +  DIRPL MDDF+YAHEQV
Sbjct  1177  SGMDIRPLKMDDFKYAHEQV  1196



>ref|XP_009119600.1| PREDICTED: uncharacterized protein LOC103844551 isoform X2 [Brassica 
rapa]
Length=1214

 Score =  1352 bits (3500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 767/1273 (60%), Positives = 928/1273 (73%), Gaps = 86/1273 (7%)
 Frame = +3

Query  132   MVETrrssssskrplpspssplpNGKRSKATES----LSSTDDMLGEKTPGAVNESGPES  299
             MVETRRSSS+SKR  P  SS     KRSKAT +     SS  D   E     V+  G ES
Sbjct  1     MVETRRSSSASKRNSPPESSSSRPTKRSKATAAEPAGSSSASDAPIENNQNPVSVPGSES  60

Query  300   AE-QEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSA  476
              E  ++ + D   A+    P+A   +++       + LV+P   G+   + DK K     
Sbjct  61    GEPSKLGTNDPVIANDASCPDADTNQQV-------QGLVTPTPTGEVVAEADKSK-----  108

Query  477   LNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCN  656
               + +K  LK      W KL+SQYPQN H  +    FTVG+ R CDL +   S+   LC 
Sbjct  109   --KAEKLWLKRT-KAPWAKLISQYPQNPHRVMKGPVFTVGR-RGCDLSIKYQSMPNVLCE  164

Query  657   LKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKF  836
             L+ ++++ G S+  LEI GK   V+VNGKIY K++ V L GGDEVIF +  KHAYIFQ  
Sbjct  165   LRQMEQQAGPSVASLEIIGKGVLVEVNGKIYQKSTCVHLRGGDEVIFNTPVKHAYIFQPL  224

Query  837   TNEDISAASMPPSVSILEAHS-GPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllP  1013
              +E+++A     SVSI EA S  P+KG++ E R+GD S+ ++ ++          L  LP
Sbjct  225   KDENLAAPDRASSVSIFEAQSTAPLKGLHVETRAGDSSSCSLLAS----LRKIHNLPFLP  280

Query  1014  PSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDV---SDHNDVPLDEKSGAISPD-S  1181
             P   N    +Q PE+  LP +S   D    D DM D    +DH  +   +KS  +SP  +
Sbjct  281   PPAKNGKK-QQNPEVSVLPSSS---DDCIPDVDMNDADSSNDHAAIASADKS-VVSPSLT  335

Query  1182  GNDNLNLENGAID----SYDGEIGK-VTGAPQELRPLIRMLAGSSTPEFDLSGNISRIID  1346
              ND+LN +   +D    + +G+ G+ V   P+E         GSS+              
Sbjct  336   ANDDLNADGNGMDPSQETEEGDDGREVKEVPKE--------CGSSS--------------  373

Query  1347  QRRELLKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTY  1526
                          S++TRRQA KD L+  +L+  +IEVSFE+FPY+LS  TK+VL+ASTY
Sbjct  374   ------------ASVATRRQAHKDFLRAGVLNPQDIEVSFENFPYFLSGTTKDVLVASTY  421

Query  1527  IHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPG  1703
             +H+K  +KF K AS+L TVCPRILLSGPAGSEIYQE LAKALAK +GA+L++VD+L+LPG
Sbjct  422   VHMKSESKFAKYASDLSTVCPRILLSGPAGSEIYQEALAKALAKNYGAKLMIVDTLLLPG  481

Query  1704  G-SAKELDPVKEAPKPERTGVFTKRAAQA--AVLRFNKKPASSVEADITGGSAISSHAQT  1874
             G +AKE D  K++ + ER  V  KRA QA  A +  +KKP SSVEADITGGS ++S A  
Sbjct  482   GPTAKEADSSKDSSRRERLTVIAKRAVQAAHAAVMQHKKPTSSVEADITGGSTLNSQAVM  541

Query  1875  KQEASTASSKN-TFKTGDRVKYVGPLPTGF-SLQTP-----ARGPAYGYKGKVLLAFEEN  2033
             +QE STA+SK+ TFKTGDRVK+VGP  +   S  T      +RGP  G +GKVLLAFE+N
Sbjct  542   RQEVSTATSKSYTFKTGDRVKFVGPATSSVTSFHTAHSAILSRGPTTGLQGKVLLAFEDN  601

Query  2034  GFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQ  2213
               SKIGVRFDR I +GNDLGGLCE+D GFFC A  LRLD+SS D+ D+LAINE+FEV++ 
Sbjct  602   VSSKIGVRFDRPIVDGNDLGGLCEKDRGFFCTATSLRLDSSSSDNADRLAINEIFEVLTN  661

Query  2214  ECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGF  2393
             E +   LILF+KDI+KS+ GN E +   K KLEKLPENVVVIAS TQ DNRKEKSHPGGF
Sbjct  662   ESEKGSLILFLKDIDKSVSGNTEVYVTLKSKLEKLPENVVVIASQTQLDNRKEKSHPGGF  721

Query  2394  LFTKFGSNQTALLDLAFPDNF-GRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSD  2570
             LFTKFGSNQT LLDLAFPDNF GRL DR+KE PK++KQ+TRLFPNKV I++P DE LL D
Sbjct  722   LFTKFGSNQTTLLDLAFPDNFGGRLQDRNKEMPKSLKQITRLFPNKVTIKLPDDEALLLD  781

Query  2571  WKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSH  2750
             WK++L+RD E +K+Q+N  +IR VL++  L+CPDIETLCI DQ+L  +SVEK++GWA SH
Sbjct  782   WKEKLERDTEILKAQANLTSIRAVLSKNRLECPDIETLCINDQSLPTDSVEKVVGWAFSH  841

Query  2751  HFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADV  2930
             H M  SE + K+ KL IS+E+I YGL VL G+QNE KS+KKSLKDVVTENEFEKKLL+DV
Sbjct  842   HLMTCSEPTVKDNKLIISAENITYGLQVLHGIQNENKSIKKSLKDVVTENEFEKKLLSDV  901

Query  2931  IPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKT  3110
             IPPSDIGV+FDDIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFGPPGTGKT
Sbjct  902   IPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPELFGKGQLTKPTKGILLFGPPGTGKT  961

Query  3111  MLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGR  3290
             MLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGR
Sbjct  962   MLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGR  1021

Query  3291  RESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNL  3470
             RE+PGEHEAMRKMKNEFM+NWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNL
Sbjct  1022  RENPGEHEAMRKMKNEFMINWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNL  1081

Query  3471  PDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekek  3650
             PD+ NR KIL +IL KEE+A +VDL+AIANMT+GYSGSDLKNLCVTAAH PIREILEKEK
Sbjct  1082  PDSANRSKILSVILAKEEMAEDVDLEAIANMTDGYSGSDLKNLCVTAAHLPIREILEKEK  1141

Query  3651  kekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGE  3830
             KE+++A +ENRP+P L+NS+DIRPLNM DF+ AHEQVCASVS++S+NM EL QWNELYGE
Sbjct  1142  KERSVAQAENRPMPQLYNSTDIRPLNMKDFKSAHEQVCASVSTDSSNMNELQQWNELYGE  1201

Query  3831  GGSRKKKALSYFM  3869
             GGSRKK +LSYFM
Sbjct  1202  GGSRKKTSLSYFM  1214



>ref|XP_010522785.1| PREDICTED: uncharacterized protein LOC104801270 isoform X2 [Tarenaya 
hassleriana]
Length=1095

 Score =  1344 bits (3479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 726/1120 (65%), Positives = 869/1120 (78%), Gaps = 53/1120 (5%)
 Frame = +3

Query  582   TFTVGQGRQCDLCVDDPSVSKS-LCNLKHIQREKGN-SITLLEISGKKGCVQVNGKIYPK  755
              FT+GQ R CDL + D S+ ++ LC L+  Q E G+ S   LEI G +G VQVNGK Y +
Sbjct  5     VFTIGQ-RGCDLSIKDSSMPRTTLCELR--QSEHGDPSAASLEIIGNRGIVQVNGKNYQR  61

Query  756   NSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARS  935
              +T+ L GGDE++F SSGKHAYIF  F +++++A+    S+SI+EA S P+KG++ EAR 
Sbjct  62    KATIQLRGGDELVFSSSGKHAYIFLPFKDDNLAASDRASSLSIIEARSAPLKGLHIEARP  121

Query  936   GDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDL--DS  1109
             GDPS +  AS LASLSN     LL PP+  N    ++ P +P        P  +D   D 
Sbjct  122   GDPSALDGASMLASLSNYHNFPLL-PPTHANRQPNREVPVVP--------PICNDCIPDV  172

Query  1110  DMKDVSDHNDVPLD---EKSGAISPDSGNDNLNLENGAID---SYDGEIGKVTGAPQELR  1271
             DM D   ++D+      EK+ A +  + N++LN E   +D   S  G  G V G+  E+R
Sbjct  173   DMNDADSNDDIAAIASMEKTVASTSGAANNSLNSEGNGMDPCQSTGG--GNVPGSSYEIR  230

Query  1272  PLIRMLAGSSTPEFDLSGNISRIIDQRRE---LLKDFDPLIS---MSTRRQAFKDGLQQT  1433
             P++ M    S+ EFDL G+IS+I+D++RE    LK FD  IS   +S+RRQA+KD L+  
Sbjct  231   PILHMHGDPSSSEFDLKGSISKILDEQREARNFLKGFD--ISSALLSSRRQAYKDSLRAG  288

Query  1434  ILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPA  1610
             +L    IEVS E+FPY+LS  TK+VL  S Y+H+KC +KF K AS L T+ PRILLSGP 
Sbjct  289   VLSPQKIEVSLENFPYFLSTTTKDVLTGSIYVHMKCGSKFAKYASGLSTMRPRILLSGPV  348

Query  1611  GSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPV--KEAPKPERTGVFTKRAA  1781
             GSE+YQE LAKAL+K+FGA+L++VDSL+LPGGS  KE+D    +E  + ER  +  +RA 
Sbjct  349   GSEVYQEMLAKALSKHFGAKLMIVDSLLLPGGSLTKEVDSSNSREGSRRERLSMLAQRAV  408

Query  1782  QAAVLRF--NKKPASSVEADITGGSAISSHAQTKQEASTASSK-NTFKTGDRVKYVGPLP  1952
             +AA      +KK AS VEADITGGS             TA+SK  TFKTGDRVK+VGP P
Sbjct  409   RAAQAAALQHKKSASIVEADITGGS-------------TATSKVYTFKTGDRVKFVGPSP  455

Query  1953  TGFS-LQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCA  2129
             +  S LQ P RGPA G++GKV+LAFE NG SKIGVRFDRSI +GNDLGGLCEEDHGFFC 
Sbjct  456   SALSSLQGPLRGPAIGFQGKVVLAFEGNGSSKIGVRFDRSIADGNDLGGLCEEDHGFFCT  515

Query  2130  ADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKL  2309
             A  LRLD+S+ DD DKLAINE+FEV   E +  PLILF+KD+EKS+VGN + ++  K KL
Sbjct  516   AGSLRLDSSTSDDADKLAINEIFEVAFGEREGGPLILFLKDVEKSLVGNTDVYATLKSKL  575

Query  2310  EKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETP  2489
             + LPE +VVIAS TQ D+RKEKS PGG LFTKFG N T+LLDLAFP+N GRLHDRSKE P
Sbjct  576   QNLPEGIVVIASQTQLDSRKEKSLPGGLLFTKFGGNPTSLLDLAFPNNLGRLHDRSKEMP  635

Query  2490  KAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCP  2669
             K++KQLTRLFPNKV IQ+PQDE LL +WK++L+RD+  +K+Q+N  +IR VL++  L C 
Sbjct  636   KSMKQLTRLFPNKVAIQLPQDEALLLEWKEKLERDMLILKAQANISSIRAVLSKNRLVCL  695

Query  2670  DIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQ  2849
             D+ETLCIKDQ L +ESVEKI+GWALSHH MH SE + K+ +L IS++SI +GL VL G+Q
Sbjct  696   DLETLCIKDQILPHESVEKIVGWALSHHSMHCSEFTIKDNQLVISAKSITFGLDVLHGIQ  755

Query  2850  NETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQR  3029
             NE+KS+KKSLKDVVTENEFEKKLL+DVIPPSDIGV+FDDIGALENVKDTLKELVMLPLQR
Sbjct  756   NESKSIKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKDTLKELVMLPLQR  815

Query  3030  PELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY  3209
             PELF KGQLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY
Sbjct  816   PELFGKGQLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKY  875

Query  3210  VKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVL  3389
             VKAVF+LASKIAP V+FVDEVD MLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD+ERVL
Sbjct  876   VKAVFSLASKIAPCVIFVDEVDGMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDRERVL  935

Query  3390  VLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTE  3569
             VLAATNRPFDLDEAVIRRLPRR+MVNLPDA NREKILR+IL KEE+ P+VDL+A+ANMT 
Sbjct  936   VLAATNRPFDLDEAVIRRLPRRMMVNLPDAANREKILRVILAKEEMLPDVDLEALANMTN  995

Query  3570  GYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYA  3749
             GYSGSDLKNLCVTAAH PIREILEKEKKEK  +++ENRPLP L+NSSDIRPL M+DF  A
Sbjct  996   GYSGSDLKNLCVTAAHRPIREILEKEKKEKNASVAENRPLPPLYNSSDIRPLTMNDFMIA  1055

Query  3750  HEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             HEQVCASVSS+S NM+EL QWNELYGEGGSRKK +LSYFM
Sbjct  1056  HEQVCASVSSDSLNMSELQQWNELYGEGGSRKKTSLSYFM  1095



>ref|XP_008805746.1| PREDICTED: uncharacterized protein LOC103718614 isoform X3 [Phoenix 
dactylifera]
Length=1140

 Score =  1342 bits (3474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 699/1005 (70%), Positives = 826/1005 (82%), Gaps = 23/1005 (2%)
 Frame = +3

Query  903   PVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASG  1082
             P+KG+ FE RSGDPS VA AS LASLSN KK+L   PPS     +  QG E PA+P A  
Sbjct  143   PIKGIQFETRSGDPSAVAGASILASLSNHKKDL---PPSASTGENAHQGVERPAVPSACD  199

Query  1083  --EPDKHDLDSDM---KDVSDHN---DVPLDEKSGAISPDSGNDNLNLENGAIDS---YD  1229
               E    DL+ +    K  ++HN   +VP  +K+  I       N + ++  I S    D
Sbjct  200   VTEGCNSDLEKNCDARKGNTEHNGSTEVPSGDKAAVILSTDLGANESTQHDTIGSDAQLD  259

Query  1230  GEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKDFD-PLISMSTRRQ  1406
              +IGK++G   E+RP ++M+AGSST E DL+G + ++ + +RELL+D D P    +TR Q
Sbjct  260   ADIGKISGTNYEIRPFLKMIAGSSTAELDLTGKVFKVFEAQRELLRDLDTPAALPTTRCQ  319

Query  1407  AFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCP  1586
             AFKDGL+Q I+++++I+VSFE FPYYLSE TKNVL++  YIHL+C  F+K A+++ +V  
Sbjct  320   AFKDGLKQGIINASDIQVSFESFPYYLSENTKNVLLSCGYIHLECKDFIKYATDISSVNQ  379

Query  1587  RILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSA-KELDPVKEAPKPERTGV  1763
             RILL+GP GSEIYQETL KALAK+FGA LL++DSL+LPGGS+ K+ + +KE  + E+   
Sbjct  380   RILLTGPTGSEIYQETLVKALAKHFGASLLIIDSLLLPGGSSSKDSESLKEGGRIEKASF  439

Query  1764  FTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYV  1940
              +KRAA   VL   +KP SSVEADI G S +SSH+  KQEASTASSKN TFK GDRVK+V
Sbjct  440   LSKRAA---VLDL-RKPTSSVEADILGTSMLSSHSLPKQEASTASSKNYTFKEGDRVKFV  495

Query  1941  GPLPTG-FSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHG  2117
             GP+P+  F LQ P RGP  GY+GKV+LAFEENG SK+GVRFD+ IP+GNDLGGLCEEDHG
Sbjct  496   GPVPSSSFPLQAPQRGPNIGYRGKVVLAFEENGASKVGVRFDKQIPDGNDLGGLCEEDHG  555

Query  2118  FFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAF  2297
             FFC AD LR D+S  +D ++LAINEL EVVS+E K+ PLI+ +KDIEKSM G  + +   
Sbjct  556   FFCTADLLRPDSSGGEDNERLAINELLEVVSEESKNGPLIILIKDIEKSMAGGTDTYLTL  615

Query  2298  KLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRS  2477
             + KL+ +P  V++I S+TQ DNRKEKSHPGG LFTKFGSNQTALLD AFPDNFGRLH+RS
Sbjct  616   RSKLDLIPAGVLIIGSHTQMDNRKEKSHPGGLLFTKFGSNQTALLDFAFPDNFGRLHERS  675

Query  2478  KETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVE  2657
             KE PK +KQLTRLFPNKV IQ+PQDE  L DWKQQLDRDIET+K++SN ++IR+ LNR  
Sbjct  676   KEIPKTMKQLTRLFPNKVSIQLPQDEAQLLDWKQQLDRDIETLKAKSNILSIRSFLNRSG  735

Query  2658  LDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSS-ESSTKEGKLAISSESIRYGLSV  2834
             LDC D+ET+ IKDQ LTNE+V+KI+G+ALSHH  ++  E+S K+ KL +SS+SI++GLS+
Sbjct  736   LDCHDVETISIKDQTLTNENVDKIVGFALSHHLKNNKIEASAKDAKLVLSSDSIKHGLSM  795

Query  2835  LQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVM  3014
             LQ +QN+TKS KKSLKDVVTENEFEK+LLADVIPP+DIGVTFDDIGALENVKDTLKELVM
Sbjct  796   LQSIQNDTKSAKKSLKDVVTENEFEKRLLADVIPPNDIGVTFDDIGALENVKDTLKELVM  855

Query  3015  LPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG  3194
             LPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG
Sbjct  856   LPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFG  915

Query  3195  EGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKD  3374
             EGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD
Sbjct  916   EGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKD  975

Query  3375  KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAI  3554
             KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDA NR KILR+IL KEELAP++DL+ +
Sbjct  976   KERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDASNRVKILRVILAKEELAPDIDLEVV  1035

Query  3555  ANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMD  3734
             ANMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE+ LA++E RPLPALH S DIR L+MD
Sbjct  1036  ANMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERILALAEGRPLPALHGSDDIRRLSMD  1095

Query  3735  DFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             D +YAHEQVCASVSSESTNM+ELLQWNELYGEGGSRKKKALSYFM
Sbjct  1096  DLKYAHEQVCASVSSESTNMSELLQWNELYGEGGSRKKKALSYFM  1140



>emb|CDY18129.1| BnaC05g01520D [Brassica napus]
Length=1214

 Score =  1340 bits (3467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 734/1173 (63%), Positives = 878/1173 (75%), Gaps = 69/1173 (6%)
 Frame = +3

Query  408   LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  587
             LV+P   G+   + DK K       + +K  LK      W KL+SQYPQN H  +    F
Sbjct  92    LVTPTPTGEVVAEADKSK-------KAEKLWLKRT-KAPWAKLISQYPQNPHRVMRGPVF  143

Query  588   TVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTV  767
             TVG+ R CDL + D S+   LC L+ ++ + G S+  LEI G    VQVNGK+Y K++ V
Sbjct  144   TVGR-RGCDLSIKDQSMPSVLCELRQME-QGGPSVASLEIIGTGVLVQVNGKVYQKSTCV  201

Query  768   PLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSG-PVKGVNFEARSGDP  944
              L GGDEV+F + GKHAYIFQ   +E+++A     SVSI EA S  P KG++ E R+GD 
Sbjct  202   HLRGGDEVVFSNPGKHAYIFQPLKDENLAAPDRASSVSIFEAQSAAPRKGLHVETRAGDS  261

Query  945   STVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDV  1124
             S+ ++ ++L  + NL       PP   N   ++Q PE+  LP +S   D    D DM D 
Sbjct  262   SSCSLLASLRKIHNLPFL----PPPAKN-GKMQQNPEVSVLPSSS---DDCIPDVDMNDA  313

Query  1125  ---SDHNDVPLDEKSGAISPD-SGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLA  1292
                +DH  +   +KS  +SP  + ND+LN +   +D                 P      
Sbjct  314   DSSNDHAAIASADKS-VVSPSLTANDDLNADGNGMD-----------------PSQETEE  355

Query  1293  GSSTPEFDLSGNISRIIDQRRELLKDFDPL-ISMSTRRQAFKDGLQQTILDSNNIEVSFE  1469
             G S P               +E+ K+ D    S++TRRQA KD L+  +L+  +IEVSFE
Sbjct  356   GVSIP--------------VKEVPKECDSSSASVATRRQAHKDFLRAGVLNPQDIEVSFE  401

Query  1470  DFPYYLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKA  1646
             +FPY+LS  TK+VLIASTY+H+K  +KF K AS+L TVCPRILLSGPAGSEIYQE LAKA
Sbjct  402   NFPYFLSGTTKDVLIASTYVHMKSESKFAKYASDLSTVCPRILLSGPAGSEIYQEALAKA  461

Query  1647  LAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFN---KKP  1814
             LAK +GA+L++VD+L+LPGG +AKE D  K++ + ER  V  KRA QAA        KKP
Sbjct  462   LAKNYGAKLMIVDTLLLPGGPTAKESDSSKDSSRRERLTVIAKRAVQAAAHAAVMQHKKP  521

Query  1815  ASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGF-SLQTP----  1976
              SSVEADITGGS ++S A  +QE STA+SK+ TFKTGDRVK+VGP  +   S  T     
Sbjct  522   TSSVEADITGGSTLNSQAVMRQEVSTATSKSYTFKTGDRVKFVGPATSSVTSFHTAHSAI  581

Query  1977  -ARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDN  2153
              +RGP  G +GKVLLAFE+N  SKIGVRFDR I +GNDLGGLCE+D GFFC A  LRLD+
Sbjct  582   LSRGPTTGLQGKVLLAFEDNVSSKIGVRFDRPIVDGNDLGGLCEKDRGFFCTATSLRLDS  641

Query  2154  SSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVV  2333
              S D+ D+LAINE+FEV++ E +   LILF+KDI+KS+ GN E +   K KLEKLPENVV
Sbjct  642   YSSDNADRLAINEIFEVLTNESEKGSLILFLKDIDKSVSGNTEVYVTLKSKLEKLPENVV  701

Query  2334  VIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLT  2510
             VIAS TQ DNRKEKSHPGGFLFTKFGSNQT LLDLAFPDNFG RL DR+KE PK++KQ+T
Sbjct  702   VIASQTQLDNRKEKSHPGGFLFTKFGSNQTTLLDLAFPDNFGGRLQDRNKEMPKSLKQIT  761

Query  2511  RLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCI  2690
             RLFPNKV IQ+P+DE LL DWK++L+RD E +K+Q+N  +IR VL++  L+CPD+ETLCI
Sbjct  762   RLFPNKVTIQLPEDEALLLDWKEKLERDTEILKAQANLSSIRAVLSKNRLECPDLETLCI  821

Query  2691  KDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVK  2870
             KDQ+L  +SVEK++GWA SHH M  SE + K+ KL IS+E+I YGL VL G+QNE KS K
Sbjct  822   KDQSLPTDSVEKVVGWAFSHHLMTCSEPTVKDNKLIISAENITYGLQVLHGIQNENKSTK  881

Query  2871  KSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKG  3050
             KSLKDVVTENEFEKKLL+DVIPPSDIGV+FDDIGALENVKDTLKELVMLPLQRPELF KG
Sbjct  882   KSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPELFGKG  941

Query  3051  QLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTL  3230
             QLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+L
Sbjct  942   QLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSL  1001

Query  3231  ASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNR  3410
             ASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKDKERVLVLAATNR
Sbjct  1002  ASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMINWDGLRTKDKERVLVLAATNR  1061

Query  3411  PFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDL  3590
             PFDLDEAVIRRLPRRLMVNLPD+ NR KIL +IL KEE+A +VDL+AIANMT+GYSGSDL
Sbjct  1062  PFDLDEAVIRRLPRRLMVNLPDSANRSKILSVILAKEEMAEDVDLEAIANMTDGYSGSDL  1121

Query  3591  KNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCAS  3770
             KNLCVTAAH PIREILEKEKKE+++A +ENRP+P L+NS+DIRPLNM DF+ AHEQVCAS
Sbjct  1122  KNLCVTAAHLPIREILEKEKKERSVAQAENRPMPQLYNSTDIRPLNMKDFKTAHEQVCAS  1181

Query  3771  VSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             VS++S+NM EL QWNELYGEGGSRKK +LSYFM
Sbjct  1182  VSTDSSNMNELQQWNELYGEGGSRKKTSLSYFM  1214



>ref|XP_010914432.1| PREDICTED: uncharacterized protein LOC105039839 isoform X3 [Elaeis 
guineensis]
Length=1162

 Score =  1338 bits (3464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 702/1035 (68%), Positives = 843/1035 (81%), Gaps = 22/1035 (2%)
 Frame = +3

Query  810   KHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnl  989
             + + IF   TN+ ++A +   +  ILEA + P+KG+ FE RSGDPS VA AS LASLSN 
Sbjct  135   QSSQIFLPLTNDKLTAPASSSAFGILEAQAVPIKGIQFETRSGDPSAVAGASILASLSNH  194

Query  990   kkellllPPSVCNDNDIKQGPEMPALPVASGEPD--KHDLDSDM---KDVSDHN---DVP  1145
             KK+L   PP+   +N   QG + PALP A   P     DL+ +    K  ++H+   +VP
Sbjct  195   KKDLS--PPASTGEN-AHQGVDGPALPSACDVPKGCNSDLEKNCDARKGNTEHDGSTEVP  251

Query  1146  LDEKSGAI-SPD-SGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDL  1319
               +K+  I S D   N++   +    D+   + GKV+G   E+RPL++M+AGSST E DL
Sbjct  252   SGDKAAVILSTDLCANESTQHDTIGSDAQLDDFGKVSGTNYEIRPLLKMIAGSSTAELDL  311

Query  1320  SGNISRIIDQRRELLKDFDPLISM-STRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEI  1496
             +G + ++ + +RELL+D D   ++ +TR QAFKDGL+  I+++N+I+VSF  FPYYLSE 
Sbjct  312   TGKVFKVFEDQRELLRDLDATAALPATRCQAFKDGLKLGIINANDIQVSFASFPYYLSEN  371

Query  1497  TKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLL  1676
             TKNVL++  YIHL+   F+K A+++ +V  RILL+GP GSEIYQETL KALAK+FGA LL
Sbjct  372   TKNVLLSCGYIHLERKDFIKYATDISSVNQRILLTGPTGSEIYQETLVKALAKHFGASLL  431

Query  1677  VVDSLVLPGGSA-KELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSA  1853
             ++DSL+LPGGS+ K+ + +K+  + E+   F+KRAA   VL   +KP S VEADI G S 
Sbjct  432   IIDSLLLPGGSSTKDSESLKDGGRIEKASFFSKRAA---VLDL-RKPTSGVEADIMGTSM  487

Query  1854  ISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPT-GFSLQTPARGPAYGYKGKVLLAFE  2027
             ++SH+  KQEASTASSKN TFK GDRV+YVG +P+ GF LQ P RGP YGY+GKV+LAFE
Sbjct  488   LNSHSLPKQEASTASSKNYTFKEGDRVRYVGTVPSSGFPLQAPQRGPNYGYRGKVVLAFE  547

Query  2028  ENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVV  2207
             ENG SKIGVRFD+ IP+GNDLGGLCEEDHGFFC AD LR D S  +D ++LAINEL EVV
Sbjct  548   ENGASKIGVRFDKQIPDGNDLGGLCEEDHGFFCTADLLRPDFSGGEDSERLAINELLEVV  607

Query  2208  SQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPG  2387
             S+E K+ PLI+ +K+IEKSM G  + +   + KL+ +P  V++I S+TQ DNRKEKSHPG
Sbjct  608   SEESKNGPLIILIKEIEKSMAGGTDTYLTLRSKLDLMPAGVLIIGSHTQIDNRKEKSHPG  667

Query  2388  GFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLS  2567
             G LFTKFGSNQTALLD AFPDNFGRLH+RSKE PK +KQLTRLFPNKV IQ+PQDE  L 
Sbjct  668   GLLFTKFGSNQTALLDFAFPDNFGRLHERSKEIPKTMKQLTRLFPNKVSIQLPQDEAQLL  727

Query  2568  DWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALS  2747
             DWKQQLDRD+ET+K++SN ++IR+ LNR  LDC D+ET+ IKDQ L+NE+V+KI+G+ALS
Sbjct  728   DWKQQLDRDVETLKAKSNILSIRSFLNRSGLDCNDLETISIKDQTLSNENVDKIVGFALS  787

Query  2748  HHF-MHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLA  2924
             HH  ++  E+S K+ KL +SS+SI++GLS+LQ +QN+TKS KKSLKDVVTENEFEK+LLA
Sbjct  788   HHLKINKIEASAKDAKLVLSSDSIKHGLSMLQSIQNDTKSTKKSLKDVVTENEFEKRLLA  847

Query  2925  DVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTG  3104
             DVIPP+DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTG
Sbjct  848   DVIPPNDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTG  907

Query  3105  KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSML  3284
             KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSML
Sbjct  908   KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSML  967

Query  3285  GRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMV  3464
             GRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMV
Sbjct  968   GRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMV  1027

Query  3465  NLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilek  3644
             NLPDAPNR KILR+IL KEELAP+VDL+A+ANMT+GYSGSDLKNLCVTAAHCPIREILEK
Sbjct  1028  NLPDAPNRVKILRVILAKEELAPDVDLEALANMTDGYSGSDLKNLCVTAAHCPIREILEK  1087

Query  3645  ekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELY  3824
             EKKE+ LA++E  PLPALH   DIRPL+M+D +YAHEQVCASVSSESTNM+ELLQWNELY
Sbjct  1088  EKKERILALAEGSPLPALHGCDDIRPLSMEDMKYAHEQVCASVSSESTNMSELLQWNELY  1147

Query  3825  GEGGSRKKKALSYFM  3869
             GEGGSRKK ALSYFM
Sbjct  1148  GEGGSRKKTALSYFM  1162



>ref|XP_010248969.1| PREDICTED: uncharacterized protein LOC104591697 isoform X2 [Nelumbo 
nucifera]
Length=1224

 Score =  1333 bits (3451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 722/1196 (60%), Positives = 870/1196 (73%), Gaps = 57/1196 (5%)
 Frame = +3

Query  321   ADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQ  500
              D  GA AL S +    EK  +      P+ +P+  G S I  DK + + S+ +  +K+ 
Sbjct  73    CDGSGADALDSGKG---EKEDKGASPAVPVSTPIAEGSSTIVGDKTRTSFSSWSLYQKQN  129

Query  501   LKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREK  680
                +  T W KLLS+YPQN HVP+    FT+G  R C+L + DP++S  LC +KH QR+ 
Sbjct  130   SSFDTSTPWCKLLSEYPQNPHVPIYSPLFTIGSSRNCNLSLKDPNISAVLCKIKHTQRDN  189

Query  681   GNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAA  860
              + I ++E +G KG V +NGK+  KNS+  LN GDEVIFG +G HAYIFQ    E +  A
Sbjct  190   -SVIAMIESTGSKGTVHINGKLQKKNSSCVLNSGDEVIFGLAGNHAYIFQLLVPEFV--A  246

Query  861   SMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDI  1040
              +P SV + E  S   KG+N E RSGDPS VA AS LASLS L+++L LL P   N  + 
Sbjct  247   KVPSSVGVAEP-SCVGKGLNLERRSGDPSAVAGASILASLSGLREDLSLLTPPAQNPGET  305

Query  1041  KQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPD--SGNDNLNLENGA  1214
              QG E P   +A  E D                  LD   G  +PD  +G+D ++     
Sbjct  306   PQGTEGPTSQLARPEID------------------LDGPQGKGNPDPSAGSDKVSEAGAT  347

Query  1215  IDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKDFDPLIS--  1388
               S+  +    +G   ++  L                  S ++++R+E  +D     +  
Sbjct  348   NKSFHLDNNHDSGVESDIVKL------------------SGVLEERKEWTRDSHQASTSG  389

Query  1389  MSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASE  1568
             +S +  AFK+ +Q  ILD   IEV+F++FPYYLS  TKNVLI + +IHLK  ++ K  S+
Sbjct  390   VSPKCAAFKEDIQAGILDGREIEVTFDNFPYYLSSSTKNVLINAAFIHLKRGEYAKYTSD  449

Query  1569  LPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPK  1745
             LPTV PRILLSGPAGSEIYQE L+KALA YFGA+LL+ D+    GG S+K+ D +K+  K
Sbjct  450   LPTVSPRILLSGPAGSEIYQEMLSKALANYFGAKLLIFDTHSFLGGLSSKDSDVLKDGLK  509

Query  1746  PERTGVFTK-RAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK------  1904
              E+    +K R   A V + N   A   +   +  +     +QTK E +TA S       
Sbjct  510   AEKICSCSKQRPGHADVAKINIPLAGEADMPDSSSTPCGLDSQTKLETNTAPSTSGTTKT  569

Query  1905  NTFKTGDRVKYVGPLP-TGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEG  2081
             + FK GDRVK+VG +  T +S   PARGP YGYKGKVLL FE+N  SKIGVRFD+ IPEG
Sbjct  570   HLFKMGDRVKFVGMVHNTSYSATLPARGPTYGYKGKVLLPFEDNMASKIGVRFDKPIPEG  629

Query  2082  NDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEK  2261
              DLGGLCE  HGFFC  + L L++   +DLDKL IN LFEV+S E +++P ILF+KD+EK
Sbjct  630   VDLGGLCEGTHGFFCNVNDLCLESPGTEDLDKLLINTLFEVLSSESRNTPFILFMKDVEK  689

Query  2262  SMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLA  2441
             S+VGN E+ S FK KLEKLP+NVV+I S+TQTD+RKEKSHPGG LFTKFGSNQTALLD A
Sbjct  690   SIVGNSESASTFKSKLEKLPDNVVIIGSHTQTDSRKEKSHPGGLLFTKFGSNQTALLDFA  749

Query  2442  FPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSN  2621
             FPD+FGRLHDR+KE PK  K L +LFPNKV I IPQDE +L+ WK QLDRD ET+K++ N
Sbjct  750   FPDSFGRLHDRNKEIPKTTKMLAKLFPNKVTIHIPQDEAVLASWKNQLDRDAETLKAKGN  809

Query  2622  AVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAI  2801
               N+RNVL+R  LDC  +ETLCIKD +LT ES EK++GWALSHH MH+++    E K  +
Sbjct  810   LNNLRNVLSRSGLDCDGLETLCIKDISLTPESAEKVVGWALSHHLMHNTKL-VAEAKPVL  868

Query  2802  SSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALE  2981
             SSESI+YG+ +LQ +Q+E+KS+KKSLKD+VTENEFEK+LL DVIPPSDIGVTFDDIGALE
Sbjct  869   SSESIQYGIGILQAIQSESKSLKKSLKDIVTENEFEKRLLTDVIPPSDIGVTFDDIGALE  928

Query  2982  NVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINI  3161
             NVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINI
Sbjct  929   NVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINI  988

Query  3162  SMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEF  3341
             SMSSITSKWFGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEF
Sbjct  989   SMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEF  1048

Query  3342  MVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKE  3521
             MVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR KIL++IL KE
Sbjct  1049  MVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILKVILAKE  1108

Query  3522  ELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALH  3701
             +L+P++DLD IA+MT+GYSGSDLKNLCVTAAHCPIREILEKEKKE+A A++E RP PAL 
Sbjct  1109  DLSPDIDLDVIASMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERAAAMAEGRPPPALS  1168

Query  3702  NSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
              S DIRPL+MDDFRYAHEQVCASVSSES NM+ELLQWNELYGEGGSRKK+ALSYFM
Sbjct  1169  GSEDIRPLSMDDFRYAHEQVCASVSSESVNMSELLQWNELYGEGGSRKKRALSYFM  1224



>ref|XP_010914433.1| PREDICTED: uncharacterized protein LOC105039839 isoform X4 [Elaeis 
guineensis]
Length=1137

 Score =  1324 bits (3426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 693/1004 (69%), Positives = 826/1004 (82%), Gaps = 22/1004 (2%)
 Frame = +3

Query  903   PVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASG  1082
             P+KG+ FE RSGDPS VA AS LASLSN KK+L   PP+   +N   QG + PALP A  
Sbjct  141   PIKGIQFETRSGDPSAVAGASILASLSNHKKDLS--PPASTGEN-AHQGVDGPALPSACD  197

Query  1083  EPD--KHDLDSDM---KDVSDHN---DVPLDEKSGAI-SPD-SGNDNLNLENGAIDSYDG  1232
              P     DL+ +    K  ++H+   +VP  +K+  I S D   N++   +    D+   
Sbjct  198   VPKGCNSDLEKNCDARKGNTEHDGSTEVPSGDKAAVILSTDLCANESTQHDTIGSDAQLD  257

Query  1233  EIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKDFDPLISM-STRRQA  1409
             + GKV+G   E+RPL++M+AGSST E DL+G + ++ + +RELL+D D   ++ +TR QA
Sbjct  258   DFGKVSGTNYEIRPLLKMIAGSSTAELDLTGKVFKVFEDQRELLRDLDATAALPATRCQA  317

Query  1410  FKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPR  1589
             FKDGL+  I+++N+I+VSF  FPYYLSE TKNVL++  YIHL+   F+K A+++ +V  R
Sbjct  318   FKDGLKLGIINANDIQVSFASFPYYLSENTKNVLLSCGYIHLERKDFIKYATDISSVNQR  377

Query  1590  ILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSA-KELDPVKEAPKPERTGVF  1766
             ILL+GP GSEIYQETL KALAK+FGA LL++DSL+LPGGS+ K+ + +K+  + E+   F
Sbjct  378   ILLTGPTGSEIYQETLVKALAKHFGASLLIIDSLLLPGGSSTKDSESLKDGGRIEKASFF  437

Query  1767  TKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVG  1943
             +KRAA   VL   +KP S VEADI G S ++SH+  KQEASTASSKN TFK GDRV+YVG
Sbjct  438   SKRAA---VLDL-RKPTSGVEADIMGTSMLNSHSLPKQEASTASSKNYTFKEGDRVRYVG  493

Query  1944  PLPT-GFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGF  2120
              +P+ GF LQ P RGP YGY+GKV+LAFEENG SKIGVRFD+ IP+GNDLGGLCEEDHGF
Sbjct  494   TVPSSGFPLQAPQRGPNYGYRGKVVLAFEENGASKIGVRFDKQIPDGNDLGGLCEEDHGF  553

Query  2121  FCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFK  2300
             FC AD LR D S  +D ++LAINEL EVVS+E K+ PLI+ +K+IEKSM G  + +   +
Sbjct  554   FCTADLLRPDFSGGEDSERLAINELLEVVSEESKNGPLIILIKEIEKSMAGGTDTYLTLR  613

Query  2301  LKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSK  2480
              KL+ +P  V++I S+TQ DNRKEKSHPGG LFTKFGSNQTALLD AFPDNFGRLH+RSK
Sbjct  614   SKLDLMPAGVLIIGSHTQIDNRKEKSHPGGLLFTKFGSNQTALLDFAFPDNFGRLHERSK  673

Query  2481  ETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVEL  2660
             E PK +KQLTRLFPNKV IQ+PQDE  L DWKQQLDRD+ET+K++SN ++IR+ LNR  L
Sbjct  674   EIPKTMKQLTRLFPNKVSIQLPQDEAQLLDWKQQLDRDVETLKAKSNILSIRSFLNRSGL  733

Query  2661  DCPDIETLCIKDQALTNESVEKIIGWALSHHF-MHSSESSTKEGKLAISSESIRYGLSVL  2837
             DC D+ET+ IKDQ L+NE+V+KI+G+ALSHH  ++  E+S K+ KL +SS+SI++GLS+L
Sbjct  734   DCNDLETISIKDQTLSNENVDKIVGFALSHHLKINKIEASAKDAKLVLSSDSIKHGLSML  793

Query  2838  QGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVML  3017
             Q +QN+TKS KKSLKDVVTENEFEK+LLADVIPP+DIGVTFDDIGALENVKDTLKELVML
Sbjct  794   QSIQNDTKSTKKSLKDVVTENEFEKRLLADVIPPNDIGVTFDDIGALENVKDTLKELVML  853

Query  3018  PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE  3197
             PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE
Sbjct  854   PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE  913

Query  3198  GEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDK  3377
             GEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKDK
Sbjct  914   GEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDK  973

Query  3378  ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIA  3557
             ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR KILR+IL KEELAP+VDL+A+A
Sbjct  974   ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRVKILRVILAKEELAPDVDLEALA  1033

Query  3558  NMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDD  3737
             NMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE+ LA++E  PLPALH   DIRPL+M+D
Sbjct  1034  NMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERILALAEGSPLPALHGCDDIRPLSMED  1093

Query  3738  FRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
              +YAHEQVCASVSSESTNM+ELLQWNELYGEGGSRKK ALSYFM
Sbjct  1094  MKYAHEQVCASVSSESTNMSELLQWNELYGEGGSRKKTALSYFM  1137



>ref|XP_010914431.1| PREDICTED: uncharacterized protein LOC105039839 isoform X2 [Elaeis 
guineensis]
Length=1176

 Score =  1324 bits (3426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 710/1139 (62%), Positives = 854/1139 (75%), Gaps = 81/1139 (7%)
 Frame = +3

Query  474   ALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLC  653
             AL   KKR  K     AW KLLSQ  QN H+ +    FTVGQ   C+L + D S+S++LC
Sbjct  112   ALELPKKRVKKVQPKAAWAKLLSQSSQNPHLVICGYQFTVGQSPTCNLSLKDSSISRTLC  171

Query  654   NLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQK  833
              LK+++                  V + G  +   S  P       I  S   H      
Sbjct  172   KLKYLE-----------------AVPIKGIQFETRSGDPSAVAGASILASLSNH------  208

Query  834   FTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllP  1013
                +D+S    PP+ +   AH G V G         PS   V                  
Sbjct  209   --KKDLS----PPASTGENAHQG-VDGPAL------PSACDV------------------  237

Query  1014  PSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAI-SPD-SGN  1187
             P  CN +D+++  +      A     +HD            +VP  +K+  I S D   N
Sbjct  238   PKGCN-SDLEKNCD------ARKGNTEHD---------GSTEVPSGDKAAVILSTDLCAN  281

Query  1188  DNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLK  1367
             ++   +    D+   + GKV+G   E+RPL++M+AGSST E DL+G + ++ + +RELL+
Sbjct  282   ESTQHDTIGSDAQLDDFGKVSGTNYEIRPLLKMIAGSSTAELDLTGKVFKVFEDQRELLR  341

Query  1368  DFDPLISM-STRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCN  1544
             D D   ++ +TR QAFKDGL+  I+++N+I+VSF  FPYYLSE TKNVL++  YIHL+  
Sbjct  342   DLDATAALPATRCQAFKDGLKLGIINANDIQVSFASFPYYLSENTKNVLLSCGYIHLERK  401

Query  1545  KFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSA-KEL  1721
              F+K A+++ +V  RILL+GP GSEIYQETL KALAK+FGA LL++DSL+LPGGS+ K+ 
Sbjct  402   DFIKYATDISSVNQRILLTGPTGSEIYQETLVKALAKHFGASLLIIDSLLLPGGSSTKDS  461

Query  1722  DPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASS  1901
             + +K+  + E+   F+KR   AAVL   +KP S VEADI G S ++SH+  KQEASTASS
Sbjct  462   ESLKDGGRIEKASFFSKR---AAVLDL-RKPTSGVEADIMGTSMLNSHSLPKQEASTASS  517

Query  1902  KN-TFKTGDRVKYVGPLP-TGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIP  2075
             KN TFK GDRV+YVG +P +GF LQ P RGP YGY+GKV+LAFEENG SKIGVRFD+ IP
Sbjct  518   KNYTFKEGDRVRYVGTVPSSGFPLQAPQRGPNYGYRGKVVLAFEENGASKIGVRFDKQIP  577

Query  2076  EGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDI  2255
             +GNDLGGLCEEDHGFFC AD LR D S  +D ++LAINEL EVVS+E K+ PLI+ +K+I
Sbjct  578   DGNDLGGLCEEDHGFFCTADLLRPDFSGGEDSERLAINELLEVVSEESKNGPLIILIKEI  637

Query  2256  EKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLD  2435
             EKSM G  + +   + KL+ +P  V++I S+TQ DNRKEKSHPGG LFTKFGSNQTALLD
Sbjct  638   EKSMAGGTDTYLTLRSKLDLMPAGVLIIGSHTQIDNRKEKSHPGGLLFTKFGSNQTALLD  697

Query  2436  LAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQ  2615
              AFPDNFGRLH+RSKE PK +KQLTRLFPNKV IQ+PQDE  L DWKQQLDRD+ET+K++
Sbjct  698   FAFPDNFGRLHERSKEIPKTMKQLTRLFPNKVSIQLPQDEAQLLDWKQQLDRDVETLKAK  757

Query  2616  SNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHF-MHSSESSTKEGK  2792
             SN ++IR+ LNR  LDC D+ET+ IKDQ L+NE+V+KI+G+ALSHH  ++  E+S K+ K
Sbjct  758   SNILSIRSFLNRSGLDCNDLETISIKDQTLSNENVDKIVGFALSHHLKINKIEASAKDAK  817

Query  2793  LAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIG  2972
             L +SS+SI++GLS+LQ +QN+TKS KKSLKDVVTENEFEK+LLADVIPP+DIGVTFDDIG
Sbjct  818   LVLSSDSIKHGLSMLQSIQNDTKSTKKSLKDVVTENEFEKRLLADVIPPNDIGVTFDDIG  877

Query  2973  ALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANF  3152
             ALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANF
Sbjct  878   ALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANF  937

Query  3153  INISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMK  3332
             INISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMK
Sbjct  938   INISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMK  997

Query  3333  NEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIIL  3512
             NEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR KILR+IL
Sbjct  998   NEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRVKILRVIL  1057

Query  3513  TKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLP  3692
              KEELAP+VDL+A+ANMT+GYSGSDLKNLCVTAAHCPIREILEKEKKE+ LA++E  PLP
Sbjct  1058  AKEELAPDVDLEALANMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERILALAEGSPLP  1117

Query  3693  ALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             ALH   DIRPL+M+D +YAHEQVCASVSSESTNM+ELLQWNELYGEGGSRKK ALSYFM
Sbjct  1118  ALHGCDDIRPLSMEDMKYAHEQVCASVSSESTNMSELLQWNELYGEGGSRKKTALSYFM  1176



>dbj|BAE99126.1| hypothetical protein [Arabidopsis thaliana]
Length=1188

 Score =  1312 bits (3395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/1138 (60%), Positives = 838/1138 (74%), Gaps = 36/1138 (3%)
 Frame = +3

Query  270   GAVNESGPESAEQEIRSAD---LDGASALKSPEAPVPEKLPEAPLGGEP--LVSPMILGD  434
             G  ++ G ES E E+ S+D   +D    + + + PV E  PE     E   L +P + G+
Sbjct  66    GPASDPGSESGEPELGSSDPQAMDAEKPVVTTDVPVMENSPETDANPEVEVLATPTVAGE  125

Query  435   SAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCD  614
             +  D DK KA      +             W KLLSQY QN H  +    FTVG+ R CD
Sbjct  126   AVADADKSKAAKKRALK-----------APWAKLLSQYSQNPHRVIRGPVFTVGR-RGCD  173

Query  615   LCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVI  794
             L + D ++  +LC LK      G S+  LEI G    V VNGK Y K++ V L GGDEVI
Sbjct  174   LSIRDQAMPSTLCELKQ-SEHGGPSVASLEILGNGVIVHVNGKCYQKSTCVHLRGGDEVI  232

Query  795   FGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVA-VASTl  971
             F  +GKHAYIFQ   +E+++A     S+SI EA   P+KGV+ E R+GD    + V    
Sbjct  233   FSLNGKHAYIFQPVKDENLAAPDRASSLSICEARGAPLKGVHVETRAGDVDGASDVDGAS  292

Query  972   aslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND----  1139
                S  K     L P +      +Q P +P +P +  +      D+DM D   +ND    
Sbjct  293   ILASLSKLRSFHLLPPIAKAGKRQQNPAVPVVPSSFNDCIS---DTDMNDADSNNDHAAV  349

Query  1140  VPLDEKSGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFD  1316
               +++ + A +P + N+NLN++   +D + + + G V  A  E+RP++ +L  SS+  FD
Sbjct  350   ASVEKIAAASTPGTANENLNVDGSGLDPFQEADGGNVPAAGYEIRPIVHLLGESSS--FD  407

Query  1317  LSGNISRIIDQRREL---LKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYL  1487
             + G+ISR++D+RRE+   L++FD   ++STRRQAFKD L+  +L++ NI++SFE+FPYYL
Sbjct  408   IRGSISRLLDERREVKEFLREFDLSSTISTRRQAFKDSLRGGVLNAQNIDISFENFPYYL  467

Query  1488  SEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFG  1664
             S  TK VL+ S Y+H+   +K+   A++L T CPRILLSGP+GSEIYQE LAKALAK FG
Sbjct  468   SATTKGVLMISMYVHMNGGSKYANFATDLTTACPRILLSGPSGSEIYQEMLAKALAKQFG  527

Query  1665  ARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADIT  1841
             A+L++VDSL+LPGGS A+E +  KE  + ER  +  KRA QAA +  +KKP SSV+ADIT
Sbjct  528   AKLMIVDSLLLPGGSPAREAESSKEGSRRERLSMLAKRAVQAAQVLQHKKPTSSVDADIT  587

Query  1842  GGSAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGFS-LQTPARGPAYGYKGKVL  2015
             GGS +SS A  KQE STA+SK+ TFK GDRVK+VGP  +  S LQ   RGPA G +GKV 
Sbjct  588   GGSTLSSQALPKQEVSTATSKSYTFKAGDRVKFVGPSASAISSLQGQLRGPAIGSQGKVA  647

Query  2016  LAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINEL  2195
             LAFE+N  SKIG+RFDR + +GNDLGGLCEEDHGFFCAA  LRL+ SS DD DKLA+NE+
Sbjct  648   LAFEDNCASKIGIRFDRPVQDGNDLGGLCEEDHGFFCAASSLRLEGSSSDDADKLAVNEI  707

Query  2196  FEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEK  2375
             FEV   E +   LILF+KDIEKS+VGN + ++  K KLE LPEN+VVIAS TQ D+RKEK
Sbjct  708   FEVALSESEGGSLILFLKDIEKSLVGNSDVYATLKSKLETLPENIVVIASQTQLDSRKEK  767

Query  2376  SHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDE  2555
             SHPGGFLFTKFG NQTALLDLAFPDNFG+LHDRSKETPK++KQ+TRLFPNK+ IQ+PQ+E
Sbjct  768   SHPGGFLFTKFGGNQTALLDLAFPDNFGKLHDRSKETPKSMKQITRLFPNKIAIQLPQEE  827

Query  2556  TLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIG  2735
              LLSDWK++LDRD E +K Q+N  +I  VL + +LDCPD+ TLCIKDQ L +ESVEK++G
Sbjct  828   ALLSDWKEKLDRDTEILKVQANITSILAVLAKNKLDCPDLGTLCIKDQTLPSESVEKVVG  887

Query  2736  WALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKK  2915
             WA  HH M  +E   K+ KL IS+ESI YGL  L  +QNE KS+KKSLKDVVTENEFEKK
Sbjct  888   WAFGHHLMICTEPIVKDNKLVISAESISYGLQTLHDIQNENKSLKKSLKDVVTENEFEKK  947

Query  2916  LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPP  3095
             LL+DVIPPSDIGV+FDDIGALENVK+TLKELVMLPLQRPELF KGQLTKP KGILLFGPP
Sbjct  948   LLSDVIPPSDIGVSFDDIGALENVKETLKELVMLPLQRPELFDKGQLTKPTKGILLFGPP  1007

Query  3096  GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVD  3275
             GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVD
Sbjct  1008  GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVD  1067

Query  3276  SMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRR  3455
             SMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLPRR
Sbjct  1068  SMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRR  1127

Query  3456  LMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIR  3629
             LMVNLPDA NR KIL +IL KEE+AP+VDL+AIANMT+GYSGSDLKNLCVTAAH PIR
Sbjct  1128  LMVNLPDATNRSKILSVILAKEEIAPDVDLEAIANMTDGYSGSDLKNLCVTAAHFPIR  1185



>ref|XP_008677897.1| PREDICTED: uncharacterized protein LOC103652718 isoform X1 [Zea 
mays]
Length=1233

 Score =  1310 bits (3391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 695/1214 (57%), Positives = 901/1214 (74%), Gaps = 59/1214 (5%)
 Frame = +3

Query  351   SPEAPVPEKLPEAPLGGE-PLVSPMILGDSAI------DVDKVKANGSALNRGKKRQLKS  509
             SP A  P +  E  + G  P  S   + D+A        VDK  +  +  ++ +K Q + 
Sbjct  38    SPTASAPGRAEEDSVAGAAPARSAGSVDDAAAVAQKDQGVDKPSSAAAESSKRRKEQEQQ  97

Query  510   NLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNS  689
                  W KLLS+  Q  H P+     +VGQ + C+L + D  VSK LC L+ +  E+G  
Sbjct  98    QPAVPWAKLLSECSQTPHYPISVDQISVGQSKNCNLWLKDQPVSKVLCKLRRL--EQGGP  155

Query  690   ITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMP  869
               L E+ GKKG VQ+NG+     + VPL GGDEVIF S GKH YIF    N+ +    + 
Sbjct  156   CEL-EVIGKKGMVQLNGRSVSPGTKVPLTGGDEVIFSSCGKHTYIFLYPLNDKVPKTVLS  214

Query  870   PSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDND----  1037
              +VS+LEA    VK +  + R+GD S VA  + + + ++ +K++  +PP+   +N     
Sbjct  215   SAVSLLEAPVASVKRIRTDKRTGDTSAVA-GTEMMTSTSNQKDVAAVPPASAGENSQRVV  273

Query  1038  ----------IKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGN  1187
                       +K     P    A+GE + ++++S+++D       P+   +  ISPD+  
Sbjct  274   RPLASSASDKLKGRAVSPEKEFANGE-NANEVNSNIEDS------PMVVAAAPISPDAAA  326

Query  1188  DNLNLENGAI-DSYDG-EIGKVTGAPQELRPLIRMLAGSSTPEFDLSGN--ISRIIDQRR  1355
             ++   +NG + DS+ G EIGK   A  ++RP++RM+ GS+  EFDL+G+     + DQR 
Sbjct  327   NDTCQQNGFVSDSHLGAEIGKT--ATYKIRPVLRMITGSTISEFDLTGDDLFKALEDQRD  384

Query  1356  ELLKDFDPLISMS-TRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIH  1532
              ++++ +   ++  +R QAFKDG++Q I++ ++I+V+FE+FPYYLSE TKNVL++S +IH
Sbjct  385   HIIRELNASTNVPPSRCQAFKDGMKQGIINPSDIDVTFENFPYYLSENTKNVLLSSAFIH  444

Query  1533  LKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSA  1712
             LK  +F+K   E+ ++  RILLSGPAGSEIYQETL KALAK+F ARLLVVDSL+LPG  +
Sbjct  445   LKKKEFIKQFVEISSINQRILLSGPAGSEIYQETLVKALAKHFSARLLVVDSLLLPGAPS  504

Query  1713  KELDPVKEAPKPERTG---------VFTK-RAAQAAVLRFNK--KPASSVEADITGGSAI  1856
             K+ +  K+  K +++G         ++ K R++ A  + F +   P SSV ADI G S +
Sbjct  505   KDPEFQKDVGKADKSGDKAAAEKFAIYQKHRSSLADTVHFRRPAAPTSSVNADIVGTSTL  564

Query  1857  SSHAQTKQEASTASSKN-TFKTGDRVKYVGPL-PTGFSLQTPARGPAYGYKGKVLLAFEE  2030
              S +  KQE+STA+SK+ TF+ GDRV+YVGP  P   S     RGP+YGY+G+V+LAFE+
Sbjct  565   HSASLPKQESSTATSKSYTFREGDRVRYVGPAQPCSLS----QRGPSYGYRGRVMLAFED  620

Query  2031  NGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVS  2210
             NG SKIGVRFD+ IP+GNDLGGLCEEDHGFFC+A+ LR D S+ +++++LA+ EL EV+S
Sbjct  621   NGSSKIGVRFDKQIPDGNDLGGLCEEDHGFFCSAELLRPDFSAGEEVERLAMTELIEVIS  680

Query  2211  QECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGG  2390
             +E KS PLI+ +KD+EKS  G  E+ S+ + KLE LP  V++I S+TQ D+RKEK+HPGG
Sbjct  681   EENKSGPLIVLLKDVEKSFTGVTESLSSLRSKLESLPPGVLIIGSHTQMDSRKEKAHPGG  740

Query  2391  FLFTKFGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLS  2567
             FLFTKF S+   L DL FPD+FG RLH+RSKE+PK +K L +LFPNK++IQ+PQDE LL+
Sbjct  741   FLFTKFASSSQTLFDL-FPDSFGSRLHERSKESPKTMKHLNKLFPNKILIQLPQDEALLT  799

Query  2568  DWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALS  2747
             DWKQQLDRD+ET+K++SN  +IR  L+R  ++C D+E L IKDQ+L+NE+V+KI+G+A+S
Sbjct  800   DWKQQLDRDVETLKAKSNIGSIRMFLSRNGIECNDLEELFIKDQSLSNENVDKIVGYAVS  859

Query  2748  HHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLAD  2927
             +H   +   ++K+ KL +++ES+++GL++LQ +QN+ KS KKSLKDVVTENEFEK+LLAD
Sbjct  860   YHLNQNKIETSKDAKLVLTTESLKHGLNMLQSMQNDNKSSKKSLKDVVTENEFEKRLLAD  919

Query  2928  VIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGK  3107
             VIPP+DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGK
Sbjct  920   VIPPNDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGK  979

Query  3108  TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLG  3287
             TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+F+DEVDSMLG
Sbjct  980   TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFIDEVDSMLG  1039

Query  3288  RRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVN  3467
             RRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVL ATNRPFDLDEAVIRR PRRLMVN
Sbjct  1040  RRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLGATNRPFDLDEAVIRRFPRRLMVN  1099

Query  3468  LPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReileke  3647
             LPDA NREKIL++IL KEEL  +VD+D++ANMT+GYSGSDLKNLCVTAAH PIREILEKE
Sbjct  1100  LPDASNREKILKVILAKEELGSDVDMDSLANMTDGYSGSDLKNLCVTAAHYPIREILEKE  1159

Query  3648  kkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYG  3827
             KKEK LA +E RP PAL+ S DIRPL++DDF+ AHEQVCASVSS+S NM ELLQWN+LYG
Sbjct  1160  KKEKNLAKTEGRPEPALYGSEDIRPLSIDDFKSAHEQVCASVSSDSANMNELLQWNDLYG  1219

Query  3828  EGGSRKKKALSYFM  3869
             EGGSRKKKALSYFM
Sbjct  1220  EGGSRKKKALSYFM  1233



>emb|CDY50381.1| BnaCnng19130D [Brassica napus]
Length=1201

 Score =  1310 bits (3389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 727/1218 (60%), Positives = 866/1218 (71%), Gaps = 104/1218 (9%)
 Frame = +3

Query  270   GAVNESGPESAEQEIRSAD-LDGASALKSP----EAPVPEKLPEAPLGGEP--LVSPMIL  428
             G  ++ G ES E E+RS+D   G  A + P    + P+ E  PE     E   L +P + 
Sbjct  70    GPGSDPGSESGEPELRSSDPQQGVDAAEKPVVLTDVPLREASPEIDANPEVDVLATPTVA  129

Query  429   GDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQ  608
              +   D +K KA       GKKR         W KLLSQYPQN H  +    FTVG+ R 
Sbjct  130   EEVVADGEKSKA-------GKKRA-----KAPWAKLLSQYPQNPHRIMRGPVFTVGR-RG  176

Query  609   CDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDE  788
             CDL + D S+  +LC LK  +   G S+  LEI+G    VQVNGK Y K + V L GGDE
Sbjct  177   CDLSIKDQSMPSTLCELKQAE-NGGPSVATLEITGNGVLVQVNGKCYQKGALVHLRGGDE  235

Query  789   VIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVAST  968
             VIF  SG+HAYIFQ   +E+ +A     S  + E   G V     E R+G+ S V  AS 
Sbjct  236   VIFNISGRHAYIFQPLKDENQAAPDRASSQILFETRGGRVHS---ETRAGESSAVDGASI  292

Query  969   laslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDL--DSDMKDV---SDH  1133
             LASLS  +   L   P +      +Q PE+P  P     P  +D   D+DM D    +DH
Sbjct  293   LASLSKYRNLHLR--PPIAKSAKRQQNPEVPQEP-----PSCNDCISDTDMNDADSNNDH  345

Query  1134  NDVPLDEKSGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPE  1310
               +   EK+ A +  + N+NLN +   +D + + + G    +  E+RP++R+L  SS+  
Sbjct  346   AAIASVEKTAASTSYTANENLNADGSGLDPFQEADGGNPPTSGYEIRPILRLLGESSS--  403

Query  1311  FDLSGNISRIIDQRRE---LLKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPY  1481
              D+ G IS+++D+RRE   LLK+FD   ++STRRQAFKD L+  +L + NI+VS + FPY
Sbjct  404   LDIRG-ISKLLDERREVRELLKEFDISSTISTRRQAFKDSLRGGVLIAQNIDVSLDSFPY  462

Query  1482  YLSEITKNVLIASTYIHLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKY  1658
             +LS  TK+VLIAS Y+H+K  +KF K AS+LPT  PRILLSGPAGSEIYQE LAKALAK 
Sbjct  463   FLSATTKDVLIASMYVHMKGGSKFAKYASDLPTTSPRILLSGPAGSEIYQEMLAKALAKN  522

Query  1659  FGARLLVVDSLVLPGGS-AKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEAD  1835
             FGA+L++VDSL+LPGGS A+E +  KE  + +  G                 P+S     
Sbjct  523   FGAKLMIVDSLLLPGGSPAREAESSKEGDRVKFLG-----------------PSS-----  560

Query  1836  ITGGSAISSHAQTKQEASTASSKNTFKTGDRVKYVGPLPTGFSLQTPARGPAYGYKGKVL  2015
                 SAISS                          GP         P RGP  G++GKV+
Sbjct  561   ----SAISS------------------------LQGP---------PLRGPTIGFQGKVV  583

Query  2016  LAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINEL  2195
             LAFE+N  SKIG+RFDR +P+GNDLGGLCEEDHGFFCAA  LRLD SS DD DKLAINE+
Sbjct  584   LAFEDNASSKIGIRFDRPVPDGNDLGGLCEEDHGFFCAASSLRLDGSSGDDADKLAINEI  643

Query  2196  FEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEK  2375
             FEV   E +   LILF+KDIEKS+VGN + ++  K KLE LP+N+VV+AS TQ D RKEK
Sbjct  644   FEVAHSEAEGGSLILFLKDIEKSLVGNSDVYATLKSKLENLPDNIVVLASQTQLDTRKEK  703

Query  2376  SHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDE  2555
             +HPGGFLFTKFG NQTALLDLAFPDNF +LHDRSKETPK++KQ+TRLFPNKV IQ+PQ E
Sbjct  704   AHPGGFLFTKFGGNQTALLDLAFPDNFSKLHDRSKETPKSMKQITRLFPNKVAIQLPQAE  763

Query  2556  TLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIG  2735
              LLSDWK++LDRD E +K Q+N  +I  VL +  LDCPD+ TL IKDQ L  ESVEK++G
Sbjct  764   ALLSDWKEKLDRDTELLKVQANITSILGVLTKNRLDCPDLGTLSIKDQTLLPESVEKVVG  823

Query  2736  WALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKK  2915
             WALSHH M+ +E + K+ KL IS+ESI YGL +L GVQ+E KS+KKSLKDVVTENEFEKK
Sbjct  824   WALSHHLMNCAEPTVKDNKLVISAESITYGLQMLHGVQDENKSLKKSLKDVVTENEFEKK  883

Query  2916  LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPP  3095
             LL+DVIPPSDIGV+FDDIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFGPP
Sbjct  884   LLSDVIPPSDIGVSFDDIGALENVKDTLKELVMLPLQRPELFDKGQLTKPTKGILLFGPP  943

Query  3096  GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVD  3275
             GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVD
Sbjct  944   GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVD  1003

Query  3276  SMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRR  3455
             SMLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKD+ERVLVLAATNRPFDLDEAVIRRLPRR
Sbjct  1004  SMLGRRENPGEHEAMRKMKNEFMINWDGLRTKDRERVLVLAATNRPFDLDEAVIRRLPRR  1063

Query  3456  LMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIRei  3635
             LMVNLPDA NR KIL +IL KEE+ P+VDL+AIANMT+GYSGSDLKNLCVTAAH PIREI
Sbjct  1064  LMVNLPDATNRSKILSVILAKEEIGPDVDLEAIANMTDGYSGSDLKNLCVTAAHLPIREI  1123

Query  3636  lekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWN  3815
             LEKEKKEK  A +ENRP P L++ +DIRPL M DF+ AHEQVCASVS++S+NM EL QWN
Sbjct  1124  LEKEKKEKTAAEAENRPTPPLYSCTDIRPLTMTDFKAAHEQVCASVSTDSSNMNELQQWN  1183

Query  3816  ELYGEGGSRKKKALSYFM  3869
             ELYGEGGSRKK +LSYFM
Sbjct  1184  ELYGEGGSRKKTSLSYFM  1201



>ref|NP_001117220.2| AAA-type ATPase family protein [Arabidopsis thaliana]
 gb|AEE27493.1| AAA-type ATPase family protein [Arabidopsis thaliana]
Length=1218

 Score =  1309 bits (3388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 720/1217 (59%), Positives = 890/1217 (73%), Gaps = 68/1217 (6%)
 Frame = +3

Query  276   VNESGPESAEQEIRSADL---DGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAID  446
             V++ G  S + E+R++D    D    + + + P  E      L G  LV+P   G+  ++
Sbjct  51    VSDPGSISGDPELRTSDPQSNDAERPVTTTDVPAMETDTNPELEG--LVTPTPAGEVVVE  108

Query  447   VDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVD  626
              +K K++       KKR  K+     W KLLSQ+PQN H+ +  S FTVG+ R CDLC+ 
Sbjct  109   AEKSKSS-------KKRIAKA----PWAKLLSQFPQNPHLVMRGSVFTVGR-RACDLCIR  156

Query  627   DPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSS  806
             D S+   LC L+  +   G S+  LEI G    VQVNGKIY +++ V L GGDE+IF + 
Sbjct  157   DHSMPNVLCELRQSE-HGGPSVASLEIIGNGVLVQVNGKIYQRSTCVHLRGGDEIIFTTP  215

Query  807   GKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsn  986
             GKHAYIFQ   +E+++A     S+S+ EA S P+KG++ E R+ D S+V   ++L +  +
Sbjct  216   GKHAYIFQPLKDENLAAPDRTSSLSLFEAQSAPLKGLHVETRARDSSSVDGTASLLASIS  275

Query  987   lkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDV---SDHNDVPLDEK  1157
               + +  LPP+       +Q  E+P LP +    D   LD D+ D    +DH  +   EK
Sbjct  276   KLQNVPFLPPT-AKSVKRQQNSEVPVLPSSC---DDFILDVDLNDADSNNDHAAIASMEK  331

Query  1158  SGAISPDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNIS  1334
             + A +  + ND+ + +   +D + + E G +     E+RP++ +L   S  EFDL G+IS
Sbjct  332   TVASTSCAANDDHDADGNGMDPFQEPEAGNIPDPAYEIRPILSLLGDPS--EFDLRGSIS  389

Query  1335  RI-IDQRRELL---KDFD-PLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEIT  1499
             +I +D+RRE+    K+++ P  S+ TRRQA KD L+  IL+  +IEVSFE+FPY+LS  T
Sbjct  390   KILVDERREVREMPKEYERPSASVLTRRQAHKDSLRGGILNPQDIEVSFENFPYFLSGTT  449

Query  1500  KNVLIASTYIHLKCNK-FVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLL  1676
             K+VL+ STY H+K  K + + AS+LPT CPRILLSGP+GSEIYQE LAKALAK  GA+L+
Sbjct  450   KDVLMISTYAHIKYGKEYAEYASDLPTACPRILLSGPSGSEIYQEMLAKALAKQCGAKLM  509

Query  1677  VVDSLVLPGGSA-KELDPVKEAPKPERTGVFTKRAAQAAVLRF--NKKPASSVEADITGG  1847
             +VDSL+LPGGS  KE D  KE+ + ER  V  KRA QAA      +KKP SSVEA ITGG
Sbjct  510   IVDSLLLPGGSTPKEADTTKESSRRERLSVLAKRAVQAAQAAVLQHKKPISSVEAGITGG  569

Query  1848  SAISSHAQTKQEASTASSKN-TFKTGDRVKYVGPLPTGF-SLQTPARGPAYGYKGKVLLA  2021
             S +SS A  +QE STA+SK+ TFK GDRV+++GP  +   SL+ P RGPA G++GKVLLA
Sbjct  570   STLSSQAVRRQEVSTATSKSYTFKAGDRVRFLGPSTSSLASLRAPPRGPATGFQGKVLLA  629

Query  2022  FEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFE  2201
             FE NG SKIGVRFDRSIP+GNDLGGLCEEDHGFFC A  LRL++SS DD DKLAINE+FE
Sbjct  630   FEGNGSSKIGVRFDRSIPDGNDLGGLCEEDHGFFCTASSLRLESSSSDDADKLAINEIFE  689

Query  2202  VVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSH  2381
             V   E +   LILF+KDIEKS+ GN + +   K KLE LPEN+VVIAS TQ DNRKEKSH
Sbjct  690   VAFNESERGSLILFLKDIEKSVSGNTDVYITLKSKLENLPENIVVIASQTQLDNRKEKSH  749

Query  2382  PGGFLFTKFGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDET  2558
             PGGFLFTKFGSNQTALLDLAFPD FG RL DR+ E PKA+KQ+TRLFPNKV IQ+P+DE 
Sbjct  750   PGGFLFTKFGSNQTALLDLAFPDTFGGRLQDRNTEMPKAVKQITRLFPNKVTIQLPEDEA  809

Query  2559  LLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGW  2738
              L DWK +L+RD E +K+Q+N  +IR VL++ +L CPDIE LCIKDQ L ++SVEK++G+
Sbjct  810   SLVDWKDKLERDTEILKAQANITSIRAVLSKNQLVCPDIEILCIKDQTLPSDSVEKVVGF  869

Query  2739  ALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKL  2918
             A +HH M+ SE + K+ KL IS+ESI YGL +L  +QNE KS KKSLKDVVTENEFEKKL
Sbjct  870   AFNHHLMNCSEPTVKDNKLIISAESITYGLQLLHEIQNENKSTKKSLKDVVTENEFEKKL  929

Query  2919  LADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPG  3098
             L+DVIPPSDIGV+F DIGALENVKDTLKELVMLPLQRPELF KGQLTKP KGILLFGPPG
Sbjct  930   LSDVIPPSDIGVSFSDIGALENVKDTLKELVMLPLQRPELFGKGQLTKPTKGILLFGPPG  989

Query  3099  TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDS  3278
             TGKTMLAKAVATEAGANFINISMSSITSK                            VDS
Sbjct  990   TGKTMLAKAVATEAGANFINISMSSITSK----------------------------VDS  1021

Query  3279  MLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRL  3458
             MLGRRE+PGEHEAMRKMKNEFM+NWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRL
Sbjct  1022  MLGRRENPGEHEAMRKMKNEFMINWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRL  1081

Query  3459  MVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReil  3638
             MVNLPD+ NR KIL +IL KEE+A +VDL+AIANMT+GYSGSDLKNLCVTAAH PIREIL
Sbjct  1082  MVNLPDSANRSKILSVILAKEEMAEDVDLEAIANMTDGYSGSDLKNLCVTAAHLPIREIL  1141

Query  3639  ekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNE  3818
             EKEKKE+++A +ENR +P L++S+D+RPLNM+DF+ AH+QVCASV+S+S+NM EL QWNE
Sbjct  1142  EKEKKERSVAQAENRAMPQLYSSTDVRPLNMNDFKTAHDQVCASVASDSSNMNELQQWNE  1201

Query  3819  LYGEGGSRKKKALSYFM  3869
             LYGEGGSRKK +LSYFM
Sbjct  1202  LYGEGGSRKKTSLSYFM  1218



>ref|XP_004979903.1| PREDICTED: uncharacterized protein LOC101767955 isoform X3 [Setaria 
italica]
Length=1242

 Score =  1306 bits (3381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/1155 (60%), Positives = 870/1155 (75%), Gaps = 56/1155 (5%)
 Frame = +3

Query  525   WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLE  704
             W KLLSQ  Q  H P+    F+VGQ + C+L + D  VSK LC L+ +  E+G    L E
Sbjct  104   WAKLLSQCSQTPHHPISAPQFSVGQSKSCNLWLKDIPVSKMLCKLRRL--EQGGQCEL-E  160

Query  705   ISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSI  884
             + GKKG VQ+NG+     + VPL GGDEVIF S  +HAYIFQ   N+ +       +VS+
Sbjct  161   VVGKKGVVQLNGRPISPGTKVPLTGGDEVIFSSCRRHAYIFQHPLNDKVPKTVPSSAVSL  220

Query  885   LEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPA  1064
             LE      K +  + R+GD S VA    LAS  N  K++   PP+   +N      +   
Sbjct  221   LEPPVASAKRIRTDKRAGDTSAVAGTEMLASACNQPKDIAAAPPASAGENS-----QRVV  275

Query  1065  LPVASGEPDK---HDLDSDMKDVSDHN---------DVPLDEKSGAISPDSGNDNLNLEN  1208
              P+AS   DK   H +  D +  +  N         D  +D  +  +SPD    +   +N
Sbjct  276   RPMASSASDKSKGHAISPDKEFENGENANEVNSNIEDSSMDVAAAPVSPDDAAHDNCQQN  335

Query  1209  GAI-DSYDG-EIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKDFDPL  1382
             G + D++ G EIGK+  A  +++P++RM  GS+ PEFDL+G++ + ++ +R++++D    
Sbjct  336   GFVPDAHLGAEIGKI--ATYKIKPVLRMFTGSTVPEFDLTGDVFKALEDQRDIIRDLSAS  393

Query  1383  ISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCA  1562
             +  S R QAFKDG++Q I+  ++I+V+FE FPYYLSE TKNVL++  +IHL+  +F+K  
Sbjct  394   VPPS-RCQAFKDGMKQGIISPSDIDVTFETFPYYLSENTKNVLLSCAFIHLEKKEFIKQF  452

Query  1563  SELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAP  1742
             +E+ ++  RILLSGPAGSEIYQETL KALAK+FGARLLVVDSLVLPG  +K+ +  K+  
Sbjct  453   AEISSINQRILLSGPAGSEIYQETLIKALAKHFGARLLVVDSLVLPGAPSKDPESQKDVG  512

Query  1743  KPERTG---------VFTK----------RAAQAAVLRFNK--KPASSVEADITGGSAIS  1859
             K +++G         +F K          R++ A  + F +   P SSV ADI G S + 
Sbjct  513   KSDKSGDKAGGDKFAIFQKLDRDYFHQKHRSSLADAVHFRRPAAPTSSVNADIVGTSTLH  572

Query  1860  SHAQTKQEASTASSKN-TFKTGDRVKYVGPL-PTGFSLQTPARGPAYGYKGKVLLAFEEN  2033
             S +  KQE+STA+SK+ TF+ GDRV+YVGP  P   S     RGP+YGY+G+V+LAFE+N
Sbjct  573   SASLPKQESSTATSKSYTFREGDRVRYVGPAQPPSLS----QRGPSYGYRGRVMLAFEDN  628

Query  2034  GFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQ  2213
             G SKIGVRFD+ IP+GNDLGGLCEEDHGFFC+A+ LR D S+ +++++LA+ EL EV+S+
Sbjct  629   GSSKIGVRFDKQIPDGNDLGGLCEEDHGFFCSAELLRPDFSTGEEVERLAMAELIEVISE  688

Query  2214  ECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGF  2393
             E KS PLI+ +KD+EKS  G  E+ S+ + KLE LP  V++I S+TQ D+RKEK+HPGGF
Sbjct  689   ENKSGPLIVLLKDVEKSFTGITESLSSLRSKLESLPSGVLIIGSHTQMDSRKEKAHPGGF  748

Query  2394  LFTKFGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSD  2570
             LFTKF S+   L DL FPD+FG RLH+R+KE+PKA+K L +LFPNK+ IQ+PQDE LL+D
Sbjct  749   LFTKFASSSQTLFDL-FPDSFGNRLHERNKESPKAMKHLNKLFPNKISIQLPQDEALLTD  807

Query  2571  WKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSH  2750
             WKQQLDRD+ET+K++SN  +IR  L+R  ++C ++E L IKDQ+L+NE+V+KI+G+A+S+
Sbjct  808   WKQQLDRDVETLKAKSNVGSIRAFLSRNGIECNELEELFIKDQSLSNENVDKIVGYAVSY  867

Query  2751  HFMHSS--ESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLA  2924
             H  H+    S++K+ KL ++SES+++GL++LQ VQ++ KS KKSLKDVVTENEFEK+LL 
Sbjct  868   HLKHNKVETSNSKDAKLVLTSESLKHGLNMLQSVQSDNKSSKKSLKDVVTENEFEKRLLT  927

Query  2925  DVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTG  3104
             DVIPP+DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTG
Sbjct  928   DVIPPNDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTG  987

Query  3105  KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSML  3284
             KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+F+DEVDSML
Sbjct  988   KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFIDEVDSML  1047

Query  3285  GRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMV  3464
             GRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVL ATNRPFDLDEAVIRR PRRLMV
Sbjct  1048  GRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLGATNRPFDLDEAVIRRFPRRLMV  1107

Query  3465  NLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilek  3644
             NLPDA NREKIL++IL KEEL P+VDLD++ANMT+GYSGSDLKNLCVTAAH PIREILEK
Sbjct  1108  NLPDASNREKILKVILAKEELGPDVDLDSLANMTDGYSGSDLKNLCVTAAHYPIREILEK  1167

Query  3645  ekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELY  3824
             EKKEK LA SE +P PAL+ S DIRPL++DDF+ AHEQVCASVSS+S NM ELLQWN+LY
Sbjct  1168  EKKEKNLAKSEGKPEPALYGSEDIRPLSIDDFKSAHEQVCASVSSDSANMNELLQWNDLY  1227

Query  3825  GEGGSRKKKALSYFM  3869
             GEGGSRKKKALSYFM
Sbjct  1228  GEGGSRKKKALSYFM  1242



>ref|XP_004979901.1| PREDICTED: uncharacterized protein LOC101767955 isoform X1 [Setaria 
italica]
Length=1274

 Score =  1306 bits (3381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/1155 (60%), Positives = 870/1155 (75%), Gaps = 56/1155 (5%)
 Frame = +3

Query  525   WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLE  704
             W KLLSQ  Q  H P+    F+VGQ + C+L + D  VSK LC L+ +  E+G    L E
Sbjct  136   WAKLLSQCSQTPHHPISAPQFSVGQSKSCNLWLKDIPVSKMLCKLRRL--EQGGQCEL-E  192

Query  705   ISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSI  884
             + GKKG VQ+NG+     + VPL GGDEVIF S  +HAYIFQ   N+ +       +VS+
Sbjct  193   VVGKKGVVQLNGRPISPGTKVPLTGGDEVIFSSCRRHAYIFQHPLNDKVPKTVPSSAVSL  252

Query  885   LEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPA  1064
             LE      K +  + R+GD S VA    LAS  N  K++   PP+   +N      +   
Sbjct  253   LEPPVASAKRIRTDKRAGDTSAVAGTEMLASACNQPKDIAAAPPASAGENS-----QRVV  307

Query  1065  LPVASGEPDK---HDLDSDMKDVSDHN---------DVPLDEKSGAISPDSGNDNLNLEN  1208
              P+AS   DK   H +  D +  +  N         D  +D  +  +SPD    +   +N
Sbjct  308   RPMASSASDKSKGHAISPDKEFENGENANEVNSNIEDSSMDVAAAPVSPDDAAHDNCQQN  367

Query  1209  GAI-DSYDG-EIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKDFDPL  1382
             G + D++ G EIGK+  A  +++P++RM  GS+ PEFDL+G++ + ++ +R++++D    
Sbjct  368   GFVPDAHLGAEIGKI--ATYKIKPVLRMFTGSTVPEFDLTGDVFKALEDQRDIIRDLSAS  425

Query  1383  ISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCA  1562
             +  S R QAFKDG++Q I+  ++I+V+FE FPYYLSE TKNVL++  +IHL+  +F+K  
Sbjct  426   VPPS-RCQAFKDGMKQGIISPSDIDVTFETFPYYLSENTKNVLLSCAFIHLEKKEFIKQF  484

Query  1563  SELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAP  1742
             +E+ ++  RILLSGPAGSEIYQETL KALAK+FGARLLVVDSLVLPG  +K+ +  K+  
Sbjct  485   AEISSINQRILLSGPAGSEIYQETLIKALAKHFGARLLVVDSLVLPGAPSKDPESQKDVG  544

Query  1743  KPERTG---------VFTK----------RAAQAAVLRFNK--KPASSVEADITGGSAIS  1859
             K +++G         +F K          R++ A  + F +   P SSV ADI G S + 
Sbjct  545   KSDKSGDKAGGDKFAIFQKLDRDYFHQKHRSSLADAVHFRRPAAPTSSVNADIVGTSTLH  604

Query  1860  SHAQTKQEASTASSKN-TFKTGDRVKYVGPL-PTGFSLQTPARGPAYGYKGKVLLAFEEN  2033
             S +  KQE+STA+SK+ TF+ GDRV+YVGP  P   S     RGP+YGY+G+V+LAFE+N
Sbjct  605   SASLPKQESSTATSKSYTFREGDRVRYVGPAQPPSLS----QRGPSYGYRGRVMLAFEDN  660

Query  2034  GFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQ  2213
             G SKIGVRFD+ IP+GNDLGGLCEEDHGFFC+A+ LR D S+ +++++LA+ EL EV+S+
Sbjct  661   GSSKIGVRFDKQIPDGNDLGGLCEEDHGFFCSAELLRPDFSTGEEVERLAMAELIEVISE  720

Query  2214  ECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGF  2393
             E KS PLI+ +KD+EKS  G  E+ S+ + KLE LP  V++I S+TQ D+RKEK+HPGGF
Sbjct  721   ENKSGPLIVLLKDVEKSFTGITESLSSLRSKLESLPSGVLIIGSHTQMDSRKEKAHPGGF  780

Query  2394  LFTKFGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSD  2570
             LFTKF S+   L DL FPD+FG RLH+R+KE+PKA+K L +LFPNK+ IQ+PQDE LL+D
Sbjct  781   LFTKFASSSQTLFDL-FPDSFGNRLHERNKESPKAMKHLNKLFPNKISIQLPQDEALLTD  839

Query  2571  WKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSH  2750
             WKQQLDRD+ET+K++SN  +IR  L+R  ++C ++E L IKDQ+L+NE+V+KI+G+A+S+
Sbjct  840   WKQQLDRDVETLKAKSNVGSIRAFLSRNGIECNELEELFIKDQSLSNENVDKIVGYAVSY  899

Query  2751  HFMHS--SESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLA  2924
             H  H+    S++K+ KL ++SES+++GL++LQ VQ++ KS KKSLKDVVTENEFEK+LL 
Sbjct  900   HLKHNKVETSNSKDAKLVLTSESLKHGLNMLQSVQSDNKSSKKSLKDVVTENEFEKRLLT  959

Query  2925  DVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTG  3104
             DVIPP+DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTG
Sbjct  960   DVIPPNDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTG  1019

Query  3105  KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSML  3284
             KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+F+DEVDSML
Sbjct  1020  KTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFIDEVDSML  1079

Query  3285  GRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMV  3464
             GRRE+PGEHEAMRKMKNEFMVNWDGLRTKDKERVLVL ATNRPFDLDEAVIRR PRRLMV
Sbjct  1080  GRRENPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLGATNRPFDLDEAVIRRFPRRLMV  1139

Query  3465  NLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilek  3644
             NLPDA NREKIL++IL KEEL P+VDLD++ANMT+GYSGSDLKNLCVTAAH PIREILEK
Sbjct  1140  NLPDASNREKILKVILAKEELGPDVDLDSLANMTDGYSGSDLKNLCVTAAHYPIREILEK  1199

Query  3645  ekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELY  3824
             EKKEK LA SE +P PAL+ S DIRPL++DDF+ AHEQVCASVSS+S NM ELLQWN+LY
Sbjct  1200  EKKEKNLAKSEGKPEPALYGSEDIRPLSIDDFKSAHEQVCASVSSDSANMNELLQWNDLY  1259

Query  3825  GEGGSRKKKALSYFM  3869
             GEGGSRKKKALSYFM
Sbjct  1260  GEGGSRKKKALSYFM  1274



>ref|XP_002511201.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51803.1| ATP binding protein, putative [Ricinus communis]
Length=1240

 Score =  1299 bits (3361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/1178 (60%), Positives = 866/1178 (74%), Gaps = 54/1178 (5%)
 Frame = +3

Query  408   LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  587
             +V+P+  G + + V+K +   S+L    K+ +       W KLL++  QN  V +   TF
Sbjct  93    VVTPIAEGSTPVAVEKPR---SSLASWYKQSITFETSVPWCKLLTESAQNRDVVICTPTF  149

Query  588   TVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTV  767
             T+G  RQC+  + D S+S +LC +KH QRE G ++ +LE +G KG VQVNG++  K +T 
Sbjct  150   TIGSSRQCNFPLKDQSISGTLCKIKHTQRE-GGAVAVLESTGSKGSVQVNGEVIKKGTTR  208

Query  768   PLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPS  947
              L+ GDEV+FG  G +AYIFQ+   E         +V  +E  S   K +  E RSGD S
Sbjct  209   DLHSGDEVVFGLMGNNAYIFQQLMTE--------VAVKGVEVQSNLGKFLQLERRSGDAS  260

Query  948   TVAVASTlaslsnlkke--llllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKD  1121
              VA AS LASLS+ +++       PS  N   I QG E+PA  V +   D  +++ D  +
Sbjct  261   AVAGASILASLSSPRQDLPSRYKSPSQ-NTGKIHQGTEVPAHSVVN---DGTEVELDGLE  316

Query  1122  VSDHNDVPLDE--KSGAIS---PDSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRM  1286
             ++   D+  D+   +GA+    P   N +  +E G +        K++G    +RPL  M
Sbjct  317   INSTPDMGSDKVVDAGAVGKNLPHDCNQDSGIEAGNV--------KLSGVNDLIRPLFGM  368

Query  1287  LAGSSTPEFDLSGNISR-IIDQRRELLKD--FDPLISMSTRRQAFKDGLQQTILDSNNIE  1457
             LA SS+ +  LS NI + ++++R E  +D        MS R   FK+ ++  ILD  NIE
Sbjct  369   LARSSSCKQKLSKNICKQVLEERNEWTRDSQLASTSGMSLRCAVFKEDIRAGILDGKNIE  428

Query  1458  VSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETL  1637
             VSF+ FPYYLSE TKNVLIA+++IHL+  + VK  +EL TV PRILLSGPAGSEIYQE L
Sbjct  429   VSFDSFPYYLSENTKNVLIAASFIHLRHKEHVKYTAELTTVNPRILLSGPAGSEIYQEML  488

Query  1638  AKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKP  1814
             AKALA YFGA+LL+ DS    GG S+KE++ +K+    E++    K++     L  +  P
Sbjct  489   AKALANYFGAKLLIFDSHSFLGGLSSKEVEFLKDGLNAEKSCTCAKQSPVTMDLSKSVNP  548

Query  1815  ASSVEADITGGS-AISSHAQTKQE--------ASTASSKNT-FKTGDRVKYV--GPLPTG  1958
             +S VE D    S A SS  Q  Q         +S+ +S+N  F+ GDRV+Y+  G  PT 
Sbjct  549   SSVVETDTPSCSNAPSSSGQESQPKMDADAVPSSSGTSRNLLFRIGDRVRYMFGGLYPTA  608

Query  1959  FSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADF  2138
                 +P+RGP  G +GKV+L FE+N  SKIGVRFD+ +P+G DLGGLCE  HG+FC    
Sbjct  609   ----SPSRGPPNGIRGKVVLVFEDNPLSKIGVRFDKPVPDGVDLGGLCEGGHGYFCNVTD  664

Query  2139  LRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKL  2318
             LRLDN  ++DLDKL IN LFE V  E ++SP ILF+KD EKS+ GNP++ S FK +LEKL
Sbjct  665   LRLDN--VEDLDKLLINTLFEAVYNESRNSPFILFMKDAEKSIAGNPDSCSTFKSRLEKL  722

Query  2319  PENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAI  2498
             P+NVV IAS+TQTDNRKEKSHPGG LFTKFGSNQTALLDLAFPD+FGRLH+R KE PKA 
Sbjct  723   PDNVVTIASHTQTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHERGKEVPKAT  782

Query  2499  KQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIE  2678
             K LT+LFPNKV+I +PQDE LL+ WK QLDRD ET+K + N  ++R+VL+R  ++C  +E
Sbjct  783   KVLTKLFPNKVVIHMPQDEALLTSWKHQLDRDAETLKMKGNLNHLRSVLSRSGMECQGLE  842

Query  2679  TLCIKDQALTNESVEKIIGWALSHHFMHS-SESSTKEGKLAISSESIRYGLSVLQGVQNE  2855
             TLCIKD  LTNE+ EK++GWALSHH M +    +  + +L +SSES++YG+ +LQ +QNE
Sbjct  843   TLCIKDHTLTNETAEKVVGWALSHHLMQNPDADADADARLVLSSESLQYGIEILQAIQNE  902

Query  2856  TKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPE  3035
             +KS+KKSLKDVVTENEFEK+LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPE
Sbjct  903   SKSLKKSLKDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPE  962

Query  3036  LFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVK  3215
             LFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVK
Sbjct  963   LFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVK  1022

Query  3216  AVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVL  3395
             AVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD ERVLVL
Sbjct  1023  AVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERVLVL  1082

Query  3396  AATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGY  3575
             AATNRPFDLDEAVIRRLPRRLMVNLPDAPNR KILR+IL KE+L+P+VD DAIA++T+GY
Sbjct  1083  AATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILRVILAKEDLSPDVDFDAIASLTDGY  1142

Query  3576  SGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHE  3755
             SGSDLKNLCVTAAH PI+EILEKEKKE+A A ++ +P PAL  S DIRPLNMDDFRYAHE
Sbjct  1143  SGSDLKNLCVTAAHRPIKEILEKEKKERATAAADGKPAPALSGSGDIRPLNMDDFRYAHE  1202

Query  3756  QVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             +VCASVSSES NMTELLQWNELYGEGGSR+KKALSYFM
Sbjct  1203  RVCASVSSESVNMTELLQWNELYGEGGSRRKKALSYFM  1240



>gb|EEE52523.1| hypothetical protein OsJ_34736 [Oryza sativa Japonica Group]
Length=1206

 Score =  1299 bits (3361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 682/1149 (59%), Positives = 863/1149 (75%), Gaps = 74/1149 (6%)
 Frame = +3

Query  516   GTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSIT  695
              T W KLLSQ  Q+ H+P+    F+VG    C+L                          
Sbjct  101   ATPWAKLLSQSSQSPHLPISVPQFSVGT---CEL--------------------------  131

Query  696   LLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPS  875
               E+ GKKG VQ+NG+     + VPL GGDEV+F   GKHAYIFQ   N+ I     P  
Sbjct  132   --EVLGKKGTVQLNGRSITAGTKVPLKGGDEVVFSPCGKHAYIFQHPLNDKIPKMVPPSP  189

Query  876   VSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPE  1055
             V++LE     VK +  E R+GD S VA    LAS+S+  K+L   PP+   +N+     +
Sbjct  190   VTLLEPPVAGVKRLRMENRTGDTSAVAGTELLASVSDQLKDLSAAPPASAGENN-----Q  244

Query  1056  MPALPVASGEPDKHDLDSDMKDVSDHN------------DVPLDEKSG-AISPDSGNDNL  1196
                 P+AS   DK   +  + D    N            D PLD  +   +SPD+  +++
Sbjct  245   RLVRPMASSASDKSKGNGIIPDKECENGENANEVNSNVEDSPLDVAAAPVVSPDAVPNDI  304

Query  1197  NLENG-AIDSYDG-EIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKD  1370
             +  NG   D++ G EIGK+  A  ++RP++RM+AG++  EFDL+G++ + ++ +R+L++ 
Sbjct  305   SQHNGFGSDAHLGAEIGKI--ATYKIRPVLRMIAGTTISEFDLTGDLFKALEDQRDLIRH  362

Query  1371  FDPLISMS-TRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNK  1547
              +   S+  +R QAFKDG++Q I+  N+I+V+FE+FPYYLS+ TKNVL++  +IHL+  +
Sbjct  363   LNSSASLPPSRCQAFKDGMKQGIISPNDIDVTFENFPYYLSDNTKNVLLSCAFIHLEKKE  422

Query  1548  FVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDP  1727
             F+K  SE+ ++  RILLSGPAGSEIYQETL KALAK+FGARLLVVDSL+LPG  +K+ + 
Sbjct  423   FIKQFSEISSINQRILLSGPAGSEIYQETLIKALAKHFGARLLVVDSLLLPGAPSKDPES  482

Query  1728  VKEAPKPERTG----------VFTKRAAQAAVLRFNKKPA---SSVEADITGGSAISSHA  1868
              K+A K +++G          +   R++ A  + F ++PA   SSV ADI G S + S +
Sbjct  483   QKDAAKSDKSGDKAGSEKLAILHKNRSSLADAMHF-RRPAVQPSSVHADIVGTSTLHSAS  541

Query  1869  QTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSLQTPARGPAYGYKGKVLLAFEENGFSK  2045
               KQE+STA+SK+ TF+ GDRV+YVGP       Q   RGP+YGY+G+V+LAFEENG SK
Sbjct  542   LPKQESSTATSKSYTFREGDRVRYVGPAQQSSLSQ---RGPSYGYRGRVMLAFEENGSSK  598

Query  2046  IGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKS  2225
             IGVRFD+ IP+GNDLGGLCEEDHGFFC+AD LR D S  +++++LA+ EL EV+S+E K+
Sbjct  599   IGVRFDKQIPDGNDLGGLCEEDHGFFCSADLLRPDFSGGEEVERLAMAELIEVISEEHKA  658

Query  2226  SPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTK  2405
              P+I+ +KD+EKS  G  E+ S+ + KLE LP  V++I S+TQ D+RKEK+HPGGFLFTK
Sbjct  659   GPMIVLLKDVEKSFTGITESLSSLRNKLEALPSGVLIIGSHTQMDSRKEKAHPGGFLFTK  718

Query  2406  FGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQ  2582
             F S+   L DL FPD+FG RLH+R+KE+PKA+K L +LFPNK+ IQ+PQDETLL+DWKQQ
Sbjct  719   FASSSQTLFDL-FPDSFGSRLHERNKESPKAMKHLNKLFPNKISIQLPQDETLLTDWKQQ  777

Query  2583  LDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMH  2762
             LDRD+ET+K++SN  +IR  L+R  ++C D+E L IKDQ+LTNE+V+KI+G+A+S+H  H
Sbjct  778   LDRDVETLKAKSNVGSIRTFLSRNGIECSDLEELFIKDQSLTNENVDKIVGYAVSYHLKH  837

Query  2763  SSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPS  2942
             +    +K+GKL ++SES+++GL++LQ +Q++ KS KKSLKDVVTENEFEK+LLADVIPP+
Sbjct  838   NKVEISKDGKLVLASESLKHGLNMLQNMQSDNKSSKKSLKDVVTENEFEKRLLADVIPPN  897

Query  2943  DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAK  3122
             DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAK
Sbjct  898   DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAK  957

Query  3123  AVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESP  3302
             AVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+F+DEVDSMLGRRE+P
Sbjct  958   AVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFIDEVDSMLGRRENP  1017

Query  3303  GEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAP  3482
             GEHEAMRKMKNEFMVNWDGLRTKDKERVLVL ATNRPFDLDEAVIRR PRRLMVNLPDA 
Sbjct  1018  GEHEAMRKMKNEFMVNWDGLRTKDKERVLVLGATNRPFDLDEAVIRRFPRRLMVNLPDAS  1077

Query  3483  NREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkeka  3662
             NREKIL++IL KEELAP +D+D++A MT+GYSGSDLKNLCVTAAH PIREILEKEKKEK 
Sbjct  1078  NREKILKVILAKEELAPGIDMDSLATMTDGYSGSDLKNLCVTAAHYPIREILEKEKKEKN  1137

Query  3663  laiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSR  3842
             +A +E RP PAL+ S DIRPL +DDF+ AHEQVCASVSS+S NM ELLQWN+LYGEGGSR
Sbjct  1138  VAKAEGRPEPALYGSEDIRPLTLDDFKSAHEQVCASVSSDSANMNELLQWNDLYGEGGSR  1197

Query  3843  KKKALSYFM  3869
             KKKALSYFM
Sbjct  1198  KKKALSYFM  1206



>gb|EEC68582.1| hypothetical protein OsI_36923 [Oryza sativa Indica Group]
Length=1191

 Score =  1298 bits (3358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 682/1149 (59%), Positives = 863/1149 (75%), Gaps = 74/1149 (6%)
 Frame = +3

Query  516   GTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSIT  695
              T W KLLSQ  Q+ H+P+    F+VG    C+L                          
Sbjct  86    ATPWAKLLSQSSQSPHLPISVPQFSVGT---CEL--------------------------  116

Query  696   LLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPS  875
               E+ GKKG VQ+NG+     + VPL GGDEV+F   GKHAYIFQ   N+ I     P  
Sbjct  117   --EVLGKKGTVQLNGRSITAGTKVPLKGGDEVVFSPCGKHAYIFQHPLNDKIPKMVPPSP  174

Query  876   VSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPE  1055
             V++LE     VK +  E R+GD S VA    LAS+S+  K+L   PP+   +N+ +    
Sbjct  175   VTLLEPPVAGVKRLRMENRTGDTSAVAGTELLASVSDQLKDLSAAPPASAGENNQRL---  231

Query  1056  MPALPVASGEPDKHDLDSDMKDVSDHN------------DVPLDEKSG-AISPDSGNDNL  1196
                 P+AS   DK   +  + D    N            D PLD  +   +SPD+  +++
Sbjct  232   --VRPMASSASDKSKGNGIIPDKECENGENANEVNSNVEDSPLDVAAAPVVSPDAVPNDI  289

Query  1197  NLENG-AIDSYDG-EIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKD  1370
             +  NG   D++ G EIGK+  A  ++RP++RM+AG++  EFDL+G++ + ++ +R+L++ 
Sbjct  290   SQHNGFGSDAHLGAEIGKI--ATYKIRPVLRMIAGTTISEFDLTGDLFKALEDQRDLIRH  347

Query  1371  FDPLISMS-TRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNK  1547
              +   S+  +R QAFKDG++Q I+  N+I+V+FE+FPYYLS+ TKNVL++  +IHL+  +
Sbjct  348   LNSSASLPPSRCQAFKDGMKQGIISPNDIDVTFENFPYYLSDNTKNVLLSCAFIHLEKKE  407

Query  1548  FVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDP  1727
             F+K  SE+ ++  RILLSGPAGSEIYQETL KALAK+FGARLLVVDSL+LPG  +K+ + 
Sbjct  408   FIKQFSEISSINQRILLSGPAGSEIYQETLIKALAKHFGARLLVVDSLLLPGAPSKDPES  467

Query  1728  VKEAPKPERTG----------VFTKRAAQAAVLRFNKKPA---SSVEADITGGSAISSHA  1868
              K+A K +++G          +   R++ A  + F ++PA   SSV ADI G S + S +
Sbjct  468   QKDAAKSDKSGDKAGSEKLAILHKNRSSLADAMHF-RRPAVQPSSVHADIVGTSTLHSAS  526

Query  1869  QTKQEASTASSKN-TFKTGDRVKYVGPLPTGFSLQTPARGPAYGYKGKVLLAFEENGFSK  2045
               KQE+STA+SK+ TF+ GDRV+YVGP       Q   RGP+YGY+G+V+LAFEENG SK
Sbjct  527   LPKQESSTATSKSYTFREGDRVRYVGPAQQSSLSQ---RGPSYGYRGRVMLAFEENGSSK  583

Query  2046  IGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKS  2225
             IGVRFD+ IP+GNDLGGLCEEDHGFFC+AD LR D S  +++++LA+ EL EV+S+E K+
Sbjct  584   IGVRFDKQIPDGNDLGGLCEEDHGFFCSADLLRPDFSGGEEVERLAMAELIEVISEEHKA  643

Query  2226  SPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTK  2405
              P+I+ +KD+EKS  G  E+ S+ + KLE LP  V++I S+TQ D+RKEK+HPGGFLFTK
Sbjct  644   GPMIVLLKDVEKSFTGITESLSSLRNKLEALPSGVLIIGSHTQMDSRKEKAHPGGFLFTK  703

Query  2406  FGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQ  2582
             F S+   L DL FPD+FG RLH+R+KE+PKA+K L +LFPNK+ IQ+PQDETLL+DWKQQ
Sbjct  704   FASSSQTLFDL-FPDSFGSRLHERNKESPKAMKHLNKLFPNKISIQLPQDETLLTDWKQQ  762

Query  2583  LDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMH  2762
             LDRD+ET+K++SN  +IR  L+R  ++C D+E L IKDQ+LTNE+V+KI+G+A+S+H  H
Sbjct  763   LDRDVETLKAKSNVGSIRTFLSRNGIECSDLEELFIKDQSLTNENVDKIVGYAVSYHLKH  822

Query  2763  SSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPS  2942
             +    +K+GKL ++SES+++GL++LQ +Q++ KS KKSLKDVVTENEFEK+LLADVIPP+
Sbjct  823   NKVEISKDGKLVLASESLKHGLNMLQNMQSDNKSSKKSLKDVVTENEFEKRLLADVIPPN  882

Query  2943  DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAK  3122
             DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAK
Sbjct  883   DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAK  942

Query  3123  AVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESP  3302
             AVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+F+DEVDSMLGRRE+P
Sbjct  943   AVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFIDEVDSMLGRRENP  1002

Query  3303  GEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAP  3482
             GEHEAMRKMKNEFMVNWDGLRTKDKERVLVL ATNRPFDLDEAVIRR PRRLMVNLPDA 
Sbjct  1003  GEHEAMRKMKNEFMVNWDGLRTKDKERVLVLGATNRPFDLDEAVIRRFPRRLMVNLPDAS  1062

Query  3483  NREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkeka  3662
             NREKIL++IL KEELAP +D+D++A MT+GYSGSDLKNLCVTAAH PIREILEKEKKEK 
Sbjct  1063  NREKILKVILAKEELAPGIDMDSLATMTDGYSGSDLKNLCVTAAHYPIREILEKEKKEKN  1122

Query  3663  laiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSR  3842
             +A +E RP PAL+ S DIRPL +DDF+ AHEQVCASVSS+S NM ELLQWN+LYGEGGSR
Sbjct  1123  VAKAEGRPEPALYGSEDIRPLTLDDFKSAHEQVCASVSSDSANMNELLQWNDLYGEGGSR  1182

Query  3843  KKKALSYFM  3869
             KKKALSYFM
Sbjct  1183  KKKALSYFM  1191



>ref|XP_006477013.1| PREDICTED: uncharacterized protein LOC102607540 [Citrus sinensis]
Length=1237

 Score =  1296 bits (3354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 717/1217 (59%), Positives = 868/1217 (71%), Gaps = 63/1217 (5%)
 Frame = +3

Query  330   DGASALKSPEAPVPEKLP--EAPLGGE----------PLVS---PMILGDSAIDVDKVKA  464
             D +  + +P AP P +    + P+ GE          P VS   P+  G +   ++K ++
Sbjct  47    DNSKEVCTPAAPDPGECGTGDTPIAGEGVSGGKTEATPAVSVTAPIAEGSTPGVMEKPRS  106

Query  465   NGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSK  644
             + S+ +  +K+       T W +LLSQ  QNS+VP+  S FTVG  RQC+  + D ++S 
Sbjct  107   SFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIFTVGSSRQCNFPLKDQAISA  166

Query  645   SLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYI  824
              LC +KH+Q E G+++ ++E  G KG +QVNGKI  KN++  L  GDEV+FGS G HAYI
Sbjct  167   VLCKIKHVQSE-GSAVAMVESIGSKG-LQVNGKILKKNTSCELRSGDEVVFGSLGNHAYI  224

Query  825   FQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkell  1004
             FQ+  NE         +V   E  SGP K +  E RSGDPS VA AS LASLS+L+ +L 
Sbjct  225   FQQLLNE--------VAVKGAEVQSGPGKFLQLERRSGDPSAVAGASILASLSSLRSDLS  276

Query  1005  llPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAIS---P  1175
                    + + I  G E+P  P A  +  + DLD    + + + D       G+I    P
Sbjct  277   RWKSPAQSTSKIHLGSELPT-PSADNDGVEVDLDGLEGNSTANTDSDKAADIGSIGKNIP  335

Query  1176  DSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISR-IIDQR  1352
                N +  +E G +        K +G    LRP +RMLA SS+    LS +I + ++D R
Sbjct  336   VECNQDAGIEAGNV--------KFSGVNDLLRPFLRMLAPSSSCNLKLSKSICKQVLDGR  387

Query  1353  RELLKDFDP--LISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTY  1526
              E  +D  P   + MS R   F++ +   ILD  N++ SFE+FPYYLSE TKNVLIA++Y
Sbjct  388   NEWRRDSQPASTLGMSLRCAVFREDILAGILDGTNLQESFENFPYYLSENTKNVLIAASY  447

Query  1527  IHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG  1706
             IHLK     K  SEL TV PRILLSGPAGSEIYQE LAKALA YFGA+LL+ DS  L GG
Sbjct  448   IHLKHKDHAKYTSELTTVNPRILLSGPAGSEIYQEMLAKALAHYFGAKLLIFDSHSLLGG  507

Query  1707  -SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISS-------  1862
              S+KE + +K+    E++    K+   +  L      A S+   ++     SS       
Sbjct  508   LSSKEAELLKDGTSAEKSCGCVKQGPTSTDL------AKSINLPVSESDTPSSSNPPPQG  561

Query  1863  -HAQTKQEAST-----ASSKN-TFKTGDRVKYVGPLPTG-FSLQTPARGPAYGYKGKVLL  2018
               +Q K E  T      +SKN   + GDRV++VG    G +   +P RGP  G +GKV L
Sbjct  562   PESQPKMETDTTLTSAGTSKNHMLRIGDRVRFVGSTSGGLYPTASPTRGPPCGTRGKVAL  621

Query  2019  AFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELF  2198
              FE+N  SKIGVRFD+ IP+G DLGG CE  HGFFC    LRL+NS  +DLDKL IN LF
Sbjct  622   LFEDNPSSKIGVRFDKPIPDGVDLGGQCEGGHGFFCNVTDLRLENSGTEDLDKLLINTLF  681

Query  2199  EVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKS  2378
             EVV  E +S P ILF+KD EKS+ GN +++S FK +LEKLP+ V+VI S+T TDNRKEKS
Sbjct  682   EVVFSESRSCPFILFMKDAEKSIAGNSDSYSTFKSRLEKLPDKVIVIGSHTHTDNRKEKS  741

Query  2379  HPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDET  2558
             HPGG LFTKFGSNQTALLDLAFPD+FGRLHDR KE PKA K LT+LFPNKV I +PQDE 
Sbjct  742   HPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEIPKATKLLTKLFPNKVTIHMPQDEA  801

Query  2559  LLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGW  2738
             LL+ WK QLDRD ET+K + N  ++R VL R  L+C  +ETLCI+DQ+LTNES EKI+GW
Sbjct  802   LLASWKHQLDRDSETLKMKGNLNHLRTVLGRSGLECEGLETLCIRDQSLTNESAEKIVGW  861

Query  2739  ALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKL  2918
             ALSHH M + E+   + +L +S ESI+YG+ + Q +QNE+KS+KKSLKDVVTENEFEK+L
Sbjct  862   ALSHHLMQNPEAD-PDARLVLSCESIQYGIGIFQAIQNESKSLKKSLKDVVTENEFEKRL  920

Query  2919  LADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPG  3098
             LADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPG
Sbjct  921   LADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPG  980

Query  3099  TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDS  3278
             TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDS
Sbjct  981   TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDS  1040

Query  3279  MLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRL  3458
             MLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD ER+LVLAATNRPFDLDEAVIRRLPRRL
Sbjct  1041  MLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNRPFDLDEAVIRRLPRRL  1100

Query  3459  MVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReil  3638
             MVNLPDAPNR KIL++IL KE+L+P+VD DAIANMT+GYSGSDLKNLCVTAAH PI+EIL
Sbjct  1101  MVNLPDAPNRAKILQVILAKEDLSPDVDFDAIANMTDGYSGSDLKNLCVTAAHRPIKEIL  1160

Query  3639  ekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNE  3818
             EKEKKE+A A++E +P PAL   +DIRPLNMDDF+YAHE+VCASVSSES NM+ELLQWNE
Sbjct  1161  EKEKKERAAAMAEGKPAPALSGCADIRPLNMDDFKYAHERVCASVSSESVNMSELLQWNE  1220

Query  3819  LYGEGGSRKKKALSYFM  3869
             LYGEGGSR+KKALSYFM
Sbjct  1221  LYGEGGSRRKKALSYFM  1237



>gb|KDP30932.1| hypothetical protein JCGZ_11308 [Jatropha curcas]
Length=1235

 Score =  1294 bits (3349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 703/1179 (60%), Positives = 866/1179 (73%), Gaps = 60/1179 (5%)
 Frame = +3

Query  408   LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  587
             +V+P+  G + I VDK + + S+ +   ++Q  +   + W  LLSQ  QN  VP+   +F
Sbjct  92    VVTPIAEGSTPIVVDKPRTSFSSWSSFYQKQ-NTIQESPWCNLLSQSAQNPSVPICVPSF  150

Query  588   TVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTV  767
             T+G  R C+L + D ++S +LC +K   + +G +  +L+ SG KG V+VNG++  KN+  
Sbjct  151   TIGSNRNCNLSLKDQTISATLCRIK---QHEGGAGAVLDCSGSKGSVKVNGEVVKKNTQR  207

Query  768   PLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSIL--EAHSGPVKGVNFEARSGD  941
              L+ GDEV+FG  G HAYIFQ+          +P  V++   E  S   K +  E RSGD
Sbjct  208   QLHSGDEVVFGLLGNHAYIFQQ----------LPTDVAVKGPEVQSSMGKFLQLERRSGD  257

Query  942   PSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKD  1121
             PS VA AS LASLS++++++        N   I QG E+PA  V     D  D D D  +
Sbjct  258   PSAVAGASILASLSSMRQDISRYKSPGQNPGKIHQGSEVPAHSVVH---DGTDGDLDGLE  314

Query  1122  VSDHNDVPLDEKS--GAIS---PDSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRM  1286
             ++   ++  D+ +  GA+    P   N +  +E G +        K++G    +RP  RM
Sbjct  315   INSTPNIGSDKAADVGAVGKNLPHDCNQDSGIEAGNV--------KLSGVNDLIRPFFRM  366

Query  1287  LAGSSTPEFDLSGNISR-IIDQRRELLKD--FDPLISMSTRRQAFKDGLQQTILDSNNIE  1457
             LA S++ +  LS +I + ++++R E  +D        MS R   FK+ +   ILD  NIE
Sbjct  367   LARSTSCKQKLSKSICKQVLEERNEWARDSQLASTSGMSLRCAVFKEDIYAGILDGKNIE  426

Query  1458  VSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETL  1637
             VSF+DFPYYLSE TKNVL A+++IHL+  + VK  ++L TV PRILLSGPAGSEIYQE L
Sbjct  427   VSFDDFPYYLSESTKNVLTAASFIHLRHKEHVKYTADLTTVNPRILLSGPAGSEIYQEML  486

Query  1638  AKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKP  1814
             AKALA YFGA+LL+ DS    GG S+KE + +K+    E++    K+   A  L     P
Sbjct  487   AKALANYFGAKLLIFDSHSFLGGLSSKEAEILKDGLNAEKSCTCAKQNPAATDLSKGVNP  546

Query  1815  ASSVEADITGGSAISSHAQTKQEA-----------STASSKNT-FKTGDRVKYV--GPLP  1952
                VEAD    S++++ + + QE+           S+ +++N  FK GDR++Y+  G  P
Sbjct  547   PG-VEADTL--SSLNATSSSGQESLPKMDIDTVPSSSGTTRNLLFKIGDRIRYISSGLYP  603

Query  1953  TGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAA  2132
             T     +P+RGP  G +GKV+L FE+N  SKIGVRFD+ +P+G DLGGLCE  HG+FC  
Sbjct  604   TA----SPSRGPPNGIRGKVVLVFEDNHLSKIGVRFDKLVPDGVDLGGLCETGHGYFCNV  659

Query  2133  DFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLE  2312
               LRLDN  ++DLDKL IN LFE V  E ++ P ILFVKD EKS+ GNP+  S FK +LE
Sbjct  660   TDLRLDN--VEDLDKLLINTLFEAVHNESRNFPFILFVKDAEKSIAGNPDTCSTFKSRLE  717

Query  2313  KLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPK  2492
             KLP+NVVVIAS+TQTDNRKEKSHPGG LFTKFGSNQTALLDLAFPD+FGRLHDR KE PK
Sbjct  718   KLPDNVVVIASHTQTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEVPK  777

Query  2493  AIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPD  2672
             A K LT+LFPNKV+I +PQDE LL+ WK QLDRD ET+K + N  ++R VL R  L+C  
Sbjct  778   ATKVLTKLFPNKVVIHMPQDEALLASWKHQLDRDSETLKMKGNLNHLRAVLTRSGLECEG  837

Query  2673  IETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQN  2852
             +ETLCIKDQ LTNES EK++GWALSHH M + E+   + ++ +SSESI+YG+ +LQ +QN
Sbjct  838   LETLCIKDQTLTNESAEKVVGWALSHHLMQNPEAEA-DARIILSSESIQYGIGILQAIQN  896

Query  2853  ETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRP  3032
             E+KS+KKSLKDVVTENEFEK+LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRP
Sbjct  897   ESKSLKKSLKDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRP  956

Query  3033  ELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYV  3212
             ELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYV
Sbjct  957   ELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYV  1016

Query  3213  KAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLV  3392
             KAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD ERVLV
Sbjct  1017  KAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERVLV  1076

Query  3393  LAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEG  3572
             LAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR KIL++IL KE+L+P+VD DAIA+MT+G
Sbjct  1077  LAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILKVILAKEDLSPDVDFDAIASMTDG  1136

Query  3573  YSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAH  3752
             YSGSDLKNLCVTAAH PI+EILEKEKKE+A A++E +P PAL  S+DIRPLNMDDF+YAH
Sbjct  1137  YSGSDLKNLCVTAAHRPIKEILEKEKKERAAALAEGKPTPALSGSADIRPLNMDDFKYAH  1196

Query  3753  EQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             E+VCASVSSES NMTELLQWNELYGEGGSR+KKALSYFM
Sbjct  1197  ERVCASVSSESVNMTELLQWNELYGEGGSRRKKALSYFM  1235



>gb|KDO52637.1| hypothetical protein CISIN_1g000823mg [Citrus sinensis]
Length=1237

 Score =  1294 bits (3348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 716/1217 (59%), Positives = 867/1217 (71%), Gaps = 63/1217 (5%)
 Frame = +3

Query  330   DGASALKSPEAPVPEKLP--EAPLGGE----------PLVS---PMILGDSAIDVDKVKA  464
             D +  + +P AP P +    + P+ GE          P VS   P+  G +   ++K ++
Sbjct  47    DNSKEVCTPAAPDPGECGTGDTPIAGEGVSGGKTEATPAVSVTAPIAEGSTPGVMEKPRS  106

Query  465   NGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSK  644
             + S+ +  +K+       T W +LLSQ  QNS+VP+  S FTVG  RQC+  + D ++S 
Sbjct  107   SFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIFTVGSSRQCNFPLKDQAISA  166

Query  645   SLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYI  824
              LC +KH+Q E G+++ ++E  G KG +QVNGK   KN++  L  GDEV+FGS G HAYI
Sbjct  167   VLCKIKHVQSE-GSAVAMVESIGSKG-LQVNGKNLKKNTSCELRSGDEVVFGSLGNHAYI  224

Query  825   FQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkell  1004
             FQ+  NE         +V   E  SGP K +  E RSGDPS VA AS LASLS+L+ +L 
Sbjct  225   FQQLLNE--------VAVKGAEVQSGPGKFLQLERRSGDPSAVAGASILASLSSLRSDLS  276

Query  1005  llPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAIS---P  1175
                    + + I  G E+P  P A  +  + DLD    + + + D       G+I    P
Sbjct  277   RWKSPAQSTSKIHLGSELPT-PSADNDGVEVDLDGLEGNSTANTDSDKAADIGSIGKNIP  335

Query  1176  DSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISR-IIDQR  1352
                N +  +E G +        K +G    LRP +RMLA SS+    LS +I + ++D R
Sbjct  336   VECNQDAGIEAGNV--------KFSGVNDLLRPFLRMLAPSSSCNLKLSKSICKQVLDGR  387

Query  1353  RELLKDFDP--LISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTY  1526
              E  +D  P   + MS R   F++ +   ILD  N++ SFE+FPYYLSE TKNVLIA++Y
Sbjct  388   NEWRRDSQPASTLGMSLRCAVFREDILAGILDGTNLQESFENFPYYLSENTKNVLIAASY  447

Query  1527  IHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG  1706
             IHLK     K  SEL TV PRILLSGPAGSEIYQE LAKALA YFGA+LL+ DS  L GG
Sbjct  448   IHLKHKDHAKYTSELTTVNPRILLSGPAGSEIYQEMLAKALAHYFGAKLLIFDSHSLLGG  507

Query  1707  -SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISS-------  1862
              S+KE + +K+    E++    K+   +  L      A S+   ++     SS       
Sbjct  508   LSSKEAELLKDGTSAEKSCGCVKQGPTSTDL------AKSINLPVSESDTPSSSNPPPQG  561

Query  1863  -HAQTKQEAST-----ASSKN-TFKTGDRVKYVGPLPTG-FSLQTPARGPAYGYKGKVLL  2018
               +Q K E  T      +SKN   + GDRV++VG    G +   +P RGP  G +GKV L
Sbjct  562   PESQPKMETDTTLTSAGTSKNHMLRIGDRVRFVGSTSGGLYPTASPTRGPPCGTRGKVAL  621

Query  2019  AFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELF  2198
              FE+N  SKIGVRFD+ IP+G DLGG CE  HGFFC    LRL+NS  +DLDKL IN LF
Sbjct  622   LFEDNPSSKIGVRFDKPIPDGVDLGGQCEGGHGFFCNVTDLRLENSGTEDLDKLLINTLF  681

Query  2199  EVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKS  2378
             EVV  E +S P ILF+KD EKS+ GN +++S FK +LEKLP+ V+VI S+T TDNRKEKS
Sbjct  682   EVVFSESRSCPFILFMKDAEKSIAGNSDSYSTFKSRLEKLPDKVIVIGSHTHTDNRKEKS  741

Query  2379  HPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDET  2558
             HPGG LFTKFGSNQTALLDLAFPD+FGRLHDR KE PKA K LT+LFPNKV I +PQDE 
Sbjct  742   HPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEIPKATKLLTKLFPNKVTIHMPQDEA  801

Query  2559  LLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGW  2738
             LL+ WK QLDRD ET+K + N  ++R VL R  L+C  +ETLCI+DQ+LTNES EKI+GW
Sbjct  802   LLASWKHQLDRDSETLKMKGNLNHLRTVLGRSGLECEGLETLCIRDQSLTNESAEKIVGW  861

Query  2739  ALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKL  2918
             ALSHH M + E+   + +L +S ESI+YG+ + Q +QNE+KS+KKSLKDVVTENEFEK+L
Sbjct  862   ALSHHLMQNPEAD-PDARLVLSCESIQYGIGIFQAIQNESKSLKKSLKDVVTENEFEKRL  920

Query  2919  LADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPG  3098
             LADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPG
Sbjct  921   LADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPG  980

Query  3099  TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDS  3278
             TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDS
Sbjct  981   TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDS  1040

Query  3279  MLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRL  3458
             MLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD ER+LVLAATNRPFDLDEAVIRRLPRRL
Sbjct  1041  MLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNRPFDLDEAVIRRLPRRL  1100

Query  3459  MVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReil  3638
             MVNLPDAPNR KIL++IL KE+L+P+VD DAIANMT+GYSGSDLKNLCVTAAH PI+EIL
Sbjct  1101  MVNLPDAPNRAKILQVILAKEDLSPDVDFDAIANMTDGYSGSDLKNLCVTAAHRPIKEIL  1160

Query  3639  ekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNE  3818
             EKEKKE+A A++E +P PAL   +DIRPLNMDDF+YAHE+VCASVSSES NM+ELLQWNE
Sbjct  1161  EKEKKERAAAMAEGKPAPALSGCADIRPLNMDDFKYAHERVCASVSSESVNMSELLQWNE  1220

Query  3819  LYGEGGSRKKKALSYFM  3869
             LYGEGGSR+KKALSYFM
Sbjct  1221  LYGEGGSRRKKALSYFM  1237



>ref|XP_011044169.1| PREDICTED: uncharacterized protein LOC105139438 isoform X1 [Populus 
euphratica]
Length=1259

 Score =  1293 bits (3346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/1184 (59%), Positives = 856/1184 (72%), Gaps = 65/1184 (5%)
 Frame = +3

Query  408   LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  587
             +V+P+  G + + ++K +++ S  N  +K+   S+  T W KLL+Q  QN ++ +  S++
Sbjct  111   VVTPIAEGSTPVVLEKPRSSLSTWNLYQKQN--SSFETPWCKLLTQSAQNQNIVICTSSY  168

Query  588   TVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTV  767
             ++G  +QCD  + D ++    C ++H QRE G+++  LE SG KG VQVNG    K +  
Sbjct  169   SIGTTKQCDFILKDHAMGGIQCKIRHTQRE-GSAVAELESSGSKGSVQVNGTAVKKGAIY  227

Query  768   PLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPS  947
              LN GDEV+FG+ G HAYIFQ+   E         +V   E HS   K +  E RSGDPS
Sbjct  228   VLNSGDEVVFGAVGNHAYIFQQLLTE--------VAVKSAEVHSSLGKLLQLERRSGDPS  279

Query  948   TVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVS  1127
              VA AS LASLS+L+ +L          + +  G E+PA  V  G  +            
Sbjct  280   AVAGASILASLSSLRPDLSRWKSPGQTASKMHHGTEVPAQSVVHGGAE------------  327

Query  1128  DHNDVPLDEKSGAISPDSGND--------NLNLENGAIDSYDGEIG--KVTGAPQELRPL  1277
                 V LD   G  +P+ G+D        N NL +        E G  K++G    +RP 
Sbjct  328   ----VELDGMEGNSTPNLGSDKAAEVGAINQNLPHDCSQDSGTEAGNVKISGMNDLIRPF  383

Query  1278  IRMLAGSSTPEFDLSGNISR-IIDQRRELLKD--FDPLISMSTRRQAFKDGLQQTILDSN  1448
              RMLA SS+ +  LS NI + ++++R E LKD        MS R   FK+ L   IL+  
Sbjct  384   FRMLARSSSCKQKLSKNICKQVLEERNEWLKDSQLASTSGMSLRCAVFKEDLHAGILNGK  443

Query  1449  NIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQ  1628
             NIEVSF++FPYYLSE TKNVLIA+++IHL   K+ K  SEL TV PRILLSGPAGSEIYQ
Sbjct  444   NIEVSFDNFPYYLSENTKNVLIAASFIHLMHKKYAKYTSELTTVNPRILLSGPAGSEIYQ  503

Query  1629  ETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFN  1805
             E LAKALA YFGA+LLV DS    GG S+KE + +K+    E++   +K+      +   
Sbjct  504   EMLAKALANYFGAKLLVFDSHSFLGGLSSKEAELLKDGTNAEKSCTCSKQ------VPVT  557

Query  1806  KKPASSVEADITGG---SAISSHAQTKQE------------ASTASSKNTFKTGDRVKYV  1940
               P+ SV  +I+ G   +  SS+A   QE               A+    FK GDRVK+ 
Sbjct  558   TDPSKSV--NISAGETDTPNSSNAPASQELFEMEDTLPSSSGPGAARNRLFKIGDRVKFT  615

Query  1941  GPLPTG-FSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHG  2117
                 +  +   +P+RGP YG +GKV+L FE+N  SKIGVRFD+ IP+G DLG +CE+ HG
Sbjct  616   SSSSSVLYQTASPSRGPPYGIRGKVVLPFEDNPLSKIGVRFDKPIPDGVDLGDVCEKGHG  675

Query  2118  FFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAF  2297
             +FC    LRL+N++++DLDKL IN LFE V  E ++SP IL++KD EKS+VGN +++S F
Sbjct  676   YFCNVTDLRLENTAVEDLDKLLINTLFEAVHSESRNSPFILYMKDAEKSIVGNSDSYSTF  735

Query  2298  KLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRS  2477
             K +LEKLP+NVVVI S+TQ DNRKEKSHPGG LFTKFGSNQTALLDLAFPD+FGRL +R 
Sbjct  736   KSRLEKLPDNVVVIGSHTQNDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLGERG  795

Query  2478  KETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVE  2657
             KE PKA K LT+LFPNKV I +PQDETLL+ WK QLD+D ET+K + N  N+R VL R  
Sbjct  796   KEVPKATKLLTKLFPNKVAIHMPQDETLLASWKHQLDQDAETLKMKGNLNNLRTVLGRCG  855

Query  2658  LDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVL  2837
             ++C  +ETLCIKDQ +TNES EK++GWALSHH M +S ++  + KL +SSESI+YG+ +L
Sbjct  856   MECEGLETLCIKDQTITNESAEKVVGWALSHHLMQNSANADADVKLVLSSESIQYGIGIL  915

Query  2838  QGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVML  3017
             Q +QNE+KS+KKSLKDV+TENEFEK+LLADVIPP+DIGVTFDDIGALENVKDTLKELVML
Sbjct  916   QAIQNESKSLKKSLKDVMTENEFEKRLLADVIPPNDIGVTFDDIGALENVKDTLKELVML  975

Query  3018  PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE  3197
             PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE
Sbjct  976   PLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE  1035

Query  3198  GEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDK  3377
             GEKYVKAVF+LASKI+PSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD 
Sbjct  1036  GEKYVKAVFSLASKISPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDT  1095

Query  3378  ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIA  3557
             ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR KIL++IL KE+L+P++D DAIA
Sbjct  1096  ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILKVILAKEDLSPDIDFDAIA  1155

Query  3558  NMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDD  3737
             +MT+GYSGSDLKNLCV AAH PI+EILEKEKKE+A A++E +P PAL  S+DIRPLNM D
Sbjct  1156  SMTDGYSGSDLKNLCVAAAHRPIKEILEKEKKEQAAALAEGKPAPALSGSADIRPLNMVD  1215

Query  3738  FRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             F+ AHEQVCASVSSES NMTELLQWNELYGEGGSR+KKALSYFM
Sbjct  1216  FKDAHEQVCASVSSESVNMTELLQWNELYGEGGSRRKKALSYFM  1259



>ref|XP_010248970.1| PREDICTED: uncharacterized protein LOC104591697 isoform X3 [Nelumbo 
nucifera]
Length=1060

 Score =  1291 bits (3342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 689/1070 (64%), Positives = 821/1070 (77%), Gaps = 22/1070 (2%)
 Frame = +3

Query  696   LLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPS  875
             ++E +G KG V +NGK+  KNS+  LN GDEVIFG +G HAYIFQ    E +  A +P S
Sbjct  1     MIESTGSKGTVHINGKLQKKNSSCVLNSGDEVIFGLAGNHAYIFQLLVPEFV--AKVPSS  58

Query  876   VSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPE  1055
             V + E  S   KG+N E RSGDPS VA AS LASLS L+++L LL P   N  +  QG E
Sbjct  59    VGVAEP-SCVGKGLNLERRSGDPSAVAGASILASLSGLREDLSLLTPPAQNPGETPQGTE  117

Query  1056  MPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGE  1235
              P   +A  E D   LD      +       D+ S A    + N + +L+N      + +
Sbjct  118   GPTSQLARPEID---LDGPQGKGNPDPSAGSDKVSEA---GATNKSFHLDNNHDSGVESD  171

Query  1236  IGKVTGAPQELRPLIRMLAGSSTPEFDLSGNI-SRIIDQRRELLKDFDPLIS--MSTRRQ  1406
             I K++G    LRP +RMLAGSS+ + +LS +I  +++++R+E  +D     +  +S +  
Sbjct  172   IVKLSGVNDSLRPFLRMLAGSSSCDLELSKHIFKQVLEERKEWTRDSHQASTSGVSPKCA  231

Query  1407  AFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCP  1586
             AFK+ +Q  ILD   IEV+F++FPYYLS  TKNVLI + +IHLK  ++ K  S+LPTV P
Sbjct  232   AFKEDIQAGILDGREIEVTFDNFPYYLSSSTKNVLINAAFIHLKRGEYAKYTSDLPTVSP  291

Query  1587  RILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGV  1763
             RILLSGPAGSEIYQE L+KALA YFGA+LL+ D+    GG S+K+ D +K+  K E+   
Sbjct  292   RILLSGPAGSEIYQEMLSKALANYFGAKLLIFDTHSFLGGLSSKDSDVLKDGLKAEKICS  351

Query  1764  FTK-RAAQAAVLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSK------NTFKTG  1922
              +K R   A V + N   A   +   +  +     +QTK E +TA S       + FK G
Sbjct  352   CSKQRPGHADVAKINIPLAGEADMPDSSSTPCGLDSQTKLETNTAPSTSGTTKTHLFKMG  411

Query  1923  DRVKYVGPLP-TGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGL  2099
             DRVK+VG +  T +S   PARGP YGYKGKVLL FE+N  SKIGVRFD+ IPEG DLGGL
Sbjct  412   DRVKFVGMVHNTSYSATLPARGPTYGYKGKVLLPFEDNMASKIGVRFDKPIPEGVDLGGL  471

Query  2100  CEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNP  2279
             CE  HGFFC  + L L++   +DLDKL IN LFEV+S E +++P ILF+KD+EKS+VGN 
Sbjct  472   CEGTHGFFCNVNDLCLESPGTEDLDKLLINTLFEVLSSESRNTPFILFMKDVEKSIVGNS  531

Query  2280  EAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFG  2459
             E+ S FK KLEKLP+NVV+I S+TQTD+RKEKSHPGG LFTKFGSNQTALLD AFPD+FG
Sbjct  532   ESASTFKSKLEKLPDNVVIIGSHTQTDSRKEKSHPGGLLFTKFGSNQTALLDFAFPDSFG  591

Query  2460  RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRN  2639
             RLHDR+KE PK  K L +LFPNKV I IPQDE +L+ WK QLDRD ET+K++ N  N+RN
Sbjct  592   RLHDRNKEIPKTTKMLAKLFPNKVTIHIPQDEAVLASWKNQLDRDAETLKAKGNLNNLRN  651

Query  2640  VLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIR  2819
             VL+R  LDC  +ETLCIKD +LT ES EK++GWALSHH MH+++    E K  +SSESI+
Sbjct  652   VLSRSGLDCDGLETLCIKDISLTPESAEKVVGWALSHHLMHNTKL-VAEAKPVLSSESIQ  710

Query  2820  YGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTL  2999
             YG+ +LQ +Q+E+KS+KKSLKD+VTENEFEK+LL DVIPPSDIGVTFDDIGALENVKDTL
Sbjct  711   YGIGILQAIQSESKSLKKSLKDIVTENEFEKRLLTDVIPPSDIGVTFDDIGALENVKDTL  770

Query  3000  KELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSIT  3179
             KELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSIT
Sbjct  771   KELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSIT  830

Query  3180  SKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDG  3359
             SKWFGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDG
Sbjct  831   SKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDG  890

Query  3360  LRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNV  3539
             LRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR KIL++IL KE+L+P++
Sbjct  891   LRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILKVILAKEDLSPDI  950

Query  3540  DLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIR  3719
             DLD IA+MT+GYSGSDLKNLCVTAAHCPIREILEKEKKE+A A++E RP PAL  S DIR
Sbjct  951   DLDVIASMTDGYSGSDLKNLCVTAAHCPIREILEKEKKERAAAMAEGRPPPALSGSEDIR  1010

Query  3720  PLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             PL+MDDFRYAHEQVCASVSSES NM+ELLQWNELYGEGGSRKK+ALSYFM
Sbjct  1011  PLSMDDFRYAHEQVCASVSSESVNMSELLQWNELYGEGGSRKKRALSYFM  1060



>ref|XP_010237445.1| PREDICTED: uncharacterized protein LOC100840651 isoform X1 [Brachypodium 
distachyon]
Length=1236

 Score =  1291 bits (3341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/1142 (59%), Positives = 865/1142 (76%), Gaps = 40/1142 (4%)
 Frame = +3

Query  525   WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLE  704
             W KLLSQ  Q+ H+ +    F+VGQ ++C+L + D  VSK LC L+H   E+G  +  LE
Sbjct  108   WAKLLSQCSQSPHLHISVPQFSVGQSKRCNLWLKDQPVSKILCKLRH--HEQGAGLCELE  165

Query  705   ISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSI  884
             + G+KG V +NGK       +PL  GDE++F S GKHAYI Q    + ++ A    +V +
Sbjct  166   VIGEKGVVLLNGKAVTPGIKLPLTAGDELVFSSCGKHAYILQHPLKDKVAKAVPSSAVGL  225

Query  885   LEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPA  1064
             LE     V  ++   RS   S V     LASLSN  K+L  LPP+   D++     +   
Sbjct  226   LEPPVAGVNHIHMANRSEVTSAVTGTEMLASLSNQSKDLPALPPASAGDDN-----QRVV  280

Query  1065  LPVASG----------EPDKHDLDSDMKDVSDHN--DVPLDEKSGAISPDSGNDNLNLEN  1208
              P+AS            PDK   + +  + ++ N  D P+D  +   SPD+  ++++ +N
Sbjct  281   RPIASSASDKSKGRCISPDKECENGETANEANSNIEDSPMDVAATPTSPDAVANDISRQN  340

Query  1209  G-AIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKDFDPLI  1385
             G   D++  EIGK+  A  ++RP++RM+AGS+ P FDL+G+  + ++ +RE++++     
Sbjct  341   GFGSDAHLDEIGKI--ATYKIRPVLRMIAGSTVPGFDLTGDPFKALEDQREIIRELTAAD  398

Query  1386  SMS-TRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCA  1562
             ++  +R +AFKDG++Q I+  ++IEV+FE+FPYYLSE TKNVL++ +++HL+    +K  
Sbjct  399   NLPPSRCEAFKDGMKQAIISPSDIEVTFENFPYYLSENTKNVLLSCSFLHLEKKDLIKQF  458

Query  1563  SELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAP  1742
             SE+ ++  RILLSGPAGSEIYQETL KALAK+FGARLLVVDSL+LPG  +K+ +  K+  
Sbjct  459   SEISSINQRILLSGPAGSEIYQETLIKALAKHFGARLLVVDSLLLPGAPSKDPETQKDVG  518

Query  1743  KPERTG---------VFTKRAAQAAVLRFNK--KPASSVEADITGGSAISSHAQTKQEAS  1889
             K +++G         +   R++ A  + F +   P SSV ADI G S + S    KQE+S
Sbjct  519   KIDKSGDKAGEKLAILHKHRSSLADAIHFRRPAAPTSSVNADIVGTSTLHSATLPKQESS  578

Query  1890  TASSKN-TFKTGDRVKYVGPLPTGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDR  2066
             TA+SK  TF+ G+RV+YVG       +    RGP+YGY+G+V+LAFEENG SKIGVRFD+
Sbjct  579   TATSKGYTFREGERVRYVGSAQPSSVIH---RGPSYGYRGRVMLAFEENGSSKIGVRFDK  635

Query  2067  SIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFV  2246
              +P+GNDLGGLCEEDHGFFC+A+ LR D +  +++++LA+ EL EV+S+E K+  LI+ +
Sbjct  636   QVPDGNDLGGLCEEDHGFFCSAELLRPDFAGGEEVERLAMTELIEVISEESKTGSLIVLL  695

Query  2247  KDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTA  2426
             KD+EKS  G  E+FS+ + KLE LP  V+VI S+TQ D+RKEK+HPGGFLFTKF S+   
Sbjct  696   KDVEKSFTGITESFSSLRNKLELLPAGVLVIGSHTQMDSRKEKAHPGGFLFTKFASSSQT  755

Query  2427  LLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIET  2603
             L DL FPD+FG RLH+R+KE+PKA+K L +LFPNK+ IQ+PQDE LL++WKQQLDRD+ET
Sbjct  756   LFDL-FPDSFGSRLHERNKESPKAMKHLNKLFPNKITIQLPQDEALLTNWKQQLDRDVET  814

Query  2604  MKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTK  2783
             +K++SN  +IR  LNR  ++C D+E L IKDQ+LTNE+V+KI+G+A+S+HF ++   +TK
Sbjct  815   LKAKSNIGSIRTFLNRSAIECNDLEELFIKDQSLTNENVDKIVGYAVSYHFKNNKVETTK  874

Query  2784  EGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFD  2963
             +GKL ++SES+++GL +LQ +  + KS KKSLKDVVTENEFEK+LLADVIPP+DIGVTFD
Sbjct  875   DGKLVLTSESLKHGLDMLQSLHTDNKSSKKSLKDVVTENEFEKRLLADVIPPNDIGVTFD  934

Query  2964  DIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAG  3143
             DIGALENVK+TLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAG
Sbjct  935   DIGALENVKETLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAG  994

Query  3144  ANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMR  3323
             ANFINISMSSITSKWFGEGEKYVKAVF+LASKI+PSV+F+DEVDSMLGRRE+PGEHEAMR
Sbjct  995   ANFINISMSSITSKWFGEGEKYVKAVFSLASKISPSVIFIDEVDSMLGRRENPGEHEAMR  1054

Query  3324  KMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILR  3503
             KMKNEFMVNWDGLRTKDKERVLVL ATNRPFDLDEAVIRR PRRLMVNLPDA NREKIL+
Sbjct  1055  KMKNEFMVNWDGLRTKDKERVLVLGATNRPFDLDEAVIRRFPRRLMVNLPDASNREKILK  1114

Query  3504  IILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENR  3683
             +IL KEEL  + DL+++ANMT+GYSGSDLKNLCVTAAH PIREILEKEKKEK++A SE R
Sbjct  1115  VILAKEELGRDTDLESLANMTDGYSGSDLKNLCVTAAHYPIREILEKEKKEKSVAKSEGR  1174

Query  3684  PLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSY  3863
             P PALH S D+RPL++DDF+ AHEQVCASVSS+S NM EL QWNELYGEGGSRKKKALSY
Sbjct  1175  PEPALHGSEDVRPLSLDDFKSAHEQVCASVSSDSANMNELNQWNELYGEGGSRKKKALSY  1234

Query  3864  FM  3869
             FM
Sbjct  1235  FM  1236



>ref|XP_002279926.2| PREDICTED: uncharacterized protein LOC100266414 isoform X1 [Vitis 
vinifera]
Length=1247

 Score =  1290 bits (3338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/1191 (58%), Positives = 868/1191 (73%), Gaps = 59/1191 (5%)
 Frame = +3

Query  384   EAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSH  563
             EA L   P+ +P+  G S I VDK +++ S+ +  +K+  ++++   W KLLSQ+ QN +
Sbjct  87    EAALAA-PVSAPIAEGTSPIVVDKPRSSFSSWSVYQKQNYETSM--PWCKLLSQFSQNPN  143

Query  564   VPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGK  743
             V +    FT+G  R C+  + D ++S  LC +KH QRE G+++ +LE SG KG VQVNG 
Sbjct  144   VSIGVINFTIGSSRHCNFPLKDQTISPILCKIKHSQRE-GSAVAVLESSGSKGSVQVNGT  202

Query  744   IYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNF  923
                + ++  LN GDEV+FG  G HAYIFQ+   E ++  +     +  E  S   K ++ 
Sbjct  203   FIKRGTSCVLNSGDEVVFGLLGNHAYIFQQLVTE-VAIKAPSSGATGAEVQSSVGKYLHV  261

Query  924   EARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKH--  1097
             E RSGDPS VA AS LASLS+L+++L             +QG E+P  P+    P+    
Sbjct  262   ERRSGDPSAVAGASILASLSSLRQDLSRWKSPPLTTGKTQQGTELPPHPIIHDSPEVEFN  321

Query  1098  ------------DLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIG  1241
                         D  +D+  VS +  +  ++ SGA   ++GN   +  N  +        
Sbjct  322   GLEGNSTANGGSDKAADIAAVSKNLSLDCNQDSGA---EAGNVKFSGMNDLV--------  370

Query  1242  KVTGAPQELRPLIRMLAGSSTPEFDLSGNI-SRIIDQRRELLKDFDPLIS--MSTRRQAF  1412
                         ++M A S++   +LS +I  +++++R E  +D  P  +  MS R   F
Sbjct  371   ------------LKMFAQSTSCNLELSKSIFKQVLEERNEWTRDSLPASTSGMSLRCAVF  418

Query  1413  KDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRI  1592
             K+ +   ILD   I+VSF+DFPYYLSE TKNVLIA+++IHLK  +  K  SEL TV PRI
Sbjct  419   KEDIHAGILDGKEIQVSFDDFPYYLSENTKNVLIAASFIHLKHREHAKFTSELTTVNPRI  478

Query  1593  LLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFT  1769
             LLSGPAGSEIYQE LAKALA YFGA+LL+ DS    GG S+KE + +K+    E+    T
Sbjct  479   LLSGPAGSEIYQEMLAKALANYFGAKLLIFDSHSFLGGLSSKEAELLKDGSNAEKFCSCT  538

Query  1770  KRAAQAAVLRFNKKPASSVEADI--TGGSAISSHAQTKQE-------ASTASSKN-TFKT  1919
             K+++ +  L  N   +S+ EAD      + IS   +++ +       +S+ ++KN  F+ 
Sbjct  539   KQSSGSTELAKNMA-SSAGEADTPNIANAPISCELESQPKLENDTVPSSSGTTKNHLFRI  597

Query  1920  GDRVKYVGPLPTG-FSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGG  2096
             GDRV+++G    G +S  + +RGP +G +GKVLL FE+N  SKIGVRFD+ I +G DLGG
Sbjct  598   GDRVRFMGSASGGSYSAVSASRGPTFGIRGKVLLPFEDNPLSKIGVRFDKLITDGVDLGG  657

Query  2097  LCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGN  2276
             LCE  +GFFC  + LRL+N+ ++DLDKL IN LFE V  E + SP ILF+KD EKS+VGN
Sbjct  658   LCEPGYGFFCNVNDLRLENTGVEDLDKLLINTLFEAVYSESRDSPFILFMKDAEKSIVGN  717

Query  2277  PEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNF  2456
              E++S FK +LEKLP+NVV+I S+T TDNRKEKSHPGG LFTKFGSNQTALLDLAFPD+F
Sbjct  718   SESYSMFKSRLEKLPDNVVIIGSHTHTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSF  777

Query  2457  GRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIR  2636
             GRLHDR K+ PK  K LT+LFPNKV I +PQDE LL+ WK QLDRD ET+K + N  ++R
Sbjct  778   GRLHDRGKDVPKTTKLLTKLFPNKVTIHMPQDEALLACWKHQLDRDSETLKMKGNLNHLR  837

Query  2637  NVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESI  2816
              VL R  ++C  +E LCIKDQ LTNES EK++GWA+SH+ M + E+   + +L +SSESI
Sbjct  838   TVLTRSGMECDGLEKLCIKDQTLTNESAEKVVGWAVSHYLMSNPEADA-DTRLVLSSESI  896

Query  2817  RYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDT  2996
             +YG+ +LQ +QNE+KS+KKSLKDVVTENEFEK+LLADVIPPSDIGVTFDDIGALENVKDT
Sbjct  897   QYGIGILQAIQNESKSLKKSLKDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDT  956

Query  2997  LKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSI  3176
             LKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSI
Sbjct  957   LKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSI  1016

Query  3177  TSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWD  3356
             TSKWFGEGEKYVKAVF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWD
Sbjct  1017  TSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWD  1076

Query  3357  GLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPN  3536
             GLRTKD ERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR KIL++IL KE+L+P+
Sbjct  1077  GLRTKDTERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILKVILAKEDLSPD  1136

Query  3537  VDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDI  3716
             VDLDA+A+MT+GYSGSDLKNLCVTAAH PIREILEKEKKE+A A +E RP PAL  S+DI
Sbjct  1137  VDLDAVASMTDGYSGSDLKNLCVTAAHRPIREILEKEKKERAAAQAEGRPPPALSGSADI  1196

Query  3717  RPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             RPLN+DDF+YAHE+VCASVSSES NMTEL+QWNELYGEGGSR+KKALSYFM
Sbjct  1197  RPLNIDDFKYAHERVCASVSSESVNMTELIQWNELYGEGGSRRKKALSYFM  1247



>gb|KDO52638.1| hypothetical protein CISIN_1g000823mg [Citrus sinensis]
Length=1267

 Score =  1277 bits (3305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 716/1247 (57%), Positives = 867/1247 (70%), Gaps = 93/1247 (7%)
 Frame = +3

Query  330   DGASALKSPEAPVPEKLP--EAPLGGE----------PLVS---PMILGDSAIDVDKVKA  464
             D +  + +P AP P +    + P+ GE          P VS   P+  G +   ++K ++
Sbjct  47    DNSKEVCTPAAPDPGECGTGDTPIAGEGVSGGKTEATPAVSVTAPIAEGSTPGVMEKPRS  106

Query  465   NGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSK  644
             + S+ +  +K+       T W +LLSQ  QNS+VP+  S FTVG  RQC+  + D ++S 
Sbjct  107   SFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIFTVGSSRQCNFPLKDQAISA  166

Query  645   SLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYI  824
              LC +KH+Q E G+++ ++E  G KG +QVNGK   KN++  L  GDEV+FGS G HAYI
Sbjct  167   VLCKIKHVQSE-GSAVAMVESIGSKG-LQVNGKNLKKNTSCELRSGDEVVFGSLGNHAYI  224

Query  825   FQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkell  1004
             FQ+  NE         +V   E  SGP K +  E RSGDPS VA AS LASLS+L+ +L 
Sbjct  225   FQQLLNE--------VAVKGAEVQSGPGKFLQLERRSGDPSAVAGASILASLSSLRSDLS  276

Query  1005  llPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAIS---P  1175
                    + + I  G E+P  P A  +  + DLD    + + + D       G+I    P
Sbjct  277   RWKSPAQSTSKIHLGSELPT-PSADNDGVEVDLDGLEGNSTANTDSDKAADIGSIGKNIP  335

Query  1176  DSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISR-IIDQR  1352
                N +  +E G +        K +G    LRP +RMLA SS+    LS +I + ++D R
Sbjct  336   VECNQDAGIEAGNV--------KFSGVNDLLRPFLRMLAPSSSCNLKLSKSICKQVLDGR  387

Query  1353  RELLKDFDP--LISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTY  1526
              E  +D  P   + MS R   F++ +   ILD  N++ SFE+FPYYLSE TKNVLIA++Y
Sbjct  388   NEWRRDSQPASTLGMSLRCAVFREDILAGILDGTNLQESFENFPYYLSENTKNVLIAASY  447

Query  1527  IHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG  1706
             IHLK     K  SEL TV PRILLSGPAGSEIYQE LAKALA YFGA+LL+ DS  L GG
Sbjct  448   IHLKHKDHAKYTSELTTVNPRILLSGPAGSEIYQEMLAKALAHYFGAKLLIFDSHSLLGG  507

Query  1707  -SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISS-------  1862
              S+KE + +K+    E++    K+   +  L      A S+   ++     SS       
Sbjct  508   LSSKEAELLKDGTSAEKSCGCVKQGPTSTDL------AKSINLPVSESDTPSSSNPPPQG  561

Query  1863  -HAQTKQEAST-----ASSKN-TFKTGDRVKYVGPLPTG-FSLQTPARGPAYGYKGKVLL  2018
               +Q K E  T      +SKN   + GDRV++VG    G +   +P RGP  G +GKV L
Sbjct  562   PESQPKMETDTTLTSAGTSKNHMLRIGDRVRFVGSTSGGLYPTASPTRGPPCGTRGKVAL  621

Query  2019  AFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELF  2198
              FE+N  SKIGVRFD+ IP+G DLGG CE  HGFFC    LRL+NS  +DLDKL IN LF
Sbjct  622   LFEDNPSSKIGVRFDKPIPDGVDLGGQCEGGHGFFCNVTDLRLENSGTEDLDKLLINTLF  681

Query  2199  EVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKS  2378
             EVV  E +S P ILF+KD EKS+ GN +++S FK +LEKLP+ V+VI S+T TDNRKEKS
Sbjct  682   EVVFSESRSCPFILFMKDAEKSIAGNSDSYSTFKSRLEKLPDKVIVIGSHTHTDNRKEKS  741

Query  2379  HPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDET  2558
             HPGG LFTKFGSNQTALLDLAFPD+FGRLHDR KE PKA K LT+LFPNKV I +PQDE 
Sbjct  742   HPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEIPKATKLLTKLFPNKVTIHMPQDEA  801

Query  2559  LLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGW  2738
             LL+ WK QLDRD ET+K + N  ++R VL R  L+C  +ETLCI+DQ+LTNES EKI+GW
Sbjct  802   LLASWKHQLDRDSETLKMKGNLNHLRTVLGRSGLECEGLETLCIRDQSLTNESAEKIVGW  861

Query  2739  ALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKL  2918
             ALSHH M + E+   + +L +S ESI+YG+ + Q +QNE+KS+KKSLKDVVTENEFEK+L
Sbjct  862   ALSHHLMQNPEAD-PDARLVLSCESIQYGIGIFQAIQNESKSLKKSLKDVVTENEFEKRL  920

Query  2919  LADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPG  3098
             LADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPG
Sbjct  921   LADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPG  980

Query  3099  TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDS  3278
             TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDS
Sbjct  981   TGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDS  1040

Query  3279  MLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRL  3458
             MLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD ER+LVLAATNRPFDLDEAVIRRLPRRL
Sbjct  1041  MLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNRPFDLDEAVIRRLPRRL  1100

Query  3459  MVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLK---------------  3593
             MVNLPDAPNR KIL++IL KE+L+P+VD DAIANMT+GYSGSDLK               
Sbjct  1101  MVNLPDAPNRAKILQVILAKEDLSPDVDFDAIANMTDGYSGSDLKVIFLSHSLICNVLLL  1160

Query  3594  ---------------NLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLN  3728
                            NLCVTAAH PI+EILEKEKKE+A A++E +P PAL   +DIRPLN
Sbjct  1161  NLWSDWLLVYLIVLQNLCVTAAHRPIKEILEKEKKERAAAMAEGKPAPALSGCADIRPLN  1220

Query  3729  MDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             MDDF+YAHE+VCASVSSES NM+ELLQWNELYGEGGSR+KKALSYFM
Sbjct  1221  MDDFKYAHERVCASVSSESVNMSELLQWNELYGEGGSRRKKALSYFM  1267



>ref|XP_008239452.1| PREDICTED: uncharacterized protein LOC103338050 isoform X1 [Prunus 
mume]
Length=1238

 Score =  1277 bits (3304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 698/1177 (59%), Positives = 850/1177 (72%), Gaps = 53/1177 (5%)
 Frame = +3

Query  411   VSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFT  590
             V+P I   S   V+K ++  S+ +  +K+       T W KLLSQ  QN ++ +    FT
Sbjct  91    VTPPIAEGSTPVVEKPRSAFSSWSFYQKQSPSFETSTPWCKLLSQSGQNMNINICTMNFT  150

Query  591   VGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVP  770
             +G  RQC+  + D ++S  LC +K +Q E G ++ +LE +G KG VQVNG    K +   
Sbjct  151   IGANRQCNFSLKDQTISGFLCKIKRVQHE-GGAVAVLESTGSKGSVQVNGTNVKKGNNCV  209

Query  771   LNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPST  950
             LN GDEV+FGS G HAYIFQ    E         +V   E  SG  K ++ E R+GDPS 
Sbjct  210   LNPGDEVVFGSLGNHAYIFQLLLTE--------AAVKSSEVQSGIGKFLHMERRAGDPSA  261

Query  951   VAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSD  1130
             VA AS LASLS   +     P +    + +  G ++PA  V                V D
Sbjct  262   VAGASILASLSLRSELSRWKPAAQTT-SKVHPGADVPAQSV----------------VQD  304

Query  1131  HNDVPLDEKSGAISPDSGND----------NLNLENGAIDSYDGEIGKVTGAPQELRPLI  1280
              N+V LD    + +P+   D          NL L++      +    K++G    LRPL+
Sbjct  305   GNEVELDGLESSSTPNRVADKAEDIGAIDKNLTLDSNHDSGIEAGNVKLSGMNDLLRPLL  364

Query  1281  RMLAGSSTPEFDLSGNISR-IIDQRRELLKDFDPLIS--MSTRRQAFKDGLQQTILDSNN  1451
             RMLA S + +  LS  I + ++++R E  +D     +  MS R   FKDG+   ILD   
Sbjct  365   RMLARSPSCKLKLSKGICKQVLEERNEWTRDSQSASTSGMSLRCAVFKDGIHAGILDGKG  424

Query  1452  IEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQE  1631
             I+VSF++FPYYLSE TKNVLIA+++IHLK  + VK  SEL TV PRILLSGPAGSEIYQE
Sbjct  425   IDVSFDNFPYYLSENTKNVLIAASFIHLKHKEHVKYTSELTTVNPRILLSGPAGSEIYQE  484

Query  1632  TLAKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNK  1808
              LAKALA+YFG++LL+ DS    GG S+KE + +K+    E+    TK++        N 
Sbjct  485   MLAKALAQYFGSKLLIFDSHSFLGGLSSKEAELLKDGFNAEKLCSLTKQSPTPTDAAKNT  544

Query  1809  KPASSVEADITGGSAISSH---AQTKQE-----ASTASSKN-TFKTGDRVKYVGPLPTG-  1958
               AS+ E +    S   S+   ++ K E     +S+ +SKN  FK GDRVK++G      
Sbjct  545   D-ASASETEAPSSSNAPSNGLESEPKMEIDTIPSSSGTSKNFLFKRGDRVKFIGSSSGAL  603

Query  1959  FSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADF  2138
             +S  + +RGPA G +G+V+L FE+N  SK+G+RFD+ IP+G DLGG+C+  +GFFC    
Sbjct  604   YSAASSSRGPASGTRGEVVLLFEDNPLSKVGIRFDKPIPDGVDLGGICK-GNGFFCNVSD  662

Query  2139  LRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKL  2318
             LRL+N+  +DLDKL IN LFE V  E +SSP ILF+KD EKS+VGN ++FS F+ +L+KL
Sbjct  663   LRLENTGAEDLDKLLINTLFEAVLSESRSSPFILFMKDAEKSLVGNSDSFSTFRARLDKL  722

Query  2319  PENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAI  2498
             P+NVVVI S+T TDNRKEKSHPGG LFTKFGSNQTALLDLAFPD+FGRLH+R +E PKA 
Sbjct  723   PDNVVVIGSHTHTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHERGQEDPKAT  782

Query  2499  KQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIE  2678
             K LT+LFPNKV I +PQDE LL  WKQQLDRD ET+K + N   +R VL R  ++C  +E
Sbjct  783   KLLTKLFPNKVTIHMPQDEALLVSWKQQLDRDSETLKMKGNLNFLRTVLGRCGIECEGLE  842

Query  2679  TLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNET  2858
             TLCIKDQ LTNES EK++GWALSHH M + E+  +E K+ +S ESI+YGL +LQ +QNET
Sbjct  843   TLCIKDQTLTNESSEKVVGWALSHHLMQNPEADPQE-KVVLSGESIQYGLEILQAIQNET  901

Query  2859  KSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPEL  3038
             KS+KKSLKDVVTENEFEK+LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPEL
Sbjct  902   KSLKKSLKDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPEL  961

Query  3039  FCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA  3218
             FCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA
Sbjct  962   FCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKA  1021

Query  3219  VFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLA  3398
             VF+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTK+ ERVLVLA
Sbjct  1022  VFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKEAERVLVLA  1081

Query  3399  ATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYS  3578
             ATNRPFDLDEAVIRRLPRRLMVNLPDAPNR KIL++IL KE+L+P++D DAIA+MT+GYS
Sbjct  1082  ATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILKVILAKEDLSPSIDFDAIASMTDGYS  1141

Query  3579  GSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQ  3758
             GSDLKNLCVTAAH PI+EILEKEKKE A+A++E +P PAL  S+DIR LNMDDF+ AHE+
Sbjct  1142  GSDLKNLCVTAAHRPIKEILEKEKKEHAVAVAEGKPAPALSGSADIRSLNMDDFKDAHER  1201

Query  3759  VCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             VCASVSSES NMTELLQWNELYGEGGSR+KKALSYFM
Sbjct  1202  VCASVSSESVNMTELLQWNELYGEGGSRRKKALSYFM  1238



>ref|XP_010663739.1| PREDICTED: uncharacterized protein LOC100266414 isoform X2 [Vitis 
vinifera]
 emb|CBI15650.3| unnamed protein product [Vitis vinifera]
Length=1216

 Score =  1276 bits (3302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/1176 (59%), Positives = 854/1176 (73%), Gaps = 60/1176 (5%)
 Frame = +3

Query  384   EAPLGGEPLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSH  563
             EA L   P+ +P+  G S I VDK +++ S+ +  +K+  ++++   W KLLSQ+ QN +
Sbjct  87    EAALAA-PVSAPIAEGTSPIVVDKPRSSFSSWSVYQKQNYETSM--PWCKLLSQFSQNPN  143

Query  564   VPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGK  743
             V +    FT+G  R C+  + D ++S  LC +KH QRE G+++ +LE SG KG VQVNG 
Sbjct  144   VSIGVINFTIGSSRHCNFPLKDQTISPILCKIKHSQRE-GSAVAVLESSGSKGSVQVNGT  202

Query  744   IYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNF  923
                + ++  LN GDEV+FG  G HAYIFQ+   E ++  +     +  E  S   K ++ 
Sbjct  203   FIKRGTSCVLNSGDEVVFGLLGNHAYIFQQLVTE-VAIKAPSSGATGAEVQSSVGKYLHV  261

Query  924   EARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDL  1103
             E RSGDPS VA AS LASLS+L+++L             +QG E+P  P+          
Sbjct  262   ERRSGDPSAVAGASILASLSSLRQDLSRWKSPPLTTGKTQQGTELPPHPI----------  311

Query  1104  DSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIR  1283
                   + D  +V  +   G  + + G+D              +   +    + L     
Sbjct  312   ------IHDSPEVEFNGLEGNSTANGGSD--------------KAADIAAVSKNLSLDCN  351

Query  1284  MLAGSSTPEFDLSGNISRIIDQRRELLKDFDPLIS--MSTRRQAFKDGLQQTILDSNNIE  1457
               +G+       +GN+   +++R E  +D  P  +  MS R   FK+ +   ILD   I+
Sbjct  352   QDSGAE------AGNV---LEERNEWTRDSLPASTSGMSLRCAVFKEDIHAGILDGKEIQ  402

Query  1458  VSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETL  1637
             VSF+DFPYYLSE TKNVLIA+++IHLK  +  K  SEL TV PRILLSGPAGSEIYQE L
Sbjct  403   VSFDDFPYYLSENTKNVLIAASFIHLKHREHAKFTSELTTVNPRILLSGPAGSEIYQEML  462

Query  1638  AKALAKYFGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKP  1814
             AKALA YFGA+LL+ DS    GG S+KE + +K+    E+    TK+++ +  L  N   
Sbjct  463   AKALANYFGAKLLIFDSHSFLGGLSSKEAELLKDGSNAEKFCSCTKQSSGSTELAKNMA-  521

Query  1815  ASSVEADI--TGGSAISSHAQTKQE-------ASTASSKN-TFKTGDRVKYVGPLPTG-F  1961
             +S+ EAD      + IS   +++ +       +S+ ++KN  F+ GDRV+++G    G +
Sbjct  522   SSAGEADTPNIANAPISCELESQPKLENDTVPSSSGTTKNHLFRIGDRVRFMGSASGGSY  581

Query  1962  SLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFL  2141
             S  + +RGP +G +GKVLL FE+N  SKIGVRFD+ I +G DLGGLCE  +GFFC  + L
Sbjct  582   SAVSASRGPTFGIRGKVLLPFEDNPLSKIGVRFDKLITDGVDLGGLCEPGYGFFCNVNDL  641

Query  2142  RLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLP  2321
             RL+N+ ++DLDKL IN LFE V  E + SP ILF+KD EKS+VGN E++S FK +LEKLP
Sbjct  642   RLENTGVEDLDKLLINTLFEAVYSESRDSPFILFMKDAEKSIVGNSESYSMFKSRLEKLP  701

Query  2322  ENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIK  2501
             +NVV+I S+T TDNRKEKSHPGG LFTKFGSNQTALLDLAFPD+FGRLHDR K+ PK  K
Sbjct  702   DNVVIIGSHTHTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKDVPKTTK  761

Query  2502  QLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIET  2681
              LT+LFPNKV I +PQDE LL+ WK QLDRD ET+K + N  ++R VL R  ++C  +E 
Sbjct  762   LLTKLFPNKVTIHMPQDEALLACWKHQLDRDSETLKMKGNLNHLRTVLTRSGMECDGLEK  821

Query  2682  LCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETK  2861
             LCIKDQ LTNES EK++GWA+SH+ M + E+   + +L +SSESI+YG+ +LQ +QNE+K
Sbjct  822   LCIKDQTLTNESAEKVVGWAVSHYLMSNPEADA-DTRLVLSSESIQYGIGILQAIQNESK  880

Query  2862  SVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELF  3041
             S+KKSLKDVVTENEFEK+LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELF
Sbjct  881   SLKKSLKDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELF  940

Query  3042  CKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAV  3221
             CKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAV
Sbjct  941   CKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAV  1000

Query  3222  FTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAA  3401
             F+LASKIAPSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD ERVLVLAA
Sbjct  1001  FSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERVLVLAA  1060

Query  3402  TNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSG  3581
             TNRPFDLDEAVIRRLPRRLMVNLPDAPNR KIL++IL KE+L+P+VDLDA+A+MT+GYSG
Sbjct  1061  TNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILKVILAKEDLSPDVDLDAVASMTDGYSG  1120

Query  3582  SDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQV  3761
             SDLKNLCVTAAH PIREILEKEKKE+A A +E RP PAL  S+DIRPLN+DDF+YAHE+V
Sbjct  1121  SDLKNLCVTAAHRPIREILEKEKKERAAAQAEGRPPPALSGSADIRPLNIDDFKYAHERV  1180

Query  3762  CASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             CASVSSES NMTEL+QWNELYGEGGSR+KKALSYFM
Sbjct  1181  CASVSSESVNMTELIQWNELYGEGGSRRKKALSYFM  1216



>ref|XP_008677898.1| PREDICTED: uncharacterized protein LOC103652718 isoform X2 [Zea 
mays]
Length=1201

 Score =  1273 bits (3295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 680/1209 (56%), Positives = 874/1209 (72%), Gaps = 81/1209 (7%)
 Frame = +3

Query  351   SPEAPVPEKLPEAPLGGE-PLVSPMILGDSAI------DVDKVKANGSALNRGKKRQLKS  509
             SP A  P +  E  + G  P  S   + D+A        VDK  +  +  ++ +K Q + 
Sbjct  38    SPTASAPGRAEEDSVAGAAPARSAGSVDDAAAVAQKDQGVDKPSSAAAESSKRRKEQEQQ  97

Query  510   NLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNS  689
                  W KLLS+  Q  H P+     +VGQ + C+L + D  VSK LC L+ +  E+G  
Sbjct  98    QPAVPWAKLLSECSQTPHYPISVDQISVGQSKNCNLWLKDQPVSKVLCKLRRL--EQGGP  155

Query  690   ITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMP  869
               L E+ GKKG VQ+NG+     + VPL GGDEVIF S GKH YIF    N+ +    + 
Sbjct  156   CEL-EVIGKKGMVQLNGRSVSPGTKVPLTGGDEVIFSSCGKHTYIFLYPLNDKVPKTVLS  214

Query  870   PSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDND----  1037
              +VS+LEA    VK +  + R+GD S VA  + + + ++ +K++  +PP+   +N     
Sbjct  215   SAVSLLEAPVASVKRIRTDKRTGDTSAVA-GTEMMTSTSNQKDVAAVPPASAGENSQRVV  273

Query  1038  ----------IKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGN  1187
                       +K     P    A+GE + ++++S+++D       P+   +  ISPD+  
Sbjct  274   RPLASSASDKLKGRAVSPEKEFANGE-NANEVNSNIEDS------PMVVAAAPISPDAAA  326

Query  1188  DNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLK  1367
             ++   +NG +   D  +G       +   +IR        E + S N+            
Sbjct  327   NDTCQQNGFVS--DSHLGAEIALEDQRDHIIR--------ELNASTNVP-----------  365

Query  1368  DFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNK  1547
                      +R QAFKDG++Q I++ ++I+V+FE+FPYYLSE TKNVL++S +IHLK  +
Sbjct  366   --------PSRCQAFKDGMKQGIINPSDIDVTFENFPYYLSENTKNVLLSSAFIHLKKKE  417

Query  1548  FVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDP  1727
             F+K   E+ ++  RILLSGPAGSEIYQETL KALAK+F ARLLVVDSL+LPG  +K+ + 
Sbjct  418   FIKQFVEISSINQRILLSGPAGSEIYQETLVKALAKHFSARLLVVDSLLLPGAPSKDPEF  477

Query  1728  VKEAPKPERTG---------VFTK-RAAQAAVLRFNK--KPASSVEADITGGSAISSHAQ  1871
              K+  K +++G         ++ K R++ A  + F +   P SSV ADI G S + S + 
Sbjct  478   QKDVGKADKSGDKAAAEKFAIYQKHRSSLADTVHFRRPAAPTSSVNADIVGTSTLHSASL  537

Query  1872  TKQEASTASSKN-TFKTGDRVKYVGPL-PTGFSLQTPARGPAYGYKGKVLLAFEENGFSK  2045
              KQE+STA+SK+ TF+ GDRV+YVGP  P   S     RGP+YGY+G+V+LAFE+NG SK
Sbjct  538   PKQESSTATSKSYTFREGDRVRYVGPAQPCSLS----QRGPSYGYRGRVMLAFEDNGSSK  593

Query  2046  IGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKS  2225
             IGVRFD+ IP+GNDLGGLCEEDHGFFC+A+ LR D S+ +++++LA+ EL EV+S+E KS
Sbjct  594   IGVRFDKQIPDGNDLGGLCEEDHGFFCSAELLRPDFSAGEEVERLAMTELIEVISEENKS  653

Query  2226  SPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTK  2405
              PLI+ +KD+EKS  G  E+ S+ + KLE LP  V++I S+TQ D+RKEK+HPGGFLFTK
Sbjct  654   GPLIVLLKDVEKSFTGVTESLSSLRSKLESLPPGVLIIGSHTQMDSRKEKAHPGGFLFTK  713

Query  2406  FGSNQTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQ  2582
             F S+   L DL FPD+FG RLH+RSKE+PK +K L +LFPNK++IQ+PQDE LL+DWKQQ
Sbjct  714   FASSSQTLFDL-FPDSFGSRLHERSKESPKTMKHLNKLFPNKILIQLPQDEALLTDWKQQ  772

Query  2583  LDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMH  2762
             LDRD+ET+K++SN  +IR  L+R  ++C D+E L IKDQ+L+NE+V+KI+G+A+S+H   
Sbjct  773   LDRDVETLKAKSNIGSIRMFLSRNGIECNDLEELFIKDQSLSNENVDKIVGYAVSYHLNQ  832

Query  2763  SSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPS  2942
             +   ++K+ KL +++ES+++GL++LQ +QN+ KS KKSLKDVVTENEFEK+LLADVIPP+
Sbjct  833   NKIETSKDAKLVLTTESLKHGLNMLQSMQNDNKSSKKSLKDVVTENEFEKRLLADVIPPN  892

Query  2943  DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAK  3122
             DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAK
Sbjct  893   DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAK  952

Query  3123  AVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESP  3302
             AVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+F+DEVDSMLGRRE+P
Sbjct  953   AVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFIDEVDSMLGRRENP  1012

Query  3303  GEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAP  3482
             GEHEAMRKMKNEFMVNWDGLRTKDKERVLVL ATNRPFDLDEAVIRR PRRLMVNLPDA 
Sbjct  1013  GEHEAMRKMKNEFMVNWDGLRTKDKERVLVLGATNRPFDLDEAVIRRFPRRLMVNLPDAS  1072

Query  3483  NREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkeka  3662
             NREKIL++IL KEEL  +VD+D++ANMT+GYSGSDLKNLCVTAAH PIREILEKEKKEK 
Sbjct  1073  NREKILKVILAKEELGSDVDMDSLANMTDGYSGSDLKNLCVTAAHYPIREILEKEKKEKN  1132

Query  3663  laiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSR  3842
             LA +E RP PAL+ S DIRPL++DDF+ AHEQVCASVSS+S NM ELLQWN+LYGEGGSR
Sbjct  1133  LAKTEGRPEPALYGSEDIRPLSIDDFKSAHEQVCASVSSDSANMNELLQWNDLYGEGGSR  1192

Query  3843  KKKALSYFM  3869
             KKKALSYFM
Sbjct  1193  KKKALSYFM  1201



>ref|XP_006663096.1| PREDICTED: uncharacterized protein LOC102715982 isoform X1 [Oryza 
brachyantha]
Length=1068

 Score =  1273 bits (3294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 664/1079 (62%), Positives = 837/1079 (78%), Gaps = 43/1079 (4%)
 Frame = +3

Query  726   VQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGP  905
             VQ+NG+     + VPL GGDEV+F S GKHAYIFQ   N+ I  A +P  V++LE     
Sbjct  2     VQLNGRPILAGTKVPLKGGDEVVFSSCGKHAYIFQHPLNDKIPKAVLPSPVTLLEPPVAG  61

Query  906   VKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGE  1085
             VK +  E R+G+ S VA    LAS+S+  K+L   PP+   +N+     +    P+AS  
Sbjct  62    VKRLRMENRTGETSAVAGTELLASVSDQLKDLPAAPPTSAGENN-----QRLVRPMASSA  116

Query  1086  PDKHDLDSDMKDVSDHN------------DVPLDEKSGAI-SPDSGNDNLNLENG-AIDS  1223
              DK   D  + D    N            D PLD  +  I SPD+  ++++  NG   D+
Sbjct  117   SDKSKGDGIIPDKECENGETANEVNSNIEDSPLDVAAAPIVSPDAVPNDISQHNGFGSDA  176

Query  1224  YDG-EIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKDFDPLISMS-T  1397
             + G EIGK+  A  ++RP++RM+AG++  EFDL+ ++ + ++ +R+L++D +   S+  +
Sbjct  177   HLGAEIGKI--ATYKIRPVLRMIAGTTISEFDLTSDLFKALEDQRDLIRDLNSSASLPPS  234

Query  1398  RRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPT  1577
             R QAFKDG++Q I+   +I V+FE+FPYYLSE TKNVL++  +IHL+  +F+K  SE+ +
Sbjct  235   RCQAFKDGMKQGIISPKDIVVTFENFPYYLSENTKNVLLSCAFIHLEKKEFIKQFSEISS  294

Query  1578  VCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERT  1757
             +  RILLSGPAGSEIYQETL KALAK+FGARLLVVDSL+LPG  +K+ +  KE  K +++
Sbjct  295   INQRILLSGPAGSEIYQETLIKALAKHFGARLLVVDSLLLPGAPSKDPESQKEISKSDKS  354

Query  1758  G----------VFTKRAAQAAVLRFNK--KPASSVEADITGGSAISSHAQTKQEASTASS  1901
             G          +   R++ A  + F +   P SSV ADI G SA+ S +  KQE+STA+S
Sbjct  355   GDKSGGEKLAILHKHRSSLADTIHFRRPAAPTSSVNADIVGTSALHSASLPKQESSTATS  414

Query  1902  KN-TFKTGDRVKYVGPL-PTGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIP  2075
             K+ TF+ GDRV+YVGP  P+  S     RGP YGY+G+V+LAFEENG SKIGVRFD+ IP
Sbjct  415   KSYTFREGDRVRYVGPAQPSSLS----QRGPNYGYRGRVMLAFEENGSSKIGVRFDKQIP  470

Query  2076  EGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDI  2255
             +GNDLGGLCEEDHGFFC+A+ LR D S  +++++LA+ EL EV+S+E K+ P+I+ +KD+
Sbjct  471   DGNDLGGLCEEDHGFFCSAELLRPDFSGGEEVERLAMTELIEVISEEHKAGPMIVLLKDV  530

Query  2256  EKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLD  2435
             EKS  G  E+ S+ + KLE LP  V++I S+TQ D+RKEK+HPGGFLFTKF S+   L D
Sbjct  531   EKSFTGITESLSSLRNKLESLPSGVLIIGSHTQMDSRKEKAHPGGFLFTKFASSSQTLFD  590

Query  2436  LAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKS  2612
             L FPD+FG RLH+R+KE+PKA+K L +LFPNK+ IQ+PQ+ETLL+DWKQQLDRD+ET+K+
Sbjct  591   L-FPDSFGSRLHERNKESPKAMKHLNKLFPNKISIQLPQEETLLTDWKQQLDRDVETLKA  649

Query  2613  QSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGK  2792
             +SN  +IR  LNR  ++C D+E L IKDQ+LTNE+V+KI+G+A+S+H  H+    +K+GK
Sbjct  650   KSNVGSIRMFLNRNGIECSDLEELFIKDQSLTNENVDKIVGYAVSYHLKHNKIEISKDGK  709

Query  2793  LAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIG  2972
             L ++SES+++GL +LQ +Q++ KS KKSLKDVVTENEFEK+LL+DVIPP+DIGVTFDDIG
Sbjct  710   LVLTSESLKHGLDMLQSMQSDNKSSKKSLKDVVTENEFEKRLLSDVIPPNDIGVTFDDIG  769

Query  2973  ALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANF  3152
             ALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANF
Sbjct  770   ALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANF  829

Query  3153  INISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMK  3332
             INISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+F+DEVDSMLGRRE+PGEHEAMRKMK
Sbjct  830   INISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFIDEVDSMLGRRENPGEHEAMRKMK  889

Query  3333  NEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIIL  3512
             NEFMVNWDGLRTKDKERVLVL ATNRPFDLDEAVIRR PRRLMVNLPDA NREKIL++IL
Sbjct  890   NEFMVNWDGLRTKDKERVLVLGATNRPFDLDEAVIRRFPRRLMVNLPDASNREKILKVIL  949

Query  3513  TKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLP  3692
              KEELAP +D+D++A MT+GYSGSDLKNLCVTAAH PIREILEKEKKEK +A +E RP P
Sbjct  950   AKEELAPGIDMDSLATMTDGYSGSDLKNLCVTAAHYPIREILEKEKKEKNVAKAEGRPDP  1009

Query  3693  ALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             AL+ S DIRPL +DDF+ AHEQVCASVSS+S NM+ELLQWN+LYGEGGSRKKKALSYFM
Sbjct  1010  ALYGSEDIRPLTLDDFKSAHEQVCASVSSDSANMSELLQWNDLYGEGGSRKKKALSYFM  1068



>ref|XP_002451231.1| hypothetical protein SORBIDRAFT_05g026170 [Sorghum bicolor]
 gb|EES10219.1| hypothetical protein SORBIDRAFT_05g026170 [Sorghum bicolor]
Length=1205

 Score =  1270 bits (3286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 678/1147 (59%), Positives = 862/1147 (75%), Gaps = 77/1147 (7%)
 Frame = +3

Query  525   WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLE  704
             W KLLSQ  Q  H P+  + F+VGQ + C+L + D  VSK LC ++ +  E+G     LE
Sbjct  104   WAKLLSQCSQTPHHPISVAQFSVGQSKSCNLWLKDQPVSKVLCKVRRL--EQGGPCE-LE  160

Query  705   ISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSI  884
             + GKKG VQ                              IFQ   NE +       +VS+
Sbjct  161   VLGKKGMVQ------------------------------IFQHPLNEKVPKTVPSSAVSL  190

Query  885   LEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPA  1064
             LE     VK +  + R+GD S VA    LAS SN  K++  +PP+   +N  + G     
Sbjct  191   LEPPVASVKRIRTDKRTGDTSAVAGTEMLASTSNQTKDVAAVPPAAAGENSQRVG-----  245

Query  1065  LPVASGEPDKH-----DLDSDMKDVSDHNDV-------PLDEKSGAISPDSGNDNLNLEN  1208
              PVAS   DK        + + ++  + N+V       P+D  +  ISPD   ++   +N
Sbjct  246   RPVASSASDKSKGRAVSPEKEFENGENANEVNSNIEDSPMDVAAAPISPDDATNDTCQQN  305

Query  1209  G-AIDSYDG-EIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKDFDPL  1382
             G   D++ G EIGK+  A  ++RP++RM+ GS+  EFDL+G++ + ++ +R+L++D +  
Sbjct  306   GFGPDTHLGAEIGKI--ATYKIRPVLRMITGSTISEFDLTGDLFKALEDQRDLIRDLNAS  363

Query  1383  ISM-STRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKC  1559
              S+  +R QAFKDG++Q I++ ++I+V+FE+FPYYLSE TKNVL++  +IHL+  +F+K 
Sbjct  364   TSVPPSRCQAFKDGMKQGIINPSDIDVTFENFPYYLSENTKNVLLSCAFIHLEKKEFIKQ  423

Query  1560  ASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEA  1739
              +E+ ++  RILLSGPAGSEIYQETL KALAK+FGARLLVVDSL+LPG  +K+ +  K+ 
Sbjct  424   FAEISSINQRILLSGPAGSEIYQETLVKALAKHFGARLLVVDSLLLPGAPSKDPESQKDV  483

Query  1740  PKPERTG---------VFTK-RAAQAAVLRFNK--KPASSVEADITGGSAISSHAQTKQE  1883
              K +++G         ++ K R++ A  + F +   P SSV ADI G S + S +  KQE
Sbjct  484   GKVDKSGDKTTAEKFAIYQKHRSSLADTVHFRRPAAPTSSVNADIVGTSTLHSASLPKQE  543

Query  1884  ASTASSKN-TFKTGDRVKYVGPL-PTGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVR  2057
             +STA+SK+ TF+ GDRV+YVGP  PT      P RGP+YGY+G+V+LAFE+NG SKIGVR
Sbjct  544   SSTATSKSYTFREGDRVRYVGPAQPTTL----PQRGPSYGYRGRVMLAFEDNGSSKIGVR  599

Query  2058  FDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLI  2237
             FD+ IP+GNDLGGLCEEDHGFFC+A+ LR D S+ +++++LA+ EL EV+S+E KS PLI
Sbjct  600   FDKQIPDGNDLGGLCEEDHGFFCSAELLRPDFSAGEEVERLAMTELIEVISEENKSGPLI  659

Query  2238  LFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSN  2417
             + +KD+EKS  G  E+ S+ + KLE LP  V+VI S+TQ D+RKEK+HPGGFLFTKF S+
Sbjct  660   VLLKDVEKSFTGVTESLSSLRSKLESLPSGVLVIGSHTQMDSRKEKAHPGGFLFTKFASS  719

Query  2418  QTALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRD  2594
                L DL FPD+FG RLH+RSKE+PKA+K L +LFPNK+ IQ+PQDE LL+DWKQQLDRD
Sbjct  720   SQTLFDL-FPDSFGSRLHERSKESPKAMKHLNKLFPNKISIQLPQDEALLTDWKQQLDRD  778

Query  2595  IETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHS--S  2768
             +ET+K++SN  +IR  L+R  ++C D+E L IKDQ+L+NE+V+KI+G+A+S+H  H+   
Sbjct  779   VETLKAKSNIGSIRTFLSRNGIECNDLEKLFIKDQSLSNENVDKIVGYAVSYHLKHNKIE  838

Query  2769  ESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDI  2948
              S++K+ KL ++SES+++GL++LQ +Q++ KS KKSLKDVVTENEFEK+LLADVIPP+DI
Sbjct  839   TSNSKDAKLVLASESLKHGLNMLQSMQSDNKSSKKSLKDVVTENEFEKRLLADVIPPNDI  898

Query  2949  GVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAV  3128
             GVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAV
Sbjct  899   GVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAV  958

Query  3129  ATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGE  3308
             ATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+F+DEVDSMLGRRE+PGE
Sbjct  959   ATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFIDEVDSMLGRRENPGE  1018

Query  3309  HEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNR  3488
             HEAMRKMKNEFMVNWDGLRTKDKERVLVL ATNRPFDLDEAVIRR PRRLMVNLPDA NR
Sbjct  1019  HEAMRKMKNEFMVNWDGLRTKDKERVLVLGATNRPFDLDEAVIRRFPRRLMVNLPDASNR  1078

Query  3489  EKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekala  3668
             EKIL++IL KEEL  +VDLD++ANMT+GYSGSDLKNLCVTAAH PIREILEKEKKEK LA
Sbjct  1079  EKILKVILAKEELGSDVDLDSLANMTDGYSGSDLKNLCVTAAHYPIREILEKEKKEKNLA  1138

Query  3669  iSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKK  3848
              +E RP PAL+ S DIRPL++DDF+ AHEQVCASVSS+S NM ELLQWN+LYGEGGSRKK
Sbjct  1139  KTEGRPEPALYGSEDIRPLSIDDFKSAHEQVCASVSSDSANMNELLQWNDLYGEGGSRKK  1198

Query  3849  KALSYFM  3869
             KALSYFM
Sbjct  1199  KALSYFM  1205



>ref|XP_011044170.1| PREDICTED: uncharacterized protein LOC105139438 isoform X2 [Populus 
euphratica]
Length=1225

 Score =  1266 bits (3276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/1173 (59%), Positives = 843/1173 (72%), Gaps = 77/1173 (7%)
 Frame = +3

Query  408   LVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTF  587
             +V+P+  G + + ++K +++ S  N  +K+   S+  T W KLL+Q  QN ++ +  S++
Sbjct  111   VVTPIAEGSTPVVLEKPRSSLSTWNLYQKQN--SSFETPWCKLLTQSAQNQNIVICTSSY  168

Query  588   TVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTV  767
             ++G  +QCD  + D ++    C ++H QRE G+++  LE SG KG VQVNG    K +  
Sbjct  169   SIGTTKQCDFILKDHAMGGIQCKIRHTQRE-GSAVAELESSGSKGSVQVNGTAVKKGAIY  227

Query  768   PLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPS  947
              LN GDEV+FG+ G HAYIFQ+   E         +V   E HS   K +  E RSGDPS
Sbjct  228   VLNSGDEVVFGAVGNHAYIFQQLLTE--------VAVKSAEVHSSLGKLLQLERRSGDPS  279

Query  948   TVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVS  1127
              VA AS LASLS+L+ +L          + +  G E+PA  V  G  +            
Sbjct  280   AVAGASILASLSSLRPDLSRWKSPGQTASKMHHGTEVPAQSVVHGGAE------------  327

Query  1128  DHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTP  1307
                 V LD   G  +P+ G+D    E GAI+             Q L       +G+   
Sbjct  328   ----VELDGMEGNSTPNLGSDKA-AEVGAIN-------------QNLPHDCSQDSGTE--  367

Query  1308  EFDLSGNISRIIDQRRELLKD--FDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPY  1481
                 +GN+   +++R E LKD        MS R   FK+ L   IL+  NIEVSF++FPY
Sbjct  368   ----AGNV---LEERNEWLKDSQLASTSGMSLRCAVFKEDLHAGILNGKNIEVSFDNFPY  420

Query  1482  YLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYF  1661
             YLSE TKNVLIA+++IHL   K+ K  SEL TV PRILLSGPAGSEIYQE LAKALA YF
Sbjct  421   YLSENTKNVLIAASFIHLMHKKYAKYTSELTTVNPRILLSGPAGSEIYQEMLAKALANYF  480

Query  1662  GARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADI  1838
             GA+LLV DS    GG S+KE + +K+    E++   +K+      +     P+ SV  +I
Sbjct  481   GAKLLVFDSHSFLGGLSSKEAELLKDGTNAEKSCTCSKQ------VPVTTDPSKSV--NI  532

Query  1839  TGG---SAISSHAQTKQE------------ASTASSKNTFKTGDRVKYVGPLPTG-FSLQ  1970
             + G   +  SS+A   QE               A+    FK GDRVK+     +  +   
Sbjct  533   SAGETDTPNSSNAPASQELFEMEDTLPSSSGPGAARNRLFKIGDRVKFTSSSSSVLYQTA  592

Query  1971  TPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLD  2150
             +P+RGP YG +GKV+L FE+N  SKIGVRFD+ IP+G DLG +CE+ HG+FC    LRL+
Sbjct  593   SPSRGPPYGIRGKVVLPFEDNPLSKIGVRFDKPIPDGVDLGDVCEKGHGYFCNVTDLRLE  652

Query  2151  NSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENV  2330
             N++++DLDKL IN LFE V  E ++SP IL++KD EKS+VGN +++S FK +LEKLP+NV
Sbjct  653   NTAVEDLDKLLINTLFEAVHSESRNSPFILYMKDAEKSIVGNSDSYSTFKSRLEKLPDNV  712

Query  2331  VVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLT  2510
             VVI S+TQ DNRKEKSHPGG LFTKFGSNQTALLDLAFPD+FGRL +R KE PKA K LT
Sbjct  713   VVIGSHTQNDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLGERGKEVPKATKLLT  772

Query  2511  RLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCI  2690
             +LFPNKV I +PQDETLL+ WK QLD+D ET+K + N  N+R VL R  ++C  +ETLCI
Sbjct  773   KLFPNKVAIHMPQDETLLASWKHQLDQDAETLKMKGNLNNLRTVLGRCGMECEGLETLCI  832

Query  2691  KDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVK  2870
             KDQ +TNES EK++GWALSHH M +S ++  + KL +SSESI+YG+ +LQ +QNE+KS+K
Sbjct  833   KDQTITNESAEKVVGWALSHHLMQNSANADADVKLVLSSESIQYGIGILQAIQNESKSLK  892

Query  2871  KSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKG  3050
             KSLKDV+TENEFEK+LLADVIPP+DIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKG
Sbjct  893   KSLKDVMTENEFEKRLLADVIPPNDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKG  952

Query  3051  QLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTL  3230
             QLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+L
Sbjct  953   QLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSL  1012

Query  3231  ASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNR  3410
             ASKI+PSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD ERVLVLAATNR
Sbjct  1013  ASKISPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERVLVLAATNR  1072

Query  3411  PFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDL  3590
             PFDLDEAVIRRLPRRLMVNLPDAPNR KIL++IL KE+L+P++D DAIA+MT+GYSGSDL
Sbjct  1073  PFDLDEAVIRRLPRRLMVNLPDAPNRAKILKVILAKEDLSPDIDFDAIASMTDGYSGSDL  1132

Query  3591  KNLCVTAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCAS  3770
             KNLCV AAH PI+EILEKEKKE+A A++E +P PAL  S+DIRPLNM DF+ AHEQVCAS
Sbjct  1133  KNLCVAAAHRPIKEILEKEKKEQAAALAEGKPAPALSGSADIRPLNMVDFKDAHEQVCAS  1192

Query  3771  VSSESTNMTELLQWNELYGEGGSRKKKALSYFM  3869
             VSSES NMTELLQWNELYGEGGSR+KKALSYFM
Sbjct  1193  VSSESVNMTELLQWNELYGEGGSRRKKALSYFM  1225



>ref|XP_009118737.1| PREDICTED: uncharacterized protein LOC103843724 [Brassica rapa]
Length=1152

 Score =  1266 bits (3275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 683/1099 (62%), Positives = 819/1099 (75%), Gaps = 56/1099 (5%)
 Frame = +3

Query  525   WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGN-SITLL  701
             W KLLSQYPQN H  +  + FTVG+ R CDL + D S+   LC L   Q E G  S+  L
Sbjct  90    WAKLLSQYPQNPHCVMRGAVFTVGR-RGCDLSIKDQSIPSVLCELS--QSEHGGPSVASL  146

Query  702   EISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPP---  872
             EI G    VQVNGKI+ + + V L GGDEV+F + GKHAYI Q   +E+++    PP   
Sbjct  147   EIVGNGVLVQVNGKIHQRRACVHLRGGDEVVFSTLGKHAYIIQSLKDENLA----PPRDR  202

Query  873   --SVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCNDNDIKQ  1046
               S SI    S P+KG++ E R+   S ++        +  +  +  LPP+  N    +Q
Sbjct  203   ASSFSIFGEQSAPLKGLHVETRAAGES-LSDEKASVLAALKQLHVPSLPPTAENVKS-QQ  260

Query  1047  GPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSY  1226
                 P LP +         D  + DV   ND      + A +  + ND+ N +   +D +
Sbjct  261   NSRAPVLPSSC--------DDCIPDVDSDND------AVASASFAANDDQNADANEMDPF  306

Query  1227  -DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRI-IDQRRE---LLKDFDPL-IS  1388
              + E G + G       L+R        +FD  G+IS++ +D RRE   + K++D    S
Sbjct  307   QEAEEGSIFG-------LLR-----DPSKFDSRGSISKLPVDDRREVKEMPKEYDSSSAS  354

Query  1389  MSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKC-NKFVKCAS  1565
             +STRRQA KD L+  +L+   IEVSFE+FPYYLS  TK+VLI STY+H+ C +KF K AS
Sbjct  355   VSTRRQAHKDCLRTGVLNPQEIEVSFENFPYYLSGTTKDVLITSTYVHMNCGSKFAKYAS  414

Query  1566  ELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGS-AKELDPVKEAP  1742
             +L TVCPR+LLSGPAGSEIYQE LAKALAK FGA+L++VD+L+LPGGS AKE D   E+ 
Sbjct  415   DLSTVCPRMLLSGPAGSEIYQEMLAKALAKKFGAKLMIVDTLLLPGGSTAKEADSTIESS  474

Query  1743  KPERTGVFTKRAAQAA---VLRFNKKPASSVEADITGGSAISSHAQTKQEASTASSKN-T  1910
             + ER  V  KRA QAA   VL+ +KKP SSV ADITGGS +SS    +QE STASSK+ T
Sbjct  475   RRERFSVLAKRAVQAAHVTVLK-HKKPTSSVVADITGGSTLSSQPVLRQEVSTASSKSYT  533

Query  1911  FKTGDRVKYVGPLPTGF-SLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGND  2087
             FKTGDRVK+VG   +   S  +P RGP  G+ GKV+LAFE+N  SKIGVRFD+ I +GND
Sbjct  534   FKTGDRVKFVGSSISSLPSFHSPLRGPVLGFHGKVVLAFEDNASSKIGVRFDKPIADGND  593

Query  2088  LGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILFVKDIEKSM  2267
             LGGLCE D GFFCAA  LRLD+ S DD+DKLAINE+FEV S E ++  LILF+KDI KS+
Sbjct  594   LGGLCERDRGFFCAASSLRLDSYSSDDVDKLAINEIFEVASNESENGSLILFLKDIGKSV  653

Query  2268  VGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFP  2447
              G  + ++  K KLE LPE +VVIAS TQ DNRKEKSHPGGFLFTKFGSNQTALLDLAFP
Sbjct  654   SGRIDVYATLKSKLESLPEKIVVIASQTQLDNRKEKSHPGGFLFTKFGSNQTALLDLAFP  713

Query  2448  DNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIETMKSQSNA  2624
             +NFG RL DR+KE  K++KQ+T+LFPNKV IQ+P+DE  L DWK++L+RD E +K+Q+N 
Sbjct  714   ENFGGRLQDRNKEMSKSVKQITKLFPNKVTIQLPEDEAFLLDWKEKLERDAEILKAQANI  773

Query  2625  VNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHSSESSTKEGKLAIS  2804
               IR VL++  L+CP IETLCI DQ+L  +SVEK++GWA S+H M  SE + ++ KL IS
Sbjct  774   AIIRAVLSKNRLECPAIETLCINDQSLLLDSVEKVVGWAFSYHLMSCSEPTIRDNKLIIS  833

Query  2805  SESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGVTFDDIGALEN  2984
              ESI YGL VL G+QNE KS KKSLKDVVTENEFEKKLL+DVIPPSDIGV+FDDIGALEN
Sbjct  834   VESITYGLQVLHGIQNENKSTKKSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALEN  893

Query  2985  VKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINIS  3164
             VKDTLKELVMLPLQRPELF KGQLTKP KGILLFGPPGTGKT+L+KAVATEAGANFINIS
Sbjct  894   VKDTLKELVMLPLQRPELFGKGQLTKPTKGILLFGPPGTGKTLLSKAVATEAGANFINIS  953

Query  3165  MSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFM  3344
             MSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGRRE+PGEHEAMRKMKNEFM
Sbjct  954   MSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFM  1013

Query  3345  VNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREKILRIILTKEE  3524
             +NWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPD+ NR KIL +IL KEE
Sbjct  1014  INWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDSANRSKILSVILAKEE  1073

Query  3525  LAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiSENRPLPALHN  3704
             +A +VD++AIANMT+GYSGSDLKNLCVTAAH PIREILEKEKKE+++A +ENRP P L+N
Sbjct  1074  MAEDVDIEAIANMTDGYSGSDLKNLCVTAAHLPIREILEKEKKERSVAQAENRPTPLLYN  1133

Query  3705  SSDIRPLNMDDFRYAHEQV  3761
             S DIRPLNM+DF+ AHEQV
Sbjct  1134  SKDIRPLNMNDFKTAHEQV  1152



>ref|XP_007037954.1| ATPase family AAA domain-containing protein 1-A isoform 1 [Theobroma 
cacao]
 gb|EOY22455.1| ATPase family AAA domain-containing protein 1-A isoform 1 [Theobroma 
cacao]
Length=1201

 Score =  1265 bits (3274),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 685/1168 (59%), Positives = 835/1168 (71%), Gaps = 64/1168 (5%)
 Frame = +3

Query  405   PLVSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQST  584
             P+ +P+  G + I +DK +++ S  +  +K+       T W +LLSQ+ QN +VP+  S 
Sbjct  85    PVTAPIADGSAPIVLDKGRSSFSTWSICQKQNPNFETSTPWCRLLSQFAQNPNVPICTSN  144

Query  585   FTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNST  764
             FT+G  + C+  + D ++S  LC +KH Q+E G+++ +LE +G KG VQVNG +  KN++
Sbjct  145   FTIGSSKHCNFQLKDQAISAMLCKIKHTQQE-GSAVAMLESTGSKGSVQVNGTVVKKNTS  203

Query  765   VPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDP  944
               LN GDEV+FGS G HAYIFQ+   E         +V   E  +   K +  E RSGD 
Sbjct  204   CALNSGDEVVFGSMGNHAYIFQQLMTE--------VAVKGAEVQNTVGKFLQLERRSGDT  255

Query  945   STVAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDV  1124
             S V  A+ LASLS+L+ +L          + I Q  E+P   V                V
Sbjct  256   SAVTGATILASLSSLRPDLSRWKSPSQASSKIHQVAEVPTHSV----------------V  299

Query  1125  SDHNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSST  1304
              D  DV LD   G  + + G+D                    GA  +  PL         
Sbjct  300   HDAADVDLDGLEGNSTANIGSDK---------------AAEVGALNKNLPL--------D  336

Query  1305  PEFDLSGNISRIIDQRRELLKDFDP--LISMSTRRQAFKDGLQQTILDSNNIEVSFEDFP  1478
                D S     ++D+R E  +D  P    SMS R   FK+ +   ILD  N+EVSF++FP
Sbjct  337   CNHDSSIEAGNVLDERNEWARDSQPASTSSMSLRCAVFKEDIHAGILDGRNLEVSFDNFP  396

Query  1479  YYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKY  1658
             YYLSE TKNVLIA+++IHLK  +  K  SEL TV PRILLSGPAGSEIYQE L KALA Y
Sbjct  397   YYLSENTKNVLIAASFIHLKHKEHAKYTSELTTVNPRILLSGPAGSEIYQEMLTKALANY  456

Query  1659  FGARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEAD  1835
             FG +LL+ DS    GG S+KE + +K+    E++   TK++     L  +  P  +VEA+
Sbjct  457   FGTKLLIFDSHSFLGGLSSKEAELLKDGVNAEKSCTCTKQSPGPTDLAKSLTP--TVEAE  514

Query  1836  ITGGSAISS---HAQTKQEA-----STASSKN-TFKTGDRVKYVGPLPTG-FSLQTPARG  1985
              +   A  S    +Q K EA     S+ SSKN  FK GDRVK++     G +S  +  RG
Sbjct  515   TSSPVAAPSCGPESQPKTEADTMPSSSGSSKNQMFKIGDRVKFMNSTSGGLYSAVSSPRG  574

Query  1986  PAYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSID  2165
             P  G +GKV+L FE+N FSKIGVRFD+ +P+G DLG +CE  HGFFC    LRL+NSS +
Sbjct  575   PPNGVRGKVVLLFEDNPFSKIGVRFDKPVPDGVDLGNICEGGHGFFCNVSDLRLENSSTE  634

Query  2166  DLDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIAS  2345
             DLD+L IN LFE V  E ++SP ILF+KD EKS+ GN ++++ FK +LEKLP+NV+VI S
Sbjct  635   DLDRLLINTLFEAVYSESRTSPFILFMKDAEKSLAGNTDSYTTFKCRLEKLPDNVIVIGS  694

Query  2346  YTQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPN  2525
             +T TDNRKEKSHPGG LFTKFG +QTALLDLAFPD+FGRLHDR KE PKA K LT+LFPN
Sbjct  695   HTHTDNRKEKSHPGGLLFTKFGGSQTALLDLAFPDSFGRLHDRGKEVPKATKLLTKLFPN  754

Query  2526  KVMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQAL  2705
             KV I +PQDE LL+ WK QLD D ET+K + N   ++ +L+R  ++C  +ETLCIKDQ+L
Sbjct  755   KVTIHMPQDEALLASWKHQLDCDAETLKMKGNLNLLQTILSRSGMECEGLETLCIKDQSL  814

Query  2706  TNESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKD  2885
             +NES EK++GWALSHH M + E+   + +L +S ESI+YG+ +LQ +QNE+KS+KKSLKD
Sbjct  815   SNESAEKVVGWALSHHLMQNPEADA-DSRLVLSCESIQYGIGILQAIQNESKSLKKSLKD  873

Query  2886  VVTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKP  3065
             VVTENEFEK+LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKP
Sbjct  874   VVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKP  933

Query  3066  CKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIA  3245
             CKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIA
Sbjct  934   CKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIA  993

Query  3246  PSVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLD  3425
             PSVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD ERVLVLAATNRPFDLD
Sbjct  994   PSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERVLVLAATNRPFDLD  1053

Query  3426  EAVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCV  3605
             EAVIRRLPRRLMVNLPDA NR KIL++IL KE+L+P VD DA+A+MT+GYSGSDLKNLCV
Sbjct  1054  EAVIRRLPRRLMVNLPDAANRAKILKVILAKEDLSPEVDFDAVASMTDGYSGSDLKNLCV  1113

Query  3606  TAAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSES  3785
             TAAH PI+EILEKEKKE+A A++E +P P L  S+DIRPLNM+DF+YAHE+VCASVSSES
Sbjct  1114  TAAHRPIKEILEKEKKERAAALAEGKPPPPLSGSADIRPLNMEDFKYAHERVCASVSSES  1173

Query  3786  TNMTELLQWNELYGEGGSRKKKALSYFM  3869
              NMTELLQWNELYGEGGSR+KKALSYFM
Sbjct  1174  VNMTELLQWNELYGEGGSRRKKALSYFM  1201



>ref|XP_004979902.1| PREDICTED: uncharacterized protein LOC101767955 isoform X2 [Setaria 
italica]
Length=1243

 Score =  1264 bits (3272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 675/1145 (59%), Positives = 842/1145 (74%), Gaps = 67/1145 (6%)
 Frame = +3

Query  525   WGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLE  704
             W KLLSQ  Q  H P+    F+VGQ + C+L + D  VSK LC L+ +  E+G    L E
Sbjct  136   WAKLLSQCSQTPHHPISAPQFSVGQSKSCNLWLKDIPVSKMLCKLRRL--EQGGQCEL-E  192

Query  705   ISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSI  884
             + GKKG VQ+NG+     + VPL GGDEVIF S  +HAYIFQ   N+ +       +VS+
Sbjct  193   VVGKKGVVQLNGRPISPGTKVPLTGGDEVIFSSCRRHAYIFQHPLNDKVPKTVPSSAVSL  252

Query  885   LEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkellllPPSVCND-NDIKQGPEMP  1061
             LE      K +  + R+GD  T AVA T                S CN   DI   P   
Sbjct  253   LEPPVASAKRIRTDKRAGD--TSAVAGTEMLA------------SACNQPKDIAAAP---  295

Query  1062  ALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPD---SGNDNLNLENGAIDSYDG  1232
               P ++GE  +  +       SD +      K  AISPD      +N N  N  I+    
Sbjct  296   --PASAGENSQRVVRPMASSASDKS------KGHAISPDKEFENGENANEVNSNIEDSSM  347

Query  1233  EIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELLKDFDPLISMSTRRQAF  1412
             ++     +P +         G   P+  L   I+  ++ +R++++D    +  S R QAF
Sbjct  348   DVAAAPVSPDDAAHDNCQQNGF-VPDAHLGAEIA--LEDQRDIIRDLSASVPPS-RCQAF  403

Query  1413  KDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRI  1592
             KDG++Q I+  ++I+V+FE FPYYLSE TKNVL++  +IHL+  +F+K  +E+ ++  RI
Sbjct  404   KDGMKQGIISPSDIDVTFETFPYYLSENTKNVLLSCAFIHLEKKEFIKQFAEISSINQRI  463

Query  1593  LLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGGSAKELDPVKEAPKPERTG----  1760
             LLSGPAGSEIYQETL KALAK+FGARLLVVDSLVLPG  +K+ +  K+  K +++G    
Sbjct  464   LLSGPAGSEIYQETLIKALAKHFGARLLVVDSLVLPGAPSKDPESQKDVGKSDKSGDKAG  523

Query  1761  -----VFTK----------RAAQAAVLRFNK--KPASSVEADITGGSAISSHAQTKQEAS  1889
                  +F K          R++ A  + F +   P SSV ADI G S + S +  KQE+S
Sbjct  524   GDKFAIFQKLDRDYFHQKHRSSLADAVHFRRPAAPTSSVNADIVGTSTLHSASLPKQESS  583

Query  1890  TASSKN-TFKTGDRVKYVGPL-PTGFSLQTPARGPAYGYKGKVLLAFEENGFSKIGVRFD  2063
             TA+SK+ TF+ GDRV+YVGP  P   S     RGP+YGY+G+V+LAFE+NG SKIGVRFD
Sbjct  584   TATSKSYTFREGDRVRYVGPAQPPSLS----QRGPSYGYRGRVMLAFEDNGSSKIGVRFD  639

Query  2064  RSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVSQECKSSPLILF  2243
             + IP+GNDLGGLCEEDHGFFC+A+ LR D S+ +++++LA+ EL EV+S+E KS PLI+ 
Sbjct  640   KQIPDGNDLGGLCEEDHGFFCSAELLRPDFSTGEEVERLAMAELIEVISEENKSGPLIVL  699

Query  2244  VKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGGFLFTKFGSNQT  2423
             +KD+EKS  G  E+ S+ + KLE LP  V++I S+TQ D+RKEK+HPGGFLFTKF S+  
Sbjct  700   LKDVEKSFTGITESLSSLRSKLESLPSGVLIIGSHTQMDSRKEKAHPGGFLFTKFASSSQ  759

Query  2424  ALLDLAFPDNFG-RLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSDWKQQLDRDIE  2600
              L DL FPD+FG RLH+R+KE+PKA+K L +LFPNK+ IQ+PQDE LL+DWKQQLDRD+E
Sbjct  760   TLFDL-FPDSFGNRLHERNKESPKAMKHLNKLFPNKISIQLPQDEALLTDWKQQLDRDVE  818

Query  2601  TMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSHHFMHS--SES  2774
             T+K++SN  +IR  L+R  ++C ++E L IKDQ+L+NE+V+KI+G+A+S+H  H+    S
Sbjct  819   TLKAKSNVGSIRAFLSRNGIECNELEELFIKDQSLSNENVDKIVGYAVSYHLKHNKVETS  878

Query  2775  STKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADVIPPSDIGV  2954
             ++K+ KL ++SES+++GL++LQ VQ++ KS KKSLKDVVTENEFEK+LL DVIPP+DIGV
Sbjct  879   NSKDAKLVLTSESLKHGLNMLQSVQSDNKSSKKSLKDVVTENEFEKRLLTDVIPPNDIGV  938

Query  2955  TFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVAT  3134
             TFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVAT
Sbjct  939   TFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVAT  998

Query  3135  EAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGRRESPGEHE  3314
             EAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+F+DEVDSMLGRRE+PGEHE
Sbjct  999   EAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFIDEVDSMLGRRENPGEHE  1058

Query  3315  AMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNREK  3494
             AMRKMKNEFMVNWDGLRTKDKERVLVL ATNRPFDLDEAVIRR PRRLMVNLPDA NREK
Sbjct  1059  AMRKMKNEFMVNWDGLRTKDKERVLVLGATNRPFDLDEAVIRRFPRRLMVNLPDASNREK  1118

Query  3495  ILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekekkekalaiS  3674
             IL++IL KEEL P+VDLD++ANMT+GYSGSDLKNLCVTAAH PIREILEKEKKEK LA S
Sbjct  1119  ILKVILAKEELGPDVDLDSLANMTDGYSGSDLKNLCVTAAHYPIREILEKEKKEKNLAKS  1178

Query  3675  ENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGEGGSRKKKA  3854
             E +P PAL+ S DIRPL++DDF+ AHEQVCASVSS+S NM ELLQWN+LYGEGGSRKKKA
Sbjct  1179  EGKPEPALYGSEDIRPLSIDDFKSAHEQVCASVSSDSANMNELLQWNDLYGEGGSRKKKA  1238

Query  3855  LSYFM  3869
             LSYFM
Sbjct  1239  LSYFM  1243



>gb|KDO52636.1| hypothetical protein CISIN_1g000823mg [Citrus sinensis]
Length=1203

 Score =  1264 bits (3270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/1213 (58%), Positives = 852/1213 (70%), Gaps = 89/1213 (7%)
 Frame = +3

Query  330   DGASALKSPEAPVPEKLP--EAPLGGE----------PLVS---PMILGDSAIDVDKVKA  464
             D +  + +P AP P +    + P+ GE          P VS   P+  G +   ++K ++
Sbjct  47    DNSKEVCTPAAPDPGECGTGDTPIAGEGVSGGKTEATPAVSVTAPIAEGSTPGVMEKPRS  106

Query  465   NGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPSVSK  644
             + S+ +  +K+       T W +LLSQ  QNS+VP+  S FTVG  RQC+  + D ++S 
Sbjct  107   SFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIFTVGSSRQCNFPLKDQAISA  166

Query  645   SLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKHAYI  824
              LC +KH+Q E G+++ ++E  G KG +QVNGK   KN++  L  GDEV+FGS G HAYI
Sbjct  167   VLCKIKHVQSE-GSAVAMVESIGSKG-LQVNGKNLKKNTSCELRSGDEVVFGSLGNHAYI  224

Query  825   FQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkkell  1004
             FQ+  NE         +V   E  SGP K +  E RSGDPS VA AS LASLS+L+ +L 
Sbjct  225   FQQLLNE--------VAVKGAEVQSGPGKFLQLERRSGDPSAVAGASILASLSSLRSDLS  276

Query  1005  llPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEKSGAISPDSG  1184
                    + + I  G E+P  P A  +  + DLD    + + + D    +K+  I     
Sbjct  277   RWKSPAQSTSKIHLGSELPT-PSADNDGVEVDLDGLEGNSTANTD---SDKAADI-----  327

Query  1185  NDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQRRELL  1364
                            G IGK    P E      + AG+             ++D R E  
Sbjct  328   ---------------GSIGK--NIPVECNQDAGIEAGN-------------VLDGRNEWR  357

Query  1365  KDFDP--LISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYIHLK  1538
             +D  P   + MS R   F++ +   ILD  N++ SFE+FPYYLSE TKNVLIA++YIHLK
Sbjct  358   RDSQPASTLGMSLRCAVFREDILAGILDGTNLQESFENFPYYLSENTKNVLIAASYIHLK  417

Query  1539  CNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVVDSLVLPGG-SAK  1715
                  K  SEL TV PRILLSGPAGSEIYQE LAKALA YFGA+LL+ DS  L GG S+K
Sbjct  418   HKDHAKYTSELTTVNPRILLSGPAGSEIYQEMLAKALAHYFGAKLLIFDSHSLLGGLSSK  477

Query  1716  ELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSAISS--------HAQ  1871
             E + +K+    E++    K+   +  L      A S+   ++     SS         +Q
Sbjct  478   EAELLKDGTSAEKSCGCVKQGPTSTDL------AKSINLPVSESDTPSSSNPPPQGPESQ  531

Query  1872  TKQEAST-----ASSKN-TFKTGDRVKYVGPLPTG-FSLQTPARGPAYGYKGKVLLAFEE  2030
              K E  T      +SKN   + GDRV++VG    G +   +P RGP  G +GKV L FE+
Sbjct  532   PKMETDTTLTSAGTSKNHMLRIGDRVRFVGSTSGGLYPTASPTRGPPCGTRGKVALLFED  591

Query  2031  NGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINELFEVVS  2210
             N  SKIGVRFD+ IP+G DLGG CE  HGFFC    LRL+NS  +DLDKL IN LFEVV 
Sbjct  592   NPSSKIGVRFDKPIPDGVDLGGQCEGGHGFFCNVTDLRLENSGTEDLDKLLINTLFEVVF  651

Query  2211  QECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKEKSHPGG  2390
              E +S P ILF+KD EKS+ GN +++S FK +LEKLP+ V+VI S+T TDNRKEKSHPGG
Sbjct  652   SESRSCPFILFMKDAEKSIAGNSDSYSTFKSRLEKLPDKVIVIGSHTHTDNRKEKSHPGG  711

Query  2391  FLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQDETLLSD  2570
              LFTKFGSNQTALLDLAFPD+FGRLHDR KE PKA K LT+LFPNKV I +PQDE LL+ 
Sbjct  712   LLFTKFGSNQTALLDLAFPDSFGRLHDRGKEIPKATKLLTKLFPNKVTIHMPQDEALLAS  771

Query  2571  WKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKIIGWALSH  2750
             WK QLDRD ET+K + N  ++R VL R  L+C  +ETLCI+DQ+LTNES EKI+GWALSH
Sbjct  772   WKHQLDRDSETLKMKGNLNHLRTVLGRSGLECEGLETLCIRDQSLTNESAEKIVGWALSH  831

Query  2751  HFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEKKLLADV  2930
             H M + E+   + +L +S ESI+YG+ + Q +QNE+KS+KKSLKDVVTENEFEK+LLADV
Sbjct  832   HLMQNPEAD-PDARLVLSCESIQYGIGIFQAIQNESKSLKKSLKDVVTENEFEKRLLADV  890

Query  2931  IPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKT  3110
             IPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKT
Sbjct  891   IPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKT  950

Query  3111  MLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEVDSMLGR  3290
             MLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSV+FVDEVDSMLGR
Sbjct  951   MLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGR  1010

Query  3291  RESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPRRLMVNL  3470
             RE+PGEHEAMRKMKNEFMVNWDGLRTKD ER+LVLAATNRPFDLDEAVIRRLPRRLMVNL
Sbjct  1011  RENPGEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNRPFDLDEAVIRRLPRRLMVNL  1070

Query  3471  PDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIReilekek  3650
             PDAPNR KIL++IL KE+L+P+VD DAIANMT+GYSGSDLKNLCVTAAH PI+EILEKEK
Sbjct  1071  PDAPNRAKILQVILAKEDLSPDVDFDAIANMTDGYSGSDLKNLCVTAAHRPIKEILEKEK  1130

Query  3651  kekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQWNELYGE  3830
             KE+A A++E +P PAL   +DIRPLNMDDF+YAHE+VCASVSSES NM+ELLQWNELYGE
Sbjct  1131  KERAAAMAEGKPAPALSGCADIRPLNMDDFKYAHERVCASVSSESVNMSELLQWNELYGE  1190

Query  3831  GGSRKKKALSYFM  3869
             GGSR+KKALSYFM
Sbjct  1191  GGSRRKKALSYFM  1203



>ref|XP_004152520.1| PREDICTED: uncharacterized protein LOC101214766 [Cucumis sativus]
Length=1244

 Score =  1263 bits (3269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/1219 (57%), Positives = 873/1219 (72%), Gaps = 46/1219 (4%)
 Frame = +3

Query  264   TPGAVNESGPESAEQEIRSADL-DGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSA  440
             TP  V+          I   D+ +G S+LK   AP    +      G  LV         
Sbjct  55    TPPTVDPGEHGPGGGPIAGVDVGEGVSSLKEDAAPAAVAVNTPTAEGTSLVG--------  106

Query  441   IDVDKVKANGSALNR-GKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDL  617
                DK +++ S+ +    K+       T W +LLSQ+ QNS+V +  S FT+G  R C+ 
Sbjct  107   ---DKPRSSFSSWSHYAAKQNPNFETTTPWCRLLSQFGQNSNVDIFSSNFTIGSSRGCNF  163

Query  618   CVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIF  797
              + D  +S +LC +KH QRE G+++ +LE  G KG V VNG    K+S   LN GDEV+F
Sbjct  164   PLKDHRISGTLCKIKHTQRE-GSAVAVLESMGGKGSVTVNGLTVKKSSNCVLNSGDEVVF  222

Query  798   GSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlas  977
             G+ G HAYIFQ+  NE         SV  L+   G  K +    R+GDPS VA AS LAS
Sbjct  223   GALGNHAYIFQQLMNE--------VSVKGLDVQGGVGKFLQLGKRTGDPSAVAGASILAS  274

Query  978   lsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEK  1157
             LS+L++++    P     +   QG E+P+  V     D  +L+ D  + + + +V  D+ 
Sbjct  275   LSSLRQDISRWKPPSQTSSKPHQGAELPSKSVVH---DAMELEIDALEANSNPEVRNDKA  331

Query  1158  SGAISPDSGNDNLNLENGAIDSYDGEIG--KVTGAPQELRPLIRMLAGSSTPEFDLSGNI  1331
             +     DS   N NL  G+      E G  K++G    + PL RMLA S++ +  LS +I
Sbjct  332   A-----DSSTTNRNLHPGSNPDAVIEAGNVKLSGVNDLIGPLFRMLAQSTSCKLKLSKSI  386

Query  1332  SR-IIDQRRELLKDFDPLIS--MSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITK  1502
              + ++++R + + +  P  +  MS R  AFK+ +   I+D  ++EVSF++FPYYLSE TK
Sbjct  387   CKQVMEERNQWIGELQPASTSGMSLRCAAFKEDVHAGIVDGRDLEVSFDNFPYYLSENTK  446

Query  1503  NVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVV  1682
             NVLIA+++IHLK     K  SEL TV PRILLSGPAGSEIYQE LAKALA Y+GA+LL+ 
Sbjct  447   NVLIAASFIHLKYKDHSKYTSELNTVNPRILLSGPAGSEIYQEMLAKALANYYGAKLLIF  506

Query  1683  DSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSA--  1853
             DS    GG S+KE + +K+     ++   +K++  +     N    +  E   +  +A  
Sbjct  507   DSHSFLGGLSSKEAELLKDGINAAKSCSCSKQSMVSTETTKNTDQVTGEEDTPSSSNATL  566

Query  1854  ISSHAQTKQE-----ASTASSKNTF-KTGDRVKYVGPLPTG-FSLQTPARGPAYGYKGKV  2012
              +  +Q K E     +S+ ++KN F K GDRV+++G    G +   +P+RGP  G +GKV
Sbjct  567   FTPDSQPKMEMDSIPSSSGTAKNNFLKIGDRVRFIGSASGGIYPTTSPSRGPPNGTRGKV  626

Query  2013  LLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINE  2192
             +L F+ N  SKIGV+FD+ IP+G DLGG CE  +G+FC A  LRL+NS +++LDK+ I+ 
Sbjct  627   VLTFDNNSSSKIGVKFDKLIPDGVDLGGYCEGGYGYFCNATDLRLENSGVEELDKILIDI  686

Query  2193  LFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKE  2372
             LFE V  E ++SP ILF+KD EKS+VGN +++S FK +LEKLP+NV+VI S+T TDNRKE
Sbjct  687   LFEAVFSESRNSPFILFMKDAEKSLVGNLDSYSTFKSRLEKLPDNVIVIGSHTHTDNRKE  746

Query  2373  KSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQD  2552
             KSHPGG LFTKFGSNQTALLDLAFPD+FGRLHDR KE PKA K LT+LFPNKV I +PQD
Sbjct  747   KSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEVPKATKLLTKLFPNKVTIHMPQD  806

Query  2553  ETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKII  2732
             E LL  WK QL+RD ET+K + N   +R VL+R  +DC  +ETLCIKDQ LTNES EK++
Sbjct  807   EGLLVSWKHQLERDSETLKMKGNLNQLRQVLSRSGMDCEGLETLCIKDQTLTNESAEKVV  866

Query  2733  GWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEK  2912
             GWALSHH M + E+   + ++ +SSESI+YG+S+LQ +QNE+KS+KKSLKDVVTENEFEK
Sbjct  867   GWALSHHLMQNLEAD-PDSRVLLSSESIQYGISILQAIQNESKSLKKSLKDVVTENEFEK  925

Query  2913  KLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGP  3092
             +LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGP
Sbjct  926   RLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGP  985

Query  3093  PGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEV  3272
             PGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSVVFVDEV
Sbjct  986   PGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEV  1045

Query  3273  DSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPR  3452
             DSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD ERVLVLAATNRPFDLDEAVIRRLPR
Sbjct  1046  DSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERVLVLAATNRPFDLDEAVIRRLPR  1105

Query  3453  RLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIRe  3632
             RLMVNLPDAPNR KIL++IL KE+L+P  D D++A+MT+GYSGSDLKNLCV AAH PI+E
Sbjct  1106  RLMVNLPDAPNRAKILKVILAKEDLSPEFDFDSVASMTDGYSGSDLKNLCVAAAHRPIKE  1165

Query  3633  ilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQW  3812
             ILEKEKKE+A A++++RP+PAL  S DIRPLNMDDF+YAHE+VCASVSSES NMTELLQW
Sbjct  1166  ILEKEKKERAAALADSRPVPALSGSEDIRPLNMDDFKYAHERVCASVSSESVNMTELLQW  1225

Query  3813  NELYGEGGSRKKKALSYFM  3869
             NELYGEGGSR+KKALSYFM
Sbjct  1226  NELYGEGGSRRKKALSYFM  1244



>ref|XP_007210914.1| hypothetical protein PRUPE_ppa000404mg [Prunus persica]
 gb|EMJ12113.1| hypothetical protein PRUPE_ppa000404mg [Prunus persica]
Length=1204

 Score =  1263 bits (3268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 693/1167 (59%), Positives = 842/1167 (72%), Gaps = 67/1167 (6%)
 Frame = +3

Query  411   VSPMILGDSAIDVDKVKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFT  590
             V+P I   S   V+K ++  S+ +  +K+       T W KLLSQ  QN ++P+    FT
Sbjct  91    VTPPIAEGSTPVVEKPRSAFSSWSFYQKQSPSFETSTPWCKLLSQSGQNLNIPISTMNFT  150

Query  591   VGQGRQCDLCVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVP  770
             +G  RQC+  + D ++S  LC ++  QRE G ++ +LE +G KG VQVNG    K ++  
Sbjct  151   IGANRQCNFTLKDQTISGFLCKIRRTQRE-GGAVAVLESTGSKGSVQVNGTNVKKGNSCM  209

Query  771   LNGGDEVIFGSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPST  950
             LN GDEV+FGS G HAYIFQ    E    +S        E  SG  K ++ E R+GDPS 
Sbjct  210   LNPGDEVVFGSLGNHAYIFQLLLTEAAVKSS--------EVQSGIGKFLHMERRAGDPSA  261

Query  951   VAVASTlaslsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSD  1130
             VA AS LASLS   +     P +    + +  G ++PA  V                V D
Sbjct  262   VAGASILASLSLRPEPSRWKPAAQTT-SKVHPGADVPAQSV----------------VQD  304

Query  1131  HNDVPLDEKSGAISPDSGNDNLNLENGAIDSYDGEIGKVTGAPQELRPLIRMLAGSSTPE  1310
              N+V LD    + +P+   D    + GAID                    + L   S  +
Sbjct  305   GNEVELDGLESSSTPNRPADKAE-DIGAID--------------------KNLTLDSNHD  343

Query  1311  FDL-SGNISRIIDQRRELLKDFDPLIS--MSTRRQAFKDGLQQTILDSNNIEVSFEDFPY  1481
               + +GN   ++++R E  +D     +  MS R   FKDG+   ILD  +I+VSF++FPY
Sbjct  344   SGIEAGN---VLEERNEWARDSQSASTSGMSLRCAVFKDGIHAGILDGKSIDVSFDNFPY  400

Query  1482  YLSEITKNVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYF  1661
             YLSE TKNVLIA+++IHLK  + VK  SEL TV PRILLSGPAGSEIYQE LAKALA+YF
Sbjct  401   YLSENTKNVLIAASFIHLKHKEHVKYTSELTTVNPRILLSGPAGSEIYQEMLAKALAQYF  460

Query  1662  GARLLVVDSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADI  1838
             GA+LL+ DS    GG S+KE + +K+    E+    TK++     +  N   AS+ E + 
Sbjct  461   GAKLLIFDSHSFLGGLSSKEAELLKDGFNAEKLCSLTKQSPTPTDVAKNTD-ASASETEA  519

Query  1839  TGGSAISSH---AQTKQE-----ASTASSKN-TFKTGDRVKYVGPLPTG-FSLQTPARGP  1988
                S   S+   +Q K E     +S+ +SKN  FK GDRVK++G      ++  + +RGP
Sbjct  520   PSSSNAPSNGLESQPKMEIDTIPSSSGTSKNFLFKIGDRVKFIGSSSGALYTAASSSRGP  579

Query  1989  AYGYKGKVLLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDD  2168
             A G +G+V+L FE+N  SK+G+RFD+ IP+G DLGGLC + +GFFC    LRL+N+ ++D
Sbjct  580   ASGTRGEVVLLFEDNPLSKVGIRFDKPIPDGVDLGGLC-KGNGFFCNVSDLRLENNGVED  638

Query  2169  LDKLAINELFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASY  2348
             LDKL IN LFE V  E +SSP ILF+KD EKS+VGN ++FS F+ +L+KLP+NVVVI S+
Sbjct  639   LDKLLINTLFEAVLSESRSSPFILFMKDAEKSLVGNSDSFSTFRARLDKLPDNVVVIGSH  698

Query  2349  TQTDNRKEKSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNK  2528
             T TDNRKEKSHPGG LFTKFGSNQTALLDLAFPD+FGRLH+R KE PKA K LT+LFPNK
Sbjct  699   THTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHERGKEVPKATKLLTKLFPNK  758

Query  2529  VMIQIPQDETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALT  2708
             V I +PQDE LL  WKQQLDRD ET+K + N   +R VL R  ++C  +ETLCIKDQ LT
Sbjct  759   VTIHMPQDEALLVSWKQQLDRDAETLKMKGNLNLLRTVLGRCGIECEGLETLCIKDQTLT  818

Query  2709  NESVEKIIGWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDV  2888
             NES EK++GWALSHH M + E+  +E K+ +S ESI+YGL +LQ +QNETKS+KKSLKDV
Sbjct  819   NESSEKVVGWALSHHLMQNPEADPQE-KVVLSGESIQYGLEILQAIQNETKSLKKSLKDV  877

Query  2889  VTENEFEKKLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPC  3068
             VTENEFEK+LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPC
Sbjct  878   VTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPC  937

Query  3069  KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAP  3248
             KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAP
Sbjct  938   KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAP  997

Query  3249  SVVFVDEVDSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDE  3428
             SVVFVDEVDSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTK+ ERVLVLAATNRPFDLDE
Sbjct  998   SVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKEAERVLVLAATNRPFDLDE  1057

Query  3429  AVIRRLPRRLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVT  3608
             AVIRRLPRRLMVNLPDAPNR KIL++IL KE+L+P++D DAIA+MT+GYSGSDLKNLCVT
Sbjct  1058  AVIRRLPRRLMVNLPDAPNRAKILKVILAKEDLSPSIDFDAIASMTDGYSGSDLKNLCVT  1117

Query  3609  AAHCPIReilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSEST  3788
             AAH PI+EILEKEKKE A+A++E +P PAL  S+DIR LNMDDF+ AHE+VCASVSSES 
Sbjct  1118  AAHRPIKEILEKEKKEHAVAVAEGKPAPALSGSADIRSLNMDDFKDAHERVCASVSSESV  1177

Query  3789  NMTELLQWNELYGEGGSRKKKALSYFM  3869
             NMTELLQWNELYGEGGSR+KKALSYFM
Sbjct  1178  NMTELLQWNELYGEGGSRRKKALSYFM  1204



>gb|KGN64404.1| hypothetical protein Csa_1G050430 [Cucumis sativus]
Length=1266

 Score =  1262 bits (3266),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 700/1219 (57%), Positives = 873/1219 (72%), Gaps = 46/1219 (4%)
 Frame = +3

Query  264   TPGAVNESGPESAEQEIRSADL-DGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSA  440
             TP  V+          I   D+ +G S+LK   AP    +      G  LV         
Sbjct  77    TPPTVDPGEHGPGGGPIAGVDVGEGVSSLKEDAAPAAVAVNTPTAEGTSLVG--------  128

Query  441   IDVDKVKANGSALNR-GKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDL  617
                DK +++ S+ +    K+       T W +LLSQ+ QNS+V +  S FT+G  R C+ 
Sbjct  129   ---DKPRSSFSSWSHYAAKQNPNFETTTPWCRLLSQFGQNSNVDIFSSNFTIGSSRGCNF  185

Query  618   CVDDPSVSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIF  797
              + D  +S +LC +KH QRE G+++ +LE  G KG V VNG    K+S   LN GDEV+F
Sbjct  186   PLKDHRISGTLCKIKHTQRE-GSAVAVLESMGGKGSVTVNGLTVKKSSNCVLNSGDEVVF  244

Query  798   GSSGKHAYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlas  977
             G+ G HAYIFQ+  NE         SV  L+   G  K +    R+GDPS VA AS LAS
Sbjct  245   GALGNHAYIFQQLMNE--------VSVKGLDVQGGVGKFLQLGKRTGDPSAVAGASILAS  296

Query  978   lsnlkkellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHNDVPLDEK  1157
             LS+L++++    P     +   QG E+P+  V     D  +L+ D  + + + +V  D+ 
Sbjct  297   LSSLRQDISRWKPPSQTSSKPHQGAELPSKSVVH---DAMELEIDALEANSNPEVRNDKA  353

Query  1158  SGAISPDSGNDNLNLENGAIDSYDGEIG--KVTGAPQELRPLIRMLAGSSTPEFDLSGNI  1331
             +     DS   N NL  G+      E G  K++G    + PL RMLA S++ +  LS +I
Sbjct  354   A-----DSSTTNRNLHPGSNPDAVIEAGNVKLSGVNDLIGPLFRMLAQSTSCKLKLSKSI  408

Query  1332  SR-IIDQRRELLKDFDPLIS--MSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITK  1502
              + ++++R + + +  P  +  MS R  AFK+ +   I+D  ++EVSF++FPYYLSE TK
Sbjct  409   CKQVMEERNQWIGELQPASTSGMSLRCAAFKEDVHAGIVDGRDLEVSFDNFPYYLSENTK  468

Query  1503  NVLIASTYIHLKCNKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGARLLVV  1682
             NVLIA+++IHLK     K  SEL TV PRILLSGPAGSEIYQE LAKALA Y+GA+LL+ 
Sbjct  469   NVLIAASFIHLKYKDHSKYTSELNTVNPRILLSGPAGSEIYQEMLAKALANYYGAKLLIF  528

Query  1683  DSLVLPGG-SAKELDPVKEAPKPERTGVFTKRAAQAAVLRFNKKPASSVEADITGGSA--  1853
             DS    GG S+KE + +K+     ++   +K++  +     N    +  E   +  +A  
Sbjct  529   DSHSFLGGLSSKEAELLKDGINAAKSCSCSKQSMVSTETTKNTDQVTGEEDTPSSSNATL  588

Query  1854  ISSHAQTKQE-----ASTASSKNTF-KTGDRVKYVGPLPTG-FSLQTPARGPAYGYKGKV  2012
              +  +Q K E     +S+ ++KN F K GDRV+++G    G +   +P+RGP  G +GKV
Sbjct  589   FTPDSQPKMEMDSIPSSSGTAKNNFLKIGDRVRFIGSASGGIYPTTSPSRGPPNGTRGKV  648

Query  2013  LLAFEENGFSKIGVRFDRSIPEGNDLGGLCEEDHGFFCAADFLRLDNSSIDDLDKLAINE  2192
             +L F+ N  SKIGV+FD+ IP+G DLGG CE  +G+FC A  LRL+NS +++LDK+ I+ 
Sbjct  649   VLTFDNNSSSKIGVKFDKLIPDGVDLGGYCEGGYGYFCNATDLRLENSGVEELDKILIDI  708

Query  2193  LFEVVSQECKSSPLILFVKDIEKSMVGNPEAFSAFKLKLEKLPENVVVIASYTQTDNRKE  2372
             LFE V  E ++SP ILF+KD EKS+VGN +++S FK +LEKLP+NV+VI S+T TDNRKE
Sbjct  709   LFEAVFSESRNSPFILFMKDAEKSLVGNLDSYSTFKSRLEKLPDNVIVIGSHTHTDNRKE  768

Query  2373  KSHPGGFLFTKFGSNQTALLDLAFPDNFGRLHDRSKETPKAIKQLTRLFPNKVMIQIPQD  2552
             KSHPGG LFTKFGSNQTALLDLAFPD+FGRLHDR KE PKA K LT+LFPNKV I +PQD
Sbjct  769   KSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEVPKATKLLTKLFPNKVTIHMPQD  828

Query  2553  ETLLSDWKQQLDRDIETMKSQSNAVNIRNVLNRVELDCPDIETLCIKDQALTNESVEKII  2732
             E LL  WK QL+RD ET+K + N   +R VL+R  +DC  +ETLCIKDQ LTNES EK++
Sbjct  829   EGLLVSWKHQLERDSETLKMKGNLNQLRVVLSRSGMDCEGLETLCIKDQTLTNESAEKVV  888

Query  2733  GWALSHHFMHSSESSTKEGKLAISSESIRYGLSVLQGVQNETKSVKKSLKDVVTENEFEK  2912
             GWALSHH M + E+   + ++ +SSESI+YG+S+LQ +QNE+KS+KKSLKDVVTENEFEK
Sbjct  889   GWALSHHLMQNLEAD-PDSRVLLSSESIQYGISILQAIQNESKSLKKSLKDVVTENEFEK  947

Query  2913  KLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGP  3092
             +LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGP
Sbjct  948   RLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGP  1007

Query  3093  PGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFTLASKIAPSVVFVDEV  3272
             PGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVF+LASKIAPSVVFVDEV
Sbjct  1008  PGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEV  1067

Query  3273  DSMLGRRESPGEHEAMRKMKNEFMVNWDGLRTKDKERVLVLAATNRPFDLDEAVIRRLPR  3452
             DSMLGRRE+PGEHEAMRKMKNEFMVNWDGLRTKD ERVLVLAATNRPFDLDEAVIRRLPR
Sbjct  1068  DSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERVLVLAATNRPFDLDEAVIRRLPR  1127

Query  3453  RLMVNLPDAPNREKILRIILTKEELAPNVDLDAIANMTEGYSGSDLKNLCVTAAHCPIRe  3632
             RLMVNLPDAPNR KIL++IL KE+L+P  D D++A+MT+GYSGSDLKNLCV AAH PI+E
Sbjct  1128  RLMVNLPDAPNRAKILKVILAKEDLSPEFDFDSVASMTDGYSGSDLKNLCVAAAHRPIKE  1187

Query  3633  ilekekkekalaiSENRPLPALHNSSDIRPLNMDDFRYAHEQVCASVSSESTNMTELLQW  3812
             ILEKEKKE+A A++++RP+PAL  S DIRPLNMDDF+YAHE+VCASVSSES NMTELLQW
Sbjct  1188  ILEKEKKERAAALADSRPVPALSGSEDIRPLNMDDFKYAHERVCASVSSESVNMTELLQW  1247

Query  3813  NELYGEGGSRKKKALSYFM  3869
             NELYGEGGSR+KKALSYFM
Sbjct  1248  NELYGEGGSRRKKALSYFM  1266



>gb|KFK30845.1| hypothetical protein AALP_AA6G033000, partial [Arabis alpina]
Length=1123

 Score =  1261 bits (3262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 665/1085 (61%), Positives = 815/1085 (75%), Gaps = 31/1085 (3%)
 Frame = +3

Query  276   VNESGPESAEQEIRSADLDGASALKSPEAPVPEKLPEAPLGGEPLVSPMILGDSAIDVDK  455
             V+E G ES E E+ S+D        + + PV E   EA    E L +P I G++  D +K
Sbjct  63    VSEPGSESGEPELGSSDPQVEEKAVTTDVPVMET--EANPEVEVLATPTIAGEAVTDTEK  120

Query  456   VKANGSALNRGKKRQLKSNLGTAWGKLLSQYPQNSHVPLDQSTFTVGQGRQCDLCVDDPS  635
              K        GKKR  K+     W KLLSQYPQN H  +    FTVG+ R CDL + + +
Sbjct  121   SK--------GKKRASKA----PWAKLLSQYPQNPHRIMRGPVFTVGR-RGCDLSIKEQN  167

Query  636   VSKSLCNLKHIQREKGNSITLLEISGKKGCVQVNGKIYPKNSTVPLNGGDEVIFGSSGKH  815
             +  +LC LK  + + G S+  L I+G    VQVNGK Y K+++V L GGDEVIF  SGKH
Sbjct  168   MPSALCELKQSE-QGGPSVATLNITGNG--VQVNGKSYQKSTSVNLRGGDEVIFSISGKH  224

Query  816   AYIFQKFTNEDISAASMPPSVSILEAHSGPVKGVNFEARSGDPSTVAVASTlaslsnlkk  995
             AYIFQ   +E+++A     S+SI EA   P+KGV+ E R+GD S V  AS LASLS  + 
Sbjct  225   AYIFQPLKDENLAAPDRASSLSICEAQGSPLKGVHVETRAGDSSAVDGASILASLSKYRN  284

Query  996   ellllPPSVCNDNDIKQGPEMPALPVASGEPDKHDLDSDMKDVSDHND-VPLDEKSGAIS  1172
               +L  P +   +  +Q PE+P +P +  + +    D++M D   +ND +   EK+ A +
Sbjct  285   FHML--PPIAKASKRQQNPEVPVVPSSCNDCNS---DTEMNDADCNNDAIASVEKAAAST  339

Query  1173  PDSGNDNLNLENGAIDSY-DGEIGKVTGAPQELRPLIRMLAGSSTPEFDLSGNISRIIDQ  1349
               + N+NLN +   +D + + + G + G+  E+RPL+R L   S+  FD+ G  S    +
Sbjct  340   SCTANENLNADGTGLDPFQEADGGNIPGSGYEIRPLLRFLTEPSS-SFDIRG-FSNGRRE  397

Query  1350  RRELLKDFDPLISMSTRRQAFKDGLQQTILDSNNIEVSFEDFPYYLSEITKNVLIASTYI  1529
              R+ L++ D   ++S+RRQAF D L+  +L++ NIEVS E+FPY+LS  TK+VLIAS Y+
Sbjct  398   VRDFLRELDHSSTISSRRQAFTDSLRAGVLNAENIEVSLEEFPYFLSATTKDVLIASMYV  457

Query  1530  HLKC-NKFVKCASELPTVCPRILLSGPAGSEIYQETLAKALAKYFGAR