BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23695_g2_i3 len=108 path=[2956:0-20 122:21-107]

Length=108
                                                                      Score     E

gb|KHG06258.1|  F-box SKIP8 -like protein                             50.4    5e-06   
emb|CBI34504.3|  unnamed protein product                              50.4    5e-06   
gb|KHG27766.1|  F-box SKIP8 -like protein                             49.7    9e-06   
ref|XP_002265246.1|  PREDICTED: F-box protein SKIP8                   49.7    9e-06   Vitis vinifera
gb|EYU23319.1|  hypothetical protein MIMGU_mgv1a013259mg              48.5    1e-05   
ref|XP_008361286.1|  PREDICTED: F-box protein SKIP8-like              49.3    2e-05   
ref|XP_011026856.1|  PREDICTED: F-box protein SKIP8                   49.3    2e-05   
ref|XP_002299461.2|  hypothetical protein POPTR_0001s10800g           48.9    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_009358631.1|  PREDICTED: F-box protein SKIP8-like              48.9    2e-05   
ref|XP_009631786.1|  PREDICTED: F-box protein SKIP8                   48.5    2e-05   
ref|XP_004298920.1|  PREDICTED: F-box protein SKIP8-like              48.5    3e-05   
ref|XP_009771412.1|  PREDICTED: F-box protein SKIP8 isoform X1        48.5    3e-05   
ref|XP_009771419.1|  PREDICTED: F-box protein SKIP8 isoform X2        48.1    3e-05   
ref|XP_004149013.1|  PREDICTED: F-box protein SKIP8-like              48.1    3e-05   
ref|XP_008451931.1|  PREDICTED: F-box protein SKIP8                   47.8    5e-05   
ref|XP_007160182.1|  hypothetical protein PHAVU_002G299800g           47.4    5e-05   
ref|XP_004503604.1|  PREDICTED: F-box protein SKIP8-like isoform X1   47.4    6e-05   
ref|XP_004503605.1|  PREDICTED: F-box protein SKIP8-like isoform X2   47.4    6e-05   
ref|XP_002509987.1|  conserved hypothetical protein                   47.0    8e-05   Ricinus communis
ref|XP_002303658.1|  hypothetical protein POPTR_0003s14150g           47.0    9e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006476359.1|  PREDICTED: F-box protein SKIP8-like              47.0    1e-04   
ref|XP_011082298.1|  PREDICTED: F-box protein SKIP8 isoform X1        47.0    1e-04   
ref|XP_006439315.1|  hypothetical protein CICLE_v10021394mg           47.0    1e-04   
ref|XP_010109783.1|  hypothetical protein L484_003143                 46.6    1e-04   
ref|XP_007040565.1|  Nuclear transport factor 2 family protein        46.6    1e-04   
gb|AFK34252.1|  unknown                                               46.2    2e-04   
gb|AFK35844.1|  unknown                                               46.2    2e-04   
ref|XP_011022482.1|  PREDICTED: F-box protein SKIP8-like isoform X1   46.2    2e-04   
ref|XP_009341879.1|  PREDICTED: F-box protein SKIP8-like              45.8    2e-04   
ref|XP_006343835.1|  PREDICTED: F-box protein SKIP8-like              45.8    3e-04   
ref|XP_010325351.1|  PREDICTED: F-box protein SKIP8                   45.4    3e-04   
gb|KDP25276.1|  hypothetical protein JCGZ_20432                       45.4    3e-04   
ref|XP_007209391.1|  hypothetical protein PRUPE_ppa009155mg           45.4    4e-04   
ref|XP_008239148.1|  PREDICTED: F-box protein SKIP8                   45.4    4e-04   
ref|XP_008341749.1|  PREDICTED: F-box protein SKIP8                   45.1    4e-04   
emb|CDP12176.1|  unnamed protein product                              44.3    5e-04   
ref|XP_010676264.1|  PREDICTED: F-box protein SKIP8                   44.3    7e-04   
ref|XP_003530424.1|  PREDICTED: F-box protein SKIP8-like              43.9    0.001   



>gb|KHG06258.1| F-box SKIP8 -like protein [Gossypium arboreum]
Length=302

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ   NWEQ  DFQ+RDVRARV+
Sbjct  219  YNAVIQSWQHAFNWEQGVDFQVRDVRARVL  248



>emb|CBI34504.3| unnamed protein product [Vitis vinifera]
Length=325

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV+ESWQ   NW+Q  DFQ+RDVRARV+
Sbjct  242  YNAVIESWQLAFNWDQGVDFQVRDVRARVL  271



>gb|KHG27766.1| F-box SKIP8 -like protein [Gossypium arboreum]
Length=305

 Score = 49.7 bits (117),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ   NWEQ  DFQ+RDVRARV+
Sbjct  220  YNAVIQSWQLAFNWEQGVDFQVRDVRARVL  249



>ref|XP_002265246.1| PREDICTED: F-box protein SKIP8 [Vitis vinifera]
Length=307

 Score = 49.7 bits (117),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV+ESWQ   NW+Q  DFQ+RDVRARV+
Sbjct  224  YNAVIESWQLAFNWDQGVDFQVRDVRARVL  253



>gb|EYU23319.1| hypothetical protein MIMGU_mgv1a013259mg [Erythranthe guttata]
Length=226

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV+ESWQ   NWE  ADFQIRDVR RV+
Sbjct  144  YNAVMESWQLAFNWENVADFQIRDVRTRVL  173



>ref|XP_008361286.1| PREDICTED: F-box protein SKIP8-like [Malus domestica]
Length=305

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ   NWEQ  +FQIRDVRARV+
Sbjct  223  YNAVIQSWQLAFNWEQGVNFQIRDVRARVL  252



>ref|XP_011026856.1| PREDICTED: F-box protein SKIP8 [Populus euphratica]
Length=302

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ   NWEQ  DFQ+RDVRARV+
Sbjct  217  YNAVIQSWQFAFNWEQGLDFQVRDVRARVL  246



>ref|XP_002299461.2| hypothetical protein POPTR_0001s10800g [Populus trichocarpa]
 gb|EEE84266.2| hypothetical protein POPTR_0001s10800g [Populus trichocarpa]
Length=302

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ   NWEQ  DFQ+RDVRARV+
Sbjct  217  YNAVIQSWQFAFNWEQGLDFQVRDVRARVL  246



>ref|XP_009358631.1| PREDICTED: F-box protein SKIP8-like [Pyrus x bretschneideri]
Length=301

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ   NWEQ  +FQIRDVRARV+
Sbjct  219  YNAVIQSWQLAFNWEQGVNFQIRDVRARVL  248



>ref|XP_009631786.1| PREDICTED: F-box protein SKIP8 [Nicotiana tomentosiformis]
Length=274

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVVHGAS  6
            Y+AV+ SWQ   NWEQ+ DF+IRDVRARV+  A+
Sbjct  192  YNAVMGSWQLAFNWEQNVDFEIRDVRARVMTDAA  225



>ref|XP_004298920.1| PREDICTED: F-box protein SKIP8-like [Fragaria vesca subsp. vesca]
Length=293

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AVV+SWQ   NWEQ  +FQ+RDVRARV+
Sbjct  212  YNAVVQSWQLAFNWEQGVNFQVRDVRARVL  241



>ref|XP_009771412.1| PREDICTED: F-box protein SKIP8 isoform X1 [Nicotiana sylvestris]
Length=272

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVVHGAS  6
            Y+AV+ SWQ   NWEQ+ DF+IRDVRARV+  A+
Sbjct  190  YNAVMGSWQLAFNWEQNVDFEIRDVRARVMTDAA  223



>ref|XP_009771419.1| PREDICTED: F-box protein SKIP8 isoform X2 [Nicotiana sylvestris]
Length=242

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVVHGAS  6
            Y+AV+ SWQ   NWEQ+ DF+IRDVRARV+  A+
Sbjct  190  YNAVMGSWQLAFNWEQNVDFEIRDVRARVMTDAA  223



>ref|XP_004149013.1| PREDICTED: F-box protein SKIP8-like [Cucumis sativus]
 ref|XP_004162683.1| PREDICTED: F-box protein SKIP8-like [Cucumis sativus]
 gb|KGN53419.1| hypothetical protein Csa_4G052690 [Cucumis sativus]
Length=313

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AVV+SWQ   NWEQ  +FQ+RDVRARV+
Sbjct  229  YNAVVQSWQVAFNWEQGINFQVRDVRARVL  258



>ref|XP_008451931.1| PREDICTED: F-box protein SKIP8 [Cucumis melo]
Length=313

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ   NWEQ  +FQ+RDVRARV+
Sbjct  229  YNAVIQSWQVAFNWEQGINFQVRDVRARVL  258



>ref|XP_007160182.1| hypothetical protein PHAVU_002G299800g [Phaseolus vulgaris]
 gb|ESW32176.1| hypothetical protein PHAVU_002G299800g [Phaseolus vulgaris]
Length=289

 Score = 47.4 bits (111),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            ++AV++SWQ + NWEQ  +FQ+RDVRARV+
Sbjct  207  FNAVMQSWQLVFNWEQGLNFQVRDVRARVL  236



>ref|XP_004503604.1| PREDICTED: F-box protein SKIP8-like isoform X1 [Cicer arietinum]
Length=277

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ + NWEQ  ++Q+RDVRARV+
Sbjct  195  YNAVMQSWQLVFNWEQGLNYQVRDVRARVL  224



>ref|XP_004503605.1| PREDICTED: F-box protein SKIP8-like isoform X2 [Cicer arietinum]
Length=279

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ + NWEQ  ++Q+RDVRARV+
Sbjct  197  YNAVMQSWQLVFNWEQGLNYQVRDVRARVL  226



>ref|XP_002509987.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51374.1| conserved hypothetical protein [Ricinus communis]
Length=302

 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ   NWEQ  +FQ+RDVRARV+
Sbjct  218  YNAVMQSWQLAFNWEQGLEFQVRDVRARVL  247



>ref|XP_002303658.1| hypothetical protein POPTR_0003s14150g [Populus trichocarpa]
 gb|EEE78637.1| hypothetical protein POPTR_0003s14150g [Populus trichocarpa]
Length=301

 Score = 47.0 bits (110),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ   NWEQ  D Q+RDVRARV+
Sbjct  216  YNAVIQSWQFAFNWEQGLDLQVRDVRARVL  245



>ref|XP_006476359.1| PREDICTED: F-box protein SKIP8-like [Citrus sinensis]
 gb|KDO76579.1| hypothetical protein CISIN_1g022429mg [Citrus sinensis]
Length=297

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y++V++SWQ   NWEQ  DFQ++DVRARV+
Sbjct  213  YNSVIQSWQIAFNWEQGVDFQVQDVRARVL  242



>ref|XP_011082298.1| PREDICTED: F-box protein SKIP8 isoform X1 [Sesamum indicum]
 ref|XP_011082299.1| PREDICTED: F-box protein SKIP8 isoform X1 [Sesamum indicum]
Length=293

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV+ESWQ   +WE  ADFQIRDVR RV+
Sbjct  209  YNAVMESWQLAFSWENVADFQIRDVRTRVL  238



>ref|XP_006439315.1| hypothetical protein CICLE_v10021394mg [Citrus clementina]
 gb|ESR52555.1| hypothetical protein CICLE_v10021394mg [Citrus clementina]
Length=297

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y++V++SWQ   NWEQ  DFQ++DVRARV+
Sbjct  213  YNSVIQSWQIAFNWEQGVDFQVQDVRARVL  242



>ref|XP_010109783.1| hypothetical protein L484_003143 [Morus notabilis]
 gb|EXC24701.1| hypothetical protein L484_003143 [Morus notabilis]
Length=297

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV+ SWQ   NWEQ  +FQ+RDVRARV+
Sbjct  214  YNAVIHSWQFAFNWEQGINFQVRDVRARVL  243



>ref|XP_007040565.1| Nuclear transport factor 2 family protein [Theobroma cacao]
 gb|EOY25066.1| Nuclear transport factor 2 family protein [Theobroma cacao]
Length=309

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ   NWEQ  DFQ+ DVRARV+
Sbjct  225  YNAVIQSWQLAFNWEQGVDFQVIDVRARVL  254



>gb|AFK34252.1| unknown [Medicago truncatula]
Length=284

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+ V++SWQ + NW+Q  +FQ+RDVRARV+
Sbjct  202  YNGVMQSWQLVFNWDQGLNFQVRDVRARVL  231



>gb|AFK35844.1| unknown [Medicago truncatula]
Length=284

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+ V++SWQ + NW+Q  +FQ+RDVRARV+
Sbjct  202  YNGVMQSWQLVFNWDQGLNFQVRDVRARVL  231



>ref|XP_011022482.1| PREDICTED: F-box protein SKIP8-like isoform X1 [Populus euphratica]
Length=301

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ   NWEQ  D Q+RDVRARV+
Sbjct  216  YNAVIQSWQFAFNWEQVLDLQVRDVRARVL  245



>ref|XP_009341879.1| PREDICTED: F-box protein SKIP8-like [Pyrus x bretschneideri]
Length=305

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ   NWEQ  +FQIRDV ARV+
Sbjct  223  YNAVIQSWQLAFNWEQGVNFQIRDVCARVL  252



>ref|XP_006343835.1| PREDICTED: F-box protein SKIP8-like [Solanum tuberosum]
Length=291

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            ++AV+ SWQ   NWEQ+ DF+IRDV+ARV+
Sbjct  209  HNAVIGSWQLAFNWEQNVDFEIRDVKARVM  238



>ref|XP_010325351.1| PREDICTED: F-box protein SKIP8 [Solanum lycopersicum]
Length=291

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            ++AV+ SWQ   NWEQ+ DF+IRDV+ARV+
Sbjct  209  HNAVIGSWQLAFNWEQNVDFEIRDVKARVM  238



>gb|KDP25276.1| hypothetical protein JCGZ_20432 [Jatropha curcas]
Length=308

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+A+++SWQ   NWEQ  D Q+RDVRARV+
Sbjct  224  YNAIMQSWQLAFNWEQVLDIQVRDVRARVL  253



>ref|XP_007209391.1| hypothetical protein PRUPE_ppa009155mg [Prunus persica]
 gb|EMJ10590.1| hypothetical protein PRUPE_ppa009155mg [Prunus persica]
Length=304

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SW+   +WEQ  +FQIRDVRARV+
Sbjct  221  YNAVMQSWRLAFDWEQGVNFQIRDVRARVL  250



>ref|XP_008239148.1| PREDICTED: F-box protein SKIP8 [Prunus mume]
Length=304

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SW+   +WEQ  +FQIRDVRARV+
Sbjct  221  YNAVMQSWRLAFDWEQGVNFQIRDVRARVL  250



>ref|XP_008341749.1| PREDICTED: F-box protein SKIP8 [Malus domestica]
Length=302

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++SWQ   NWEQ  +FQIRDV ARV+
Sbjct  220  YNAVIQSWQLAFNWEQGVNFQIRDVCARVL  249



>emb|CDP12176.1| unnamed protein product [Coffea canephora]
Length=217

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y AV++SWQ   NWEQ  +FQ++DVRARV+
Sbjct  133  YSAVMQSWQLAFNWEQGFNFQVQDVRARVL  162



>ref|XP_010676264.1| PREDICTED: F-box protein SKIP8 [Beta vulgaris subsp. vulgaris]
Length=301

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 1/31 (3%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSAD-FQIRDVRARVV  18
            Y+AV+ESWQ   NW Q AD FQ+RDVRAR++
Sbjct  216  YNAVIESWQIAFNWVQQADGFQLRDVRARIL  246



>ref|XP_003530424.1| PREDICTED: F-box protein SKIP8-like [Glycine max]
Length=284

 Score = 43.9 bits (102),  Expect = 0.001, Method: Composition-based stats.
 Identities = 17/30 (57%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -2

Query  107  YDAVVESWQPILNWEQSADFQIRDVRARVV  18
            Y+AV++ WQ + NWEQ  +FQ+RDV ARV+
Sbjct  203  YNAVMQGWQLVFNWEQGLNFQVRDVCARVL  232



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524198921584