BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23693_g1_i1 len=1093 path=[417:0-576 332:577-752 1165:753-762
308:763-859 1270:860-1092]

Length=1093
                                                                      Score     E

ref|XP_009363226.1|  PREDICTED: alpha carbonic anhydrase 4-like         276   6e-87   
ref|XP_008351630.1|  PREDICTED: bifunctional monodehydroascorbate...    272   2e-85   
emb|CDP14170.1|  unnamed protein product                                269   3e-84   
ref|XP_010036307.1|  PREDICTED: alpha carbonic anhydrase 4-like         268   2e-83   
ref|XP_010036662.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    266   2e-83   
ref|XP_010696305.1|  PREDICTED: alpha carbonic anhydrase 7-like         265   5e-83   
ref|XP_002323272.2|  hypothetical protein POPTR_0016s04300g             266   5e-83   Populus trichocarpa [western balsam poplar]
ref|XP_008244285.1|  PREDICTED: bifunctional monodehydroascorbate...    265   8e-83   
ref|XP_011033188.1|  PREDICTED: alpha carbonic anhydrase 4-like         266   2e-82   
ref|XP_007202419.1|  hypothetical protein PRUPE_ppa009714mg             264   3e-82   
ref|XP_007028632.1|  Carbonic anhydrase, putative                       263   3e-82   
emb|CAM59682.1|  a-type carbonic anhydrase                              262   9e-82   Lotus japonicus
ref|XP_006413835.1|  hypothetical protein EUTSA_v10027157mg             261   2e-81   
gb|KHN39018.1|  Bifunctional monodehydroascorbate reductase and c...    261   2e-81   
ref|XP_007028635.1|  Alpha carbonic anhydrase 4, putative               261   3e-81   
ref|XP_008364026.1|  PREDICTED: bifunctional monodehydroascorbate...    260   3e-81   
ref|XP_009400916.1|  PREDICTED: alpha carbonic anhydrase 7-like         261   5e-81   
gb|KDP26093.1|  hypothetical protein JCGZ_21126                         260   6e-81   
ref|XP_008360674.1|  PREDICTED: bifunctional monodehydroascorbate...    260   8e-81   
ref|XP_003553396.1|  PREDICTED: bifunctional monodehydroascorbate...    259   9e-81   
gb|KHN10833.1|  Bifunctional monodehydroascorbate reductase and c...    258   9e-81   
ref|XP_008464600.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    260   9e-81   
ref|XP_004493459.1|  PREDICTED: bifunctional monodehydroascorbate...    259   9e-81   
gb|KHN14952.1|  Bifunctional monodehydroascorbate reductase and c...    259   2e-80   
emb|CDX76404.1|  BnaA08g09960D                                          259   2e-80   
gb|EYU18694.1|  hypothetical protein MIMGU_mgv11b010420mg               258   2e-80   
ref|XP_006489872.1|  PREDICTED: bifunctional monodehydroascorbate...    259   2e-80   
ref|XP_010269790.1|  PREDICTED: alpha carbonic anhydrase 4-like         258   3e-80   
ref|XP_003535188.1|  PREDICTED: bifunctional monodehydroascorbate...    258   4e-80   
emb|CDY27409.1|  BnaC03g64490D                                          258   4e-80   
ref|XP_008810946.1|  PREDICTED: alpha carbonic anhydrase 7-like         258   5e-80   
ref|XP_006421163.1|  hypothetical protein CICLE_v10005610mg             258   6e-80   
ref|XP_007016793.1|  Alpha carbonic anhydrase 7                         257   7e-80   
ref|XP_003520509.1|  PREDICTED: bifunctional monodehydroascorbate...    257   9e-80   
gb|KDO48229.1|  hypothetical protein CISIN_1g025618mg                   256   9e-80   
ref|XP_011048125.1|  PREDICTED: alpha carbonic anhydrase 4-like         258   1e-79   
gb|EYU18692.1|  hypothetical protein MIMGU_mgv1a011638mg                257   1e-79   
ref|XP_011015725.1|  PREDICTED: alpha carbonic anhydrase 4-like         258   1e-79   
ref|XP_007016796.1|  Alpha carbonic anhydrase 7                         256   2e-79   
gb|KCW47832.1|  hypothetical protein EUGRSUZ_K01571                     256   2e-79   
ref|XP_004493458.1|  PREDICTED: bifunctional monodehydroascorbate...    256   3e-79   
ref|XP_011075357.1|  PREDICTED: alpha carbonic anhydrase 4-like         256   3e-79   
ref|XP_011015541.1|  PREDICTED: alpha carbonic anhydrase 4-like         255   3e-79   
ref|XP_010098808.1|  hypothetical protein L484_022573                   256   4e-79   
ref|XP_004303634.1|  PREDICTED: bifunctional monodehydroascorbate...    256   4e-79   
ref|XP_008810960.1|  PREDICTED: alpha carbonic anhydrase 7-like         255   4e-79   
ref|XP_007144378.1|  hypothetical protein PHAVU_007G151300g             255   5e-79   
emb|CDP14169.1|  unnamed protein product                                254   5e-79   
ref|XP_011075358.1|  PREDICTED: alpha carbonic anhydrase 7-like         255   6e-79   
gb|AFK49331.1|  unknown                                                 252   2e-78   
ref|XP_006292541.1|  hypothetical protein CARUB_v10018775mg             253   2e-78   
emb|CDX94018.1|  BnaC07g36520D                                          253   2e-78   
gb|KCW89335.1|  hypothetical protein EUGRSUZ_A01626                     252   3e-78   
ref|XP_010046439.1|  PREDICTED: alpha carbonic anhydrase 7-like         253   3e-78   
ref|XP_010050504.1|  PREDICTED: alpha carbonic anhydrase 7-like         253   3e-78   
gb|EYU41598.1|  hypothetical protein MIMGU_mgv1a011586mg                253   4e-78   
ref|XP_010439535.1|  PREDICTED: alpha carbonic anhydrase 4              253   4e-78   
gb|EYU20767.1|  hypothetical protein MIMGU_mgv1a019017mg                251   5e-78   
ref|NP_193831.1|  alpha carbonic anhydrase 4                            252   7e-78   Arabidopsis thaliana [mouse-ear cress]
gb|EPS62533.1|  hypothetical protein M569_12260                         250   8e-78   
ref|XP_002869915.1|  carbonic anhydrase family protein                  251   1e-77   
ref|XP_010272832.1|  PREDICTED: alpha carbonic anhydrase 7-like         251   1e-77   
ref|XP_010279581.1|  PREDICTED: alpha carbonic anhydrase 4-like         251   1e-77   
ref|XP_009782909.1|  PREDICTED: bifunctional monodehydroascorbate...    251   2e-77   
ref|XP_010043780.1|  PREDICTED: alpha carbonic anhydrase 7-like         251   3e-77   
ref|XP_010451325.1|  PREDICTED: alpha carbonic anhydrase 4-like         250   3e-77   
ref|XP_011077301.1|  PREDICTED: alpha carbonic anhydrase 7-like         250   4e-77   
ref|XP_009137160.1|  PREDICTED: alpha carbonic anhydrase 4-like         250   4e-77   
ref|XP_002519458.1|  carbonic anhydrase, putative                       250   5e-77   Ricinus communis
ref|XP_011075611.1|  PREDICTED: alpha carbonic anhydrase 7-like         249   6e-77   
ref|XP_010050514.1|  PREDICTED: alpha carbonic anhydrase 7-like         250   7e-77   
ref|XP_002282495.2|  PREDICTED: alpha carbonic anhydrase 7              249   7e-77   Vitis vinifera
emb|CDP07086.1|  unnamed protein product                                249   1e-76   
gb|AFK33933.1|  unknown                                                 249   1e-76   
ref|XP_006594167.1|  PREDICTED: bifunctional monodehydroascorbate...    249   1e-76   
ref|XP_010555357.1|  PREDICTED: alpha carbonic anhydrase 4              249   1e-76   
ref|XP_006391784.1|  hypothetical protein EUTSA_v10023909mg             249   2e-76   
gb|KEH42158.1|  eukaryotic-type carbonic anhydrase                      249   2e-76   
dbj|BAD09854.1|  putative dioscorin class A precursor                   248   2e-76   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009595413.1|  PREDICTED: bifunctional monodehydroascorbate...    248   3e-76   
ref|XP_010050537.1|  PREDICTED: alpha carbonic anhydrase 7-like         248   3e-76   
ref|XP_002268233.1|  PREDICTED: alpha carbonic anhydrase 7              248   3e-76   Vitis vinifera
ref|XP_010646590.1|  PREDICTED: alpha carbonic anhydrase 4 isofor...    248   4e-76   
gb|KHN48240.1|  Bifunctional monodehydroascorbate reductase and c...    248   4e-76   
gb|KDP44024.1|  hypothetical protein JCGZ_05491                         248   4e-76   
ref|XP_011018803.1|  PREDICTED: alpha carbonic anhydrase 7-like         248   4e-76   
ref|XP_006473002.1|  PREDICTED: bifunctional monodehydroascorbate...    248   5e-76   
ref|XP_011090042.1|  PREDICTED: alpha carbonic anhydrase 7-like         247   5e-76   
ref|XP_006381381.1|  hypothetical protein POPTR_0006s12380g             247   6e-76   
ref|XP_010050530.1|  PREDICTED: alpha carbonic anhydrase 7-like         248   6e-76   
ref|XP_006424533.1|  hypothetical protein CICLE_v10029790mg             247   7e-76   
ref|XP_011048097.1|  PREDICTED: alpha carbonic anhydrase 4-like         248   7e-76   
gb|KGN59000.1|  hypothetical protein Csa_3G742880                       246   1e-75   
emb|CDY56563.1|  BnaCnng30610D                                          246   1e-75   
ref|XP_010434249.1|  PREDICTED: alpha carbonic anhydrase 4-like         246   2e-75   
gb|KDO81077.1|  hypothetical protein CISIN_1g038655mg                   246   2e-75   
ref|XP_006433902.1|  hypothetical protein CICLE_v10003227mg             246   2e-75   
ref|XP_004168624.1|  PREDICTED: bifunctional monodehydroascorbate...    246   2e-75   
ref|XP_010036660.1|  PREDICTED: alpha carbonic anhydrase 4-like         246   2e-75   
ref|XP_008443579.1|  PREDICTED: bifunctional monodehydroascorbate...    246   2e-75   
ref|XP_011090098.1|  PREDICTED: alpha carbonic anhydrase 7              246   2e-75   
ref|XP_008778933.1|  PREDICTED: alpha carbonic anhydrase 7-like         246   2e-75   
ref|XP_004143278.1|  PREDICTED: bifunctional monodehydroascorbate...    246   2e-75   
ref|XP_008359452.1|  PREDICTED: bifunctional monodehydroascorbate...    246   3e-75   
ref|XP_002278828.1|  PREDICTED: alpha carbonic anhydrase 4 isofor...    245   3e-75   Vitis vinifera
ref|XP_010916592.1|  PREDICTED: alpha carbonic anhydrase 7-like         245   4e-75   
ref|XP_002529418.1|  carbonic anhydrase, putative                       245   5e-75   Ricinus communis
ref|XP_006488639.1|  PREDICTED: bifunctional monodehydroascorbate...    245   5e-75   
ref|XP_008802055.1|  PREDICTED: alpha carbonic anhydrase 7-like         245   6e-75   
gb|KEH42156.1|  eukaryotic-type carbonic anhydrase                      245   6e-75   
gb|KDO73356.1|  hypothetical protein CISIN_1g039445mg                   244   8e-75   
ref|XP_010050524.1|  PREDICTED: alpha carbonic anhydrase 7-like         244   1e-74   
ref|XP_006659489.1|  PREDICTED: bifunctional monodehydroascorbate...    244   1e-74   
gb|EYU38572.1|  hypothetical protein MIMGU_mgv1a011717mg                244   1e-74   
ref|XP_009621603.1|  PREDICTED: alpha carbonic anhydrase 7              244   1e-74   
emb|CDX79018.1|  BnaA01g10850D                                          243   1e-74   
ref|XP_006409842.1|  hypothetical protein EUTSA_v10017075mg             244   1e-74   
ref|XP_002308927.2|  hypothetical protein POPTR_0006s04600g             244   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_010241820.1|  PREDICTED: alpha carbonic anhydrase 7-like         244   2e-74   
ref|XP_006351243.1|  PREDICTED: bifunctional monodehydroascorbate...    243   2e-74   
ref|NP_001147028.1|  carbonic anhydrase precursor                       244   2e-74   Zea mays [maize]
ref|XP_004137981.1|  PREDICTED: bifunctional monodehydroascorbate...    246   2e-74   
ref|XP_008462491.1|  PREDICTED: bifunctional monodehydroascorbate...    243   3e-74   
ref|XP_004515925.1|  PREDICTED: bifunctional monodehydroascorbate...    243   3e-74   
ref|XP_006284932.1|  hypothetical protein CARUB_v10006231mg             242   3e-74   
ref|XP_009391366.1|  PREDICTED: alpha carbonic anhydrase 7-like         243   3e-74   
gb|ABO36620.1|  eukaryotic-type carbonic anhydrase family protein       243   3e-74   Solanum lycopersicum
ref|XP_006384924.1|  hypothetical protein POPTR_0004s22280g             243   3e-74   
ref|XP_010036663.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    242   3e-74   
ref|XP_008442725.1|  PREDICTED: bifunctional monodehydroascorbate...    243   3e-74   
gb|ADW27480.1|  carbonic anhydrase                                      243   4e-74   
ref|XP_004293093.1|  PREDICTED: bifunctional monodehydroascorbate...    249   4e-74   
ref|XP_010090219.1|  hypothetical protein L484_016558                   241   5e-74   
ref|XP_010916593.1|  PREDICTED: alpha carbonic anhydrase 7-like         242   5e-74   
emb|CBI33385.3|  unnamed protein product                                242   7e-74   
ref|XP_009134167.1|  PREDICTED: alpha carbonic anhydrase 4-like         241   7e-74   
ref|XP_009770757.1|  PREDICTED: alpha carbonic anhydrase 4-like         241   7e-74   
ref|XP_008227262.1|  PREDICTED: bifunctional monodehydroascorbate...    242   7e-74   
ref|XP_004251153.1|  PREDICTED: alpha carbonic anhydrase 7              242   9e-74   
ref|XP_009775004.1|  PREDICTED: alpha carbonic anhydrase 7-like         241   1e-73   
gb|KHG27075.1|  Bifunctional monodehydroascorbate reductase and c...    241   1e-73   
gb|AFK36418.1|  unknown                                                 241   1e-73   
ref|XP_009592985.1|  PREDICTED: alpha carbonic anhydrase 7-like         241   1e-73   
ref|XP_002278815.1|  PREDICTED: alpha carbonic anhydrase 4-like         241   1e-73   Vitis vinifera
ref|XP_006488640.1|  PREDICTED: bifunctional monodehydroascorbate...    241   1e-73   
gb|KDO73355.1|  hypothetical protein CISIN_1g046862mg                   241   2e-73   
ref|XP_002308928.2|  hypothetical protein POPTR_0006s04610g             241   3e-73   Populus trichocarpa [western balsam poplar]
ref|XP_002532664.1|  carbonic anhydrase, putative                       240   3e-73   Ricinus communis
ref|XP_007206520.1|  hypothetical protein PRUPE_ppa019410mg             240   4e-73   
ref|XP_011040911.1|  PREDICTED: alpha carbonic anhydrase 7-like         240   5e-73   
gb|KCW47834.1|  hypothetical protein EUGRSUZ_K01571                     240   5e-73   
ref|XP_004249474.1|  PREDICTED: alpha carbonic anhydrase 7-like         239   6e-73   
ref|XP_004973745.1|  PREDICTED: bifunctional monodehydroascorbate...    240   6e-73   
ref|XP_007144380.1|  hypothetical protein PHAVU_007G151500g             239   7e-73   
ref|XP_010098809.1|  hypothetical protein L484_022574                   238   7e-73   
ref|XP_009380700.1|  PREDICTED: alpha carbonic anhydrase 7-like         239   8e-73   
ref|XP_007144381.1|  hypothetical protein PHAVU_007G151500g             240   9e-73   
ref|XP_008226047.1|  PREDICTED: bifunctional monodehydroascorbate...    239   9e-73   
ref|XP_009599195.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    239   9e-73   
ref|XP_002529419.1|  carbonic anhydrase, putative                       239   1e-72   Ricinus communis
ref|XP_006340169.1|  PREDICTED: bifunctional monodehydroascorbate...    239   1e-72   
ref|XP_009367040.1|  PREDICTED: alpha carbonic anhydrase 7-like         239   1e-72   
ref|XP_010439534.1|  PREDICTED: alpha carbonic anhydrase 4-like         238   1e-72   
ref|XP_006424534.1|  hypothetical protein CICLE_v10030314mg             238   2e-72   
ref|XP_004142716.1|  PREDICTED: bifunctional monodehydroascorbate...    239   3e-72   
ref|XP_009399717.1|  PREDICTED: alpha carbonic anhydrase 7-like         237   4e-72   
ref|XP_007162157.1|  hypothetical protein PHAVU_001G129100g             237   5e-72   
ref|XP_008664513.1|  PREDICTED: bifunctional monodehydroascorbate...    238   6e-72   
ref|XP_010449136.1|  PREDICTED: alpha carbonic anhydrase 4-like         236   6e-72   
gb|KDP44023.1|  hypothetical protein JCGZ_05490                         237   6e-72   
ref|XP_010521744.1|  PREDICTED: alpha carbonic anhydrase 7-like         237   7e-72   
ref|XP_009776894.1|  PREDICTED: bifunctional monodehydroascorbate...    236   7e-72   
ref|XP_009113037.1|  PREDICTED: alpha carbonic anhydrase 2-like         236   1e-71   
ref|XP_002445624.1|  hypothetical protein SORBIDRAFT_07g022880          236   1e-71   Sorghum bicolor [broomcorn]
emb|CDP11563.1|  unnamed protein product                                236   1e-71   
ref|XP_002314288.2|  hypothetical protein POPTR_0009s01540g             236   1e-71   Populus trichocarpa [western balsam poplar]
ref|XP_010090214.1|  hypothetical protein L484_016553                   237   1e-71   
ref|XP_003625103.1|  Bifunctional monodehydroascorbate reductase ...    236   2e-71   
ref|XP_006340168.1|  PREDICTED: bifunctional monodehydroascorbate...    236   2e-71   
ref|XP_010696307.1|  PREDICTED: alpha carbonic anhydrase 7-like         236   2e-71   
ref|XP_011044411.1|  PREDICTED: alpha carbonic anhydrase 7-like         236   2e-71   
ref|XP_006339092.1|  PREDICTED: bifunctional monodehydroascorbate...    235   2e-71   
gb|KFK28694.1|  hypothetical protein AALP_AA7G034200                    235   2e-71   
emb|CDY45963.1|  BnaA09g13030D                                          235   2e-71   
emb|CDY45480.1|  BnaC09g12980D                                          235   3e-71   
ref|XP_006845947.1|  hypothetical protein AMTR_s00157p00092470          234   3e-71   
ref|XP_009132759.1|  PREDICTED: alpha carbonic anhydrase 2-like         234   4e-71   
ref|XP_007203913.1|  hypothetical protein PRUPE_ppa016859mg             237   4e-71   
ref|XP_006301790.1|  hypothetical protein CARUB_v10022254mg             234   5e-71   
gb|AFK47340.1|  unknown                                                 234   7e-71   
ref|XP_008385339.1|  PREDICTED: bifunctional monodehydroascorbate...    234   9e-71   
ref|XP_009356885.1|  PREDICTED: alpha carbonic anhydrase 7-like         234   1e-70   
ref|XP_004241280.1|  PREDICTED: bifunctional monodehydroascorbate...    234   1e-70   
ref|XP_010434246.1|  PREDICTED: alpha carbonic anhydrase 4-like         233   1e-70   
gb|KFK32339.1|  hypothetical protein AALP_AA6G228800                    233   2e-70   
emb|CDY23976.1|  BnaC03g17150D                                          233   2e-70   
ref|XP_003541987.1|  PREDICTED: bifunctional monodehydroascorbate...    233   2e-70   
gb|EMT11024.1|  Bifunctional monodehydroascorbate reductase and c...    233   2e-70   
ref|XP_010414580.1|  PREDICTED: alpha carbonic anhydrase 2-like         233   3e-70   
ref|XP_002445628.1|  hypothetical protein SORBIDRAFT_07g022910          233   3e-70   Sorghum bicolor [broomcorn]
ref|XP_010696308.1|  PREDICTED: alpha carbonic anhydrase 7-like         233   3e-70   
ref|XP_002445625.1|  hypothetical protein SORBIDRAFT_07g022890          233   4e-70   Sorghum bicolor [broomcorn]
gb|KEH16352.1|  eukaryotic-type carbonic anhydrase                      232   4e-70   
ref|XP_004973662.1|  PREDICTED: bifunctional monodehydroascorbate...    232   4e-70   
ref|XP_010696309.1|  PREDICTED: alpha carbonic anhydrase 7-like         233   5e-70   
ref|XP_007027463.1|  Alpha carbonic anhydrase 7 isoform 1               232   5e-70   
gb|EEE68846.1|  hypothetical protein OsJ_27636                          232   5e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004300792.1|  PREDICTED: bifunctional monodehydroascorbate...    232   6e-70   
ref|XP_009599194.1|  PREDICTED: alpha carbonic anhydrase 4-like i...    232   6e-70   
gb|EEC83720.1|  hypothetical protein OsI_29556                          232   6e-70   Oryza sativa Indica Group [Indian rice]
ref|XP_009358738.1|  PREDICTED: alpha carbonic anhydrase 4-like         234   7e-70   
ref|XP_004973661.1|  PREDICTED: bifunctional monodehydroascorbate...    231   1e-69   
ref|XP_008383977.1|  PREDICTED: bifunctional monodehydroascorbate...    233   1e-69   
ref|XP_004168623.1|  PREDICTED: bifunctional monodehydroascorbate...    231   2e-69   
ref|XP_009103655.1|  PREDICTED: alpha carbonic anhydrase 2              230   2e-69   
ref|XP_006365755.1|  PREDICTED: bifunctional monodehydroascorbate...    230   2e-69   
dbj|BAK03530.1|  predicted protein                                      231   3e-69   
ref|NP_001149032.1|  carbonic anhydrase precursor                       231   3e-69   Zea mays [maize]
gb|AAD29832.1|  putative carbonic anhydrase                             229   3e-69   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ99342.1|  predicted protein                                      230   3e-69   
ref|XP_010510675.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    229   3e-69   
ref|XP_006660200.1|  PREDICTED: bifunctional monodehydroascorbate...    231   3e-69   
ref|XP_010470128.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    230   4e-69   
gb|KGN58999.1|  hypothetical protein Csa_3G742870                       230   4e-69   
tpg|DAA48425.1|  TPA: carbonic anhydrase                                230   4e-69   
ref|XP_009377055.1|  PREDICTED: alpha carbonic anhydrase 4-like         232   4e-69   
ref|XP_008241384.1|  PREDICTED: bifunctional monodehydroascorbate...    230   4e-69   
ref|XP_008387558.1|  PREDICTED: bifunctional monodehydroascorbate...    230   4e-69   
emb|CDX84811.1|  BnaA03g14190D                                          228   4e-69   
ref|XP_010510674.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    229   5e-69   
ref|XP_004160914.1|  PREDICTED: bifunctional monodehydroascorbate...    229   5e-69   
ref|XP_008227264.1|  PREDICTED: bifunctional monodehydroascorbate...    229   5e-69   
gb|ABK22387.1|  unknown                                                 229   6e-69   Picea sitchensis
ref|XP_007213463.1|  hypothetical protein PRUPE_ppa024299mg             229   7e-69   
ref|XP_008462808.1|  PREDICTED: bifunctional monodehydroascorbate...    229   8e-69   
gb|EMT14740.1|  Bifunctional monodehydroascorbate reductase and c...    229   9e-69   
ref|XP_010262876.1|  PREDICTED: alpha carbonic anhydrase 7-like         229   9e-69   
dbj|BAD09858.1|  putative dioscorin class A precursor                   229   9e-69   Oryza sativa Japonica Group [Japonica rice]
emb|CDY04545.1|  BnaA07g13710D                                          228   1e-68   
ref|XP_010510673.1|  PREDICTED: alpha carbonic anhydrase 2-like         228   1e-68   
gb|KHN39017.1|  Bifunctional monodehydroascorbate reductase and c...    229   1e-68   
ref|XP_003574630.1|  PREDICTED: alpha carbonic anhydrase 7-like         228   2e-68   
ref|XP_010470127.1|  PREDICTED: alpha carbonic anhydrase 2-like i...    228   3e-68   
ref|XP_006286119.1|  hypothetical protein CARUB_v10007668mg             227   3e-68   
ref|XP_007211988.1|  hypothetical protein PRUPE_ppa010973mg             225   6e-68   
gb|KFK43125.1|  hypothetical protein AALP_AA1G083600                    226   6e-68   
ref|XP_003537009.2|  PREDICTED: bifunctional monodehydroascorbate...    227   7e-68   
ref|XP_008462817.1|  PREDICTED: bifunctional monodehydroascorbate...    226   7e-68   
ref|XP_004242096.1|  PREDICTED: bifunctional monodehydroascorbate...    226   8e-68   
emb|CDP15287.1|  unnamed protein product                                227   8e-68   
ref|XP_009407045.1|  PREDICTED: alpha carbonic anhydrase 7-like         226   1e-67   
ref|XP_004242097.1|  PREDICTED: bifunctional monodehydroascorbate...    226   1e-67   
ref|XP_002445622.1|  hypothetical protein SORBIDRAFT_07g022860          226   2e-67   Sorghum bicolor [broomcorn]
ref|XP_008227274.1|  PREDICTED: bifunctional monodehydroascorbate...    225   2e-67   
ref|XP_009148224.1|  PREDICTED: alpha carbonic anhydrase 7-like         225   3e-67   
ref|XP_010109499.1|  hypothetical protein L484_007519                   225   3e-67   
ref|XP_010267256.1|  PREDICTED: alpha carbonic anhydrase 7-like         225   3e-67   
ref|XP_007150177.1|  hypothetical protein PHAVU_005G133000g             224   3e-67   
ref|XP_010475599.1|  PREDICTED: alpha carbonic anhydrase 7-like         224   4e-67   
ref|XP_008241447.1|  PREDICTED: bifunctional monodehydroascorbate...    224   4e-67   
ref|XP_004304476.1|  PREDICTED: bifunctional monodehydroascorbate...    224   4e-67   
ref|XP_010458032.1|  PREDICTED: alpha carbonic anhydrase 7              224   5e-67   
gb|KGN64826.1|  hypothetical protein Csa_1G120420                       224   5e-67   
ref|XP_010488326.1|  PREDICTED: alpha carbonic anhydrase 7              224   5e-67   
ref|XP_004139553.1|  PREDICTED: bifunctional monodehydroascorbate...    224   5e-67   
ref|XP_002892434.1|  carbonic anhydrase family protein                  224   6e-67   
dbj|BAK01826.1|  predicted protein                                      224   7e-67   
gb|KHG29611.1|  Bifunctional monodehydroascorbate reductase and c...    224   9e-67   
ref|XP_006303231.1|  hypothetical protein CARUB_v10012300mg             224   9e-67   
emb|CDX95095.1|  BnaC05g05760D                                          223   1e-66   
gb|AFW61791.1|  hypothetical protein ZEAMMB73_990747                    223   1e-66   
dbj|BAK02152.1|  predicted protein                                      223   1e-66   
ref|XP_009148066.1|  PREDICTED: alpha carbonic anhydrase 7-like         223   1e-66   
ref|XP_004506040.1|  PREDICTED: bifunctional monodehydroascorbate...    223   2e-66   
ref|XP_010450977.1|  PREDICTED: alpha carbonic anhydrase 8              224   3e-66   
ref|XP_004172039.1|  PREDICTED: bifunctional monodehydroascorbate...    221   3e-66   
ref|XP_008241448.1|  PREDICTED: bifunctional monodehydroascorbate...    223   4e-66   
ref|XP_008362138.1|  PREDICTED: bifunctional monodehydroascorbate...    222   4e-66   
ref|XP_011094588.1|  PREDICTED: alpha carbonic anhydrase 7-like         222   4e-66   
gb|EMT00558.1|  Bifunctional monodehydroascorbate reductase and c...    222   6e-66   
ref|XP_007132283.1|  hypothetical protein PHAVU_011G081900g             221   8e-66   
ref|XP_009622096.1|  PREDICTED: alpha carbonic anhydrase 7-like         220   2e-65   
ref|NP_172287.1|  alpha carbonic anhydrase 7                            220   2e-65   
gb|KHN38743.1|  Bifunctional monodehydroascorbate reductase and c...    220   2e-65   
gb|EYU18693.1|  hypothetical protein MIMGU_mgv1a011955mg                219   2e-65   
ref|XP_010050605.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    221   3e-65   
ref|XP_010443286.1|  PREDICTED: alpha carbonic anhydrase 8-like         222   3e-65   
ref|XP_009767316.1|  PREDICTED: alpha carbonic anhydrase 7-like         220   3e-65   
ref|XP_006845943.1|  hypothetical protein AMTR_s00157p00085110          219   3e-65   
ref|XP_004306263.1|  PREDICTED: bifunctional monodehydroascorbate...    222   4e-65   
ref|XP_003539200.1|  PREDICTED: bifunctional monodehydroascorbate...    219   4e-65   
ref|XP_010050600.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    220   4e-65   
ref|XP_002873139.1|  carbonic anhydrase family protein                  219   4e-65   
sp|Q9FM99.2|ATCA8_ARATH  RecName: Full=Alpha carbonic anhydrase 8...    219   5e-65   
ref|XP_006845945.1|  hypothetical protein AMTR_s00157p00088030          218   5e-65   
ref|XP_007204039.1|  hypothetical protein PRUPE_ppa021069mg             218   7e-65   
ref|XP_010312400.1|  PREDICTED: alpha carbonic anhydrase 4              217   8e-65   
ref|XP_008462774.1|  PREDICTED: bifunctional monodehydroascorbate...    219   8e-65   
ref|NP_196038.1|  alpha carbonic anhydrase 3                            218   1e-64   
gb|ABK28680.1|  unknown                                                 218   1e-64   
ref|XP_006660137.1|  PREDICTED: bifunctional monodehydroascorbate...    218   1e-64   
ref|XP_004973744.1|  PREDICTED: bifunctional monodehydroascorbate...    217   3e-64   
ref|XP_009358737.1|  PREDICTED: alpha carbonic anhydrase 7-like         218   3e-64   
ref|XP_004160913.1|  PREDICTED: bifunctional monodehydroascorbate...    217   4e-64   
ref|XP_004139554.1|  PREDICTED: bifunctional monodehydroascorbate...    217   4e-64   
ref|XP_006286833.1|  hypothetical protein CARUB_v10003788mg             217   4e-64   
emb|CDX93593.1|  BnaA06g04550D                                          224   6e-64   
ref|XP_006401345.1|  hypothetical protein EUTSA_v10014359mg             216   7e-64   
ref|XP_008462835.1|  PREDICTED: bifunctional monodehydroascorbate...    216   8e-64   
ref|XP_007028639.1|  Carbonic anhydrase, putative                       216   1e-63   
gb|KEH24050.1|  eukaryotic-type carbonic anhydrase                      216   1e-63   
ref|NP_001061831.1|  Os08g0423500                                       215   1e-63   
ref|XP_008464591.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    215   1e-63   
ref|XP_008462825.1|  PREDICTED: bifunctional monodehydroascorbate...    214   3e-63   
emb|CDY41393.1|  BnaCnng10290D                                          214   3e-63   
ref|XP_009125546.1|  PREDICTED: alpha carbonic anhydrase 3-like i...    214   5e-63   
ref|XP_009122630.1|  PREDICTED: alpha carbonic anhydrase 3              214   5e-63   
ref|XP_006354411.1|  PREDICTED: bifunctional monodehydroascorbate...    214   5e-63   
sp|Q84UV8.1|NEC3_NICLS  RecName: Full=Bifunctional monodehydroasc...    214   5e-63   
ref|XP_008227263.1|  PREDICTED: bifunctional monodehydroascorbate...    213   6e-63   
ref|XP_004506042.1|  PREDICTED: bifunctional monodehydroascorbate...    213   7e-63   
ref|XP_002529417.1|  carbonic anhydrase, putative                       213   8e-63   
ref|XP_008383978.1|  PREDICTED: bifunctional monodehydroascorbate...    214   8e-63   
ref|XP_007202870.1|  hypothetical protein PRUPE_ppa015691mg             213   8e-63   
ref|XP_010109502.1|  hypothetical protein L484_007522                   213   1e-62   
ref|XP_006843475.1|  hypothetical protein AMTR_s00053p00197030          212   1e-62   
ref|XP_010490921.1|  PREDICTED: alpha carbonic anhydrase 3-like         213   1e-62   
ref|XP_010423620.1|  PREDICTED: alpha carbonic anhydrase 3              212   2e-62   
gb|EAZ07037.1|  hypothetical protein OsI_29284                          212   2e-62   
dbj|BAC99799.1|  putative dioscorin                                     212   3e-62   
gb|KFK24865.1|  hypothetical protein AALP_AA8G035000                    211   5e-62   
gb|KHG14539.1|  Bifunctional monodehydroascorbate reductase and c...    211   1e-61   
ref|XP_009125547.1|  PREDICTED: alpha carbonic anhydrase 3-like i...    210   2e-61   
ref|XP_002880942.1|  hypothetical protein ARALYDRAFT_320571             209   2e-61   
emb|CDX95097.1|  BnaC05g05740D                                          209   2e-61   
ref|XP_010488317.1|  PREDICTED: alpha carbonic anhydrase 5              209   3e-61   
ref|XP_010530484.1|  PREDICTED: alpha carbonic anhydrase 7-like         207   3e-61   
ref|XP_008241381.1|  PREDICTED: bifunctional monodehydroascorbate...    210   3e-61   
ref|XP_006398874.1|  hypothetical protein EUTSA_v10014397mg             209   3e-61   
ref|XP_008241380.1|  PREDICTED: bifunctional monodehydroascorbate...    209   6e-61   
ref|XP_002532668.1|  carbonic anhydrase, putative                       207   6e-61   
ref|XP_010322405.1|  PREDICTED: bifunctional monodehydroascorbate...    208   6e-61   
gb|KFK43123.1|  hypothetical protein AALP_AA1G083400                    208   6e-61   
ref|XP_010458030.1|  PREDICTED: alpha carbonic anhydrase 5              208   1e-60   
ref|XP_004139442.1|  PREDICTED: bifunctional monodehydroascorbate...    207   1e-60   
ref|XP_006304810.1|  hypothetical protein CARUB_v10012428mg             207   1e-60   
ref|XP_010904591.1|  PREDICTED: alpha carbonic anhydrase 7-like         208   2e-60   
ref|XP_010050579.1|  PREDICTED: alpha carbonic anhydrase 7-like         208   2e-60   
ref|XP_010475597.1|  PREDICTED: alpha carbonic anhydrase 5-like         207   2e-60   
ref|XP_006604587.1|  PREDICTED: bifunctional monodehydroascorbate...    206   4e-60   
ref|XP_006294831.1|  hypothetical protein CARUB_v10023883mg             206   5e-60   
emb|CDX76409.1|  BnaA08g09910D                                          206   5e-60   
ref|XP_003520661.2|  PREDICTED: bifunctional monodehydroascorbate...    206   5e-60   
ref|NP_172285.2|  alpha carbonic anhydrase 5                            206   6e-60   
ref|XP_006659407.1|  PREDICTED: bifunctional monodehydroascorbate...    206   6e-60   
ref|XP_006577712.1|  PREDICTED: bifunctional monodehydroascorbate...    206   6e-60   
gb|KHN18685.1|  Bifunctional monodehydroascorbate reductase and c...    206   6e-60   
emb|CAA53781.1|  storage protein                                        206   6e-60   
emb|CDX93595.1|  BnaA06g04530D                                          206   7e-60   
ref|XP_009148063.1|  PREDICTED: alpha carbonic anhydrase 5              205   1e-59   
gb|EEE68706.1|  hypothetical protein OsJ_27361                          205   1e-59   
dbj|BAK00887.1|  predicted protein                                      205   1e-59   
ref|XP_003538184.1|  PREDICTED: bifunctional monodehydroascorbate...    205   1e-59   
ref|XP_004494904.1|  PREDICTED: bifunctional monodehydroascorbate...    204   2e-59   
ref|XP_002892432.1|  carbonate dehydratase/ zinc ion binding protein    204   3e-59   
ref|XP_002532665.1|  carbonic anhydrase, putative                       203   3e-59   
gb|KHG05281.1|  Bifunctional monodehydroascorbate reductase and c...    204   4e-59   
gb|KGN64825.1|  hypothetical protein Csa_1G120410                       202   5e-59   
ref|XP_004166480.1|  PREDICTED: bifunctional monodehydroascorbate...    202   6e-59   
ref|XP_004139552.1|  PREDICTED: bifunctional monodehydroascorbate...    202   7e-59   
ref|XP_002869914.1|  carbonic anhydrase family protein                  202   8e-59   
gb|ACT36293.1|  dioscorin precursor                                     202   1e-58   
emb|CDY61773.1|  BnaAnng17740D                                          214   1e-58   
gb|ACT36289.1|  dioscorin precursor                                     202   1e-58   
gb|ACT36290.1|  dioscorin precursor                                     202   3e-58   
ref|XP_006417733.1|  hypothetical protein EUTSA_v10008451mg             201   3e-58   
gb|EAZ07038.1|  hypothetical protein OsI_29285                          201   3e-58   
ref|XP_006417731.1|  hypothetical protein EUTSA_v10009315mg             200   5e-58   
ref|NP_193832.1|  alpha carbonic anhydrase 6                            200   6e-58   
gb|AAF79837.1|AC026875_17  T6D22.16                                     200   6e-58   
emb|CAO98738.1|  dioscorin 5 precursor                                  200   8e-58   
gb|ACT36291.1|  dioscorin precursor                                     200   9e-58   
ref|XP_011044414.1|  PREDICTED: LOW QUALITY PROTEIN: alpha carbon...    200   1e-57   
ref|XP_009377054.1|  PREDICTED: alpha carbonic anhydrase 7-like         200   1e-57   
emb|CDY35256.1|  BnaA01g07750D                                          212   1e-57   
ref|NP_001175588.1|  Os08g0424100                                       200   1e-57   
gb|AAF60191.1|AF242551_1  dioscorin A                                   199   1e-57   
gb|ACT36292.1|  dioscorin precursor                                     199   1e-57   
gb|EMS55408.1|  Bifunctional monodehydroascorbate reductase and c...    199   2e-57   
gb|EMT14744.1|  Bifunctional monodehydroascorbate reductase and c...    201   2e-57   
emb|CDY65169.1|  BnaC05g49130D                                          199   2e-57   
ref|XP_010918699.1|  PREDICTED: alpha carbonic anhydrase 7-like         199   2e-57   
gb|KCW89334.1|  hypothetical protein EUGRSUZ_A01625                     198   3e-57   
emb|CAO98739.1|  dioscorin 6 precursor                                  198   3e-57   
ref|XP_008677173.1|  PREDICTED: carbonic anhydrase isoform X1           199   6e-57   
dbj|BAD18021.1|  tuber storage protein                                  197   7e-57   
emb|CAO98737.1|  dioscorin 4 precursor                                  197   1e-56   
gb|AEN14505.1|  dioscorin A3                                            196   1e-56   
pir||S57767  dioscorin class B - Dioscorea cayenensis (fragment)        196   1e-56
ref|XP_007027464.1|  Alpha carbonic anhydrase 7 isoform 2               196   2e-56   
ref|XP_010245039.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    196   2e-56   
ref|XP_009379811.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    196   4e-56   
ref|XP_008784764.1|  PREDICTED: alpha carbonic anhydrase 7-like         196   5e-56   
gb|AAF63334.1|AF245019_1  dioscorin A                                   195   6e-56   
emb|CAO98736.1|  dioscorin 3 precursor                                  195   6e-56   
gb|ACT36288.1|  dioscorin precursor                                     195   7e-56   
gb|EMS63276.1|  Bifunctional monodehydroascorbate reductase and c...    195   1e-55   
ref|NP_001066181.1|  Os12g0153500                                       195   1e-55   
ref|XP_007162791.1|  hypothetical protein PHAVU_001G180900g             194   1e-55   
ref|XP_010520706.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    195   1e-55   
ref|XP_006339307.1|  PREDICTED: bifunctional monodehydroascorbate...    193   1e-55   
ref|XP_006664349.1|  PREDICTED: bifunctional monodehydroascorbate...    194   2e-55   
ref|XP_008231952.1|  PREDICTED: bifunctional monodehydroascorbate...    194   2e-55   
gb|ACN85335.1|  unknown                                                 194   2e-55   
ref|XP_003560592.1|  PREDICTED: alpha carbonic anhydrase 7-like         194   2e-55   
dbj|BAD18020.1|  tuber storage protein                                  194   2e-55   
ref|NP_180388.2|  alpha carbonic anhydrase 2                            192   3e-55   
sp|F4IHR4.2|ATCA2_ARATH  RecName: Full=Alpha carbonic anhydrase 2...    192   6e-55   
gb|AAF44711.1|AF243526_1  dioscorin B                                   192   7e-55   
ref|XP_008810944.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    193   1e-54   
emb|CAO98735.1|  dioscorin 2 precursor                                  191   2e-54   
gb|ACN85304.1|  unknown                                                 192   2e-54   
ref|XP_004306265.1|  PREDICTED: bifunctional monodehydroascorbate...    195   3e-54   
ref|XP_008442729.1|  PREDICTED: bifunctional monodehydroascorbate...    192   4e-54   
gb|ACN85275.1|  unknown                                                 191   4e-54   
ref|XP_002323427.2|  hypothetical protein POPTR_0016s08050g             191   4e-54   
ref|XP_009115968.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    190   7e-54   
ref|XP_006296034.1|  hypothetical protein CARUB_v10025180mg             189   8e-54   
emb|CDX73611.1|  BnaC08g23920D                                          190   8e-54   
emb|CDX78118.1|  BnaA09g33130D                                          191   1e-53   
ref|XP_008810945.1|  PREDICTED: alpha carbonic anhydrase 7-like i...    190   1e-53   
emb|CAO98734.1|  dioscorin 1 precursor                                  189   2e-53   
gb|EMS68433.1|  hypothetical protein TRIUR3_33908                       189   2e-53   
ref|XP_006430188.1|  hypothetical protein CICLE_v10013720mg             189   2e-53   
ref|XP_008442726.1|  PREDICTED: bifunctional monodehydroascorbate...    188   2e-53   
ref|XP_002528758.1|  carbonic anhydrase, putative                       189   2e-53   
ref|XP_010527573.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    189   3e-53   
ref|XP_009413153.1|  PREDICTED: alpha carbonic anhydrase 7-like         188   4e-53   
ref|XP_006481762.1|  PREDICTED: bifunctional monodehydroascorbate...    188   4e-53   
ref|XP_006403779.1|  hypothetical protein EUTSA_v10010611mg             188   6e-53   
ref|XP_004959504.1|  PREDICTED: bifunctional monodehydroascorbate...    187   1e-52   
ref|XP_009374764.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    186   2e-52   
ref|XP_006403777.1|  hypothetical protein EUTSA_v10010611mg             186   2e-52   
ref|XP_010036672.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    186   2e-52   
ref|XP_011004112.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    186   2e-52   
ref|XP_008677673.1|  PREDICTED: uncharacterized protein LOC100384...    186   3e-52   
gb|KHG12744.1|  Bifunctional monodehydroascorbate reductase and c...    185   3e-52   
ref|XP_004965905.1|  PREDICTED: bifunctional monodehydroascorbate...    186   3e-52   
gb|KHN11228.1|  Bifunctional monodehydroascorbate reductase and c...    186   4e-52   
ref|XP_009389630.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    185   5e-52   
gb|AFW87496.1|  hypothetical protein ZEAMMB73_893265                    186   5e-52   
ref|XP_007150181.1|  hypothetical protein PHAVU_005G133400g             185   5e-52   
dbj|BAH20029.1|  AT3G52720                                              185   6e-52   
ref|NP_566971.2|  alpha carbonic anhydrase 1                            185   6e-52   
gb|ACN85320.1|  unknown                                                 185   7e-52   
ref|XP_009387987.1|  PREDICTED: alpha carbonic anhydrase 7-like         184   1e-51   
emb|CAN60024.1|  hypothetical protein VITISV_006907                     183   1e-51   
ref|XP_007027757.1|  Alpha carbonic anhydrase 1, putative               184   1e-51   
ref|XP_003579701.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    184   1e-51   
ref|XP_010239880.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    184   2e-51   
ref|XP_009795833.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    182   2e-51   
ref|NP_001140512.1|  uncharacterized protein LOC100272575 precursor     184   2e-51   
ref|XP_010426891.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    184   2e-51   
ref|XP_008387081.1|  PREDICTED: bifunctional monodehydroascorbate...    182   2e-51   
gb|KHN02302.1|  Bifunctional monodehydroascorbate reductase and c...    186   3e-51   
ref|XP_004149223.1|  PREDICTED: bifunctional monodehydroascorbate...    182   5e-51   
ref|XP_002309427.2|  hypothetical protein POPTR_0006s22940g             182   5e-51   
ref|XP_011077861.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    183   5e-51   
ref|XP_004161225.1|  PREDICTED: bifunctional monodehydroascorbate...    182   5e-51   
gb|EMT10087.1|  Bifunctional monodehydroascorbate reductase and c...    182   7e-51   
ref|XP_010271743.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    182   7e-51   
ref|XP_006341109.1|  PREDICTED: bifunctional monodehydroascorbate...    182   9e-51   
ref|XP_009390032.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    181   1e-50   
ref|XP_010515745.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    182   2e-50   
ref|XP_010504017.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    181   2e-50   
ref|XP_002877879.1|  carbonic anhydrase family protein                  181   3e-50   
gb|KEH42020.1|  eukaryotic-type carbonic anhydrase                      180   3e-50   
gb|EMS54273.1|  Bifunctional monodehydroascorbate reductase and c...    181   4e-50   
gb|EYU38639.1|  hypothetical protein MIMGU_mgv1a011347mg                180   5e-50   
gb|EMT14743.1|  Bifunctional monodehydroascorbate reductase and c...    179   6e-50   
ref|XP_011004239.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    179   8e-50   
gb|KDP37301.1|  hypothetical protein JCGZ_06755                         179   8e-50   
ref|XP_008442846.1|  PREDICTED: bifunctional monodehydroascorbate...    179   1e-49   
ref|XP_009606839.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    179   1e-49   
ref|XP_010325903.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    179   1e-49   
gb|ACN85281.1|  unknown                                                 180   1e-49   
ref|XP_010931134.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    179   1e-49   
gb|EMT00557.1|  Bifunctional monodehydroascorbate reductase and c...    179   2e-49   
ref|XP_009796023.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    179   2e-49   
gb|KEH42021.1|  eukaryotic-type carbonic anhydrase                      177   2e-49   
ref|XP_008243568.1|  PREDICTED: bifunctional monodehydroascorbate...    178   3e-49   
ref|XP_010101554.1|  hypothetical protein L484_015378                   177   3e-49   
ref|XP_010912301.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    178   3e-49   
ref|XP_010912303.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    177   4e-49   
gb|KEH42022.1|  eukaryotic-type carbonic anhydrase                      177   6e-49   
ref|XP_008784028.1|  PREDICTED: alpha carbonic anhydrase 1, chlor...    177   7e-49   
ref|XP_009776976.1|  PREDICTED: alpha carbonic anhydrase 7-like         174   7e-49   
ref|XP_007144395.1|  hypothetical protein PHAVU_007G152600g             177   8e-49   
ref|XP_006291539.1|  hypothetical protein CARUB_v10017694mg             177   1e-48   
emb|CDP15426.1|  unnamed protein product                                176   2e-48   



>ref|XP_009363226.1| PREDICTED: alpha carbonic anhydrase 4-like [Pyrus x bretschneideri]
Length=280

 Score =   276 bits (705),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 166/233 (71%), Gaps = 0/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T FTY+ G   GP KWG++   + VC+ G MQSPIN+ D  VKV  K G+L R YK + A
Sbjct  41   TAFTYLEGTGKGPKKWGQIDPQWKVCDNGKMQSPINLLDQRVKVFPKLGKLKREYKPAPA  100

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            I+ N+GH + ++W GDAGKI INGTDY +LQCHWH+PSE+T NG +  +E H+VH S+  
Sbjct  101  IVKNRGHDITMRWNGDAGKIKINGTDYRLLQCHWHSPSEHTFNGSRYALEFHIVHVSSTR  160

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
            + A + I+YK G+PD  L +L + I+ V +    +G +NPG I +  +KYYR+IGSLT P
Sbjct  161  KIAVIGIVYKYGRPDPLLSKLFHHIKSVGKEEVDIGIINPGDIKFGSRKYYRYIGSLTVP  220

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GVIWT+ K+V+TVS+EQ++ L+EAV DGYE NARP Q L+GR V L  P
Sbjct  221  PCTEGVIWTIVKKVRTVSREQVHALREAVHDGYEANARPTQELDGRPVLLYTP  273



>ref|XP_008351630.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=280

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 165/233 (71%), Gaps = 0/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T FTY+ G   GP KWG++   + VC+ G MQSPI++ D  V+V  K G+L R YK + A
Sbjct  41   TAFTYLEGTGKGPKKWGQIDPQWKVCDNGKMQSPIDLLDQRVQVFPKLGKLKRXYKPAPA  100

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            I+ N+GH + ++W GDAGK  INGTDY +LQCHWH+PSE+T NG +  +E H+VH S+  
Sbjct  101  IVKNRGHDITMRWNGDAGKTKINGTDYRLLQCHWHSPSEHTFNGSRYALEFHIVHVSSTG  160

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
            + A + I+YK G+PD FL +L + I+ V +    +G +NPG I +  +KYYR+IGSLT P
Sbjct  161  KIAVIGIVYKYGRPDPFLSKLFHHIKSVGKEEVDIGIINPGDIKFGSRKYYRYIGSLTVP  220

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GVIWT+ K+V+TVS+EQ+  L+EAV DGYE NARP Q L+GR V L  P
Sbjct  221  PCTEGVIWTIVKKVRTVSREQVRALREAVHDGYEANARPTQELDGRPVLLYTP  273



>emb|CDP14170.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 169/234 (72%), Gaps = 1/234 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            + FTY  G   GP  WG +   + VC+ G +QSPI++ D  V++    G+L R YK + A
Sbjct  38   SPFTYEEGTGKGPKNWGHIDPQWQVCDKGKLQSPIDLLDERVQIFPGLGKLKRGYKPAAA  97

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            ++ N+GH + ++W GDAGKI+ NGTDY +LQCHWH+PSE+T+NG + ++E+H+VHRS+  
Sbjct  98   VLKNRGHDISVEWRGDAGKIVANGTDYKVLQCHWHSPSEHTLNGTRHNLELHIVHRSSSG  157

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDR-NGKALGALNPGKITYEGKKYYRFIGSLTT  711
              A V ILYKIG+PD FL +LL+ I++ D  +   LG ++PG I +  +KYYR+IGSLT 
Sbjct  158  GIAVVGILYKIGRPDSFLAKLLHHIKRADEGDAIDLGVVSPGDIKFGSRKYYRYIGSLTV  217

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PPC++GV+WT+ K+V+TVS+EQI  +++ V DG+E NARPLQ  NGR VYL +P
Sbjct  218  PPCTEGVLWTIVKKVRTVSREQIRAIRDVVHDGFEANARPLQQENGRPVYLYRP  271



>ref|XP_010036307.1| PREDICTED: alpha carbonic anhydrase 4-like [Eucalyptus grandis]
 gb|KCW47833.1| hypothetical protein EUGRSUZ_K01571 [Eucalyptus grandis]
Length=299

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 168/242 (69%), Gaps = 3/242 (1%)
 Frame = +1

Query  157  ASESE---GTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGEL  327
            ASESE    T FTYI G   GP +WG++   +  C  G +QSPI++ +  V+V    G+L
Sbjct  51   ASESEVDDETPFTYIEGTGKGPKEWGQIDPRWQACGMGKLQSPIDLLNERVQVFPNLGKL  110

Query  328  IRRYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEI  507
             R YK + AI+ N+GH + + W GDAGKI INGT Y +LQCHWH+PSE+T NG + D+E+
Sbjct  111  KRDYKPAPAIVRNRGHDITVMWKGDAGKININGTYYKLLQCHWHSPSEHTFNGSRYDLEL  170

Query  508  HLVHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYY  687
            H+VH S+  E A + I+YK G+PD FL +LL  I  V +    LG +NPG I +  +KY+
Sbjct  171  HMVHLSSHGEIAVIGIVYKYGRPDPFLTKLLEHITVVGKEDTDLGVINPGIIKFGSRKYF  230

Query  688  RFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLN  867
            R+IGSLT PPC++GV+WT+ ++V+TVS++Q+  L+EAV DGYE NARP Q L+GR V+L 
Sbjct  231  RYIGSLTVPPCTEGVVWTIVRKVRTVSRKQVEALREAVHDGYEANARPTQQLDGRAVWLY  290

Query  868  QP  873
             P
Sbjct  291  TP  292



>ref|XP_010036662.1| PREDICTED: alpha carbonic anhydrase 4-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW48290.1| hypothetical protein EUGRSUZ_K02021 [Eucalyptus grandis]
Length=277

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 170/242 (70%), Gaps = 3/242 (1%)
 Frame = +1

Query  157  ASESE---GTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGEL  327
            ASESE    T FTYI G   GP +WG++  ++  C+ G +QSPI++ D  V+V    G+L
Sbjct  29   ASESEVGDETPFTYIEGTGKGPKEWGQIDPHWRACSTGKLQSPIDLLDERVQVFPNLGKL  88

Query  328  IRRYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEI  507
             R YK + AI+ N+GH + + W G AG+I INGT Y +LQCHWH+PSE+T NG K D+E+
Sbjct  89   KRDYKPAPAIVRNRGHDITVMWKGYAGQININGTYYKLLQCHWHSPSEHTFNGSKYDLEL  148

Query  508  HLVHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYY  687
            H+VH S+  E A + I+YK G+PD FL +LL  I+ V +  + LG +NPG I +  +KY+
Sbjct  149  HVVHLSSHGEIAVIGIVYKYGRPDPFLTKLLEHIKVVRKEDRDLGVINPGIIKFGSRKYF  208

Query  688  RFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLN  867
            R+IGSLT PPC++GV+WT+ ++V+TVS+EQ+  L+EAV DGYE NARP Q L+ R V+L 
Sbjct  209  RYIGSLTVPPCTEGVVWTIIRKVRTVSREQVEALREAVHDGYEANARPTQRLDRRAVWLY  268

Query  868  QP  873
             P
Sbjct  269  TP  270



>ref|XP_010696305.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=276

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 170/231 (74%), Gaps = 2/231 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F YI G+E GP +WG++   +  C+ G MQSPI++ D+ VKVT +  E+ R Y+ + A+
Sbjct  36   EFDYIRGSEMGPERWGEIRPEWATCSTGEMQSPIDLLDARVKVTPRSAEINRLYRPTRAM  95

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH ++++W  D+ +I INGT+Y + Q HWH+PSE+T+NGK+ DME+H+VH+S  ++
Sbjct  96   LRNRGHDIELEWEDDSSRIQINGTEYILRQSHWHSPSEHTINGKRYDMELHMVHQSRDNQ  155

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKAL--GALNPGKITYEGKKYYRFIGSLTT  711
             A + +LYKIGKP+ FL +L+N+IR +      L  G +NP +I   G+KYYR++GSLTT
Sbjct  156  TAVIGLLYKIGKPNHFLSKLMNNIRLISETTLELDVGIINPSRIKMGGRKYYRYLGSLTT  215

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            PPC++GVIWT+  ++ TVS+EQ++LL+EAV D  EENARPLQ  NGR + L
Sbjct  216  PPCTEGVIWTLNTQIGTVSEEQVSLLREAVHDHAEENARPLQRTNGRNMRL  266



>ref|XP_002323272.2| hypothetical protein POPTR_0016s04300g [Populus trichocarpa]
 gb|EEF05033.2| hypothetical protein POPTR_0016s04300g [Populus trichocarpa]
Length=283

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 164/233 (70%), Gaps = 0/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T+FTY  G E GP  WGK++ ++  C  G MQSPI++ D  V+V    G+L R Y+++ A
Sbjct  44   TQFTYEEGTEEGPKNWGKINPHWEACGKGKMQSPIDVLDRRVEVFPNLGKLRRDYQAAPA  103

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + + W GDAGKI IN TDY + QCHWH+PSE+T NG + D+E+HLVH S++ 
Sbjct  104  AVKNRGHDITVIWKGDAGKITINDTDYQLQQCHWHSPSEHTFNGSRHDLELHLVHYSSQG  163

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
              A V+I+YK G+PD+FL +LL  I  VD   + +G +NPG I +  +KYYR++GSLT P
Sbjct  164  GIAVVAIVYKYGRPDRFLSKLLRHINHVDHREREMGIVNPGDIKFGSRKYYRYVGSLTVP  223

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GV+WT+  +V+TVS+EQ+  L++AV DG+E NARP QP  G  +Y  +P
Sbjct  224  PCTEGVVWTIVMKVRTVSREQVKALRDAVHDGFEANARPTQPSTGIPMYEYRP  276



>ref|XP_008244285.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=277

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 166/233 (71%), Gaps = 0/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            TKFTYI G   GP KWG++  ++ VC+ G +QSPI++ D  V+V    G+L R YK + A
Sbjct  42   TKFTYIEGTGKGPKKWGQIDPHWKVCDNGKLQSPIDLLDQRVQVFPNLGKLKRDYKPAPA  101

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + ++W GDAGKI INGTD+ +LQCHWH+PSE+T NG +  +E+H++H S+  
Sbjct  102  TVKNRGHDITVRWKGDAGKININGTDFGLLQCHWHSPSEHTFNGSRYALELHVIHLSSTH  161

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
            + A + I+YK G+PD FL +LL+ ++ V      +G +N G I +  +KYYR+IGSLT P
Sbjct  162  KIAVIGIVYKYGRPDPFLSKLLHHVKSVGTKEVDIGMINSGDIKFGSRKYYRYIGSLTVP  221

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GVIWT+ K+V+TVS+EQ+  L+EAV DG+E NARP Q L+GR V L  P
Sbjct  222  PCTEGVIWTIVKKVRTVSREQVRALREAVHDGFEANARPTQQLDGRPVLLYTP  274



>ref|XP_011033188.1| PREDICTED: alpha carbonic anhydrase 4-like [Populus euphratica]
 ref|XP_011033189.1| PREDICTED: alpha carbonic anhydrase 4-like [Populus euphratica]
Length=330

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 166/242 (69%), Gaps = 3/242 (1%)
 Frame = +1

Query  157  ASESE---GTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGEL  327
            A ESE    T+FTY  G E GP  WGK++ ++  C  G MQSPI++ D  V+V    G L
Sbjct  82   AFESEVEDETQFTYEEGTEKGPKNWGKINPHWEACGKGKMQSPIDVLDRRVEVFPNLGRL  141

Query  328  IRRYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEI  507
             R Y+++ A + N+GH + + W GDAGKI IN TDY + QCHWH+PSE+  NG + D+E+
Sbjct  142  RRDYQAAPAAVKNRGHDITVIWKGDAGKITINDTDYQLQQCHWHSPSEHAFNGTRHDLEL  201

Query  508  HLVHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYY  687
            HLVH S++   A V+I+YK G+PD+FL +LL  I  VD   + +G +NPG I +  +KYY
Sbjct  202  HLVHYSSQGGIAVVAIVYKYGRPDRFLSKLLRHINHVDHREREMGIVNPGDIKFGSRKYY  261

Query  688  RFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLN  867
            R+IGSLT PPC++GV+WT+ K+V+TVS+EQ+  L++AV DG+E NARP QP  G  +Y  
Sbjct  262  RYIGSLTVPPCTEGVVWTIVKKVRTVSREQVKALRDAVHDGFEANARPAQPSTGIPMYEY  321

Query  868  QP  873
             P
Sbjct  322  SP  323



>ref|XP_007202419.1| hypothetical protein PRUPE_ppa009714mg [Prunus persica]
 gb|EMJ03618.1| hypothetical protein PRUPE_ppa009714mg [Prunus persica]
Length=281

 Score =   264 bits (674),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 165/232 (71%), Gaps = 0/232 (0%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            KFTYI G   GP KWG++  ++ VC+ G +QSPI++ D  V+V    G+L R YK + A 
Sbjct  43   KFTYIEGTGKGPKKWGQIDPHWKVCDNGKLQSPIDLLDQRVQVFPNLGKLKRDYKPAPAT  102

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W GDAGKI INGTD+ +LQCHWH+PSE+T NG +  +E+H++H S+  +
Sbjct  103  VKNRGHDVTVRWKGDAGKININGTDFGLLQCHWHSPSEHTFNGSRYALELHVIHLSSTHK  162

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTPP  717
             A + I+YK G+PD FL +LL+ I+ V      +G +N G I +  +KYYR+IGSLT PP
Sbjct  163  IAVIGIVYKYGRPDPFLSKLLHHIKSVGTKEVDIGMINSGDIKFGSRKYYRYIGSLTVPP  222

Query  718  CSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            C++GVIWT+ K+V+TVS+EQ+  L+EAV DG+E NARP Q L+GR V L  P
Sbjct  223  CTEGVIWTIVKKVRTVSREQVRALREAVHDGFEANARPTQQLDGRPVLLYTP  274



>ref|XP_007028632.1| Carbonic anhydrase, putative [Theobroma cacao]
 gb|EOY09134.1| Carbonic anhydrase, putative [Theobroma cacao]
Length=273

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 115/237 (49%), Positives = 169/237 (71%), Gaps = 0/237 (0%)
 Frame = +1

Query  169  EGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSS  348
            EG +F Y  G+  GP +WG L   +  C+ GN+QSPI+I   +V ++   G+L   Y SS
Sbjct  34   EGDEFNYDEGSGRGPSRWGSLKPEWQTCSTGNLQSPIDIPVGSVLLSPALGDLQTSYASS  93

Query  349  EAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSA  528
             A++ N+GH + + W GDAGK+ INGTDY +LQCHWH+PSE+T +G + D+EIH+VH++A
Sbjct  94   PAVLKNRGHDIAVMWNGDAGKVDINGTDYKILQCHWHSPSEHTFDGTRHDLEIHIVHQNA  153

Query  529  KDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             ++ A VS++++ G+PD FL  LL+SI+ V    K LG +NPG I + G++Y+R+ GSL+
Sbjct  154  NNQIAVVSMVFQFGQPDPFLSALLSSIKTVGGGEKELGNVNPGDIGFVGRQYFRYTGSLS  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*E  879
            TPPC++GVIWTV ++VKT S EQ+  LK+A+ + ++EN+RP QPL GR V   +P E
Sbjct  214  TPPCTEGVIWTVFQQVKTASTEQVQALKDALTEQFKENSRPTQPLGGRLVSFYEPGE  270



>emb|CAM59682.1| a-type carbonic anhydrase [Lotus japonicus]
Length=269

 Score =   262 bits (669),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 168/240 (70%), Gaps = 3/240 (1%)
 Frame = +1

Query  157  ASESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRR  336
            ASES+G ++ Y  GA NGP  WG L   + VC  G  QSPI+I +  V+  S+ G+L + 
Sbjct  29   ASESKGEEYIYTKGARNGPENWGSLKPEWEVCRNGKSQSPIDIKN--VEGFSQLGKLKKD  86

Query  337  YKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLV  516
            YK + A + N+GH + +QW GDAGK+ INGT Y  +Q HWHTPSE+T+NG K DME+H V
Sbjct  87   YKVAPATLKNRGHDIMLQWDGDAGKLNINGTYYKFVQSHWHTPSEHTLNGSKFDMEMHAV  146

Query  517  HRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQV-DRNGKALGALNPGKITYEGKKYYRF  693
            H ++K E A + I Y IG+PD  L +LL++I+   D     LG LNPG I +  +KYYR+
Sbjct  147  HENSKGERAVIGIWYTIGQPDPLLSKLLDNIKLSGDNKDIDLGILNPGLIKFGSRKYYRY  206

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            +GSLTTPPCS+GVIWT+ K+V+TVS+EQ+  LKEAV DG+E NARP Q LNGR V+L  P
Sbjct  207  VGSLTTPPCSEGVIWTIVKKVRTVSREQLKALKEAVHDGFEINARPTQELNGRKVWLYTP  266



>ref|XP_006413835.1| hypothetical protein EUTSA_v10027157mg [Eutrema salsugineum]
 gb|ESQ55288.1| hypothetical protein EUTSA_v10027157mg [Eutrema salsugineum]
Length=268

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 169/233 (73%), Gaps = 1/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T FTY    + GP  W K++ ++ VCN G  QSPI++ +  V +  +     R YK + A
Sbjct  34   TAFTYEQNPDKGPEGWSKVNPHWKVCNTGKFQSPIDLTNQRVSLI-RDQAWSRDYKPAPA  92

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            +I+N+GH + + W GDAGKI I GT++ ++QCHWH+PSE+TVNG + DME+H+VH SA+ 
Sbjct  93   VIMNRGHDIMVSWKGDAGKITIRGTEFKLVQCHWHSPSEHTVNGTRYDMELHMVHTSARG  152

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
            + A + +LY++GKP++FL +LLN I+ V++  K+LG ++P  I ++ KK+YR+IGSLT P
Sbjct  153  QTAVIGVLYRLGKPNEFLTRLLNGIKTVEKEEKSLGIVDPRSIRFQTKKFYRYIGSLTVP  212

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GVIWT+ K+V T+SQEQI  L+ AVDDGYE N+RP+Q  +GR+++   P
Sbjct  213  PCTEGVIWTIVKKVNTISQEQIAALRNAVDDGYETNSRPVQDPHGRSIWFYDP  265



>gb|KHN39018.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=278

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 166/236 (70%), Gaps = 6/236 (3%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F YI G+E GP  WG+L   +  C +G MQSPI++    V+V  K GEL + YK   A
Sbjct  36   SEFDYIKGSEKGPSHWGELKKEWETCKSGKMQSPIDLSSHRVRVVPKLGELKKYYKPQNA  95

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
             + N+GH ++++W GDAG I INGT++F+ QCHWH+PSE+T+NG++ D+E+H+VH S   
Sbjct  96   TVKNRGHDIELKWEGDAGSININGTEFFLHQCHWHSPSEHTINGRRYDLELHMVHESKRI  155

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIRQV--DRNGKALGALNPGKITYEGKKYYRFI  696
              K + A V + YKIG+PD  L +L   I+ +  +   K +GA +P KI   GKKYYR++
Sbjct  156  NGKGKIAVVGLFYKIGRPDSVLNKLSKFIKTMVDEEEEKNIGAFDPSKIKLGGKKYYRYM  215

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            GSLT PPC++GVIWT+ K+++TVS+ Q+NLL+EAV D  E+NARP+QPLN R + L
Sbjct  216  GSLTVPPCTEGVIWTINKKIRTVSRAQVNLLREAVHDHAEKNARPIQPLNRRGIQL  271



>ref|XP_007028635.1| Alpha carbonic anhydrase 4, putative [Theobroma cacao]
 gb|EOY09137.1| Alpha carbonic anhydrase 4, putative [Theobroma cacao]
Length=279

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 165/231 (71%), Gaps = 0/231 (0%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            FTY  G   GP +WG ++ ++ +C+ G +QSPI++    V+V  K G+L R YK + A++
Sbjct  42   FTYTEGTGKGPKEWGHINPHWKLCDTGKLQSPIDLLSEKVQVLPKLGKLKRDYKPAPAVV  101

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
             N+GH + ++W GDAGKI INGTDY +LQCHWH+PSE+T NG + ++E+H+VH SA  E 
Sbjct  102  KNRGHDITVRWEGDAGKININGTDYKLLQCHWHSPSEHTFNGTRHELELHIVHLSAHGEI  161

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTPPC  720
            A V+I++K G+PD+FL +L + I+ +    K LG +NPG I +  +KYYR+IGSLT PPC
Sbjct  162  AVVAIVFKYGRPDRFLARLFHHIKTMGNEEKNLGMVNPGDIKFGSRKYYRYIGSLTVPPC  221

Query  721  SQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            ++GV+WT+ K+V+T ++EQ+  L++AV DG+E NARP Q L+ R V    P
Sbjct  222  TEGVVWTIVKKVRTATREQVRALRDAVHDGFEANARPTQRLDERPVLFYAP  272



>ref|XP_008364026.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=246

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 165/234 (71%), Gaps = 1/234 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T FTY+ G   GP KWG++  ++ VC+ G +QSPI++ D  V+V    G+L R YK + A
Sbjct  6    TPFTYLEGTGKGPKKWGEIDPHWKVCDTGKLQSPIDLLDQRVQVFPHLGKLKRGYKPAPA  65

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + ++W GDAGKI INGTDY +LQCHWH+PSE+T NG +  +E H+VH S+  
Sbjct  66   TVKNRGHDITMRWNGDAGKININGTDYRLLQCHWHSPSEHTFNGSRYALEFHVVHLSSTG  125

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA-LGALNPGKITYEGKKYYRFIGSLTT  711
            + A + I+YK G+PD  L +L + I+ V    +  +G +NPG I +  +KYYR+IGSLT 
Sbjct  126  KIAVIGIVYKYGRPDPLLSKLFHHIKSVGIEEEVDIGIINPGDIKFGSRKYYRYIGSLTV  185

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PPC++GVIWT+ K+V+TVS+EQ++ L+EAV DG+E NARP Q L+GR V L  P
Sbjct  186  PPCTEGVIWTIVKKVRTVSREQVHALREAVHDGFEMNARPTQELDGRPVLLYTP  239



>ref|XP_009400916.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=282

 Score =   261 bits (666),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 110/236 (47%), Positives = 170/236 (72%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y  G+ NGP +WG++   + +CN G+MQSPI++    VKV    G L R Y+++ A
Sbjct  36   SEFSYEEGSPNGPQRWGEIREEWAICNNGDMQSPIDLLHERVKVLPGLGRLRRSYRAANA  95

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + ++W  +AG+I I+GTDY + QCHWH+PSE+++NGK+  +E+H+VH+SA +
Sbjct  96   TLKNRGHDIMLEWPEEAGRIHIDGTDYELKQCHWHSPSEHSINGKRFALELHMVHQSADE  155

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNG---KALGALNPGKITYEGKKYYRFIGSL  705
              A V I+YKIG+PD FL +L+  I ++  N    + +G ++P  I    +KYYR++GSL
Sbjct  156  RVAVVGIMYKIGRPDSFLTELMEYIEEIAGNKEEERVVGFVDPRYIKIGSRKYYRYMGSL  215

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTPPC QGV+WT++++++TVS++Q++LL+EAV D  E NARPLQPLNGR +    P
Sbjct  216  TTPPCKQGVVWTISEKIRTVSKDQVSLLREAVHDDAENNARPLQPLNGREIQFYTP  271



>gb|KDP26093.1| hypothetical protein JCGZ_21126 [Jatropha curcas]
Length=269

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 165/234 (71%), Gaps = 1/234 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            + FTY      GP  WG +   + VCN G +QSPI++ +  V+ +SK G+L R YK + A
Sbjct  29   SPFTYDEDTGKGPKHWGNIEPEWQVCNNGKLQSPIDLLNKRVQTSSKLGKLHRCYKPAPA  88

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + + W GDAGKI INGTDY + QCHWH+PSE+T NG + ++EIHLVH S++ 
Sbjct  89   SVKNRGHDIAVIWKGDAGKIKINGTDYKLQQCHWHSPSEHTFNGSRYELEIHLVHESSEG  148

Query  535  EFAAVSILYKIGKPDKFLGQLLNSI-RQVDRNGKALGALNPGKITYEGKKYYRFIGSLTT  711
            + A + I+YK G+ D FL +L   I R V++    LG +NPG I +  +KYYR+ GSLTT
Sbjct  149  KIAVIGIVYKYGRHDPFLSKLFQHIKRTVEKEEIDLGIVNPGNIRFGSRKYYRYNGSLTT  208

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PPC++GVIWT+ K+V+TVS+EQ+  L++AV DG+E NARP QPL+GR VY+ +P
Sbjct  209  PPCTEGVIWTIVKKVRTVSREQVKALRDAVHDGFEANARPSQPLDGRPVYMYRP  262



>ref|XP_008360674.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=280

 Score =   260 bits (664),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 165/234 (71%), Gaps = 1/234 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T FTY+ G   GP KWG++  ++ VC+ G +QSPI++ D  V+V    G+L R YK + A
Sbjct  40   TPFTYLEGTGKGPKKWGEIDPHWKVCDTGKLQSPIDLLDQRVQVFPHLGKLKRGYKPAPA  99

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + ++W GDAGKI INGTDY +LQCHWH+PSE+T NG +  +E H+VH S+  
Sbjct  100  TVKNRGHDITMRWNGDAGKININGTDYRLLQCHWHSPSEHTFNGSRYALEFHVVHLSSTG  159

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA-LGALNPGKITYEGKKYYRFIGSLTT  711
            + A + I+YK G+PD  L +L + I+ V    +  +G +NPG I +  +KYYR+IGSLT 
Sbjct  160  KIAVIGIVYKYGRPDPLLSKLFHHIKSVGIEEEVDIGIINPGDIKFGSRKYYRYIGSLTV  219

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PPC++GVIWT+ K+V+TVS+EQ++ L+EAV DG+E NARP Q L+GR V L  P
Sbjct  220  PPCTEGVIWTIVKKVRTVSREQVHALREAVHDGFEMNARPTQELDGRPVLLYTP  273



>ref|XP_003553396.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=275

 Score =   259 bits (663),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 118/240 (49%), Positives = 166/240 (69%), Gaps = 0/240 (0%)
 Frame = +1

Query  160  SESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRY  339
            S++E  KFTY  G+  GP  W  ++  +  C  G +QSPI++ D  V+   + G+L + Y
Sbjct  31   SKAEDEKFTYAIGSSTGPENWWHVNQKWKTCGDGKLQSPIDLLDQRVQELPQLGKLKKAY  90

Query  340  KSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVH  519
            KS+ A++ N GH + ++W GDAG + IN T Y ++QCHWHTPSE+T+NG K D+E+H VH
Sbjct  91   KSAPAVLKNSGHDIVLEWKGDAGHLNINETYYNLIQCHWHTPSEHTLNGTKFDLELHAVH  150

Query  520  RSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIG  699
            +S+K EFA + ILYKIG PD F  +LLN I+        +G +NP +I ++ + YYR++G
Sbjct  151  KSSKGEFAVIGILYKIGSPDPFFSKLLNDIKSSVDKDIDVGVINPREIKFKSRPYYRYVG  210

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*E  879
            SLTTPPC++GV+WT+ K+V+TVS EQ++ LK AV  GYEENARP Q L GR V+L  P E
Sbjct  211  SLTTPPCTEGVVWTIVKKVRTVSSEQLSALKGAVHHGYEENARPTQELGGRQVWLYGPME  270



>gb|KHN10833.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3, partial [Glycine soja]
Length=237

 Score =   258 bits (660),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 116/232 (50%), Positives = 161/232 (69%), Gaps = 0/232 (0%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y  G  NGP  W  L+  + VC  G +QSPI++ D  VKV  + GEL + YK + A+
Sbjct  4    EFSYAKGTSNGPENWWHLNPKWKVCQYGKLQSPIDLRDRWVKVLPQLGELQKVYKPAPAV  63

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N GH + ++W GDAG++ ING  Y ++Q HWHTPSE+T+NG K D+E+H VH++++ E
Sbjct  64   LKNMGHYITVRWNGDAGQLRINGNYYKLIQFHWHTPSEHTLNGLKFDLELHAVHQNSRGE  123

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTPP  717
             A + I YKIG PD FL +LLN+I+ +      LG +NPG I +  +KYYR++GSLT PP
Sbjct  124  TAVIGIWYKIGSPDPFLSKLLNNIKSIRDKDIDLGVINPGDIYFRSRKYYRYVGSLTNPP  183

Query  718  CSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            C++GV+W+  KEVKTVS EQ++ LK AV  G+EENARP Q L GR V+L  P
Sbjct  184  CTEGVVWSFVKEVKTVSMEQLSALKGAVHHGFEENARPTQALKGRQVWLYNP  235



>ref|XP_008464600.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate 
reductase and carbonic anhydrase nectarin-3-like [Cucumis 
melo]
Length=278

 Score =   260 bits (664),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/243 (50%), Positives = 168/243 (69%), Gaps = 4/243 (2%)
 Frame = +1

Query  157  ASESE---GTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGEL  327
            ASESE    + F+Y  G  NGP +WGKL   +  C  G  QSPINI +  V+V    G+L
Sbjct  34   ASESEVGDESLFSYNEGNGNGPKEWGKLKPEWKSCGKGKYQSPINIVEEDVQVLPNLGKL  93

Query  328  IRRYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEI  507
             R Y  + AI+ N+GH + I+W  DAGKI +NGT Y + QCHWH PSE++ NGK+ D+E+
Sbjct  94   TRDYNPAPAILKNRGHDILIRWEKDAGKITMNGTKYKLSQCHWHAPSEHSFNGKRYDLEM  153

Query  508  HLVHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQV-DRNGKALGALNPGKITYEGKKY  684
            H+VH S  +E A V+ILYK G+PD+FL +L + I+ +  +  K +G +NPG I + G+KY
Sbjct  154  HIVHTSNHNETAVVAILYKFGRPDRFLSRLFHHIKSIGKKEEKEIGMVNPGDIKFGGRKY  213

Query  685  YRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            YR+IGSLT PPC++GVIWT+ K+V+TVS+EQ+  LK A+ DG ++NARP+Q L+GR +  
Sbjct  214  YRYIGSLTVPPCTEGVIWTIQKKVRTVSREQVRALKTAIHDGLKKNARPIQALDGRRIQF  273

Query  865  NQP  873
              P
Sbjct  274  YTP  276



>ref|XP_004493459.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X2 [Cicer arietinum]
Length=275

 Score =   259 bits (663),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/236 (51%), Positives = 163/236 (69%), Gaps = 0/236 (0%)
 Frame = +1

Query  157  ASESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRR  336
            AS+S   ++ Y  G++ GP  WG +   + VC  G +QSPI+I +  V+   + G L R 
Sbjct  30   ASDSTTDEYNYKVGSKEGPENWGNMKPEWKVCGIGKLQSPIDICNKRVQEFPQLGILQRD  89

Query  337  YKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLV  516
            YK + A+++N+GH + +QW GDAG I INGT Y ++QCHWHTPSE+T++G K DME+H V
Sbjct  90   YKPAPAVLLNRGHDVMVQWNGDAGNININGTYYKLVQCHWHTPSEHTLSGSKYDMELHAV  149

Query  517  HRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFI  696
            H+S+  E A + + YKIGKPD FL +LL+ I+ +D     +G +NP  I +  KKYYR+I
Sbjct  150  HKSSTGETAVIGVWYKIGKPDPFLSKLLDQIKLIDDKEIDVGTINPADIKFANKKYYRYI  209

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            GSLTTPPC++GV WT+ K+VKT S EQI  LKEAV  G+EENARP Q L  R V+L
Sbjct  210  GSLTTPPCTEGVTWTIVKKVKTASIEQIIALKEAVHRGFEENARPTQNLGAREVWL  265



>gb|KHN14952.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=275

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/240 (49%), Positives = 166/240 (69%), Gaps = 0/240 (0%)
 Frame = +1

Query  160  SESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRY  339
            S++E  KFTY  G+  GP  W +++  +  C  G +QSPI++ D  V+   + G+L + Y
Sbjct  31   SKAEDEKFTYAIGSSTGPENWWRVNQKWKTCGDGKLQSPIDLLDQRVQELPQLGKLKKAY  90

Query  340  KSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVH  519
            KS+ A++ N GH + ++W GDAG + IN T Y ++QCHWHTPSE+T+NG K D+E+H VH
Sbjct  91   KSAPAVLKNSGHDIVLEWKGDAGHLNINETYYNLIQCHWHTPSEHTLNGTKFDLELHAVH  150

Query  520  RSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIG  699
            +S+K EFA + ILYKIG PD F  +LLN I+        +G +NP +I ++ + YYR++G
Sbjct  151  KSSKGEFAVIGILYKIGSPDPFFSKLLNDIKSSVDKDIDVGVINPREIKFKSRPYYRYVG  210

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*E  879
            SLTTPPC++GV+WT+ K+V TVS EQ++ LK AV  GYEENARP Q L GR V+L  P E
Sbjct  211  SLTTPPCTEGVVWTIVKKVLTVSSEQLSALKGAVHHGYEENARPTQELGGRQVWLYGPME  270



>emb|CDX76404.1| BnaA08g09960D [Brassica napus]
Length=268

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/240 (49%), Positives = 166/240 (69%), Gaps = 3/240 (1%)
 Frame = +1

Query  157  ASESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRR  336
            A   + T FTY    E GP  WGK++ ++  CN G  QSPI++ ++ V +     E  RR
Sbjct  29   AEVDDETPFTYEQNPEKGPEGWGKINPHWKTCNTGKFQSPIDLTNARVSIIRD--EAWRR  86

Query  337  -YKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK + A+I+N+GH + + W GDAGKI I  T+Y ++QCHWH+PSE+TVNG + DME+H+
Sbjct  87   QYKPAPAVIVNRGHDVMVSWKGDAGKITIRRTEYKLVQCHWHSPSEHTVNGTRYDMELHM  146

Query  514  VHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRF  693
            VH SA  + A + +LYK+GKP++FL +LL+ I+ V +  + LG + P  I ++ KK+YR+
Sbjct  147  VHTSAGGKTAVIGVLYKLGKPNEFLTRLLDGIKTVGKEERDLGIVEPRTIRFQTKKFYRY  206

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            IGSLT PPC++GVIWTV K V T+S EQI  L+ AVDDGYE N+RP+Q  NGR+V+   P
Sbjct  207  IGSLTVPPCTEGVIWTVVKRVNTISMEQIAALRSAVDDGYETNSRPVQERNGRSVWFYDP  266



>gb|EYU18694.1| hypothetical protein MIMGU_mgv11b010420mg [Erythranthe guttata]
Length=248

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 166/237 (70%), Gaps = 0/237 (0%)
 Frame = +1

Query  163  ESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYK  342
            + + + FTY +  E GP  WG L+  +  C  G +QSPI++ D  V +  K G L R YK
Sbjct  5    QEDESPFTYAAQTEKGPNNWGSLNPKWEACKNGRLQSPIDLIDQRVVLLPKLGSLRRTYK  64

Query  343  SSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHR  522
             + A+I N+GH + + W GDAG +I+NGT+Y +LQCHWHTPSE+T++GK+  MEIH++H+
Sbjct  65   PAPAVIKNRGHDITVAWEGDAGGVIVNGTEYKLLQCHWHTPSEHTIDGKRFKMEIHMIHK  124

Query  523  SAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGS  702
            S++   + V ILYK+G+PD FL ++L +I++V+  G   G L+P  I +  +KY R+ GS
Sbjct  125  SSEGHISVVGILYKLGRPDPFLAKILKNIKRVNHEGVNAGVLDPWGIKFGSRKYLRYNGS  184

Query  703  LTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            LT PPC++GV+WT+ K+V+TVS+EQI  L+EAV DG+E+NARP Q  +   VY+ +P
Sbjct  185  LTVPPCTEGVLWTILKKVRTVSEEQIRALREAVHDGFEKNARPTQHSDEIDVYMYRP  241



>ref|XP_006489872.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=273

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 163/233 (70%), Gaps = 0/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T F+Y      GP +WGK+  ++ VC  G +QSPI++ +  V+V    G+L R YK + A
Sbjct  36   TPFSYKEETGKGPSEWGKISPHWRVCGIGKLQSPIDLLNQRVQVLPALGKLKRDYKPALA  95

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            ++ N+GH + + W GDAGK+ INGT Y +LQCHWHTPSE+T+NG   +ME+HLVH S+  
Sbjct  96   VVKNRGHDICVWWRGDAGKMHINGTIYKLLQCHWHTPSEHTINGSSYEMELHLVHLSSDG  155

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
            + A   I+Y+ G+PD FL +LL+ I+ + +  K +G +NPG I +  +KYYR+IGSLT P
Sbjct  156  KLAVTGIVYEYGRPDPFLSKLLHHIKSLGKEEKEVGIVNPGDIKFGSRKYYRYIGSLTVP  215

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GVIWT+ K+V+TVS+EQ+  LKE V DGYE+NARP   LNGR ++   P
Sbjct  216  PCTEGVIWTIGKKVRTVSREQVRALKEEVHDGYEKNARPTNELNGRPIWFYSP  268



>ref|XP_010269790.1| PREDICTED: alpha carbonic anhydrase 4-like [Nelumbo nucifera]
Length=274

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/240 (50%), Positives = 166/240 (69%), Gaps = 1/240 (0%)
 Frame = +1

Query  157  ASESEGT-KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A+E E   +FTY  G+E GP  WG + +++ +C  G MQSPI++    V+V S  G L R
Sbjct  28   ATEQEDEHEFTYKEGSERGPEHWGDIQSDWKICKKGEMQSPIDLLHERVQVFSGLGRLKR  87

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             Y+ + A   N+GH + I+W GDAGKI ING +Y + QCHWH+PSE+T NG +  +E+H+
Sbjct  88   DYQPAPAAAKNRGHDIMIEWKGDAGKININGINYSLKQCHWHSPSEHTFNGSRYKLELHM  147

Query  514  VHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRF  693
            VH ++    A + I YK G+ D FL +++ SI  V    K LG +NPG I +  +KYYR+
Sbjct  148  VHINSCGGIAVIGITYKYGRHDHFLDKIIASIGSVGSEEKDLGIINPGDIKFGSRKYYRY  207

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            +GSLT PPC++GVIWT+ K+V+TVS+EQ+  L++AVDDGYEENARP+Q  NGRTV L +P
Sbjct  208  MGSLTVPPCTEGVIWTIEKKVRTVSREQVRALRDAVDDGYEENARPIQQKNGRTVLLYRP  267



>ref|XP_003535188.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=278

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 115/236 (49%), Positives = 164/236 (69%), Gaps = 6/236 (3%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F YI G+E GP  WG+L   +  C +G MQSPI++    V+V  K GEL + YK   A
Sbjct  36   SEFDYIKGSEKGPSHWGELKKEWETCKSGKMQSPIDLSSHRVRVVPKLGELKKYYKPQNA  95

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
             + N+GH ++++W GDAG I INGT++F+ QCHWH+PSE+T+NG++ D+E+H+VH S   
Sbjct  96   TVKNRGHDIELKWEGDAGSININGTEFFLHQCHWHSPSEHTINGRRYDLELHMVHESKRI  155

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIRQV--DRNGKALGALNPGKITYEGKKYYRFI  696
              K + A V + YKIG+PD  L +L   I+ +  +   K +G  +P KI   GKKYYR++
Sbjct  156  NGKGKIAVVGLFYKIGRPDSVLNKLSKFIKTMVDEEEEKNIGVFDPSKIKLGGKKYYRYM  215

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            GSLT PPC +GVIWT+ K+++TVS+ Q+NLL+EAV D  E+NARP+QPLN R + L
Sbjct  216  GSLTVPPCIEGVIWTINKKIRTVSRAQVNLLREAVHDHAEKNARPIQPLNRRGIQL  271



>emb|CDY27409.1| BnaC03g64490D [Brassica napus]
Length=268

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/240 (49%), Positives = 166/240 (69%), Gaps = 3/240 (1%)
 Frame = +1

Query  157  ASESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRR  336
            A   + T FTY    E GP  WGK++ ++  CN G  QSPI++ ++ V +     E  RR
Sbjct  29   AEVDDETSFTYEKNPEKGPEGWGKINPHWKTCNIGKFQSPIDLTNTRVSIIRD--EAWRR  86

Query  337  -YKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK + A+I+N+GH + + W GDAGKI I  T+Y ++QCHWH+PSE+TVNG + DME+H+
Sbjct  87   QYKPAPAVIVNRGHDVMVSWKGDAGKITIRRTEYKLVQCHWHSPSEHTVNGTRYDMELHM  146

Query  514  VHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRF  693
            VH SA  +   + +LYK+GKP++FL +LL+ I+ V +  + LG ++P  I ++ KK+YR+
Sbjct  147  VHTSAGGKTVVIGVLYKLGKPNEFLTRLLDGIKTVGKEERDLGIVDPRTIRFQTKKFYRY  206

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            IGSLT PPC++GVIWTV K V T+S EQI  L+ AVDDGYE N+RP+Q  NGR+V+   P
Sbjct  207  IGSLTVPPCTEGVIWTVVKRVNTISMEQIAALRSAVDDGYETNSRPVQERNGRSVWFYDP  266



>ref|XP_008810946.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=284

 Score =   258 bits (659),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 166/235 (71%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y  G+ NGP  WG++H  +  CN G+MQSPI++    VK+    G L R YK+S A 
Sbjct  35   EFSYEEGSPNGPDHWGEIHKEWAACNNGDMQSPIDLTHERVKIFPGLGRLKRSYKASNAT  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W    G I INGT+Y ++QCHWH+PSE+++NGK+ D+EIH+VH+S+  +
Sbjct  95   LKNRGHDIMLKWAEGGGWIRINGTEYQLMQCHWHSPSEHSINGKRYDLEIHMVHQSSDQK  154

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A V I+YKIG+PD FL +L+  I+++   +     +G ++P  I    +KYYR++GSLT
Sbjct  155  NAVVGIMYKIGRPDTFLSELMEHIKEIADAEEKETNVGMVDPRDIKIGSRKYYRYMGSLT  214

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC+QGV+WT+TK+V+TVS+EQ+ LL+EAV D  + NARP+QP+N R +    P
Sbjct  215  TPPCTQGVVWTITKKVRTVSREQVRLLREAVHDNAKNNARPIQPINEREIQFYTP  269



>ref|XP_006421163.1| hypothetical protein CICLE_v10005610mg [Citrus clementina]
 gb|ESR34403.1| hypothetical protein CICLE_v10005610mg [Citrus clementina]
Length=273

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 163/233 (70%), Gaps = 0/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T F+Y      GP +WGK++ ++ VC  G +QSPI++ +  V+V    G+L R YK + A
Sbjct  36   TAFSYKEETGKGPREWGKINPHWRVCGIGKLQSPIDLLNQRVQVLPALGKLKRDYKPAPA  95

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            ++ N+GH + + W GDAGK+ INGT Y +LQCHWHTPSE+T NG   +ME+HLVH S+  
Sbjct  96   VVKNRGHDICVWWRGDAGKMNINGTVYKLLQCHWHTPSEHTFNGSSYEMELHLVHLSSDG  155

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
            + A   I+Y+ G+PD FL +LL+ I+ + +  K +G +NPG I +  +KYYR+IGSLT P
Sbjct  156  KLAVTGIVYEYGRPDPFLSKLLHHIKSLGKEEKEVGIVNPGDIKFGSRKYYRYIGSLTVP  215

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GVIWT+ K+V+TVS+EQ+  LKE V DGYE+NARP   LNGR ++   P
Sbjct  216  PCTEGVIWTIGKKVRTVSREQVRALKEEVHDGYEKNARPTNELNGRPIWFYSP  268



>ref|XP_007016793.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
 gb|EOY34412.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
Length=275

 Score =   257 bits (657),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 161/236 (68%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F Y   +  GP +WG++H  +  C+ G+MQSPI++ +  V + S  G L R YK   A
Sbjct  34   SEFDYNENSARGPARWGEIHPEWRACSNGSMQSPIDMSNERVNIVSHLGRLKRSYKPCNA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + ++W GDAG I INGT+Y + QCHWH+PSE+T+NG++ D+E+HLVH SA D
Sbjct  94   TLRNRGHDMMLRWDGDAGAIEINGTEYALKQCHWHSPSEHTINGRRYDLEVHLVHESADD  153

Query  535  EFAAVSILYKIGKPDKFLGQLLN---SIRQVDRNGKALGALNPGKITYEGKKYYRFIGSL  705
            + A + I+YKIG+PD FL  LL+   SI  +       G ++P  I    +KYYR+IGSL
Sbjct  154  KVAVIGIMYKIGRPDSFLSSLLDHLASITDITEGESVAGVIDPRHIKIGSRKYYRYIGSL  213

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            T PPC + V+W++ ++V+TV++EQ+ LL+ AV D  + NARPLQP+N R+V L +P
Sbjct  214  TVPPCDENVVWSIVRKVRTVTREQVRLLRVAVHDASDTNARPLQPINKRSVQLFRP  269



>ref|XP_003520509.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3 [Glycine max]
 gb|KHN07339.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=272

 Score =   257 bits (657),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 164/234 (70%), Gaps = 1/234 (0%)
 Frame = +1

Query  163  ESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYK  342
            ++E  +FT+  G+  GP  WG+++  + VC  G +QSPI++ D   +   + G+L + YK
Sbjct  32   KAEDEEFTFAEGSIKGPKNWGQINPKWKVCGDGKLQSPIDLSDQMAQELPQLGKLDKVYK  91

Query  343  SSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHR  522
             +  ++IN+GH + +QW GDAG++ INGT Y ++QCHWHTPSE+T+NG K D+E+H VH+
Sbjct  92   PAPVVLINRGHDIMLQWNGDAGQLNINGTFYNLMQCHWHTPSEHTLNGTKFDLELHAVHK  151

Query  523  SAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGS  702
            ++K E A + I YKIG  D  L +LLN I+ +      +G +NPG I +E K+YYR++GS
Sbjct  152  TSKGEIAVIGIWYKIGHSDPLLSKLLNDIKSIKDKKIDVGVINPGDIMFETKEYYRYVGS  211

Query  703  LTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            LTTPPC++GV+WT+ KEV+TVS EQ+N LK AV  G EENARP Q L GR V L
Sbjct  212  LTTPPCTEGVVWTIVKEVRTVSTEQLNALKGAVHHG-EENARPTQELGGRQVLL  264



>gb|KDO48229.1| hypothetical protein CISIN_1g025618mg [Citrus sinensis]
Length=250

 Score =   256 bits (654),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 162/233 (70%), Gaps = 0/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T F+Y      GP +WGK+  ++ VC  G +QSPI++ +  V+V    G+L R YK + A
Sbjct  13   TPFSYKEETGKGPSEWGKISPHWRVCGIGKLQSPIDLLNQRVQVLPALGKLKRDYKPALA  72

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            ++ N+GH + + W GDAGK+ INGT Y +LQCHWHTPSE+T+NG   +ME+HLVH S+  
Sbjct  73   VVKNRGHDICVWWRGDAGKMHINGTIYKLLQCHWHTPSEHTINGSSYEMELHLVHLSSDG  132

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
            + A   I+Y+ G+PD FL +LL+ I+ + +  K +G +NPG I +  +KYYR+IGSLT P
Sbjct  133  KLAVTGIVYEYGRPDPFLSKLLHHIKSLGKEEKEVGIVNPGDIKFGSRKYYRYIGSLTVP  192

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GVIWT+  +V+TVS+EQ+  LKE V DGYE+NARP   LNGR ++   P
Sbjct  193  PCTEGVIWTIGNKVRTVSREQVRALKEEVHDGYEKNARPTNELNGRPIWFYSP  245



>ref|XP_011048125.1| PREDICTED: alpha carbonic anhydrase 4-like [Populus euphratica]
Length=305

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 163/237 (69%), Gaps = 1/237 (0%)
 Frame = +1

Query  157  ASESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRR  336
            A+ ++   F+YI     GP  WG+L   +  C  G +QSPI++ D  VKV     + +RR
Sbjct  62   AATNDTITFSYIEATGRGPSNWGQLDPKWKACGDGKLQSPIDLLDQNVKVLYGQEDQLRR  121

Query  337  -YKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK ++A I+++G+ + + W GDAGKI INGTDY +   HWH PSE+T N K  DME+H+
Sbjct  122  DYKPAKATIVSRGYDVMVSWKGDAGKITINGTDYNLQHSHWHVPSEHTFNSKTYDMELHI  181

Query  514  VHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRF  693
            VH ++  E A V +LYK G+PD FL +L   I+ V +  K+LG L+P KI +  +  YR+
Sbjct  182  VHANSLGETAVVGVLYKYGEPDPFLSKLSPYIKSVTKQEKSLGILSPNKIEFGSRNLYRY  241

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            IGSL+TPPCS+GVIWTV KEV TVS+EQ+ LL++AVDDGY+ NARP+QPLNGR V L
Sbjct  242  IGSLSTPPCSEGVIWTVVKEVGTVSREQVQLLRDAVDDGYQANARPVQPLNGRVVNL  298



>gb|EYU18692.1| hypothetical protein MIMGU_mgv1a011638mg [Erythranthe guttata]
Length=275

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 164/234 (70%), Gaps = 1/234 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLH-TNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSE  351
            T F+Y+ GA NGP  WG L+  N+T+C  G  QSPINI D+TV V     +L   YK + 
Sbjct  38   TSFSYVVGAYNGPENWGNLNFPNWTLCGTGTNQSPINILDNTVVVWPSLWDLNTNYKPAL  97

Query  352  AIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK  531
            A+I N+GH ++++W GDAG +IINGT+Y + +CHWH PSE+T+NG + DME+H VH S++
Sbjct  98   AVIKNRGHDIEVEWRGDAGGVIINGTEYKLEKCHWHIPSEHTINGVRFDMELHAVHMSSE  157

Query  532  DEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTT  711
             + A V ILY++G PD FL ++L  ++   R G  +G L P ++ + G++YYR+ GSLTT
Sbjct  158  GDIAVVGILYELGPPDSFLARILPYLQAATREGTNIGILEPPEVAFGGREYYRYNGSLTT  217

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PPCS+ + WTV K V+TVS +QI  L +AVDDG   NARP+Q L+GR VYL +P
Sbjct  218  PPCSENITWTVFKTVRTVSLQQITALSDAVDDGNTGNARPIQELHGRPVYLFEP  271



>ref|XP_011015725.1| PREDICTED: alpha carbonic anhydrase 4-like [Populus euphratica]
Length=305

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 163/237 (69%), Gaps = 1/237 (0%)
 Frame = +1

Query  157  ASESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVT-SKFGELIR  333
            A+ ++   F+YI     GP  WG+L   +  C  G +QSPI++ D  VKV   +  +L R
Sbjct  62   AATNDTITFSYIEATGRGPSNWGQLDPKWKACGDGKLQSPIDLLDQNVKVLYGQEDQLRR  121

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK ++A I+++G+ + + W GDAGKI INGTDY +   HWH PSE+T N K  DME+H+
Sbjct  122  DYKPAKATIVSRGYDVMVSWKGDAGKITINGTDYNLQHSHWHVPSEHTFNSKTYDMELHI  181

Query  514  VHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRF  693
            VH ++  E A V +LYK G+PD FL +L   I+ V +  K+LG L+P KI +  +  YR+
Sbjct  182  VHANSLGETAVVGVLYKYGEPDPFLSKLSPYIKSVTKQEKSLGILSPNKIEFGSRNLYRY  241

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            IGSL+TPPCS+GVIWTV KEV TVS+EQ+ LL++AVDDGY+ NARP+QPLNGR V L
Sbjct  242  IGSLSTPPCSEGVIWTVVKEVGTVSREQVQLLRDAVDDGYQANARPVQPLNGRAVNL  298



>ref|XP_007016796.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
 gb|EOY34415.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
Length=275

 Score =   256 bits (654),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 162/236 (69%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F Y   +  GP +WG++H  ++ C+ G+MQSPI++ +  V + S  G L R YK S A
Sbjct  34   SEFDYNENSPRGPARWGEIHPEWSACSNGSMQSPIDMSNERVNIVSHLGRLKRSYKPSNA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + ++W GDAG I INGT+Y + QCHWH+PSE+T+NG++ D+E+HLVH SA  
Sbjct  94   TLKNRGHDMMLRWDGDAGAIEINGTEYALKQCHWHSPSEHTINGRRYDLEVHLVHESADG  153

Query  535  EFAAVSILYKIGKPDKFLGQLLN---SIRQVDRNGKALGALNPGKITYEGKKYYRFIGSL  705
            + A + I+YKIG+PD FL  LL+   SI  +       G ++P  I    +KYYR+IGSL
Sbjct  154  KVAVIGIMYKIGRPDSFLSSLLDHLASITDITEGESVAGVIDPRHIKIGSRKYYRYIGSL  213

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            T PPC + V+W++ ++V+TV++EQ+ LL+ AV D  + NARPLQP+N R+V L +P
Sbjct  214  TVPPCDENVVWSIVRKVRTVTREQVRLLRVAVHDASDTNARPLQPINKRSVQLFRP  269



>gb|KCW47832.1| hypothetical protein EUGRSUZ_K01571 [Eucalyptus grandis]
Length=289

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 163/239 (68%), Gaps = 7/239 (3%)
 Frame = +1

Query  157  ASESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRR  336
            ASESE        G   GP +WG++   +  C  G +QSPI++ +  V+V    G+L R 
Sbjct  51   ASESE-------VGTGKGPKEWGQIDPRWQACGMGKLQSPIDLLNERVQVFPNLGKLKRD  103

Query  337  YKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLV  516
            YK + AI+ N+GH + + W GDAGKI INGT Y +LQCHWH+PSE+T NG + D+E+H+V
Sbjct  104  YKPAPAIVRNRGHDITVMWKGDAGKININGTYYKLLQCHWHSPSEHTFNGSRYDLELHMV  163

Query  517  HRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFI  696
            H S+  E A + I+YK G+PD FL +LL  I  V +    LG +NPG I +  +KY+R+I
Sbjct  164  HLSSHGEIAVIGIVYKYGRPDPFLTKLLEHITVVGKEDTDLGVINPGIIKFGSRKYFRYI  223

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            GSLT PPC++GV+WT+ ++V+TVS++Q+  L+EAV DGYE NARP Q L+GR V+L  P
Sbjct  224  GSLTVPPCTEGVVWTIVRKVRTVSRKQVEALREAVHDGYEANARPTQQLDGRAVWLYTP  282



>ref|XP_004493458.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Cicer arietinum]
Length=276

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/229 (51%), Positives = 159/229 (69%), Gaps = 0/229 (0%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            ++ Y  G++ GP  WG +   + VC  G +QSPI+I +  V+   + G L R YK + A+
Sbjct  38   EYNYKVGSKEGPENWGNMKPEWKVCGIGKLQSPIDICNKRVQEFPQLGILQRDYKPAPAV  97

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            ++N+GH + +QW GDAG I INGT Y ++QCHWHTPSE+T++G K DME+H VH+S+  E
Sbjct  98   LLNRGHDVMVQWNGDAGNININGTYYKLVQCHWHTPSEHTLSGSKYDMELHAVHKSSTGE  157

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTPP  717
             A + + YKIGKPD FL +LL+ I+ +D     +G +NP  I +  KKYYR+IGSLTTPP
Sbjct  158  TAVIGVWYKIGKPDPFLSKLLDQIKLIDDKEIDVGTINPADIKFANKKYYRYIGSLTTPP  217

Query  718  CSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            C++GV WT+ K+VKT S EQI  LKEAV  G+EENARP Q L  R V+L
Sbjct  218  CTEGVTWTIVKKVKTASIEQIIALKEAVHRGFEENARPTQNLGAREVWL  266



>ref|XP_011075357.1| PREDICTED: alpha carbonic anhydrase 4-like [Sesamum indicum]
Length=274

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 112/239 (47%), Positives = 167/239 (70%), Gaps = 6/239 (3%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            + FTY   ++ GPG WG L+  +  C  G +QSPI+++D  V +    G L R Y+ + A
Sbjct  34   SPFTYDWNSDRGPGNWGNLNRKWKACGFGKLQSPIDLNDDRVSIVHTLGNLKRTYEPAPA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            +I N+GH + + W GDAG ++INGT++ + QCHWHTPSE+TV+GK+  MEIH+VH++++ 
Sbjct  94   VIKNRGHDIMVAWEGDAGGVVINGTEFKLQQCHWHTPSEHTVDGKRFKMEIHMVHKNSRG  153

Query  535  EFAAVSILYKIGKPDKFLG------QLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFI  696
            + + V ILYK+G+PD FL       QLL  ++ V   GK +G ++P  I +  +KY+R+I
Sbjct  154  QISVVGILYKLGRPDPFLAKLLKQVQLLKHVKTVGHEGKYVGFVDPWGIKFGSRKYFRYI  213

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            GSLT PPC++GV+WT+ K+V+TVS EQI  L++AV DG+EENARP+Q  +  TVY+ +P
Sbjct  214  GSLTVPPCTEGVLWTILKKVRTVSIEQIRALRDAVHDGFEENARPIQQSDDITVYMYRP  272



>ref|XP_011015541.1| PREDICTED: alpha carbonic anhydrase 4-like, partial [Populus 
euphratica]
Length=254

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/229 (52%), Positives = 159/229 (69%), Gaps = 1/229 (0%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRR-YKSSEAI  357
            F+YI     GP  WG+L   +  C  G +QSPI++ D  VKV     + +RR YK ++A 
Sbjct  19   FSYIEATGRGPSNWGQLDPKWKACGDGKLQSPIDLLDQNVKVLYGQEDQLRRDYKPAKAT  78

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            I+++G+ + + W GDAGKI INGTDY +   HWH PSE+T N K  DME+H+VH ++  E
Sbjct  79   IVSRGYDVMVSWKGDAGKITINGTDYNLQHSHWHVPSEHTFNSKTYDMELHIVHANSLGE  138

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTPP  717
             A V +LYK G+PD FL +L   I+ V +  K+LG L+P KI +  +  YR+IGSL+TPP
Sbjct  139  TAVVGVLYKYGEPDPFLSKLSPYIKSVTKQEKSLGILSPDKIEFGSRNLYRYIGSLSTPP  198

Query  718  CSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            CS+GVIWTV KEV TVS+EQ+ LL++AVDDGY+ NARP+QPLNGR V L
Sbjct  199  CSEGVIWTVVKEVGTVSREQVQLLRDAVDDGYQANARPVQPLNGRVVNL  247



>ref|XP_010098808.1| hypothetical protein L484_022573 [Morus notabilis]
 gb|EXB75896.1| hypothetical protein L484_022573 [Morus notabilis]
Length=280

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 110/236 (47%), Positives = 166/236 (70%), Gaps = 6/236 (3%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F Y   +E GP +WG+L   ++ C  G MQSPI++ +  VK+  K G+L R Y  S A
Sbjct  38   SEFDYSRRSEKGPDRWGELKKEWSACKNGGMQSPIDLSNQRVKIIPKLGKLTRSYTPSNA  97

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
             + N+GH + IQW G AG I INGT+YF+ Q HWH+PSE+T+NG++  ME+H+VH+S   
Sbjct  98   TVKNRGHDISIQWHGKAGSIKINGTEYFLQQAHWHSPSEHTINGRRFHMELHMVHQSTDK  157

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIRQVD--RNGKALGALNPGKITYEGKKYYRFI  696
              K+  A + +LYK+G+PD FL +L+  I  +   +  K +G ++P +I   GK+YYR++
Sbjct  158  TVKNNIAVIGVLYKLGRPDSFLSKLMKDITAISDKKEEKHMGIIDPSEIKLGGKRYYRYM  217

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            GSLT PPC++GVIWT++K+++TVS++Q+ LL+ AV D  EENARP+QP+N R ++L
Sbjct  218  GSLTVPPCTEGVIWTISKKIRTVSKQQVELLRVAVHDYAEENARPVQPINRRDIHL  273



>ref|XP_004303634.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Fragaria vesca subsp. vesca]
Length=286

 Score =   256 bits (653),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 158/233 (68%), Gaps = 0/233 (0%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            F Y+ G   GP KWG +  ++  C+ G MQSPI++ DS V+V    G+L R YK S A +
Sbjct  49   FAYVEGTGKGPKKWGDIDPHWKACDNGKMQSPIDLLDSRVQVFPNLGKLKRDYKPSPATV  108

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
             N+GH + ++W  DAGKI IN TDY ++QCHWH+P+E+T NG +  +E+H++H S+  + 
Sbjct  109  RNRGHDITVRWKKDAGKININSTDYNLVQCHWHSPAEHTFNGSRYALELHIIHTSSIGKI  168

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTPPC  720
            A + I+YK G+PD FL +L + I  V +    +G +NPG I +  +KYYR+IGSLT PPC
Sbjct  169  AVIGIVYKYGRPDPFLSKLFHHINSVGKEEVDIGVINPGDIKFGSRKYYRYIGSLTVPPC  228

Query  721  SQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*E  879
            ++GVIWT+ K+V+TVS EQ+  ++E V DGYE NARP Q  NGR V L  P E
Sbjct  229  TEGVIWTIVKKVRTVSMEQVRAIRETVHDGYEANARPTQQFNGRPVLLYTPGE  281



>ref|XP_008810960.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=263

 Score =   255 bits (651),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 162/229 (71%), Gaps = 3/229 (1%)
 Frame = +1

Query  196  GAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAIIINKGH  375
            G+ NGP  WG++H  +  CN G+MQSPI++    VK+    G L R YK+S A + N+GH
Sbjct  24   GSPNGPDHWGEIHKEWAACNNGDMQSPIDLTHERVKIFPGLGRLKRSYKASNATLKNRGH  83

Query  376  ALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEFAAVSI  555
             + ++W    G I INGT+Y ++QCHWH+PSE+++NGK+ D+EIH+VH+S+  + A V I
Sbjct  84   DIMLKWAEGGGWIRINGTEYQLMQCHWHSPSEHSINGKRFDLEIHMVHQSSDQKNAVVGI  143

Query  556  LYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLTTPPCSQ  726
            +YKIG+PD FL +L+  I+++   +     +G ++P  I    +KYYR++GSLTTPPC+Q
Sbjct  144  MYKIGRPDTFLSELMEHIKEIADAEEKETNVGMVDPRDIKIGSRKYYRYMGSLTTPPCTQ  203

Query  727  GVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            GV+WT+TK+V+TVS+EQ+ LL+EAV D  E NARP+QP+N R +    P
Sbjct  204  GVVWTITKKVRTVSREQVRLLREAVHDNAENNARPIQPINEREIQFYTP  252



>ref|XP_007144378.1| hypothetical protein PHAVU_007G151300g [Phaseolus vulgaris]
 gb|ESW16372.1| hypothetical protein PHAVU_007G151300g [Phaseolus vulgaris]
Length=279

 Score =   255 bits (652),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 163/239 (68%), Gaps = 6/239 (3%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F Y+ G+E GP +WG+L   +  C +G MQSPI++    VKV  K GEL + YK   A
Sbjct  37   SEFDYLKGSEKGPSRWGELKKEWETCKSGKMQSPIDLSSHRVKVVPKLGELKKHYKPQNA  96

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
             + N+GH ++++W  DAG I IN TD+F+ QCHWH+PSE+T+NG++ D+E+H+VH S   
Sbjct  97   TVKNRGHDIELKWGEDAGSININATDFFLHQCHWHSPSEHTINGRRYDLELHMVHESKSK  156

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRN--GKALGALNPGKITYEGKKYYRFI  696
              K + A V IL+KIG+PD  L +L   I+ +  N   K +G  +P +I   GKKYYR+I
Sbjct  157  NGKTKIAVVGILFKIGRPDPILSKLSEIIKSMGENEVEKKIGVFDPSEIKLGGKKYYRYI  216

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            GSLT PPC++GVIWT+ K++KTVS+ Q+NLL+EAV D  E N+RP Q LN R + L  P
Sbjct  217  GSLTVPPCTEGVIWTINKKIKTVSRAQVNLLREAVHDHAELNSRPRQALNKRGIQLYGP  275



>emb|CDP14169.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   254 bits (649),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 164/232 (71%), Gaps = 1/232 (0%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            FT+  G   GP  WG +   + VC  G +QSPI++ D   + +  F  L R YK + A++
Sbjct  12   FTHQEGTGKGPKNWGHIDPQWQVCGNGKLQSPIDLLDERAQASPNFKGLKRAYKPAPAVL  71

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
             N+GH + ++WTGDAGKII+NGTDY +LQCHWH+PSE+ +NG++ ++E+HLVH+++  + 
Sbjct  72   KNRGHDIMVEWTGDAGKIIVNGTDYKVLQCHWHSPSEHNLNGRRYNLELHLVHKNSLGDT  131

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA-LGALNPGKITYEGKKYYRFIGSLTTPP  717
            A V ILY++G+PD FL QLL+ I+  +  G   LG ++P  I +  + YYR+IGSLT PP
Sbjct  132  AVVGILYELGRPDPFLAQLLHHIKTTEIGGAVDLGIVSPLDIKFVSRNYYRYIGSLTVPP  191

Query  718  CSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            C++GV+WT+ K+V+TVS+EQI  +++AV DG+E NARP+Q  NGR VY   P
Sbjct  192  CTEGVLWTIIKKVRTVSREQIKAIEDAVRDGFEANARPIQQQNGRQVYFYGP  243



>ref|XP_011075358.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=273

 Score =   255 bits (651),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 162/233 (70%), Gaps = 0/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T F+Y+ GA +GP  WG L+ N+T+C  G  QSPINI D  VK+    G+L   Y+ +EA
Sbjct  36   TSFSYVVGATDGPQNWGNLNPNWTLCGTGKSQSPINILDYKVKLNRTLGDLNINYRPAEA  95

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            +I N G+ ++++WTGDAG +IING ++ + + HWHTP+E+TVNG + +ME+H+VH ++  
Sbjct  96   LIRNAGYEIEVKWTGDAGGVIINGDEFKLQEVHWHTPAEHTVNGIRFNMELHIVHVNSGG  155

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
            + A V ILYK+G  D FL Q L  +      G  LG ++P  +   G++YYR+ GSLTTP
Sbjct  156  DIAVVGILYKLGPADPFLAQFLPYLPSASEEGFPLGIVDPSSVKIPGREYYRYNGSLTTP  215

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PCS+ V WT+ K VKTVS EQ++ LK+A+DD    NARP+QPLNGRTVY+ +P
Sbjct  216  PCSENVTWTIFKRVKTVSIEQVHALKDAIDDENTGNARPIQPLNGRTVYIFEP  268



>gb|AFK49331.1| unknown [Lotus japonicus]
Length=238

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/235 (52%), Positives = 162/235 (69%), Gaps = 3/235 (1%)
 Frame = +1

Query  172  GTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSE  351
            G ++ Y  GA NGP  WG L   + VC  G  QSPI+I +  V+  S+ G+L + YK + 
Sbjct  3    GEEYIYTKGARNGPENWGSLKPEWEVCRNGKSQSPIDIKN--VEGFSQLGKLKKDYKVAP  60

Query  352  AIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK  531
            A + N+GH + +QW GDAGK+ INGT Y  +Q HWHTPSE+T+NG K DME+H VH ++K
Sbjct  61   ATLKNRGHDIMLQWDGDAGKLNINGTYYKFVQSHWHTPSEHTLNGSKFDMEMHAVHENSK  120

Query  532  DEFAAVSILYKIGKPDKFLGQLLNSIR-QVDRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             E A + I Y IG+PD  L +LL++I+   D     LG LNPG + +  +KYYR++GSLT
Sbjct  121  GERAVIGIWYTIGQPDPLLSKLLDNIKLSGDNKDIDLGILNPGLVKFGSRKYYRYVGSLT  180

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPCS+GVIWT+ K+V TVS+EQ+  LKEAV DG+E NARP Q LNGR V+L  P
Sbjct  181  TPPCSEGVIWTIVKKVWTVSREQLKALKEAVHDGFEINARPTQELNGRKVWLYTP  235



>ref|XP_006292541.1| hypothetical protein CARUB_v10018775mg [Capsella rubella]
 gb|EOA25439.1| hypothetical protein CARUB_v10018775mg [Capsella rubella]
Length=268

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 161/233 (69%), Gaps = 1/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T FTY    ENGP  WG+++  + VCN+G  QSPI++ +  V +        R+YK + A
Sbjct  35   TPFTYEQKKENGPEGWGQINPEWKVCNSGRFQSPIDLTNERVSLIHD-QAWKRQYKPAPA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            +I N+GH + + W GDAGK+ I  TD+ ++QCHWH+PSE+TVNG + D+E+H+VH SA  
Sbjct  94   VITNRGHDIMVSWKGDAGKVTIRQTDFKLVQCHWHSPSEHTVNGTRYDLELHMVHTSAGG  153

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
              A + +LYK+GKP++FL +LLN I+ V      LG ++P +I ++ +K+YR+IGSLT P
Sbjct  154  RTAVIGVLYKLGKPNEFLAKLLNGIKSVGTKEIDLGVIDPREIRFQTRKFYRYIGSLTVP  213

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GV+WTV K V T+S EQI  L+EAV DG+E N+RP+Q   GRTV+   P
Sbjct  214  PCTEGVLWTVVKRVNTISMEQITALREAVHDGFETNSRPVQESKGRTVWFYDP  266



>emb|CDX94018.1| BnaC07g36520D [Brassica napus]
Length=268

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 166/240 (69%), Gaps = 3/240 (1%)
 Frame = +1

Query  157  ASESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRR  336
            A   + T FTY    E GP  W K++ ++ VCN G +QSPI++ ++ V +     E  RR
Sbjct  29   AEADDETPFTYEQNPEKGPEGWSKINPHWKVCNNGKLQSPIDLTNARVSLIHD--EAWRR  86

Query  337  -YKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK + A+I+N+GH + + W GDAGK+ I   ++ ++QCHWH+PSE+TVNG + D+E+H+
Sbjct  87   EYKPAPAVIMNRGHDVMVSWKGDAGKLTIREMEFKLVQCHWHSPSEHTVNGTRYDLELHM  146

Query  514  VHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRF  693
            VH SA+   A + +LYK+GKP++FL +LL+ ++ V +  K LG ++P  I ++ KK+YR+
Sbjct  147  VHTSARGRIAVIGVLYKLGKPNEFLTRLLDGLKTVGKEEKDLGIVDPRTIRFQTKKFYRY  206

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            IGSLT PPC++GVIWTV K V T+S EQI  L+ AVDDGYE N+RP+Q  NGR V+   P
Sbjct  207  IGSLTVPPCTEGVIWTVVKRVNTISVEQIAALRNAVDDGYETNSRPVQDTNGRPVWFFDP  266



>gb|KCW89335.1| hypothetical protein EUGRSUZ_A01626, partial [Eucalyptus grandis]
Length=249

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 167/245 (68%), Gaps = 7/245 (3%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F YI+G+E GP  WG+L   +  C  G  QSPI++    VKV  K G + R YK S A 
Sbjct  4    EFDYIAGSEKGPKHWGELRKEWEACKKGETQSPIDLSSRRVKVIPKLGGIQRSYKPSNAT  63

Query  358  IINKGHALQIQW-TGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
            + N+GH + +QW  G+ G + INGT+YF+ QCHWH+PSE+T+NG++ +ME+H+VH S   
Sbjct  64   LKNRGHDISLQWDVGNVGSVKINGTEYFLQQCHWHSPSEHTINGRRYEMELHMVHVSTDP  123

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSI-RQVDRNG-KALGALNPGKITYEGKKYYRFI  696
              ++  A V +LYK G+PD FL +L+ ++   VD+ G + +G  +P KI   GK Y R++
Sbjct  124  NVENNIAVVGLLYKTGRPDAFLSKLMGNLWSMVDQEGERTMGVFDPRKIKMGGKSYLRYM  183

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*  876
            GSLT PPC++GVIWT+ K++ TVS++QI LL+EAV D  E+NARP+QPLN R ++L QP 
Sbjct  184  GSLTVPPCTEGVIWTINKKIGTVSKDQIKLLREAVHDHAEKNARPVQPLNRREIHLYQPK  243

Query  877  ERCCR  891
            E   R
Sbjct  244  EAAAR  248



>ref|XP_010046439.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW85766.1| hypothetical protein EUGRSUZ_B02522 [Eucalyptus grandis]
Length=278

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 107/236 (45%), Positives = 166/236 (70%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F Y +G+E GP +WG++   + +C++G+MQSPI++    V+V +  G L R YK+S A
Sbjct  33   SEFNYDAGSERGPARWGEIRREWGMCSSGSMQSPIDLSSERVQVVAHLGRLKRCYKASNA  92

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + ++W G AG I +NGT Y + QCHWH+PSE+ VNG++ D+E+H+VH S   
Sbjct  93   TLKNRGHDITLRWEGGAGSIYVNGTWYLLKQCHWHSPSEHAVNGRRFDLELHMVHESLNG  152

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIR---QVDRNGKALGALNPGKITYEGKKYYRFIGSL  705
            + A V I+YK+G+PD FL  ++  I     +    KA+G +NP +I    +KYYR++GSL
Sbjct  153  KVAVVGIMYKLGRPDTFLSMMMKHIEDIADIHEAEKAVGIVNPKRIKIGSRKYYRYVGSL  212

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            T PPC++ V+WT+ ++V+TV++EQ+ LL++AV D  E NARPLQP+N R+V L +P
Sbjct  213  TVPPCTENVLWTIVQKVRTVAREQVKLLRKAVRDDSEFNARPLQPINIRSVQLFRP  268



>ref|XP_010050504.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
Length=283

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 167/245 (68%), Gaps = 7/245 (3%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F YI+G+E GP  WG+L   +  C  G  QSPI++    VKV  K G + R YK S A 
Sbjct  38   EFDYIAGSEKGPKHWGELRKEWEACKKGETQSPIDLSSRRVKVIPKLGGIQRSYKPSNAT  97

Query  358  IINKGHALQIQW-TGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
            + N+GH + +QW  G+ G + INGT+YF+ QCHWH+PSE+T+NG++ +ME+H+VH S   
Sbjct  98   LKNRGHDISLQWDVGNVGSVKINGTEYFLQQCHWHSPSEHTINGRRYEMELHMVHVSTDP  157

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSI-RQVDRNG-KALGALNPGKITYEGKKYYRFI  696
              ++  A V +LYK G+PD FL +L+ ++   VD+ G + +G  +P KI   GK Y R++
Sbjct  158  NVENNIAVVGLLYKTGRPDAFLSKLMGNLWSMVDQEGERTMGVFDPRKIKMGGKSYLRYM  217

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*  876
            GSLT PPC++GVIWT+ K++ TVS++QI LL+EAV D  E+NARP+QPLN R ++L QP 
Sbjct  218  GSLTVPPCTEGVIWTINKKIGTVSKDQIKLLREAVHDHAEKNARPVQPLNRREIHLYQPK  277

Query  877  ERCCR  891
            E   R
Sbjct  278  EAAAR  282



>gb|EYU41598.1| hypothetical protein MIMGU_mgv1a011586mg [Erythranthe guttata]
Length=277

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 167/247 (68%), Gaps = 10/247 (4%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y    E GP KWG +   +  CN G MQSP+++ ++ V++ SK  + I 
Sbjct  29   AQEVEDEREFDYAEKGEKGPRKWGHIKEEWAACNNGTMQSPVDMSNARVRIISKPEKRI-  87

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             Y+ S A + N+GH +QIQW+GDAG I+INGT++ +   HWH+PSE+T+NG++ DME+H+
Sbjct  88   -YRVSNATVRNRGHDIQIQWSGDAGSILINGTEFSLRYAHWHSPSEHTINGRRYDMELHM  146

Query  514  VHRSAKD----EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA---LGALNPGKITYE  672
            VH +       + A V ILYKIGKPDKFL +L+ +I  +  N      +G +NP  I   
Sbjct  147  VHLNTDSNVTTKIAVVGILYKIGKPDKFLSKLMRNISSIVDNKDEQVNIGMINPNDIKLR  206

Query  673  GKKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGR  852
             K+YYR++GSLT PPC++GVIWT+ K+VKTVS+EQ+NLL+EAV D  E NARPLQP N R
Sbjct  207  SKRYYRYMGSLTVPPCTEGVIWTLNKKVKTVSREQVNLLREAVHDYAEVNARPLQPHNKR  266

Query  853  TVYLNQP  873
             +YL  P
Sbjct  267  GIYLYGP  273



>ref|XP_010439535.1| PREDICTED: alpha carbonic anhydrase 4 [Camelina sativa]
Length=267

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 161/233 (69%), Gaps = 1/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T FTY    E GP  WG+++  + VCN G  QSPI++ +  V +        R+Y+ + A
Sbjct  34   TSFTYEQKTEKGPEGWGQINPEWKVCNTGRFQSPIDLTNERVSLIHD-QAWNRQYQPAPA  92

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            +I N+GH + + W GDAGKI I  TD+ ++QCHWH+PSE+TVNG + D+E+H+VH SA+ 
Sbjct  93   VITNRGHDIMVSWKGDAGKITIRQTDFKLVQCHWHSPSEHTVNGTRYDLELHMVHTSARG  152

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
              A + +LYK+GKP++FL +LLN I+ V      LG ++P +I ++ +K+YR+IGSLT P
Sbjct  153  RTAVIGVLYKLGKPNEFLTKLLNGIKAVGNKEVDLGVIDPREIRFQTRKFYRYIGSLTVP  212

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GV+WTV K V T+S EQI  L+EAVDDG+E N+RP+Q   GR+V+   P
Sbjct  213  PCTEGVLWTVVKRVNTISMEQITALREAVDDGFETNSRPVQDSKGRSVWFYDP  265



>gb|EYU20767.1| hypothetical protein MIMGU_mgv1a019017mg, partial [Erythranthe 
guttata]
Length=240

 Score =   251 bits (642),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 159/232 (69%), Gaps = 1/232 (0%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            FTY+  +E GP KWG+L+  + +C  G  QSPIN+  +    +   G+L + YK + A+I
Sbjct  5    FTYVGESEKGPKKWGQLNPEWQICENGKRQSPINLVHAKSSPSPSLGKLKKTYKPAHAVI  64

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
             N+GH + + W GDAG ++INGT+Y ++QCHWHTPSE+ VNG+ ++ME H+VH +++   
Sbjct  65   KNRGHDIMVAWRGDAGGVVINGTEYKLVQCHWHTPSEHRVNGRSLNMEFHMVHNNSQGHI  124

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQ-VDRNGKALGALNPGKITYEGKKYYRFIGSLTTPP  717
            A V ILY +G+PD FL + L  I   V   G  LG ++P  I +  +KY+R++GSLT PP
Sbjct  125  AVVGILYTLGRPDTFLEKFLEHITSLVGEEGIDLGIVSPRDIKFGSRKYFRYMGSLTVPP  184

Query  718  CSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            C++GVIWT+  +V+TVS+EQI  L+ AV DG+EENARP QP  GR +YL  P
Sbjct  185  CTEGVIWTIIDKVRTVSREQIRALRNAVHDGFEENARPPQPWGGRNIYLYGP  236



>ref|NP_193831.1| alpha carbonic anhydrase 4 [Arabidopsis thaliana]
 sp|F4JIK2.1|ATCA4_ARATH RecName: Full=Alpha carbonic anhydrase 4; Short=AtaCA4; Short=AtalphaCA4; 
AltName: Full=Alpha carbonate dehydratase 4; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE84385.1| alpha carbonic anhydrase 4 [Arabidopsis thaliana]
Length=267

 Score =   252 bits (643),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 162/233 (70%), Gaps = 1/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T FTY    E GP  WGK++ ++ VCN G  QSPI++ +  V +        R+YK + A
Sbjct  34   TPFTYEQKTEKGPEGWGKINPHWKVCNTGRYQSPIDLTNERVSLIHD-QAWTRQYKPAPA  92

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            +I N+GH + + W GDAGK+ I  TD+ ++QCHWH+PSE+TVNG + D+E+H+VH SA+ 
Sbjct  93   VITNRGHDIMVSWKGDAGKMTIRKTDFNLVQCHWHSPSEHTVNGTRYDLELHMVHTSARG  152

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
              A + +LYK+G+P++FL +LLN I+ V      LG ++P +I ++ +K+YR+IGSLT P
Sbjct  153  RTAVIGVLYKLGEPNEFLTKLLNGIKAVGNKEINLGMIDPREIRFQTRKFYRYIGSLTVP  212

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GVIWTV K V T+S EQI  L++AVDDG+E N+RP+Q   GR+V+   P
Sbjct  213  PCTEGVIWTVVKRVNTISMEQITALRQAVDDGFETNSRPVQDSKGRSVWFYDP  265



>gb|EPS62533.1| hypothetical protein M569_12260, partial [Genlisea aurea]
Length=224

 Score =   250 bits (639),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 160/224 (71%), Gaps = 0/224 (0%)
 Frame = +1

Query  202  ENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAIIINKGHAL  381
            E GP  WG L   +  C  G +QSPI ++ +T+ + S  G L R YK + A+I +KG+ +
Sbjct  1    EKGPQNWGNLKPEWETCRTGRLQSPIELNRNTLTIRSTLGNLRRTYKPTPALIKSKGYNI  60

Query  382  QIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEFAAVSILY  561
             ++W G+AG IIINGT + + QCHWHTPSE+ + GK + ME+HLVH +++ E A + ILY
Sbjct  61   MVEWKGNAGGIIINGTKFALRQCHWHTPSEHKIGGKSLSMELHLVHNNSQGEVAVIGILY  120

Query  562  KIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTPPCSQGVIWT  741
            ++G+ D FL ++ + I ++ ++G +LG ++P +I +  +KYYR+ GSLTTPPC +GVIWT
Sbjct  121  ELGRSDPFLRKIRDKIERITKSGTSLGEIDPWEIKFGSRKYYRYKGSLTTPPCKEGVIWT  180

Query  742  VTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            + K+V+TVS++Q   L+EAVD G+E NARP+Q L GRT+YL QP
Sbjct  181  ILKKVRTVSKDQTQFLREAVDPGFENNARPIQELQGRTLYLFQP  224



>ref|XP_002869915.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46174.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=267

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 160/233 (69%), Gaps = 1/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T FTY    E GP  WGK++  + VCN G  QSPI++ +  V +        R+YK + A
Sbjct  34   TPFTYEQKTEKGPEGWGKINPQWKVCNTGRYQSPIDLTNERVSLIHD-QAWTRQYKPAPA  92

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            +I N+GH + + W GDAGKI I  TD+ ++QCHWH+PSE+TVNG   D+E+H+VH SA+ 
Sbjct  93   VITNRGHDIMVSWKGDAGKITIRKTDFKLVQCHWHSPSEHTVNGTSYDLELHMVHTSARG  152

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
              A + +LY++G+P++FL +LLN I+ V      LG ++P +I ++ +K+YR+IGSLT P
Sbjct  153  RTAVIGVLYRLGEPNEFLTKLLNGIKAVGNKEINLGMIDPREIRFQTRKFYRYIGSLTVP  212

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GVIWTV K V T+S EQI  L+EAVDDG+E N+RP+Q   GR+V+   P
Sbjct  213  PCTEGVIWTVVKRVNTISTEQIAALREAVDDGFETNSRPVQDSKGRSVWFYDP  265



>ref|XP_010272832.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
 ref|XP_010272833.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=270

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 160/231 (69%), Gaps = 3/231 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y+ G+  GP  WG++H  +  C  G MQSPI++ +  V+V    G+L RRY+ S A+
Sbjct  33   EFNYVEGSGVGPEHWGEIHEEWAACGNGEMQSPIDLSEKKVEVLHHLGKLKRRYRPSRAV  92

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            ++N+GH + I+W   AG I INGT YF+  CHWH+PSE+T+NG +  +E H+VH S+  +
Sbjct  93   LVNRGHDIMIKWVERAGSIYINGTRYFLRHCHWHSPSEHTINGVRYALEGHMVHESSDKK  152

Query  538  FAAVSILYKIGKPDKFLGQLLNSI-RQVDRNG--KALGALNPGKITYEGKKYYRFIGSLT  708
             A V ILYK G+PD+FL  + N + +  D+ G  + LG +NP +I   G +YYR++GSLT
Sbjct  153  VAVVGILYKFGRPDRFLSMMENYVFKTADKEGAEEELGIVNPKRIKLGGTEYYRYMGSLT  212

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVY  861
            TPPC++GV+WT+ K+VKTVS+EQ+ LL+ AV D  E NARP QP N R+V+
Sbjct  213  TPPCTEGVVWTILKKVKTVSKEQVELLRMAVHDDSEMNARPTQPTNYRSVH  263



>ref|XP_010279581.1| PREDICTED: alpha carbonic anhydrase 4-like [Nelumbo nucifera]
Length=270

 Score =   251 bits (642),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 164/240 (68%), Gaps = 1/240 (0%)
 Frame = +1

Query  157  ASESEGT-KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            ASE E   +FTY  G+E GP  WG++  ++ VC  G MQSPI++ D  V+V S  G+L R
Sbjct  28   ASELEDEHEFTYEEGSEKGPEHWGEIDPHWRVCGNGEMQSPIDLLDKRVEVVSGLGKLKR  87

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             Y+ + A ++N+GH + I+W GDAGKI IN TDY++ QCHWH+PSE+T N  + ++E+HL
Sbjct  88   DYRPAPAAVMNRGHDIMIEWKGDAGKININRTDYYLKQCHWHSPSEHTFNKSRYNLELHL  147

Query  514  VHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRF  693
            VH ++    A + I YK G+ D FL +L+     V      +G +NPG I +  +KYYR+
Sbjct  148  VHINSSGRIAVIGITYKYGRHDPFLARLIPYFGSVGSVENDVGIINPGDIKFGSRKYYRY  207

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            +GSLT PPC++GVIWT+ K+V+T S+EQ+  +++AV DG+E+NARP Q  NGRTV L  P
Sbjct  208  MGSLTVPPCTEGVIWTMVKKVRTASEEQVRAIRDAVHDGFEQNARPTQQQNGRTVLLYTP  267



>ref|XP_009782909.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Nicotiana sylvestris]
Length=270

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/248 (46%), Positives = 167/248 (67%), Gaps = 9/248 (4%)
 Frame = +1

Query  157  ASESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRR  336
            A   + ++F+Y   +ENGP KWGK+H  ++ CN G +QSPI++ +  V+V S  G+L   
Sbjct  25   AEVDDESEFSYDEKSENGPAKWGKIHPEWSTCNTGKLQSPIDLLNKRVEVVSNLGKLCTH  84

Query  337  YKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLV  516
            YK S A ++N+GH + ++W G  G + INGT Y + QCHWHTPSE+T+NGK+ ++E HLV
Sbjct  85   YKPSNATLLNRGHDMMLRWEGGGGYLKINGTKYQLKQCHWHTPSEHTINGKRFNLEAHLV  144

Query  517  HRSAKDEFAAVSILYKIGKPDKFLGQL------LNSIRQVDRNGKALGALNPGKITYEGK  678
            H S   + A + I+YKIG+PD FL  +      L S + V+R   A+G ++P  I  +GK
Sbjct  145  HESDDGKTAVIGIMYKIGRPDSFLSMIEKDLKALASTKGVER---AIGTIDPKLIKMDGK  201

Query  679  KYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTV  858
             YYR+IGSLT PPC++ V+WT+ ++VKT+++ Q+ L++EAV D  E NARP QP+N R +
Sbjct  202  TYYRYIGSLTVPPCTEDVVWTIDRKVKTITKRQMKLIREAVHDESETNARPAQPVNRRPI  261

Query  859  YLNQP*ER  882
               +P ER
Sbjct  262  KFYKPEER  269



>ref|XP_010043780.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW85764.1| hypothetical protein EUGRSUZ_B02520 [Eucalyptus grandis]
Length=278

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 165/236 (70%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F Y + ++ GP +WG++   + +C  G+MQSPI++    V+V ++ G L R YK+S A
Sbjct  33   SQFNYDARSDRGPARWGEIRREWEMCRNGSMQSPIDLSSERVQVMARLGRLKRSYKASNA  92

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + ++W GDAG I +NGT Y + Q HWH+PSE+ VNG++ D+E+H+VH S + 
Sbjct  93   TLKNRGHDIMLRWDGDAGSIYVNGTQYLLKQSHWHSPSEHAVNGRRFDLELHMVHDSPEG  152

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQV-DRNG--KALGALNPGKITYEGKKYYRFIGSL  705
            + A V ++YK+G+PD FL  ++  I+ + D +G  + +G +NP  I    +KYYR++GSL
Sbjct  153  KVAVVGVMYKLGRPDTFLSTMMKHIQGIADTHGAERTVGIVNPKHIKIGSRKYYRYVGSL  212

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            T PPC+Q V+WT+ ++V+TV++EQ+ LL+EAV D  E NARPLQP+N R V L  P
Sbjct  213  TVPPCTQNVLWTIVRKVRTVTREQVKLLREAVRDDSEFNARPLQPINKRPVQLFSP  268



>ref|XP_010451325.1| PREDICTED: alpha carbonic anhydrase 4-like [Camelina sativa]
Length=267

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 110/233 (47%), Positives = 160/233 (69%), Gaps = 1/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T FTY    E GP  WG ++  + VCN G  QSPI++ +  V +        R+Y+ + A
Sbjct  34   TPFTYEQKTEKGPEGWGNINPEWKVCNTGRFQSPIDLTNERVSLIHD-QAWHRQYQPAPA  92

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            +I N+GH + + W GDAGKI I  TD+ ++QCHWH+PSE+TVNG + D+E+H+VH SA+ 
Sbjct  93   VITNRGHDIMVSWKGDAGKITIRQTDFKLVQCHWHSPSEHTVNGTRYDLELHMVHTSARG  152

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
              A + +LYK+G+P++FL +LLN I+ V      LG ++P +I ++ +K+YR+IGSLT P
Sbjct  153  RTAVIGVLYKLGEPNEFLTKLLNGIKAVGNKEVDLGVIDPREIRFQTRKFYRYIGSLTVP  212

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GV+WTV K V T+S EQI  L+EAVDDG+E N+RP+Q   GR+V+   P
Sbjct  213  PCTEGVLWTVVKRVNTISMEQITALREAVDDGFETNSRPVQDSKGRSVWFYDP  265



>ref|XP_011077301.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=278

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 170/236 (72%), Gaps = 9/236 (4%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y + ++ GPGKWG++   +  CN G++QSPI++ +  V++ S+  +  R Y+++ A 
Sbjct  38   EFEYAANSDMGPGKWGQIKKEWAACNNGSLQSPIDMSNERVRIISRSEK--RTYRAANAT  95

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS----  525
            + N+GH +Q+QW GDAG I INGT+Y +   HWH+PSE+T+NG++ D+E+HLVH +    
Sbjct  96   VRNRGHDIQMQWFGDAGSIFINGTEYPLRNAHWHSPSEHTINGRRYDLELHLVHLNTDPN  155

Query  526  AKDEFAAVSILYKIGKPDKFLGQLLNSIR-QVDRNG--KALGALNPGKITYEGKKYYRFI  696
             K++ A + + YKIGKP++FL +L+ +IR  +D+    K LG ++P  I    K+YYR++
Sbjct  156  VKNKIAVIGVFYKIGKPNQFLSKLMTNIRSMIDKKDEEKILGMIDPEDIKIRSKRYYRYM  215

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            GSLT PPC++GVIWT+ K+VKTVS++Q+ LL+EAV D  EENARPLQP + R VYL
Sbjct  216  GSLTVPPCTEGVIWTINKKVKTVSRDQVKLLREAVHDYAEENARPLQPKHNRDVYL  271



>ref|XP_009137160.1| PREDICTED: alpha carbonic anhydrase 4-like [Brassica rapa]
Length=268

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/240 (47%), Positives = 164/240 (68%), Gaps = 3/240 (1%)
 Frame = +1

Query  157  ASESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRR  336
            A   + T FTY    E GP  W K++ ++ VCN G +QSPI++ ++ V +     E  RR
Sbjct  29   AEADDETLFTYEQNPEKGPEGWSKINPHWKVCNNGKLQSPIDLTNARVSLIHD--EAWRR  86

Query  337  -YKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK + A+I+N+GH + + W GDAGKI I   ++ ++QCHWH+PSE+TVNG + D+E+H+
Sbjct  87   EYKPAPAVIMNRGHDVMVSWKGDAGKITIRQMEFKLVQCHWHSPSEHTVNGTRYDLELHM  146

Query  514  VHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRF  693
            VH SA+   A + +LYK+GKP++FL +LL+ ++ V +  K LG ++P  I ++ KK+YR+
Sbjct  147  VHTSARGRIAVIGVLYKLGKPNEFLTRLLDGLKTVGKEEKDLGIVDPRTIRFQTKKFYRY  206

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            IGSLT PPC++GV W V K V T+S EQI  L+ AVDDGYE N+RP+Q  NGR V+   P
Sbjct  207  IGSLTVPPCTEGVFWPVVKRVNTISVEQIAALRNAVDDGYETNSRPVQDTNGRPVWFFDP  266



>ref|XP_002519458.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF42872.1| carbonic anhydrase, putative [Ricinus communis]
Length=274

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/244 (49%), Positives = 167/244 (68%), Gaps = 8/244 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F YI G+E GP KWG+L   +  C  G +QSPI++ +  VK+  K G+L R
Sbjct  27   AQEVEDEREFDYIQGSEKGPEKWGELKKEWASCKNGTLQSPIDMSNQRVKIIPKSGDLKR  86

Query  334  RYKSSEAIIINKGHALQIQWTG-DAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIH  510
             Y+S  + + N+GH + +QW G  AG + INGT YF+ QCHWH+PSE+T+NG++ DME+H
Sbjct  87   NYRSCNSTVKNRGHDISLQWEGHKAGSVNINGTGYFLQQCHWHSPSEHTINGRRYDMELH  146

Query  511  LVHRS----AKDEFAAVSILYKIGKPDKFLGQLL-NSIRQVD-RNGKALGALNPGKITYE  672
            +VH S     K++ A   ILYKIG+PD FL +LL N I   D +  + +G +NP +I   
Sbjct  147  MVHESTDPNVKNKIAVTGILYKIGQPDAFLSKLLGNVISMTDHKQDRNMGMINPNEIKMG  206

Query  673  GKKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGR  852
            GK+YYR+ GSLT PPC++GVIWT+ K+++TVS +Q+  L+EAV D  E+N+RP+QPLN R
Sbjct  207  GKRYYRYEGSLTVPPCTEGVIWTINKKIRTVSIDQVKALREAVHDYAEKNSRPVQPLNER  266

Query  853  TVYL  864
             V L
Sbjct  267  EVQL  270



>ref|XP_011075611.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=271

 Score =   249 bits (637),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 162/233 (70%), Gaps = 2/233 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T F+YI GA+ GP  WG L+ N+T+C  G  QSP+NI +  VK+    G+L + Y+ +EA
Sbjct  36   TSFSYIVGAKTGPENWGTLNPNWTLCGTGKSQSPVNILE--VKLNRSLGDLNKNYQPAEA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            ++ N  H ++++WTG+AG IIING ++ + Q HWH P+E+TVNG + DME+H+VH ++  
Sbjct  94   LLRNTEHKIEVKWTGNAGGIIINGDEFKLQQSHWHIPAEHTVNGVRFDMELHIVHANSGG  153

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
            + A V ILYK+G+ D FLGQ L  +    R G  LG+++P  I    ++YYR+ GSLTTP
Sbjct  154  DIAVVGILYKLGQADPFLGQFLQYLPLATREGYPLGSVDPSSINISSREYYRYNGSLTTP  213

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PCS+ V WT+ K VKTVS EQI+ LK+ + D    NARP+QPLNGRTVY+ +P
Sbjct  214  PCSENVTWTIFKTVKTVSIEQIDTLKDVIHDENTGNARPIQPLNGRTVYIFEP  266



>ref|XP_010050514.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89336.1| hypothetical protein EUGRSUZ_A01627 [Eucalyptus grandis]
Length=283

 Score =   250 bits (638),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/245 (48%), Positives = 168/245 (69%), Gaps = 7/245 (3%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F YI+G+E GP  WG+L  ++  C  G MQSPI++    VKV  K GE+ R YK S A 
Sbjct  38   EFDYIAGSEKGPMHWGELRKDWEACKKGEMQSPIDLSSQGVKVMPKLGEIDRSYKPSNAT  97

Query  358  IINKGHALQIQW-TGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
            ++N+GH + +QW TG+AG I INGT+YF+ QCHWH+PSE+T+NG++  +E+H+VH S   
Sbjct  98   LMNRGHDISLQWDTGNAGSIKINGTEYFLQQCHWHSPSEHTINGRRYALELHMVHVSTDP  157

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSI-RQVDR-NGKALGALNPGKITYEGKKYYRFI  696
              K+  A + +LYK G PD FL +L+ S+   +D+ + + +G ++P +I   GK Y R+ 
Sbjct  158  NVKNNIAVIGLLYKTGVPDAFLSKLMGSVWSMIDKEDERKMGTIDPREIKMGGKNYLRYT  217

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*  876
            GSLT PPC++GVIWT+ K++ TVS++QI LL+EAV D  E NARP+Q LN R ++  QP 
Sbjct  218  GSLTVPPCTEGVIWTINKKMGTVSKDQIKLLREAVHDYAENNARPVQQLNRREIHFYQPN  277

Query  877  ERCCR  891
            E   R
Sbjct  278  EAAKR  282



>ref|XP_002282495.2| PREDICTED: alpha carbonic anhydrase 7 [Vitis vinifera]
 emb|CBI16339.3| unnamed protein product [Vitis vinifera]
Length=274

 Score =   249 bits (637),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 161/235 (69%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y  G++ GP KWG++H  ++ C  GNMQSPI++    V+V S  G L R YK S+A 
Sbjct  34   EFDYEKGSDKGPDKWGEIHEEWSTCKHGNMQSPIDLLHERVQVVSHLGRLQRSYKPSQAT  93

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH +++ W GDAG I INGT Y + QCHWH+PSE+TVNGK+ D+E+H++H +   +
Sbjct  94   LKNRGHDMKLSWEGDAGSIQINGTKYELKQCHWHSPSEHTVNGKRFDLELHMLHETPSGK  153

Query  538  FAAVSILYKIGKPDKFLGQL---LNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             + V I+YKIG+ D FL  L   L ++       + +G ++P  I    +KYYR++GSLT
Sbjct  154  TSVVGIMYKIGRADSFLSTLTDHLEALSDSSDQERDVGVVDPRHIKIGSRKYYRYMGSLT  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC++ VIWT+  +V+TV++EQ+NLL+ AV D    NARP+QP+N R+V+  +P
Sbjct  214  TPPCTEDVIWTIVNKVRTVTREQVNLLRVAVHDDSGSNARPIQPINRRSVHFYRP  268



>emb|CDP07086.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 164/243 (67%), Gaps = 4/243 (2%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  K F+Y   +  GP  WG++   +++CN G+MQSPI++ D+ V+V S  G L R
Sbjct  26   AEEVEDEKEFSYDERSHRGPAHWGEIRQEWSMCNHGSMQSPIDLLDARVQVVSSLGRLHR  85

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK S A ++N+GH + ++W  DAG I INGT Y + QCHWH+PSE+++NGK+ D+E HL
Sbjct  86   EYKPSNATLVNRGHDMMLRWVDDAGHIHINGTLYHLRQCHWHSPSEHSINGKRYDLEAHL  145

Query  514  VHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNG---KALGALNPGKITYEGKKY  684
            VH +     A + I+Y+IG+ D FL  + N ++ +       K +G ++P +I    +KY
Sbjct  146  VHEALNGRIAVIGIIYEIGRSDSFLSMMENKLKALADTRDLEKVVGVIDPKQIKLGSRKY  205

Query  685  YRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            YR+IGSLT PPC+Q V+WT+ K+V+TV+++Q+ +++EAV D  E NARPLQPL+ R + +
Sbjct  206  YRYIGSLTIPPCTQNVVWTIVKKVRTVTRDQVKMIREAVHDESEANARPLQPLHNRPIRM  265

Query  865  NQP  873
             +P
Sbjct  266  YRP  268



>gb|AFK33933.1| unknown [Medicago truncatula]
Length=279

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/238 (47%), Positives = 162/238 (68%), Gaps = 6/238 (3%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y   ++ GP  WGK+   +  C  G MQSPI++    VKV  K G+L R YK   A 
Sbjct  38   EFDYTKDSKIGPSHWGKIKKEWATCKDGKMQSPIDMSSHRVKVVPKLGKLKRHYKPRNAT  97

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSA---  528
            I N+GH ++++W  DAG I INGT++F+ QCHWH PSE+T+NG++ D+E+H+VH SA   
Sbjct  98   IKNRGHDIEVKWKEDAGSININGTEFFLHQCHWHAPSEHTINGRRYDLELHMVHESAKVN  157

Query  529  -KDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRN--GKALGALNPGKITYEGKKYYRFIG  699
             K + A + ++YKIG+PD+ L +L   I+ +  N   +++G  +P +I   GKKYYR+IG
Sbjct  158  GKSKLAVIGLMYKIGRPDRLLSKLSKYIKTMMDNEVERSIGVFDPSEIKLGGKKYYRYIG  217

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            SLT PPC++GVIWT+ K+V++VS+ Q+ LL+EAV D  E+NARP+Q LN R + L  P
Sbjct  218  SLTVPPCTEGVIWTINKKVRSVSRAQLELLREAVHDHAEKNARPVQLLNRREIQLYGP  275



>ref|XP_006594167.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=282

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 162/235 (69%), Gaps = 6/235 (3%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F YI G+E GP  WG+L   +  C +G MQSPI++    V+V  K GEL + Y    A
Sbjct  42   SEFDYIKGSEKGPSHWGELKKEWETCKSGKMQSPIDLSSHRVRVVPKLGELKKYYTPQNA  101

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
             I N+GH ++++W  DAG I INGT++F+ QCHWH+PSE+T+NG++ D+E+H+VH S   
Sbjct  102  TIKNRGHDIELKWE-DAGSININGTEFFLHQCHWHSPSEHTINGRRYDLELHMVHESKNI  160

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIR-QVDRNGKALGALNPGKITYEGKKYYRFIG  699
              K +FA V + YKIG+PD  L +L   I+  V    K +G  +P KI   GKKYYR++G
Sbjct  161  KGKTKFAVVGLFYKIGRPDPVLKKLSKFIKTMVYGEEKNIGVFDPSKIKLGGKKYYRYMG  220

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            SLT PPC++GVIWT+ K+++TVS+ Q+ LL+EAV D  E+NARP+QP+N R + L
Sbjct  221  SLTVPPCTEGVIWTINKKIRTVSRAQVKLLREAVHDHAEKNARPIQPINRRGIQL  275



>ref|XP_010555357.1| PREDICTED: alpha carbonic anhydrase 4 [Tarenaya hassleriana]
Length=276

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 157/239 (66%), Gaps = 0/239 (0%)
 Frame = +1

Query  157  ASESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRR  336
            A   + + FTY  G+E GP KWG ++  + VC  G  QSPI++  S V V  +    +R 
Sbjct  34   AEVEDESPFTYELGSEKGPEKWGNINPQWEVCQTGKFQSPIDLTSSRVSVLRQDDLWLRS  93

Query  337  YKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLV  516
            YK +  +I N+GH + + W  D GKI ING+DY ++QCHWH+PSE+TVNG +  ME+H+V
Sbjct  94   YKPAIGVIKNRGHDIMLSWKEDVGKITINGSDYKLVQCHWHSPSEHTVNGTRFVMELHMV  153

Query  517  HRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFI  696
            H + + + A + +LY+ G PD FL +LLN IR VD+    +G ++P  I Y  +K+YR++
Sbjct  154  HTNPQGKIAVIGVLYRFGVPDPFLSRLLNGIRSVDKEEINMGIVDPRHIRYLSRKFYRYV  213

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            GSLT PPC++GVIWTV K V TVS  Q+  L+EAV DG+E NARP+Q   GR +   +P
Sbjct  214  GSLTVPPCTEGVIWTVVKRVNTVSPAQVRALREAVHDGFETNARPIQHQQGRPLRYYEP  272



>ref|XP_006391784.1| hypothetical protein EUTSA_v10023909mg [Eutrema salsugineum]
 gb|ESQ29070.1| hypothetical protein EUTSA_v10023909mg [Eutrema salsugineum]
Length=273

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/233 (47%), Positives = 164/233 (70%), Gaps = 1/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T+FTY    + GP  W  ++ ++ VC+ G  QSPI++ +  V +       I  YK + A
Sbjct  40   TRFTYEQNPDKGPEGWSNVNPHWKVCSTGKFQSPIDLTNQRVSLLHDQAWKIE-YKPAPA  98

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            +I+N+GH + + W GDAGKI I  T++ ++QCHWH+PSE+T+NG + DME+H+VH SA+ 
Sbjct  99   VILNRGHDIMVSWKGDAGKITIRDTEFKLVQCHWHSPSEHTINGTRYDMELHMVHTSAQG  158

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
            + A + +LY++G+P++FL +LLN I+ V++  K LG ++P  I  E +K+YR+IGSLT P
Sbjct  159  KTAVIGVLYRLGEPNEFLTKLLNGIKTVEKEEKNLGIVDPRTIRVENEKFYRYIGSLTVP  218

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GVIWTV + V T+S+EQI  L+ AVDDGYE N+RP+Q L+GR V+   P
Sbjct  219  PCTEGVIWTVVERVNTISKEQIAALRNAVDDGYETNSRPVQDLHGRLVWFYDP  271



>gb|KEH42158.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=279

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/238 (47%), Positives = 162/238 (68%), Gaps = 6/238 (3%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y   ++ GP  WGK+   +  C  G MQSPI++    VKV  K G+L R YK   A 
Sbjct  38   EFDYTKDSKIGPSHWGKIKKEWATCKDGKMQSPIDMSSHRVKVVPKLGKLKRHYKPHNAT  97

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSA---  528
            I N+GH ++++W  DAG I INGT++F+ QCHWH PSE+T+NG++ D+E+H+VH SA   
Sbjct  98   IKNRGHDIEVKWKEDAGSININGTEFFLHQCHWHAPSEHTINGRRYDLELHMVHESAKVN  157

Query  529  -KDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRN--GKALGALNPGKITYEGKKYYRFIG  699
             K + A + ++YKIG+PD+ L +L   I+ +  N   +++G  +P +I   GKKYYR+IG
Sbjct  158  GKSKLAVIGLMYKIGRPDRLLSKLSKYIKTMMDNEVERSIGVFDPSEIKLGGKKYYRYIG  217

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            SLT PPC++GVIWT+ K++++VS+ Q+ LL+EAV D  E+NARP+Q LN R + L  P
Sbjct  218  SLTVPPCTEGVIWTINKKIRSVSRAQLELLREAVHDHAEKNARPVQLLNRREIQLYGP  275



>dbj|BAD09854.1| putative dioscorin class A precursor [Oryza sativa Japonica Group]
 gb|EAZ07303.1| hypothetical protein OsI_29552 [Oryza sativa Indica Group]
 gb|EAZ43045.1| hypothetical protein OsJ_27633 [Oryza sativa Japonica Group]
Length=275

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 165/236 (70%), Gaps = 5/236 (2%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +FTYISG E GP  WGKL   +  C AG MQSPI++    VK+    G L   Y+++EA 
Sbjct  35   EFTYISGDEKGPEHWGKLKPEWAQCGAGEMQSPIDLSHERVKLVRDLGYLDDSYRAAEAS  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            I+N+GH + +++ GDAG ++INGT Y++ Q HWH+P+E++V+G++ DME+H+VH SA+ +
Sbjct  95   IVNRGHDIMVRFDGDAGSVVINGTAYYLRQLHWHSPTEHSVDGRRYDMELHMVHESAEKK  154

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV----DRNGKALGALNPGKITYEGKKYYRFIGSL  705
             A + +LY++G+PD+FL ++   ++ +    DR  K +G ++P         YYR++GSL
Sbjct  155  AAVIGLLYEVGRPDRFLQKMEPYLKMIADKEDREEK-VGMIDPRGARGRASVYYRYMGSL  213

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTPPC+QGV+WT+ K V+TVS+ Q++LL+EAV D  E NARPLQ +N R + + +P
Sbjct  214  TTPPCTQGVVWTIVKRVRTVSRYQLDLLREAVHDEMENNARPLQAVNNRDISIFRP  269



>ref|XP_009595413.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Nicotiana tomentosiformis]
Length=269

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 165/245 (67%), Gaps = 3/245 (1%)
 Frame = +1

Query  157  ASESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRR  336
            A   + ++F+Y    ENGP  WGK++  +  CN G +QSPI++ +  V+V S  G+L + 
Sbjct  24   AEVDDESEFSYDEKNENGPANWGKIYPEWNTCNTGKLQSPIDLLNKRVEVVSNLGKLRKH  83

Query  337  YKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLV  516
            YK S A ++N+GH + ++W G AG + INGT Y + QCHWHTPSE+T+NGK+ ++E HLV
Sbjct  84   YKPSNATLLNRGHDMMLRWEGGAGHLKINGTKYQLKQCHWHTPSEHTINGKRFNLEAHLV  143

Query  517  HRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNG---KALGALNPGKITYEGKKYY  687
            H S   + A + I+YKIG+PD FL  +   ++ +       +A+G ++P  I  +GKKYY
Sbjct  144  HESDDGKTAVIGIMYKIGRPDFFLSMIEKDLKALANTKGIERAIGTIDPNLIKMDGKKYY  203

Query  688  RFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLN  867
            R+IGSLT PPC++ V+WT+ ++VKT+++ Q+ L++EAV D  E NARP QP+N R +   
Sbjct  204  RYIGSLTVPPCTEDVVWTIDRKVKTITKRQMKLIREAVHDESETNARPAQPVNRRPIKFY  263

Query  868  QP*ER  882
            +P ER
Sbjct  264  KPEER  268



>ref|XP_010050537.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89340.1| hypothetical protein EUGRSUZ_A01633 [Eucalyptus grandis]
Length=283

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/241 (48%), Positives = 170/241 (71%), Gaps = 7/241 (3%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F YI  ++ GP  WG+L   +  C  G MQSPI++    VKV  K GE+ R YK S+AI
Sbjct  38   EFDYIPKSKKGPRHWGELRKEWEACKKGEMQSPIDLSSRRVKVIPKLGEIKRSYKPSKAI  97

Query  358  IINKGHALQIQW-TGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
            + N+GH + +QW  G AG I INGT +F+ Q HWH+PSE+T+NG++ ++E+H+VH +   
Sbjct  98   LKNRGHDISLQWDLGSAGSIKINGTRHFLQQFHWHSPSEHTINGRRYELELHMVHVTTDP  157

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIR-QVDRNG-KALGALNPGKITYEGKKYYRFI  696
              K++ A V +LYK G+P+ FL +L+ ++R  VD+ G + +GA++P +I   GK Y R++
Sbjct  158  DVKNKIAVVGLLYKTGQPNAFLSKLMGNVRSMVDKKGERKMGAIDPREIKMGGKSYLRYM  217

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*  876
            GSLT PPC++GVIWT+ K++ TVS++QI LL+EAV D  E+N+RP+QPLN R ++L QP 
Sbjct  218  GSLTVPPCTEGVIWTINKKIGTVSKDQIKLLREAVHDYAEKNSRPVQPLNRREIHLYQPN  277

Query  877  E  879
            E
Sbjct  278  E  278



>ref|XP_002268233.1| PREDICTED: alpha carbonic anhydrase 7 [Vitis vinifera]
 emb|CBI30161.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 164/242 (68%), Gaps = 3/242 (1%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F YI G+E GP  WG+L   +  CN G++QSPI++ +  VKV  K G+L R
Sbjct  28   AQEVEDEREFEYIEGSEKGPKHWGELKEEWAACNNGDLQSPIDLSNQRVKVIPKLGDLKR  87

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK   A + N+GH + +QW GDAG I INGT+Y + Q HWH PSE+++NG++ D+E+H+
Sbjct  88   NYKLCNATVKNRGHDISLQWVGDAGSIRINGTEYKLQQGHWHAPSEHSINGRRYDLELHM  147

Query  514  VHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQV--DRNGKALGALNPGKITYEGKKYY  687
            VH S  +  A V ++YK G+PDKFL +++++I  +      + +G ++PG I   G+KYY
Sbjct  148  VHVSPDNNIAVVGLIYKTGQPDKFLSKMMSNITSMADKMEQRKMGVIHPGDIKMGGRKYY  207

Query  688  RFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLN  867
            +++GSLT PPC++GV W + K+++TVS+EQ+  L+ AV D  E NARP+QPLN R V L 
Sbjct  208  KYMGSLTVPPCTEGVTWIINKKIRTVSREQVKQLRLAVHDYAEMNARPVQPLNLREVQLY  267

Query  868  QP  873
             P
Sbjct  268  GP  269



>ref|XP_010646590.1| PREDICTED: alpha carbonic anhydrase 4 isoform X2 [Vitis vinifera]
Length=275

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 168/239 (70%), Gaps = 1/239 (0%)
 Frame = +1

Query  160  SESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRY  339
            SE++ T+F+YI     GP +WG+++ ++  C  G MQSPI++ D+ V+V     +L R Y
Sbjct  30   SETDETQFSYIEDTGKGPKRWGQINPDWKACGNGAMQSPIDLLDARVQVLPNLEKLKRDY  89

Query  340  KSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVH  519
            K + A++ N+GH + ++W G AGKI INGT + + QCHWH+PSE+T NG + ++E+H++H
Sbjct  90   KPAPAVVKNRGHDVTVEWKGYAGKININGTYFKLQQCHWHSPSEHTFNGSRYNLELHVIH  149

Query  520  RSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDR-NGKALGALNPGKITYEGKKYYRFI  696
             S+ ++ A + I YK G+ D FL ++L  I  +     K LG +NPG I +  +KYYR+I
Sbjct  150  LSSDEKIAVIGITYKYGRADPFLTRMLRHIDSLPVGEEKELGIVNPGDIKFGSRKYYRYI  209

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            GSLT PPC++GVIWT++K+V+T ++EQ+  L++AV DGYE NARP Q ++GRTV L +P
Sbjct  210  GSLTVPPCTEGVIWTISKKVRTATREQVRALRKAVQDGYEANARPSQEVDGRTVLLYKP  268



>gb|KHN48240.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=282

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 161/235 (69%), Gaps = 6/235 (3%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F YI G+E GP  WG L   +  C +G MQSPI++    V+V  K GEL + Y    A
Sbjct  42   SEFDYIKGSEKGPSHWGGLKKEWETCKSGKMQSPIDLSSHRVRVVPKLGELKKYYTPQNA  101

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
             I N+GH ++++W  DAG I INGT++F+ QCHWH+PSE+T+NG++ D+E+H+VH S   
Sbjct  102  TIKNRGHDIELKWE-DAGSININGTEFFLHQCHWHSPSEHTINGRRYDLELHMVHESKNI  160

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIR-QVDRNGKALGALNPGKITYEGKKYYRFIG  699
              K +FA V + YKIG+PD  L +L   I+  V    K +G  +P KI   GKKYYR++G
Sbjct  161  KGKTKFAVVGLFYKIGRPDPVLKKLSKFIKTMVYGEEKNIGVFDPSKIKLGGKKYYRYMG  220

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            SLT PPC++GVIWT+ K+++TVS+ Q+ LL+EAV D  E+NARP+QP+N R + L
Sbjct  221  SLTVPPCTEGVIWTINKKIRTVSRAQVKLLREAVHDHAEKNARPIQPINRRGIQL  275



>gb|KDP44024.1| hypothetical protein JCGZ_05491 [Jatropha curcas]
Length=274

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 109/237 (46%), Positives = 162/237 (68%), Gaps = 3/237 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y   +E GP +WG+LH  ++ C+ G MQSPI++ +  V+V S  G+L R YK S A 
Sbjct  34   EFSYEKNSETGPERWGELHPEWSTCSNGTMQSPIDLLNERVEVVSHLGKLKRSYKPSNAT  93

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W   AG I INGT+Y + QCHWH+PSE+T++G +  +E+H+VH S   +
Sbjct  94   LKNRGHDMMLEWENGAGTIEINGTEYVLRQCHWHSPSEHTIDGGRFALELHMVHESQDGK  153

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A V I+Y IG+PD FL  L   +R+V   +     +G +NP  I    +KYYR+IGSLT
Sbjct  154  VAVVGIMYIIGRPDSFLSSLTEKLREVSGTEEEETVVGIVNPKDIKIGSRKYYRYIGSLT  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*E  879
             PPC++ V+WT++++V+TV++EQ+ LL+ AV D  + NARPLQP NGR+V L +P E
Sbjct  214  VPPCTENVVWTISRKVRTVTKEQVELLRVAVHDEADTNARPLQPTNGRSVQLYRPEE  270



>ref|XP_011018803.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=277

 Score =   248 bits (632),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 163/242 (67%), Gaps = 5/242 (2%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y  G+E GP  WG +   +  C  G +QSPI++ D  VK+  K   + R
Sbjct  27   AQEVEDEREFDYTEGSEKGPAHWGDIKEEWADCKTGRLQSPIDMSDRRVKMVQKKDNMKR  86

Query  334  RYKSSEAIIINKGHALQIQWTG--DAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEI  507
             Y+   A + N+GH + +QW G   AG I +N T YF+ QCHWH+PSE+T+NG++ DME+
Sbjct  87   NYRPFNATLKNRGHDIMVQWEGRDKAGSIQLNCTRYFLRQCHWHSPSEHTINGRRYDMEL  146

Query  508  HLVHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQV--DRNGKALGALNPGKITYEGKK  681
            H++H + + + A V  LYKIGKPD FL +LLN I  +   ++ + +G ++P +I + GKK
Sbjct  147  HMIHTTPEQKIAVVGYLYKIGKPDAFLSKLLNDIVSMTDQKSERNIGIVDPREIKFGGKK  206

Query  682  YYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVY  861
            YYR++GSLTTPPC QGVIWT+ K+++T+S++Q+  L+ AV D  E+NARPLQPLN R ++
Sbjct  207  YYRYMGSLTTPPCKQGVIWTINKKIRTISKDQVRALRVAVHDYAEKNARPLQPLNQREIH  266

Query  862  LN  867
             +
Sbjct  267  FH  268



>ref|XP_006473002.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/245 (45%), Positives = 161/245 (66%), Gaps = 3/245 (1%)
 Frame = +1

Query  169  EGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSS  348
            E  +F Y  G E+GP +WG++H+ ++ C  G MQSPI++ +  V+V S  G L R YK S
Sbjct  31   EEKEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLLNERVEVVSHLGRLKRSYKPS  90

Query  349  EAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSA  528
             A + N+GH + +QW G AG I+INGT Y + QCHWH+PSE+T++GK+  +E H+VH S 
Sbjct  91   NATLRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPSEHTIDGKRFALEAHMVHESH  150

Query  529  KDEFAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIG  699
              + A V I+YKIG+PD FL  + + +R +   +     +G ++P  I     KYYR+IG
Sbjct  151  DGKVAVVGIVYKIGRPDSFLASISDHLRNISGSNERDATVGVIDPRAIKIGSSKYYRYIG  210

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*E  879
            SLT PPC++ V WT+ ++V++V++EQ+ LL+ AV D    NARPLQP+N R+V L +P E
Sbjct  211  SLTVPPCTENVTWTIVRKVRSVTREQVRLLRVAVHDESNTNARPLQPINMRSVKLYKPDE  270

Query  880  RCCRC  894
                C
Sbjct  271  ENENC  275



>ref|XP_011090042.1| PREDICTED: alpha carbonic anhydrase 7-like [Sesamum indicum]
Length=274

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/238 (46%), Positives = 158/238 (66%), Gaps = 3/238 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y   +E GP  WGK+   ++ CN+G +QSPI++ +  V+  S  G L R Y  S A 
Sbjct  35   QFSYEEDSEIGPSNWGKIRPEWSQCNSGRLQSPIDLLNQRVEEVSHLGRLKRNYNPSNAT  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            +IN+GH + ++W  DAG I INGT Y + QCHWH+PSE+T+NGK+ DME HLVH S    
Sbjct  95   LINRGHDMMLRWRNDAGHIQINGTLYHLRQCHWHSPSEHTINGKRFDMETHLVHESDDKR  154

Query  538  FAAVSILYKIGKPDKFLGQL---LNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A + I+YKIG+PD FL  L     +I +     + +G +NP  +    +KYYR++GSLT
Sbjct  155  TAVIGIMYKIGRPDAFLSMLKRDFEAIVETRDVERTVGVVNPKLVELGSRKYYRYMGSLT  214

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*ER  882
             PPC+Q +IWT+ K+V+TV++EQ+ L++EAV D  E NARP+QP+N R + L  P +R
Sbjct  215  VPPCTQDIIWTMVKKVRTVTREQVELIREAVHDESEMNARPIQPMNERPINLYTPKDR  272



>ref|XP_006381381.1| hypothetical protein POPTR_0006s12380g [Populus trichocarpa]
 gb|ERP59178.1| hypothetical protein POPTR_0006s12380g [Populus trichocarpa]
Length=277

 Score =   247 bits (631),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 165/245 (67%), Gaps = 11/245 (4%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y  G+E GP  WG + T +  C  G++QSPI++ D  VK+  K   + R
Sbjct  27   AQEVEDEREFDYTEGSEKGPAHWGDIKTEWADCKTGSLQSPIDMSDRRVKMVQKTENIKR  86

Query  334  RYKSSEAIIINKGHALQIQWTG--DAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEI  507
             Y+   A + N+GH + +QW G   AG I ING  YF+ QCHWH+PSE+T+NG+  DME+
Sbjct  87   NYRPFNATLKNRGHDIMVQWEGFDKAGSIQINGARYFLQQCHWHSPSEHTINGRSYDMEL  146

Query  508  HLVHRSAKDEFAAVSILYKIGKPDKFLGQLLNSI-----RQVDRNGKALGALNPGKITYE  672
            H++H + + + A +  LYK GKPD FL +LLN I     ++++RN   +G ++P +I + 
Sbjct  147  HMLHTTPEQKIAVIGYLYKTGKPDAFLSKLLNDIVSMTDQKMERN---IGIVDPREIKFG  203

Query  673  GKKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGR  852
            GKKYYR++GSLTTPPC QGVIWT+ K+++T+S++Q+  L+ AV D  E+NARPLQPLN R
Sbjct  204  GKKYYRYMGSLTTPPCKQGVIWTINKKIRTISKDQVRALRVAVHDYAEKNARPLQPLNQR  263

Query  853  TVYLN  867
             ++ +
Sbjct  264  EIHFH  268



>ref|XP_010050530.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89339.1| hypothetical protein EUGRSUZ_A01632 [Eucalyptus grandis]
Length=283

 Score =   248 bits (632),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/245 (47%), Positives = 166/245 (68%), Gaps = 7/245 (3%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F YI G+E GP  WG+L  ++  C  G MQSPI++    V+V  K GE+ R +K S A 
Sbjct  38   EFDYIPGSEKGPMHWGELRNDWEACKKGEMQSPIDLSSERVQVMPKLGEIERSHKPSNAT  97

Query  358  IINKGHALQIQW-TGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
            + N+GH + +QW TG+AG I IN T+YF+ QCHWH+PSE+T+NG++  +E+H+VH S   
Sbjct  98   LKNRGHDISLQWDTGNAGSIKINSTEYFLQQCHWHSPSEHTINGRRYALELHMVHVSTDP  157

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDR--NGKALGALNPGKITYEGKKYYRFI  696
              K+  A V +LYK G PD FL +L+ S+  +    + + +G ++P +I   GK Y R++
Sbjct  158  NVKNNIAVVGLLYKTGVPDAFLSKLMGSVWSMSEKEDERKMGTIDPREIKMGGKNYLRYM  217

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*  876
            GSLTTPPC++GVIWT+ K++ TVS++QI LL+EAV D  E+NARP+Q LN R ++  QP 
Sbjct  218  GSLTTPPCTEGVIWTINKKMGTVSKDQIKLLREAVHDYAEKNARPVQQLNTREIHFYQPN  277

Query  877  ERCCR  891
            E   R
Sbjct  278  EAATR  282



>ref|XP_006424533.1| hypothetical protein CICLE_v10029790mg [Citrus clementina]
 gb|ESR37773.1| hypothetical protein CICLE_v10029790mg [Citrus clementina]
Length=275

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 158/235 (67%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y    + GP KWG+LH  ++ C  G MQSPI++ +  V+V S  G L R YK S A 
Sbjct  34   EFNYEEEGQRGPSKWGELHKEWSDCKKGTMQSPIDLLNERVQVVSHLGRLKRSYKPSYAT  93

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + +QW G AG ++INGT+Y + QCHWH+PSE+T+NG++  +E H+VH S   +
Sbjct  94   LKNRGHDMMLQWHGGAGTLLINGTEYVLKQCHWHSPSEHTINGERFALEAHMVHESQDGK  153

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A V I+YKIG+PD  L  + + +RQ+   D     +G ++P  I    +KYYR+IGSLT
Sbjct  154  IAVVGIMYKIGRPDSLLASIADHLRQIAGSDERETVVGVIDPRGIKLGSRKYYRYIGSLT  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC++ VIWT+ ++V+TV++EQ+ LL+ AV D    NARP QP+N RT+ L +P
Sbjct  214  TPPCTENVIWTIVRKVRTVTREQVKLLRVAVHDDSGTNARPQQPINLRTIKLYRP  268



>ref|XP_011048097.1| PREDICTED: alpha carbonic anhydrase 4-like [Populus euphratica]
Length=285

 Score =   248 bits (632),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 161/233 (69%), Gaps = 2/233 (1%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINI-DDSTVKVTSKFGELIRRYKSSEAI  357
            F Y+ G   GP  WGK++ ++  C  G MQSPI++ D   V+V    G+L R Y+++ A 
Sbjct  46   FAYVEGTGKGPKNWGKINPHWETCGKGQMQSPIDLLDGRAVQVFPNLGKLRRDYQAAPAA  105

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + + W GDAGKI IN T Y + QCHWH+PSE+T NG + D+E+HLVH S++  
Sbjct  106  VKNRGHDITVIWKGDAGKITINNTSYQLKQCHWHSPSEHTFNGSRYDLELHLVHYSSQGG  165

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA-LGALNPGKITYEGKKYYRFIGSLTTP  714
             A  +I+YK G+PD+FL +L + I ++D   +   G +NPG I +  +KYYR+IGSLT+P
Sbjct  166  VAVSAIVYKYGRPDRFLSRLFHHITRLDPEEEIDAGIVNPGDIKFGSRKYYRYIGSLTSP  225

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GVIWT+ K+V+TVS+EQ+  L++AV DG+E NARP Q  +GR V+   P
Sbjct  226  PCTEGVIWTIVKKVRTVSREQVKALRDAVHDGFEANARPTQSSDGRAVFEYTP  278



>gb|KGN59000.1| hypothetical protein Csa_3G742880 [Cucumis sativus]
Length=275

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 160/238 (67%), Gaps = 5/238 (2%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F Y  G++ GP KWG +   +  CN GNMQSPI++ +  VKV    G+L  +YK S A
Sbjct  31   SEFDYRKGSKKGPSKWGDIKREWEKCNNGNMQSPIDLSNKRVKVVKHLGQLKNKYKPSIA  90

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
            II N+GH + ++W  DAG I INGTDY + Q HWH+PSE+T+NG++ D+E+HLVH+S   
Sbjct  91   IIKNRGHDISVKWEEDAGSIEINGTDYLLQQAHWHSPSEHTLNGRRYDLEVHLVHQSSNP  150

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGK-ALGALNPGKITYEGKKYYRFIG  699
             AK   A V   YKIG+PD FL +L   I+ ++   +   G +NP  I   G KYYR+IG
Sbjct  151  NAKYPIAVVGFFYKIGRPDSFLSKLNRKIKALNEKKEIKAGIINPRWIKNGGMKYYRYIG  210

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            SLT PPC++GVIW + K++ TVS++Q+ LL+ AV D  E+NARP+QP NGR + L  P
Sbjct  211  SLTVPPCTEGVIWNIKKKIGTVSRKQVKLLRSAVHDSAEKNARPIQPHNGRHIDLYDP  268



>emb|CDY56563.1| BnaCnng30610D [Brassica napus]
Length=263

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 161/228 (71%), Gaps = 1/228 (0%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            +TY    ENGP  W KL   + +CN G +QSPI++    V         I  +K +EA+I
Sbjct  32   YTYDQNPENGPEGWSKLDHQWKICNHGKLQSPIDLTRGRVSRVHDEAWKIH-HKPAEAVI  90

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
            +++GH + + W GDAGK++I+ T++ ++QCHWH+PSE+T+N  + DME+H+VH SA+ + 
Sbjct  91   MSRGHDIMVSWKGDAGKMMIDHTEFKLVQCHWHSPSEHTINRTRYDMELHMVHTSAEGQT  150

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTPPC  720
            A +++LYK+G+P++FL  L N I+ V +  K LG ++P  I +   K+YR++GSLT PPC
Sbjct  151  AVIAVLYKLGRPNEFLTTLQNEIKTVGKEEKKLGIVDPRTIGFHTDKFYRYVGSLTAPPC  210

Query  721  SQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            ++GVIWTV K+V TVS EQ+  L+EAVDDG+E N+RP+Q  NGR+V+L
Sbjct  211  TEGVIWTVVKKVNTVSMEQLAALREAVDDGFERNSRPVQDTNGRSVWL  258



>ref|XP_010434249.1| PREDICTED: alpha carbonic anhydrase 4-like [Camelina sativa]
Length=267

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/233 (46%), Positives = 159/233 (68%), Gaps = 1/233 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T FTY    E GP  WG ++  + VCN G  QSPI++ +  V +        R+Y+ + A
Sbjct  34   TPFTYEQKTEKGPEGWGNINPEWKVCNTGRFQSPIDLTNERVSLIHD-QAWNRQYQPAPA  92

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            +I N+GH + + W GDAGK+ I  TD+ ++QCHWH+PSE+TVNG + D+E+H+VH SA  
Sbjct  93   VITNRGHDIMVSWKGDAGKVTIRETDFKLVQCHWHSPSEHTVNGTRYDLELHMVHTSAGG  152

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
              A + +LYK+GKP++FL +LLN I+ V +    LG ++P +I ++ +K++R+IGSLT P
Sbjct  153  RTAVIGVLYKLGKPNEFLTKLLNGIKAVGQKEVDLGVIDPREIRFQTRKFFRYIGSLTVP  212

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GV+WTV K V T+S EQI  L+EAV DG+E N+RP+Q   GR+V+   P
Sbjct  213  PCTEGVLWTVVKRVNTISMEQITALREAVHDGFETNSRPVQESKGRSVWFYDP  265



>gb|KDO81077.1| hypothetical protein CISIN_1g038655mg [Citrus sinensis]
Length=275

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 161/245 (66%), Gaps = 3/245 (1%)
 Frame = +1

Query  169  EGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSS  348
            E  +F Y  G E+GP +WG++H+ ++ C  G MQSPI++ +  V+V S  G L R YK S
Sbjct  31   EEKEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLLNERVEVVSHLGRLKRSYKPS  90

Query  349  EAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSA  528
             A + N+GH + +QW G AG I+INGT Y + QCHWH+PSE+T++GK+  +E H+VH S 
Sbjct  91   NATLRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPSEHTIDGKRFALEAHMVHESH  150

Query  529  KDEFAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIG  699
              + A V I+YKIG+PD FL  + + +R +   +     +G ++P  I     KYYR+IG
Sbjct  151  DGKVAVVGIVYKIGRPDSFLASISDHLRNISGSNERDATVGVIDPRAIKIGSSKYYRYIG  210

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*E  879
            SLT PPC++ V WT+ ++V++V++EQ+ +L+ AV D    NARPLQP+N R+V L +P E
Sbjct  211  SLTVPPCTENVTWTIVRKVRSVTREQVRVLRVAVHDESNTNARPLQPINMRSVKLYKPDE  270

Query  880  RCCRC  894
                C
Sbjct  271  ENENC  275



>ref|XP_006433902.1| hypothetical protein CICLE_v10003227mg [Citrus clementina]
 gb|ESR47142.1| hypothetical protein CICLE_v10003227mg [Citrus clementina]
Length=275

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/245 (45%), Positives = 160/245 (65%), Gaps = 3/245 (1%)
 Frame = +1

Query  169  EGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSS  348
            E  +F Y  G E+GP +WG++H+ ++ C  G MQSPI++ +  V V S  G L R YK S
Sbjct  31   EEKEFNYEKGGEHGPDRWGEIHSEWSACKNGTMQSPIDLLNERVVVVSHLGRLKRSYKPS  90

Query  349  EAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSA  528
             A + N+GH + +QW G AG I+INGT Y + QCHWH+PSE+T++GK+  +E H+VH S 
Sbjct  91   NATLRNRGHDIMLQWKGGAGTILINGTKYVLQQCHWHSPSEHTIDGKRFALEAHMVHESH  150

Query  529  KDEFAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIG  699
              + A V I+YKIG+PD FL  + + +R +   +     +G ++P  I     KYYR+IG
Sbjct  151  DGKVAVVGIVYKIGRPDSFLASISDHLRNISGSNERDATVGVIDPRAIKIGSSKYYRYIG  210

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*E  879
            SLT PPC++ V WT+ ++V++V++EQ+ +L+ AV D    NARPLQPLN R+V L +P E
Sbjct  211  SLTVPPCTENVTWTIVRKVRSVTREQVRVLRVAVHDESNTNARPLQPLNMRSVKLYKPDE  270

Query  880  RCCRC  894
                C
Sbjct  271  ENENC  275



>ref|XP_004168624.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=280

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 160/238 (67%), Gaps = 5/238 (2%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F Y  G++ GP KWG +   +  CN GNMQSPI++ +  VKV    G+L  +YK S A
Sbjct  36   SEFDYRKGSKKGPSKWGDIKREWEKCNNGNMQSPIDLSNKRVKVVKHLGQLKNKYKPSIA  95

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
            II N+GH + ++W  DAG I INGTDY + Q HWH+PSE+T+NG++ D+E+HLVH+S   
Sbjct  96   IIKNRGHDISVKWEEDAGSIEINGTDYLLQQAHWHSPSEHTLNGRRYDLEVHLVHQSSNP  155

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGK-ALGALNPGKITYEGKKYYRFIG  699
             AK   A V   YKIG+PD FL +L   I+ ++   +   G +NP  I   G KYYR+IG
Sbjct  156  NAKYPIAVVGFFYKIGRPDSFLSKLNRKIKALNEKKEIKAGIINPRWIKNGGMKYYRYIG  215

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            SLT PPC++GVIW + K++ TVS++Q+ LL+ AV D  E+NARP+QP NGR + L  P
Sbjct  216  SLTVPPCTEGVIWNIKKKIGTVSRKQVKLLRSAVHDSAEKNARPIQPHNGRHIDLYDP  273



>ref|XP_010036660.1| PREDICTED: alpha carbonic anhydrase 4-like [Eucalyptus grandis]
Length=278

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 158/230 (69%), Gaps = 0/230 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            + FTY+ G   GP  WG++  ++  C  G +QSPI++ +  V++    G+L R YK + A
Sbjct  43   SHFTYLEGTGKGPKDWGRIDPHWRACATGKLQSPIDLLNERVQIFPHLGKLKRDYKPAPA  102

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            I+ N+GH + + W G AG+I INGT Y +LQCHWH+PSE+T NG +  +E+H VH S+  
Sbjct  103  IVKNRGHDISVMWKGYAGQININGTYYKLLQCHWHSPSEHTFNGSRYALELHAVHESSHG  162

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
              A ++I+YK G+PD  L +LL  I+ VD+    LG +NPG I +  +KY+R+IGSLT P
Sbjct  163  AIAVIAIVYKYGRPDPLLKELLEHIKVVDKEDIELGVINPGLIKFGSRKYFRYIGSLTIP  222

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            PC++GV+WT+ ++V+TVS+EQ+  L+EAV DG+E N+RP Q  +GR + L
Sbjct  223  PCTEGVVWTIVRKVRTVSREQVKALREAVHDGFEANSRPTQRSHGRGIGL  272



>ref|XP_008443579.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=277

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 161/237 (68%), Gaps = 7/237 (3%)
 Frame = +1

Query  169  EGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSS  348
            E  +F YI G+  GP KWG +   +  CN G MQSPI++   T++V +  G+L +RY   
Sbjct  33   EECEFDYIGGSNKGPTKWGAIKREWANCNYGKMQSPIDLSTKTIQVVNSMGQLNKRYIPF  92

Query  349  EAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS-  525
             AI+ N+GH + + W G+AG I INGT YF+ Q HWH+PSE+T+NGK+ D+E+H+VH+S 
Sbjct  93   GAILKNRGHDVSVGWEGNAGSIEINGTQYFLKQTHWHSPSEHTINGKRYDLELHVVHQSS  152

Query  526  ---AKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGK---ALGALNPGKITYEGKKYY  687
               AK   A VS LY+IG PD FL ++   I+++    K    LG++NP +I   G  YY
Sbjct  153  NPNAKYPLAVVSFLYEIGPPDSFLSKVSREIKELSHGKKDQMKLGSINPNEIRRGGINYY  212

Query  688  RFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTV  858
            R++GSLT PPC++GVIW++ K++ TVSQEQ+ LL+  V+   E+NARP+QPLNGR V
Sbjct  213  RYVGSLTVPPCTEGVIWSINKQIGTVSQEQVMLLRSVVEHCAEKNARPIQPLNGRQV  269



>ref|XP_011090098.1| PREDICTED: alpha carbonic anhydrase 7 [Sesamum indicum]
Length=271

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 163/235 (69%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y   +E GP  WG++   +  C++G MQSPI++ +  V+V S  G+L R YK S   
Sbjct  33   EFSYEENSEIGPAHWGEIRPEWKECSSGEMQSPIDLLNERVEVVSHLGKLKRSYKPSNTT  92

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            +IN+GH + ++W G AG I INGT Y + QCHWH+PSE+T++G++ DME+HLVH+S  + 
Sbjct  93   LINRGHDMMLRWPGGAGHININGTLYQLKQCHWHSPSEHTISGRRFDMEVHLVHQSDDNR  152

Query  538  FAAVSILYKIGKPDKFLGQL---LNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A + I+YKIG+PD FL  +   L ++ ++    K +G ++P  I    +KYYR+IGSLT
Sbjct  153  IAVIGIMYKIGRPDSFLSMMKRNLKAVAEMRDVEKTIGIIDPKLIKLGSRKYYRYIGSLT  212

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC+Q VIWT+ ++V+TV++EQ+ L+++ V D  E NARP+QP++ R V L +P
Sbjct  213  TPPCTQNVIWTIVRKVRTVTREQVELIRDVVHDDSEANARPIQPVHERLVELYRP  267



>ref|XP_008778933.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=273

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 165/235 (70%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y S +E+GP  WGK+H ++ +CN G MQSP+++ D  V+V    G L R Y+++ A+
Sbjct  34   EFSYESDSEHGPENWGKIHEDWAICNKGQMQSPLDLLDKRVQVHHHLGPLRRTYRAALAV  93

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W  D G I IN T Y + Q HWH PSE+T+NG++  +E+H+VH SA  +
Sbjct  94   VKNRGHDIMVKWEEDPGAIWINETMYTLKQLHWHAPSEHTLNGRRYAVEMHMVHESADQK  153

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV-DRNG--KALGALNPGKITYEGKKYYRFIGSLT  708
             A V ILYKIG+PD FL ++   I ++ D  G  + LG +NP    +  +KYYR++GSLT
Sbjct  154  VAVVGILYKIGRPDSFLEEVEEEIMKIGDLTGEEEVLGMVNPRHAKWGSRKYYRYLGSLT  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
             PPC++GV+WT+ K+V+TVS++Q++ L+EAV D +E NARP+Q +N RTV L +P
Sbjct  214  VPPCTEGVVWTIIKKVRTVSRKQVDRLREAVHDDFEMNARPIQEINERTVSLYRP  268



>ref|XP_004143278.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 gb|KGN48196.1| hypothetical protein Csa_6G446560 [Cucumis sativus]
Length=276

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 167/249 (67%), Gaps = 7/249 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y  G++ GPG WG++   +  CN G++QSPI++    VK+  + GEL R
Sbjct  25   AQEVEDEREFDYAEGSQKGPGHWGEIKKEWEACNNGDLQSPIDLSSQRVKIVPQLGELKR  84

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             Y    A + N+GH + + W G  G I ING  Y + Q HWH+PSE++VNG++ D+E+H+
Sbjct  85   SYYPCNATVKNRGHDISVYWYGKPGSIEINGDVYDLQQSHWHSPSEHSVNGRRYDLELHM  144

Query  514  VHRSA----KDEFAAVSILYKIGKPDKFLGQLLNSIR-QVDR-NGKALGALNPGKITYEG  675
            VH+S+    K++ A V  LY IG+PD F+ QL   I   VDR + K +G +NP  I + G
Sbjct  145  VHQSSDPTVKNKIAVVGQLYTIGQPDPFITQLSREILGMVDRKHEKKVGVMNPADIKFGG  204

Query  676  KKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRT  855
            KKYYR++GSLT PPC++GVIWT+ K+++TVS+EQ+ LL+EAV D  E NARPLQPLN R 
Sbjct  205  KKYYRYLGSLTVPPCTEGVIWTMNKKIRTVSREQVRLLREAVHDYAEFNARPLQPLNSRE  264

Query  856  VYLNQP*ER  882
            + L +P +R
Sbjct  265  IGLYRPIQR  273



>ref|XP_008359452.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=275

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/237 (46%), Positives = 159/237 (67%), Gaps = 3/237 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y   +E GP +WG++   +++C+ G+MQSPI++ D  V+V S FG L   Y+   A 
Sbjct  35   EFNYXEDSEKGPARWGEIRQEWSMCSKGSMQSPIDLLDDRVEVVSNFGILQGSYRPCNAT  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W  DAG I +NGT Y + QCHWH+ SE+T+NGK+ D+E HLVH S+  +
Sbjct  95   LKNRGHDMMLKWEADAGFIQLNGTLYKLKQCHWHSSSEHTINGKRFDLEAHLVHESSTGK  154

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A   ILYKIG PD FL  +++S+ +V       +A+G ++P KI     KYYR+IGSLT
Sbjct  155  IAVTGILYKIGAPDPFLSSMMDSLAEVSGTSEEEEAVGTVDPKKIKTRSTKYYRYIGSLT  214

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*E  879
             PPC+Q V WT+ +EV+TVS+EQ+  L+ AV D  + NARP+QP NGR V + +P E
Sbjct  215  IPPCTQNVTWTIVQEVRTVSEEQVEFLRVAVHDDSKTNARPVQPRNGRVVQVYRPKE  271



>ref|XP_002278828.1| PREDICTED: alpha carbonic anhydrase 4 isoform X1 [Vitis vinifera]
 emb|CBI33384.3| unnamed protein product [Vitis vinifera]
Length=276

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 169/243 (70%), Gaps = 4/243 (2%)
 Frame = +1

Query  157  ASESEG---TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGEL  327
            +SESE    T+F+YI     GP +WG+++ ++  C  G MQSPI++ D+ V+V     +L
Sbjct  27   SSESETEDETQFSYIEDTGKGPKRWGQINPDWKACGNGAMQSPIDLLDARVQVLPNLEKL  86

Query  328  IRRYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEI  507
             R YK + A++ N+GH + ++W G AGKI INGT + + QCHWH+PSE+T NG + ++E+
Sbjct  87   KRDYKPAPAVVKNRGHDVTVEWKGYAGKININGTYFKLQQCHWHSPSEHTFNGSRYNLEL  146

Query  508  HLVHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDR-NGKALGALNPGKITYEGKKY  684
            H++H S+ ++ A + I YK G+ D FL ++L  I  +     K LG +NPG I +  +KY
Sbjct  147  HVIHLSSDEKIAVIGITYKYGRADPFLTRMLRHIDSLPVGEEKELGIVNPGDIKFGSRKY  206

Query  685  YRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            YR+IGSLT PPC++GVIWT++K+V+T ++EQ+  L++AV DGYE NARP Q ++GRTV L
Sbjct  207  YRYIGSLTVPPCTEGVIWTISKKVRTATREQVRALRKAVQDGYEANARPSQEVDGRTVLL  266

Query  865  NQP  873
             +P
Sbjct  267  YKP  269



>ref|XP_010916592.1| PREDICTED: alpha carbonic anhydrase 7-like [Elaeis guineensis]
Length=275

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 165/235 (70%), Gaps = 4/235 (2%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            F+Y SG+E GP  WG+LHT ++ C  G +QSPI++ D  V+V  + G+L   Y+ ++A++
Sbjct  36   FSYESGSETGPEHWGELHTEWSACGKGKLQSPIDLSDERVQVVHQLGQLRSSYRPADAVM  95

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
             N+GH ++I+W    G I INGT Y + Q HWH+PSE+T+N  +  +E+H+VH++  ++ 
Sbjct  96   KNRGHDIEIKWENHTGGIWINGTKYDLKQLHWHSPSEHTINRHRYSLELHMVHQTTDNKT  155

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA----LGALNPGKITYEGKKYYRFIGSLT  708
            A V ILYKIG+PD FL ++   I++++   ++    LG ++P  +    +KYYR++GSLT
Sbjct  156  AVVGILYKIGRPDPFLAKMEKYIKKMEDMAESEEEKLGMVDPRDVKKGSRKYYRYMGSLT  215

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC++GV+WT+ ++V+TVS+ Q+NLL+EAV D  E NARPLQ LN R V L +P
Sbjct  216  TPPCTEGVVWTIIRKVRTVSKHQVNLLREAVHDHAEMNARPLQLLNNRPVGLYRP  270



>ref|XP_002529418.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF32944.1| carbonic anhydrase, putative [Ricinus communis]
Length=274

 Score =   245 bits (625),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 162/237 (68%), Gaps = 3/237 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y    E GP +WG+LH  +  C+ G+MQSPI++ +  V+V S  G L R Y+ S A 
Sbjct  34   EFDYEKNGERGPARWGELHEEWRACSNGSMQSPIDMLNERVEVVSHLGRLNRSYEPSNAT  93

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W   AG I INGT+Y + QCHWH+PSE+T++G++  +E+H+VH S   +
Sbjct  94   LKNRGHDMMLEWENGAGTIEINGTEYILRQCHWHSPSEHTLDGRRFALELHMVHESPDGK  153

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A V ++Y IG+PD FL  L + +R +   +   + +G +NP  I    +KYYR++GSLT
Sbjct  154  VAVVGVMYTIGRPDSFLLSLTDHLRSISGTEEEERVVGIINPKDIKIGSRKYYRYMGSLT  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*E  879
             PPC++ VIWT+ K+V+TV++EQ++LL+ AV D  + NARPLQ +NGR+V+L +P E
Sbjct  214  VPPCTENVIWTIVKKVRTVTREQVSLLRVAVHDESDTNARPLQQINGRSVHLYRPEE  270



>ref|XP_006488639.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   245 bits (625),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 158/235 (67%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y    + GP KWG+LH  ++ C  G MQSPI++ +  V+V S  G L R YK S A 
Sbjct  34   EFNYEEEGQRGPSKWGELHKEWSACKKGTMQSPIDLLNERVQVVSHLGRLKRSYKPSYAT  93

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + +QW G AG ++INGT+Y + QCHWH+PSE+T++G++  +E H+VH S   +
Sbjct  94   LKNRGHDMMLQWHGGAGTLLINGTEYVLKQCHWHSPSEHTIDGERFALEAHMVHESQDGK  153

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A V I+YKIG+PD  L  + + +RQ+   +     +G ++P  I    +KYYR+IGSLT
Sbjct  154  IAVVGIMYKIGRPDSLLASISDHLRQIAGSNERETVVGVIDPRGIKLGSRKYYRYIGSLT  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC++ VIWT+ ++V+TV++EQ+ LL+ AV D    NARP QP+N RTV L +P
Sbjct  214  TPPCTENVIWTIVRKVRTVTREQVKLLRVAVHDDSGTNARPQQPINLRTVKLYRP  268



>ref|XP_008802055.1| PREDICTED: alpha carbonic anhydrase 7-like [Phoenix dactylifera]
Length=275

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 171/236 (72%), Gaps = 4/236 (2%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y  G+E GP +WG+LH  ++ C  G +QSPI++ D  V+V  + G L   Y  ++A+
Sbjct  35   EFSYEIGSETGPERWGELHEEWSACGKGKLQSPIDLSDERVQVLHQSGPLRSSYHPADAV  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH ++I+W    G + INGT Y + Q HWH+PSE+T+NG++  +E+H+VH+SA ++
Sbjct  95   MKNRGHDIEIKWENQTGGVWINGTKYVLKQLHWHSPSEHTINGRRYSLELHMVHQSADEK  154

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA----LGALNPGKITYEGKKYYRFIGSL  705
             A V ILYKIG+PD FL ++ + I++++   ++    LG ++PG +    +KYYR++GSL
Sbjct  155  IAVVGILYKIGRPDPFLAKMEDYIKKMEDMEESEEEKLGLVDPGDVKKGSRKYYRYMGSL  214

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTPPC++GV+WT+ ++V+TV+++Q+NLL+EAV D  E+NARPLQ +N R++ L +P
Sbjct  215  TTPPCTEGVVWTIIRKVRTVAKQQVNLLREAVHDHAEKNARPLQLINDRSLGLYRP  270



>gb|KEH42156.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=286

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 169/246 (69%), Gaps = 8/246 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F YI G+E GP  WG+L   +  C  G+MQSPI++ +  VK+   + ++I+
Sbjct  29   AQEVEDEREFDYIEGSEKGPHHWGELKEEWAACKHGDMQSPIDLSNERVKIIPNYRQVIK  88

Query  334  -RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIH  510
             +YKSS A IIN+GH + + W GDAG I INGT +F+ QCHWH+PSE+++NG+K D+E+H
Sbjct  89   TKYKSSNATIINRGHDIAVFWRGDAGSISINGTKFFLHQCHWHSPSEHSINGRKYDLEMH  148

Query  511  LVHRSAK---DEFAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYE  672
            +VH S     ++ A V   +KIG+P+ FL QL   I+ +   +   + +G  +P +I  +
Sbjct  149  MVHISPNPKGNKIAVVGAFFKIGRPNSFLSQLEEDIKHMVDEEEEERVIGDKDPSQIQTK  208

Query  673  GKKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGR  852
            GK YYR++GSLTTPPC++GV+W + K+++TVS+ Q++LL++AV D  E NARP QP N R
Sbjct  209  GKIYYRYVGSLTTPPCTEGVMWNLDKKIRTVSKAQVDLLRQAVHDHAEMNARPRQPHNNR  268

Query  853  TVYLNQ  870
             ++L++
Sbjct  269  DIHLHK  274



>gb|KDO73356.1| hypothetical protein CISIN_1g039445mg [Citrus sinensis]
Length=275

 Score =   244 bits (624),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 158/235 (67%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y    + GP KWG+LH  ++ C  G MQSPI++ +  V+V S  G L R YK S A 
Sbjct  34   EFNYEEEGQRGPSKWGELHKEWSACKKGTMQSPIDLLNERVQVVSHLGRLKRSYKPSYAT  93

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + +QW G AG ++INGT+Y + QCHWH+PSE+T++G++  +E H+VH S   +
Sbjct  94   LKNRGHDMMLQWHGGAGTLLINGTEYVLKQCHWHSPSEHTIDGERFALEAHMVHESQDGK  153

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A V I+YKIG+PD  L  + + +RQ+   +     +G ++P  I    +KYYR+IGSLT
Sbjct  154  IAVVGIMYKIGRPDSLLASISDHLRQIAGSNERETVVGVIDPRGIKLGSRKYYRYIGSLT  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC++ VIWT+ ++V+TV++EQ+ LL+ AV D    NARP QP+N RT+ L +P
Sbjct  214  TPPCTENVIWTIVRKVRTVTREQVKLLRVAVHDDSGTNARPQQPINLRTIKLYRP  268



>ref|XP_010050524.1| PREDICTED: alpha carbonic anhydrase 7-like [Eucalyptus grandis]
 gb|KCW89338.1| hypothetical protein EUGRSUZ_A01630 [Eucalyptus grandis]
Length=283

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/245 (47%), Positives = 166/245 (68%), Gaps = 7/245 (3%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F YI G+E GP  WG+L  ++  C  G MQSPI++    V+V  K GE+ R +K S A 
Sbjct  38   EFDYIPGSEKGPMHWGELRKDWEACKKGEMQSPIDLSSERVQVMPKLGEIERNHKPSNAT  97

Query  358  IINKGHALQIQW-TGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
            + N+GH + +QW TG+AG I INGT+YF+ QCHWH+PSE+T+NG++  +E+H+VH S   
Sbjct  98   LKNRGHDISLQWDTGNAGSIKINGTEYFLQQCHWHSPSEHTINGRRYALELHMVHVSTDP  157

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSI-RQVDR-NGKALGALNPGKITYEGKKYYRFI  696
              K+    V +LYK G PD FL +L+ S+   +D+ + + +G ++P +I   GK Y R+ 
Sbjct  158  NVKNNITVVGLLYKTGVPDAFLSKLMGSVWSMIDKEDERKMGTIDPREIKMGGKNYLRYT  217

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*  876
            GSLT PPC++GVIWT+ K++ TVS++QI LL+EAV D  E+NARP+Q LN R ++  QP 
Sbjct  218  GSLTVPPCTEGVIWTINKKMGTVSKDQIKLLREAVHDYAEKNARPVQQLNRREIHFYQPN  277

Query  877  ERCCR  891
            E   R
Sbjct  278  EAATR  282



>ref|XP_006659489.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Oryza brachyantha]
Length=276

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/235 (45%), Positives = 162/235 (69%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +FTY SG E GP  WGK+   +  C AG MQSPI++    V +    G L   Y+++EA 
Sbjct  36   EFTYTSGEEKGPEHWGKIKPEWAQCGAGEMQSPIDLSHERVTLVRDLGYLDHSYRAAEAS  95

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            I+N+GH + +++ GDAG ++INGT Y++ Q HWH+P+E++V+G++ DME+H+VH SA+ +
Sbjct  96   IVNRGHDIMVRFDGDAGSVVINGTAYYLRQLHWHSPTEHSVDGRRYDMELHMVHESAEKK  155

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV-DRNGKA--LGALNPGKITYEGKKYYRFIGSLT  708
             A + +LY++G+PD+FL ++   +R + D+  K   +G ++P         YYR++GSLT
Sbjct  156  AAVIGLLYEVGRPDRFLQKMEPYLRMIADKEDKEEKVGVIDPRGARGRASVYYRYMGSLT  215

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC++GVIWT+ K V+TVS+ Q+ LL+EAV D  E NARPLQ +N R V + +P
Sbjct  216  TPPCTEGVIWTIVKRVRTVSKYQLELLREAVHDNMENNARPLQAVNNRDVSIFRP  270



>gb|EYU38572.1| hypothetical protein MIMGU_mgv1a011717mg [Erythranthe guttata]
Length=272

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 166/247 (67%), Gaps = 10/247 (4%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y    E GP KWG++   +  CN G+ QSPI++ +  V + S+  +  R
Sbjct  22   AQEVEDEREFDYSKKGEKGPRKWGEIKKEWGACNNGSFQSPIDMSNERVVIFSRPEK--R  79

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             Y+ + A I N+GH +QI+W GDAG I IN T+Y + Q HWH+PSE+T+NG++ DME+HL
Sbjct  80   NYRLTNATIKNRGHDIQIEWFGDAGSIFINNTEYPLRQAHWHSPSEHTINGRRYDMELHL  139

Query  514  VHRS----AKDEFAAVSILYKIGKPDKFLGQLLNSIR-QVDRNGKAL--GALNPGKITYE  672
            VH +     K+      ILY+IGKPDKFL +L+ +I   +D+  + +  G ++P KI   
Sbjct  140  VHLNTDPNVKNRITVTGILYEIGKPDKFLSKLMKNISSMIDKKDEEITVGKIDPDKIKLR  199

Query  673  GKKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGR  852
             K +YR++GSLT PPC+QGVIWT+ K+VKTVS++QI LL+EAV D  EENARPLQP N R
Sbjct  200  SKMFYRYMGSLTVPPCTQGVIWTINKKVKTVSRDQIKLLREAVHDYAEENARPLQPKNRR  259

Query  853  TVYLNQP  873
             VYL +P
Sbjct  260  DVYLYRP  266



>ref|XP_009621603.1| PREDICTED: alpha carbonic anhydrase 7 [Nicotiana tomentosiformis]
Length=273

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 166/239 (69%), Gaps = 9/239 (4%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++FTY   +E GP  WG++HT +++CN+G +QSPI++ +  V+V S  G L R YK S +
Sbjct  33   SEFTYDEESEKGPAHWGEIHTEWSMCNSGKLQSPIDLLNERVEVVSHLGRLRRSYKPSNS  92

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             ++N+GH + ++W G AG I INGT Y + Q HWH+PSE+T+NGK+ D+E+HLVH S   
Sbjct  93   TLLNRGHDMMLRWEGGAGHIEINGTRYQLNQAHWHSPSEHTINGKRFDLEVHLVHESNDG  152

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQ------VDRNGKALGALNPGKITYEGKKYYRFI  696
            + A V I+YKIG+ D FL ++ + ++       V+RN   +G ++P ++    +KYYR+I
Sbjct  153  KTAVVGIMYKIGRADSFLSKIEDDLKALAHTKGVERN---IGIIDPKQVKLGSRKYYRYI  209

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            GSLT PPC+Q V+WT+ ++V+TV++EQ+ L++EAV D  E N+RP+Q  N R + L +P
Sbjct  210  GSLTVPPCTQDVVWTIVRKVRTVTREQMKLIREAVHDESETNSRPVQAANKRPIRLYRP  268



>emb|CDX79018.1| BnaA01g10850D [Brassica napus]
Length=261

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 165/231 (71%), Gaps = 3/231 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR-RYKSSE  351
            T +TY    ENGP  W KL   +  CN G +QSPI++ ++  +V+    E  +  +K ++
Sbjct  28   TPYTYDQNPENGPKGWSKLDHQWKPCNNGKLQSPIDLTNA--RVSRAHDETWKIHHKPAD  85

Query  352  AIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK  531
            A+I+++GH + + W GD GK++I+ T++ ++QCHWH+PSE+TVNG + DME+H+VH SA+
Sbjct  86   AVILSRGHDIMVSWKGDTGKMMIHRTEFKLVQCHWHSPSEHTVNGTRYDMELHMVHTSAE  145

Query  532  DEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTT  711
             + A +++LYK+G+P++FL  L N I+ V +  K +G ++P  I +   K+YR++GSLT 
Sbjct  146  GQTAVIAVLYKLGRPNEFLTTLENEIKTVGKEEKEIGIVDPRIIGFHTDKFYRYVGSLTA  205

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            PPC++GVIWTV K V TVS EQ+  L++AVDDG+E N+RP+Q  NGR+V+L
Sbjct  206  PPCTEGVIWTVVKRVNTVSMEQLAALRDAVDDGFERNSRPIQDTNGRSVWL  256



>ref|XP_006409842.1| hypothetical protein EUTSA_v10017075mg [Eutrema salsugineum]
 gb|ESQ51295.1| hypothetical protein EUTSA_v10017075mg [Eutrema salsugineum]
Length=271

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/236 (48%), Positives = 159/236 (67%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y    ENGP KWGKL   + +C  G MQSPI++ +  V+V    G L R YK S A
Sbjct  33   SEFSYERNEENGPEKWGKLKPEWKMCGKGEMQSPIDLMNERVRVVYHLGRLTRDYKPSNA  92

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + +++   +G I INGT+Y +LQ HWH+PSE+T+NG++  ME+HLVH S   
Sbjct  93   TLKNRGHDMMLRFEEGSGSIKINGTEYQLLQLHWHSPSEHTINGRRFAMELHLVHESING  152

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQV-DRNGKA--LGALNPGKITYEGKKYYRFIGSL  705
              A V++LYKIG+PD FL  L N +  + D+N K   +G ++P KI +  +KYYR++GSL
Sbjct  153  RMAVVTVLYKIGRPDSFLRLLENKLLAITDQNEKEKNIGLIDPKKIKFGSRKYYRYVGSL  212

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTPPC+Q V WTV K+V+TVS+ Q+ LL+ AV D    NARP+QP N R V L +P
Sbjct  213  TTPPCTQNVTWTVVKKVRTVSKNQVRLLRVAVHDDSNSNARPVQPTNKRVVNLYKP  268



>ref|XP_002308927.2| hypothetical protein POPTR_0006s04600g [Populus trichocarpa]
 gb|EEE92450.2| hypothetical protein POPTR_0006s04600g [Populus trichocarpa]
Length=285

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 159/233 (68%), Gaps = 2/233 (1%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINI-DDSTVKVTSKFGELIRRYKSSEAI  357
            F Y+ G   GP  WGK++ ++  C  G MQSPI++ D   V+V    G+L R Y+++ A 
Sbjct  46   FAYVEGTGKGPKNWGKINPHWETCGKGQMQSPIDLLDGKAVQVFPNLGKLRRDYQAAPAA  105

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + + W GDAGKI IN T Y + Q HWH+PSE+T NG + D+E+HLVH S++  
Sbjct  106  VKNRGHDITVIWKGDAGKITINNTSYQLKQGHWHSPSEHTFNGSRYDLELHLVHYSSQGG  165

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA-LGALNPGKITYEGKKYYRFIGSLTTP  714
             A  +I+YK G+PD+FL +L + I  VD   +   G +NPG I +  +KYYR+IGSLT+P
Sbjct  166  VAVSAIVYKYGRPDRFLSRLFHHITHVDPEEEIDAGIVNPGDIKFGSRKYYRYIGSLTSP  225

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PC++GVIWT+ K+V+TVS+EQ+  L++AV DGYE NARP Q  +GR V+   P
Sbjct  226  PCTEGVIWTIVKKVRTVSREQVKALRDAVHDGYEANARPTQSSDGRAVFEYIP  278



>ref|XP_010241820.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=282

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/238 (47%), Positives = 160/238 (67%), Gaps = 6/238 (3%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y+ G+  GP  WG+LH  +  C  G+MQSPI++ +  V++    G L R YK S AI
Sbjct  36   EFDYLEGSGKGPDHWGELHEEWAACKNGDMQSPIDLLNERVQLVPGLGRLKRSYKPSNAI  95

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS----  525
            + N+GH + ++W   AG I ING DY + QCHWH+PSE+T+NGK+ D+E+H+VH S    
Sbjct  96   LKNRGHDIALEWGEGAGSININGXDYVLEQCHWHSPSEHTLNGKRFDLELHMVHVSPDNT  155

Query  526  AKDEFAAVSILYKIGKPDKFLGQLLNSIRQV--DRNGKALGALNPGKITYEGKKYYRFIG  699
              ++ A + ILYKIG+PD FL +L   I  +   +N   +G ++P  I    +KYYR++G
Sbjct  156  TANQIAVIGILYKIGRPDDFLSELKKGIWSIADSKNEVGVGVVDPRHIKIGSRKYYRYMG  215

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            SLT PPC+QGVIWT+  +V+TVS+ Q+  L++AV D  E+NARPLQPLN R ++L +P
Sbjct  216  SLTVPPCTQGVIWTINTKVRTVSKGQVKALRDAVHDYAEQNARPLQPLNKREIHLYRP  273



>ref|XP_006351243.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=265

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 158/230 (69%), Gaps = 0/230 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            +KF+Y+ G   GP  WG + + + +C  G  QSP+N  + TVK+T+    L   YK++ A
Sbjct  34   SKFSYLLGTTEGPESWGTIKSEWKLCETGLFQSPVNFRNKTVKITTAIPRLKPNYKNAPA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            +I+N+GH +++QW  DAG I I+GT+Y + QCHWHTPSE+ V+GK   ME H+VH+SA  
Sbjct  94   MIVNRGHDIKLQWETDAGSINIDGTEYRLQQCHWHTPSEHKVDGKCFAMEAHMVHQSADG  153

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
              A V+I +KIG P+ FL +L+  ++ VD  G  LG ++P ++  + + +YR+IGSLT P
Sbjct  154  RLAVVAIPFKIGAPNPFLDELIGHVKTVDDKGLKLGLVDPQQLGVKAEPFYRYIGSLTVP  213

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            PC++G++W+V  E +TVS EQ+  L+ AV DG+E NARP+Q L+ R VYL
Sbjct  214  PCTEGIVWSVLYEARTVSMEQMMALRNAVHDGFEANARPVQGLHRRPVYL  263



>ref|NP_001147028.1| carbonic anhydrase precursor [Zea mays]
 gb|ACF88000.1| unknown [Zea mays]
 gb|ACG25129.1| carbonic anhydrase precursor [Zea mays]
 gb|AFW61792.1| carbonic anhydrase [Zea mays]
Length=277

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 161/234 (69%), Gaps = 3/234 (1%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            F+Y+ G ENGP  WG +   +  C+AG MQSPI++    V +    G L   Y+ +EA I
Sbjct  38   FSYVVGDENGPEHWGSIKAEWGNCSAGRMQSPIDLSHERVSLVRSLGYLTHSYRPAEAAI  97

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
             N+GH + +++ GDAG ++INGT Y++ Q HWH+P+E+TV+G++ DME+HLVH S+ ++ 
Sbjct  98   ANRGHDIMVRFKGDAGFLVINGTAYYLKQMHWHSPTEHTVDGRRYDMELHLVHESSANKA  157

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQV-DRNGK--ALGALNPGKITYEGKKYYRFIGSLTT  711
            A + +LY+IG  D FL  L  SI ++ DR  +  A+G ++P +       YYR++GSLTT
Sbjct  158  AVIGMLYEIGAEDPFLQALEPSIHRIADRQDREEAIGVVDPRRARGRASVYYRYVGSLTT  217

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PPC++GVIWTV K V+TVS+ Q+ LL+EAV DG E+NARP+Q +N R + + +P
Sbjct  218  PPCTEGVIWTVVKRVRTVSRHQLELLREAVHDGMEKNARPVQDVNDRDISIFRP  271



>ref|XP_004137981.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=352

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 160/238 (67%), Gaps = 5/238 (2%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F Y  G++ GP KWG +   +  CN GNMQSPI++ +  VKV    G+L  +YK S A
Sbjct  108  SEFDYRKGSKKGPSKWGDIKREWEKCNNGNMQSPIDLSNKRVKVVKHLGQLKNKYKPSIA  167

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
            II N+GH + ++W  DAG I INGTDY + Q HWH+PSE+T+NG++ D+E+HLVH+S   
Sbjct  168  IIKNRGHDISVKWEEDAGSIEINGTDYLLQQAHWHSPSEHTLNGRRYDLEVHLVHQSSNP  227

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGK-ALGALNPGKITYEGKKYYRFIG  699
             AK   A V   YKIG+PD FL +L   I+ ++   +   G +NP  I   G KYYR+IG
Sbjct  228  NAKYPIAVVGFFYKIGRPDSFLSKLNRKIKALNEKKEIKAGIINPRWIKNGGMKYYRYIG  287

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            SLT PPC++GVIW + K++ TVS++Q+ LL+ AV D  E+NARP+QP NGR + L  P
Sbjct  288  SLTVPPCTEGVIWNIKKKIGTVSRKQVKLLRSAVHDSAEKNARPIQPHNGRHIDLYDP  345


 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  169  EGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSS  348
            E  +F YI G+  GP KWG +   ++ CN G MQSPI++  +T+ V +  G L R Y   
Sbjct  32   EVCEFDYIGGSNKGPTKWGAIKEEWSKCNNGKMQSPIDLSTNTINVVNSLGPLNREYNPF  91

Query  349  EAIIINKGHALQIQ  390
             A + N+GH + ++
Sbjct  92   SATLRNRGHDISVE  105



>ref|XP_008462491.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=276

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 167/249 (67%), Gaps = 7/249 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y+  ++ GPG WG++   +  CN G++QSPI++    VK+  + GEL R
Sbjct  25   AQEVEDERDFDYVEWSQKGPGHWGEIKKEWEACNNGDLQSPIDLSSERVKIVPQLGELKR  84

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             Y    A + N+GH + + W G  G I ING  Y + Q HWH+PSE+++NG++ D+E+H+
Sbjct  85   NYYPCNATVKNRGHDISVYWYGKPGSIEINGVVYDLQQSHWHSPSEHSINGRRYDLELHM  144

Query  514  VHRSA----KDEFAAVSILYKIGKPDKFLGQLLNSIR-QVDR-NGKALGALNPGKITYEG  675
            VH+S+    K++ A V  LY IG+PD F+ QL   I   VDR + K +G +NP  I + G
Sbjct  145  VHQSSDPTVKNKIAVVGQLYTIGQPDPFITQLSREILGMVDRKHEKKVGVMNPADIKFGG  204

Query  676  KKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRT  855
            +KYYR++GSLT PPC++GVIWT+ K+++TVS+EQ+ LL+EAV D  E NARPLQPLN R 
Sbjct  205  RKYYRYLGSLTVPPCTEGVIWTMNKKIRTVSREQVRLLREAVHDYAEFNARPLQPLNSRE  264

Query  856  VYLNQP*ER  882
            + L +P +R
Sbjct  265  IGLYRPTQR  273



>ref|XP_004515925.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cicer arietinum]
Length=279

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 164/239 (69%), Gaps = 6/239 (3%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F YI  ++ GP +WG+L   +  C  G +QSPI++    V++ +  G+L + YK   A
Sbjct  37   SEFDYIKESKKGPSRWGELKKEWASCKNGKLQSPIDLSSHRVRIVTNLGKLKKYYKPQNA  96

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
             I N+GH ++++W GDAG I INGT++F+ QCHWH+PSE+T+NG++ DME+H+VH S   
Sbjct  97   TIKNRGHDIEVKWEGDAGSININGTEFFLHQCHWHSPSEHTINGRRYDMELHMVHESPKI  156

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRN--GKALGALNPGKITYEGKKYYRFI  696
              K + A + +LYKIG+PD  L +L   I+ +  N   +++G ++P  I +  KKYYR+ 
Sbjct  157  NGKSKIAVIGLLYKIGRPDPVLTKLSKYIKSMIDNEAERSIGVIDPSDIKFGSKKYYRYR  216

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            GSLT PPC++GVIWT+ K+++ VS++Q+ LL+EAV D  E+NARP+Q LN R + L  P
Sbjct  217  GSLTVPPCTEGVIWTINKKIRRVSRDQMELLREAVHDHAEKNARPVQFLNRREIQLYGP  275



>ref|XP_006284932.1| hypothetical protein CARUB_v10006231mg, partial [Capsella rubella]
 gb|EOA17830.1| hypothetical protein CARUB_v10006231mg, partial [Capsella rubella]
Length=254

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/251 (45%), Positives = 160/251 (64%), Gaps = 19/251 (8%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T FTY    ENGP  WG+++  + VCN G  QSPI++ +  V +        R+YK + A
Sbjct  3    TPFTYEQIKENGPKGWGQINPEWKVCNTGRFQSPIDLTNERVSLIHD-QAWKRQYKPAHA  61

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            +I N+GH + + W GDAGK+ I  TD+ ++QCHWH+PSE+TVNG + D+E+H+VH SA  
Sbjct  62   VITNRGHDIMVSWKGDAGKVTIRQTDFKLVQCHWHSPSEHTVNGTRYDLELHMVHTSAGG  121

Query  535  EFAAVSILYKIGKPDKFLG------------------QLLNSIRQVDRNGKALGALNPGK  660
              A + +LYK+GKP++FL                   QLLN I+ V      LG ++P +
Sbjct  122  RTAVIGVLYKLGKPNEFLAKKIVFYKLCFDDSIYTNMQLLNGIKSVGTKEIDLGVIDPRE  181

Query  661  ITYEGKKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQP  840
            I ++ +K+YR+IGSLT PPC++GV+WTV K V T+S EQI  L+EAV DG+E N+RP+Q 
Sbjct  182  IRFQTRKFYRYIGSLTVPPCTEGVLWTVVKRVNTISMEQITALREAVHDGFETNSRPVQE  241

Query  841  LNGRTVYLNQP  873
              GRTV+   P
Sbjct  242  SKGRTVWFYDP  252



>ref|XP_009391366.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=272

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 160/235 (68%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y++G+E GP  WG++H ++  C  G+MQSPI++    V++    G L R Y+ + AI
Sbjct  33   EFSYVTGSELGPEHWGEIHKDWVACGDGHMQSPIDLSHKRVRILPNLGHLRRSYRPAMAI  92

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W  +AG I INGT Y + Q HWH+PSE+T+NG++  +E+H+VH SA   
Sbjct  93   VENRGHDIMLKWEDEAGVIWINGTKYALKQLHWHSPSEHTINGRRYSLELHMVHESADKN  152

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA---LGALNPGKITYEGKKYYRFIGSLT  708
             A V ILYK+G+ D FL +L   I+++     A    G ++P  I    +KYYR++GSLT
Sbjct  153  IAVVGILYKMGRHDPFLAKLERYIKKIADKHDAEEVAGMVDPRHIRKGSRKYYRYMGSLT  212

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC++GV+WT+ K+V+TVS+EQ+ LL+EAV D  E NARP Q +NGR V   +P
Sbjct  213  TPPCTEGVVWTIIKKVRTVSREQVALLREAVHDDSEMNARPTQQINGRIVGFYRP  267



>gb|ABO36620.1| eukaryotic-type carbonic anhydrase family protein [Solanum lycopersicum]
Length=262

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 156/230 (68%), Gaps = 0/230 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            +KF Y+ G   GP  WG +   + +C  G  QSP+N  + +VK+T+    L   YK++ A
Sbjct  31   SKFNYLLGTTEGPESWGTIKFEWKLCETGLFQSPVNFRNKSVKITTTIPLLKPNYKNAPA  90

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            +I+N+GH +++QW  DAG I I+GT+Y + QCHWHTPSE+ V+GK   ME H+VH+S   
Sbjct  91   MIVNRGHDIKLQWEADAGSINIDGTEYRLQQCHWHTPSEHKVDGKSFGMEAHMVHQSDDG  150

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
              A V+I +KIG P+ FL QL+  +++VD  G  LG +NP ++  + + +YR+IGSLT P
Sbjct  151  RLAVVAIPFKIGAPNPFLDQLIGHVKRVDDKGLKLGLVNPQQLGVKAEPFYRYIGSLTVP  210

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            PC++G+IW+V  E +TVS EQ+  L+ AV DG+E NARP+Q L+ R VYL
Sbjct  211  PCTEGIIWSVLYEARTVSMEQMMALRNAVHDGFEANARPVQGLHRRPVYL  260



>ref|XP_006384924.1| hypothetical protein POPTR_0004s22280g [Populus trichocarpa]
 gb|ERP62721.1| hypothetical protein POPTR_0004s22280g [Populus trichocarpa]
Length=274

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 156/236 (66%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T+F Y   +E GP  WG++H  +  C+ G+MQSPI++ +  V + S  G L R YK   A
Sbjct  34   TEFDYNPYSERGPAHWGRIHPEWVACSNGSMQSPIDLLNERVDIVSYLGRLNRSYKPGNA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + ++W   AG I INGT+Y + QCHWH+PSE+T++GK+  +E H+VH S   
Sbjct  94   TLRNRGHDIMLKWESGAGTIEINGTEYVLKQCHWHSPSEHTIDGKRFALEAHMVHESLDG  153

Query  535  EFAAVSILYKIGKPDKFLGQL---LNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSL  705
            + A V ILYKIG+PD FL  L   L S+   +     +G ++P  I    +KYYR++GSL
Sbjct  154  KVAVVGILYKIGRPDSFLSSLTEQLESVAGTNERDTVVGVVDPRNIEIGSRKYYRYLGSL  213

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTPPC++ V+WT+ K+V+T ++EQ+ LL+ AV D  + NARPLQPLNGR+V L  P
Sbjct  214  TTPPCTENVLWTIVKKVRTATREQVRLLRVAVHDDSDTNARPLQPLNGRSVKLFVP  269



>ref|XP_010036663.1| PREDICTED: alpha carbonic anhydrase 4-like isoform X2 [Eucalyptus 
grandis]
Length=256

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 159/235 (68%), Gaps = 13/235 (6%)
 Frame = +1

Query  157  ASESE---GTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGEL  327
            ASESE    T FTYI G   GP +WG++  ++  C+ G +QSPI++ D  V+V    G+L
Sbjct  29   ASESEVGDETPFTYIEGTGKGPKEWGQIDPHWRACSTGKLQSPIDLLDERVQVFPNLGKL  88

Query  328  IRRYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEI  507
             R YK + AI+ N+GH + + W G AG+I INGT Y +LQCHWH+PSE+T NG K D+E+
Sbjct  89   KRDYKPAPAIVRNRGHDITVMWKGYAGQININGTYYKLLQCHWHSPSEHTFNGSKYDLEL  148

Query  508  HLVHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYY  687
            H+VH S+  E A + I+YK G+PD FL +LL  I+ V +  + LG +NPG I +  +KY+
Sbjct  149  HVVHLSSHGEIAVIGIVYKYGRPDPFLTKLLEHIKVVRKEDRDLGVINPGIIKFGSRKYF  208

Query  688  RFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGR  852
            R+IGSLT PPC++GV+WT+ ++V+TVS+EQ+  L+EAV D          P+ GR
Sbjct  209  RYIGSLTVPPCTEGVVWTIIRKVRTVSREQVEALREAVHD----------PMQGR  253



>ref|XP_008442725.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=274

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 157/238 (66%), Gaps = 5/238 (2%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F Y  G++ GP KWG +   +  C  GNMQSPI++ +  VKV    G+L  +YK S A
Sbjct  30   SEFDYRKGSKKGPSKWGDIKREWEKCKNGNMQSPIDLSNKRVKVVKSLGQLKNKYKPSIA  89

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
            II N+GH + ++W  DAG I INGT+Y + Q HWH+PSE+T+NG+  D+E+HLVH+S   
Sbjct  90   IIKNRGHDISVKWEEDAGSIEINGTEYLLQQAHWHSPSEHTLNGRSYDLEVHLVHQSSNP  149

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA-LGALNPGKITYEGKKYYRFIG  699
             AK   A V   YKIG+PD FL +L   I+ ++   +   G +NP  I   G KYYR+IG
Sbjct  150  NAKYPIAVVGFFYKIGRPDSFLSKLTRKIKALNEKKETKAGIINPRWIKNGGMKYYRYIG  209

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            SLT PPC++GVIW + K++ TVS +Q+ LL+ AV D  E+NARP+QP NGR V L  P
Sbjct  210  SLTVPPCTEGVIWNINKKIGTVSGKQVKLLRSAVHDSAEKNARPIQPHNGRHVVLYDP  267



>gb|ADW27480.1| carbonic anhydrase [Zea mays]
Length=277

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 161/234 (69%), Gaps = 3/234 (1%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            F+Y+ G ENGP  WG +   +  C+AG MQSPI++    V +    G L   Y+ +EA I
Sbjct  38   FSYVVGDENGPEHWGSIKAEWGNCSAGRMQSPIDLSHERVSLVRSLGYLTHSYRPAEAAI  97

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
             N+GH + +++ GDAG ++INGT Y++ Q HWH+P+E+TV+G++ DME+HLVH S+ ++ 
Sbjct  98   ANRGHDIMVRFKGDAGFLVINGTAYYLKQMHWHSPTEHTVDGRRYDMELHLVHESSANKA  157

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQV-DRNGK--ALGALNPGKITYEGKKYYRFIGSLTT  711
            A + +LY+IG  D FL  L  SI ++ DR  +  A+G ++P +       YYR++GSLTT
Sbjct  158  AVIGMLYEIGGEDPFLQALEPSIHRIADRQDREEAIGVVDPRRARGRASVYYRYVGSLTT  217

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PPC++GVIWTV K V+TVS+ Q+ LL+EAV DG E+NARP+Q +N R + + +P
Sbjct  218  PPCTEGVIWTVVKRVRTVSRHQLELLREAVHDGMEKNARPVQDVNDRDISIFRP  271



>ref|XP_004293093.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Fragaria vesca subsp. vesca]
Length=472

 Score =   249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/236 (47%), Positives = 155/236 (66%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y   +E GP +WG +   +++CN G +QSPIN+ D  V V S  G L   YK+  A
Sbjct  231  SEFSYDENSEKGPARWGNIRREWSMCNNGLLQSPINLSDDRVNVISDLGALQGSYKACNA  290

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + ++W  DAG I INGT Y + QCHWH+PSE+ +NGK+ D+E H+VH     
Sbjct  291  TLKNRGHDIMLKWQADAGYIPINGTHYSVRQCHWHSPSEHKINGKQFDLEAHMVHDGPNG  350

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNG---KALGALNPGKITYEGKKYYRFIGSL  705
              A + ILYKIGKPD FL Q+++ I  +  +    K +G ++P +I     KYYR+IGSL
Sbjct  351  SIAVIGILYKIGKPDPFLTQMMDYIEDLSESSGEEKVIGMVDPKQIKTVSTKYYRYIGSL  410

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            T PPC+Q V+W +  EV+TVS+EQ+  L+EAV D  E NARPLQP+N R+V L  P
Sbjct  411  TIPPCTQNVLWNLVGEVRTVSKEQVEFLREAVHDESETNARPLQPINTRSVRLYNP  466



>ref|XP_010090219.1| hypothetical protein L484_016558 [Morus notabilis]
 gb|EXB39088.1| hypothetical protein L484_016558 [Morus notabilis]
Length=252

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 153/211 (73%), Gaps = 0/211 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            + FTY+ G+  GP +WG++  ++ +C+ G +QSPI++ D  V+V    G+L R YK + A
Sbjct  31   SPFTYVEGSGKGPKEWGEVDPHWQLCDKGKLQSPIDLLDQRVQVFPSLGKLKRDYKPAPA  90

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             I N+GH + ++W GDAGKI INGTDY +LQCHWH+PSE+T NG + ++E+H++H+S+  
Sbjct  91   TIKNRGHDITVKWKGDAGKININGTDYALLQCHWHSPSEHTFNGTRFELELHVIHKSSSG  150

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
            E A ++I+Y+ G PD FL +L   I+ +    + LG +NPG I +  +KYYR+IGSLT P
Sbjct  151  EIAVIAIVYEYGHPDPFLTRLFEHIKSISHEERELGIVNPGDIKFGSRKYYRYIGSLTVP  210

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDD  807
            PC++GVIWT+ K+V+T S+EQ++ L++AV D
Sbjct  211  PCTEGVIWTIVKKVRTASREQVHALRQAVHD  241



>ref|XP_010916593.1| PREDICTED: alpha carbonic anhydrase 7-like [Elaeis guineensis]
Length=270

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 167/243 (69%), Gaps = 4/243 (2%)
 Frame = +1

Query  157  ASESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRR  336
             S+ +  +F+Y+ G++ GP  WG+L  +++ C  G +QSPI++ D  V+V  + GEL   
Sbjct  28   CSQEDEREFSYVRGSKRGPEHWGELKNSWSACGTGKLQSPIDLSDERVRVLPQLGELRSS  87

Query  337  YKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLV  516
            Y  + A++ N+GH ++I+W    G I INGT Y + Q HWH PSE+T+NG++  +E+H+V
Sbjct  88   YHPANAVMKNRGHDIEIEWKNQTGGIWINGTKYVLQQLHWHLPSEHTINGRRYSLELHMV  147

Query  517  HRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDR----NGKALGALNPGKITYEGKKY  684
            H++A ++ A V ILYKIG+PD FL ++ + +++V+       + LG ++P  +     +Y
Sbjct  148  HQTADNKTAVVGILYKIGRPDPFLAKMEDYLKKVEDLAELEEEKLGMVDPRDVRKGSSEY  207

Query  685  YRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            YR++GSLT PPC++GV+W + ++V+TV+Q+Q+NLL+EAV D    NARPLQP+N R+V L
Sbjct  208  YRYMGSLTAPPCTEGVVWIIIRKVRTVTQQQVNLLREAVHDDVGMNARPLQPINNRSVGL  267

Query  865  NQP  873
             +P
Sbjct  268  YRP  270



>emb|CBI33385.3| unnamed protein product [Vitis vinifera]
Length=271

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 163/239 (68%), Gaps = 1/239 (0%)
 Frame = +1

Query  160  SESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRY  339
            S  + ++F+YI G+E GP KWG +   +  C  G  QSPI++ +  V +   FG+L R+Y
Sbjct  25   SMEDESEFSYIEGSETGPEKWGTIKAEWKTCGKGKRQSPIDLRNRRVSIFPDFGQLKRKY  84

Query  340  KSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVH  519
            + + A++ N+GH + ++W G+AGKI ++G  + + Q HWHTPSE+TVNG    ME+HLVH
Sbjct  85   RPAHAVLKNRGHDVAVEWKGNAGKIKLHGVHFKLEQLHWHTPSEHTVNGTSFQMELHLVH  144

Query  520  RSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDR-NGKALGALNPGKITYEGKKYYRFI  696
            +SA+ + A +   +K+G PD FL ++++ +  +     K +G ++   I + G+KYYR+I
Sbjct  145  KSARGKIAVIGKTFKLGPPDPFLAKMIDHVTGIPAGEEKDIGIVDANDIKHWGRKYYRYI  204

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            GSLTTPPC++GVIWT++K+V TVS+EQ+  L+  V DG+E NARP Q LNGR V+L  P
Sbjct  205  GSLTTPPCTEGVIWTISKKVNTVSKEQVESLRRVVHDGHEGNARPAQRLNGRPVWLYIP  263



>ref|XP_009134167.1| PREDICTED: alpha carbonic anhydrase 4-like [Brassica rapa]
Length=261

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 106/231 (46%), Positives = 164/231 (71%), Gaps = 3/231 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR-RYKSSE  351
            T  TY    ENGP  W KL   +  CN G +QSPI++ ++  +V+    E  +  +K ++
Sbjct  28   TPCTYDQNPENGPKGWSKLDHQWKPCNNGKLQSPIDLTNA--RVSRAHDETWKIHHKPAD  85

Query  352  AIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK  531
            A+I+++GH + + W GD GK++I+ T++ ++QCHWH+PSE+TVNG + DME+H+VH SA+
Sbjct  86   AVILSRGHDIMVSWKGDTGKMMIHRTEFKLVQCHWHSPSEHTVNGTRYDMELHMVHTSAE  145

Query  532  DEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTT  711
             + A +++LYK+G+P++FL  L N I+ V +  K +G ++P  I +   K+YR++GSLT 
Sbjct  146  GQTAVIAVLYKLGRPNEFLTTLENEIKTVGKEEKEIGIVDPRIIGFHTDKFYRYVGSLTA  205

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            PPC++GVIWTV K V TVS EQ+  L++AVDDG+E N+RP+Q  NGR+V+L
Sbjct  206  PPCTEGVIWTVVKRVNTVSMEQLAALRDAVDDGFERNSRPIQDTNGRSVWL  256



>ref|XP_009770757.1| PREDICTED: alpha carbonic anhydrase 4-like [Nicotiana sylvestris]
Length=265

 Score =   241 bits (616),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 153/230 (67%), Gaps = 0/230 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            +KFTY+ G   GP  WG L   +T+C  G  QSP+NI + TV VT+    L   YK + A
Sbjct  34   SKFTYLLGTNEGPENWGNLKPEWTLCTTGKFQSPVNIRNKTVTVTTALQHLKPNYKVAPA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            IIIN+GH +++QW GDAG I I+GT+Y + QCHWHTPSE+ +N K   ME H+VH+SA  
Sbjct  94   IIINRGHDIKLQWEGDAGYINIDGTEYKLQQCHWHTPSEHKLNNKCFAMEAHMVHQSADG  153

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
            + A V+I +KIG P+ F  +L++ I  VD  G  LG ++P ++    + +YR+IGSLT P
Sbjct  154  KIAVVAIPFKIGSPNPFFEELMHHIETVDDKGLKLGWVDPQQLGVGDEPFYRYIGSLTVP  213

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            PC++G+ W V  + +TVS EQ+   + AV DG+E NARP+Q L+ R VYL
Sbjct  214  PCTEGITWNVLPKARTVSMEQLMAYRSAVHDGFEANARPVQSLHKRPVYL  263



>ref|XP_008227262.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Prunus mume]
Length=281

 Score =   242 bits (618),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 162/243 (67%), Gaps = 7/243 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y+ G+  GP +WG++   +  C  G MQSPI++    VK+    G+L  
Sbjct  29   AQEVEDEREFDYLQGSGKGPKQWGEMKKEWAACKNGGMQSPIDLSSQRVKLIPNLGKLNT  88

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK   A + N+GH + I+W GDAG + INGT+Y + QCHWH+PSE+++NG++ DME+H+
Sbjct  89   AYKPCNATVKNRGHDISIEWVGDAGSLKINGTEYLLKQCHWHSPSEHSINGRRYDMELHM  148

Query  514  VHRS----AKDEFAAVSILYKIGKPDKFLGQLLNSIRQV--DRNGKALGALNPGKITYEG  675
            VH S      ++ A V+ LYKIG+PD FL +L   I+ +   +  ++ G ++P KI   G
Sbjct  149  VHLSPDPNVTNKIAVVAALYKIGRPDSFLSKLTRDIKSMTDQKEERSAGIIDPNKIKIPG  208

Query  676  KKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRT  855
            K YYR++GSLT PPC++GVIWT+ K+++TVS++Q+ L + AV D  E NARP+QPLN R 
Sbjct  209  KSYYRYMGSLTVPPCTEGVIWTINKKIRTVSRDQVKLFRVAVHDYAETNARPVQPLNLRE  268

Query  856  VYL  864
            +++
Sbjct  269  IHV  271



>ref|XP_004251153.1| PREDICTED: alpha carbonic anhydrase 7 [Solanum lycopersicum]
Length=276

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 163/237 (69%), Gaps = 4/237 (2%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKS-SE  351
            ++F+Y   +ENGP  WG++H  + +CN G +QSPI++ +  V+V S  G L R YK+ S 
Sbjct  35   SEFSYDRESENGPTHWGEIHPEWKLCNTGKLQSPIDLLNERVEVVSHLGRLHRSYKTTSY  94

Query  352  AIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK  531
            A ++N+GH + ++W G AG I+INGT Y + Q HWH+PSE+T+NG++ D+E+HLVH S  
Sbjct  95   ATLLNRGHDMMLRWEGGAGHIVINGTKYQLNQAHWHSPSEHTINGRRFDLEVHLVHESED  154

Query  532  DEFAAVSILYKIGKPDKFLGQL---LNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGS  702
             + A V I+YKIG+ D FL  +   L ++       + +G ++P K+    +KYYR+IGS
Sbjct  155  GKTAVVGIMYKIGRADSFLSMIESDLKALAHTKNVERKIGIIDPKKVKLGSRKYYRYIGS  214

Query  703  LTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            LT PPC+Q V+WT+ ++V+TV++EQ+ L++EAV D  E N+RP+Q  N RT+ L +P
Sbjct  215  LTVPPCTQDVVWTIVRKVRTVTKEQMKLIREAVHDESETNSRPVQATNKRTIRLYRP  271



>ref|XP_009775004.1| PREDICTED: alpha carbonic anhydrase 7-like [Nicotiana sylvestris]
Length=272

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 165/245 (67%), Gaps = 8/245 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y   +E GP  WGK+   +  CN G MQSPI++ +  V++  K  +  R
Sbjct  26   AQEVEDEREFDYAVKSEKGPRMWGKMKKEWEACNNGEMQSPIDLSNERVRIIRKPEK--R  83

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK   A + N+GH + +QW GDAG ++INGT+Y + Q HWH+PSE+TVNG++  ME+H+
Sbjct  84   NYKLCNATVKNRGHDISLQWHGDAGSLLINGTEYPLQQAHWHSPSEHTVNGRRYAMEMHM  143

Query  514  VH--RSAKDEFAAVSILYKIGKPDKFLGQLLNSIR-QVDRNG--KALGALNPGKITYEGK  678
            VH   +A ++ A + +LYK GKPDKFL +L+ +I   +D+    K  G +NP +I    +
Sbjct  144  VHLNENATNKIAVIGVLYKFGKPDKFLSRLIRNISSMIDKKDEVKNAGMINPREIKIGSR  203

Query  679  KYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTV  858
            +YYR++GSLT PPC++GVIW++ K+V+T+S++Q+ LL+EAV D    NARP+QPLN R V
Sbjct  204  RYYRYLGSLTVPPCTEGVIWSIKKKVRTISRDQVKLLREAVHDYAASNARPMQPLNKRPV  263

Query  859  YLNQP  873
            YL  P
Sbjct  264  YLMAP  268



>gb|KHG27075.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Gossypium arboreum]
Length=274

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 160/236 (68%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F Y + +  GP +WG++H  +  C+ G MQSPI++ +  V + S  G L + YK S A
Sbjct  33   SEFDYGANSTKGPARWGEIHAEWGACSNGTMQSPIDMSNERVNIVSHLGRLKKSYKPSNA  92

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + ++W  +AG I I G +Y + QCHWH+PSE+T+NG++ D+E+H+VH SA  
Sbjct  93   TLRNRGHDMMLRWEDEAGAIEIKGREYVLHQCHWHSPSEHTINGRRYDLELHMVHESADG  152

Query  535  EFAAVSILYKIGKPDKFLGQL---LNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSL  705
            + A + I+YKIG+PD FL  L   L +I  +    +A+G ++P  I +  +KYYR++GSL
Sbjct  153  KVAVIGIMYKIGRPDSFLSSLMDHLEAITDITDGERAVGVIDPRHIKFGSRKYYRYVGSL  212

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            T PPC++ V+W++ ++V+TV++EQ+  L+ AV D  + NARPLQ +N R++ L +P
Sbjct  213  TIPPCTENVVWSIVRKVRTVTREQVRFLRVAVHDESDSNARPLQSINKRSIQLFRP  268



>gb|AFK36418.1| unknown [Lotus japonicus]
Length=280

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 107/240 (45%), Positives = 159/240 (66%), Gaps = 7/240 (3%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F YI G E GP  WG +   +  C  G MQSPI++    V+V    GEL + YK   A
Sbjct  37   SEFNYIQGNEKGPSNWGTMKKEWKTCKTGKMQSPIDLSSHRVRVVPNLGELKKFYKPQNA  96

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS---  525
             + N+GH ++++W  DAG IIINGT++F+ Q HWHTPSE+T+NG++ ++E+H+VH S   
Sbjct  97   TVKNRGHDIEVKWEADAGSIIINGTEFFLHQSHWHTPSEHTINGRRYELELHMVHESRKI  156

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNG---KALGALNPGKITYEGKKYYRF  693
              K + A V ++Y IG+PD  L +L   I+ +  +    K++G ++P +I   GKKYYR+
Sbjct  157  NGKSKIAVVGVMYNIGQPDPVLNKLSKYIKSMGSDHEAEKSIGVMDPSEIKLGGKKYYRY  216

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            +GSLT PPC++GVIWT+ K++++VS+ QIN L+EAV +  + NARP Q LN R + L  P
Sbjct  217  VGSLTIPPCTEGVIWTINKKIRSVSKAQINFLREAVHNHAQRNARPAQSLNRRGIQLYGP  276



>ref|XP_009592985.1| PREDICTED: alpha carbonic anhydrase 7-like [Nicotiana tomentosiformis]
Length=272

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/245 (47%), Positives = 165/245 (67%), Gaps = 8/245 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y + +E GP  WGKL   +  CN G MQSPI++ +  V++  K  +  R
Sbjct  26   AQEVEDEREFDYAAKSEKGPRMWGKLKKEWDACNKGEMQSPIDLSNERVRIIRKPEK--R  83

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK   A + N+GH + +QW G+AG ++INGT+Y + Q HWH+PSE+TVNG++  ME+H+
Sbjct  84   NYKLCNATVKNRGHDISLQWHGNAGSVLINGTEYPLQQAHWHSPSEHTVNGRRYAMEMHM  143

Query  514  VH--RSAKDEFAAVSILYKIGKPDKFLGQLLNSIR-QVDRNG--KALGALNPGKITYEGK  678
            VH   +A ++ A + +LYK GKPDKFL +L+ +I   +D+    K  G +NP +I    +
Sbjct  144  VHLNENATNKIAVIGVLYKFGKPDKFLSKLIRNISSMIDKKDEVKNAGMINPREIKIGSR  203

Query  679  KYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTV  858
            KYYR++GSLT PPC +GVIW++ K+V+T+S++Q+ LL+EAV D    NARP+QPLN R V
Sbjct  204  KYYRYLGSLTVPPCIEGVIWSIKKKVRTISRDQVKLLREAVHDYAASNARPMQPLNKRPV  263

Query  859  YLNQP  873
            YL  P
Sbjct  264  YLMAP  268



>ref|XP_002278815.1| PREDICTED: alpha carbonic anhydrase 4-like [Vitis vinifera]
Length=279

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 161/234 (69%), Gaps = 1/234 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+YI G+E GP KWG +   +  C  G  QSPI++ +  V +   FG+L R+Y+ + A
Sbjct  38   SEFSYIEGSETGPEKWGTIKAEWKTCGKGKRQSPIDLRNRRVSIFPDFGQLKRKYRPAHA  97

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            ++ N+GH + ++W G+AGKI ++G  + + Q HWHTPSE+TVNG    ME+HLVH+SA+ 
Sbjct  98   VLKNRGHDVAVEWKGNAGKIKLHGVHFKLEQLHWHTPSEHTVNGTSFQMELHLVHKSARG  157

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDR-NGKALGALNPGKITYEGKKYYRFIGSLTT  711
            + A +   +K+G PD FL ++++ +  +     K +G ++   I + G+KYYR+IGSLTT
Sbjct  158  KIAVIGKTFKLGPPDPFLAKMIDHVTGIPAGEEKDIGIVDANDIKHWGRKYYRYIGSLTT  217

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PPC++GVIWT++K+V TVS+EQ+  L+  V DG+E NARP Q LNGR V+L  P
Sbjct  218  PPCTEGVIWTISKKVNTVSKEQVESLRRVVHDGHEGNARPAQRLNGRPVWLYIP  271



>ref|XP_006488640.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Citrus sinensis]
Length=275

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 157/235 (67%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y  G ENGP KWG+LH+ ++ C  G MQSPI++ +  V+V S  G L R YK S A 
Sbjct  34   EFNYEEGGENGPSKWGQLHSEWSACKNGRMQSPIDLLNERVQVVSHLGRLKRSYKPSNAT  93

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + +QW G AG + INGT+Y + QCHWH+PSE+T+NG++  +E H+VH S   +
Sbjct  94   LKNRGHDMMLQWEGGAGTLRINGTEYVLQQCHWHSPSEHTINGQRFALEAHMVHVSQDGK  153

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A V I+YKIG+PD FL  + + + QV   +     +G ++P  I    +KYYR+IGSLT
Sbjct  154  IAVVGIVYKIGRPDSFLESISDHLTQVAGSNERETVVGVIDPRGIKIGSRKYYRYIGSLT  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
             PPC++ V+WT+ ++V+TV++EQ+  L+ AV D  + NARP QP+N R V   +P
Sbjct  214  IPPCTENVLWTIVRKVRTVTREQVRSLRVAVHDESDTNARPQQPINLRIVKSYRP  268



>gb|KDO73355.1| hypothetical protein CISIN_1g046862mg [Citrus sinensis]
Length=275

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 156/235 (66%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y  G ENGP KWG+LH+ ++ C  G MQSPI++ +  V+V S  G L R YK S A 
Sbjct  34   EFNYEEGGENGPSKWGQLHSEWSACKNGRMQSPIDLLNERVQVVSHLGRLKRSYKPSNAT  93

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + +QW G AG + INGT+Y + QCHWH+PSE+T+NG++  +E H+VH S   +
Sbjct  94   LKNRGHDMMLQWEGGAGTLRINGTEYVLQQCHWHSPSEHTINGQRFALEAHMVHVSQDGK  153

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A V I+YKIG+PD FL  + + + QV   +      G ++P  I    +KYYR+IGSLT
Sbjct  154  IAVVGIMYKIGRPDSFLESISDHLTQVAGSNERETVAGVIDPRGIKIGSRKYYRYIGSLT  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
             PPC++ V+WT+ ++V+TV++EQ+  L+ AV D  + NARP QP+N R V   +P
Sbjct  214  IPPCTENVLWTIVRKVRTVTREQVRSLRVAVHDESDTNARPQQPINLRIVKSYRP  268



>ref|XP_002308928.2| hypothetical protein POPTR_0006s04610g [Populus trichocarpa]
 gb|EEE92451.2| hypothetical protein POPTR_0006s04610g [Populus trichocarpa]
Length=287

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 155/231 (67%), Gaps = 3/231 (1%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRR-YKSSEAI  357
            F+YI     GP KWG+L   +  C  G +QSPI++ D  VKV     + +RR YK + A 
Sbjct  49   FSYIEATGRGPSKWGQLDPKWKACGDGKLQSPIDLLDQNVKVLYGQEDQLRRDYKPANAT  108

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            II++G  + + W  DAGKI INGTDY +   HWH P+E+T N KK DME+H+VH ++   
Sbjct  109  IISRGRDILVAWKSDAGKISINGTDYNLQGSHWHVPAEHTFNFKKYDMELHIVHVNSLGA  168

Query  538  FAAVSILYKIGKPDKFLGQ--LLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTT  711
             A V +LYK GKPD FL +  L   I+ V +  K+LG   P ++ +E +K YR+IGSL+ 
Sbjct  169  TAVVGVLYKYGKPDPFLSKVFLFPYIKSVTKQEKSLGIFCPNEMVFESRKLYRYIGSLSV  228

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            PPC++ VIWTV K+V+TVS+EQ+ LL++ VDDGY+ NARP+QPLNGR V L
Sbjct  229  PPCNESVIWTVVKKVRTVSREQVQLLRDVVDDGYQANARPVQPLNGRAVNL  279



>ref|XP_002532664.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF29711.1| carbonic anhydrase, putative [Ricinus communis]
Length=266

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 152/227 (67%), Gaps = 2/227 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T++ Y   +  GP +W +L+  +  C  G  QSPIN+ DS  K+    G+L   Y+S+ A
Sbjct  31   TEYRYDEASGKGPSRWAELNPLWRACGVGRSQSPINLQDS--KLIPAPGDLHLAYQSAPA  88

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + ++GH + + WTGDAG I +NGT + + QCHWH P+E+ ++G + DME+HLVH ++  
Sbjct  89   TVKSRGHDIMVSWTGDAGSIQVNGTKFMLKQCHWHMPTEHAISGIRYDMELHLVHSNSAG  148

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
              A V ILYKIG+ D FL +LL  I+ V +  K +G +NP  I +    YYR++GS T+P
Sbjct  149  APAVVGILYKIGQADPFLAKLLPDIKSVTKEEKKIGTINPKDIGFSSSNYYRYVGSFTSP  208

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRT  855
            PC++GV WTV +EVKTVS EQ+  LK AVDDG++ NARPLQPL GRT
Sbjct  209  PCTEGVPWTVFQEVKTVSMEQVQALKGAVDDGFQMNARPLQPLYGRT  255



>ref|XP_007206520.1| hypothetical protein PRUPE_ppa019410mg [Prunus persica]
 gb|EMJ07719.1| hypothetical protein PRUPE_ppa019410mg [Prunus persica]
Length=275

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/235 (47%), Positives = 156/235 (66%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y   +E GP +WGK+   +++CN G+MQSPI++ D  V+V S  G L   Y+   A 
Sbjct  35   EFNYEDDSEKGPARWGKIRQEWSMCNKGSMQSPIDLLDDRVEVVSDLGRLQGSYRPRNAT  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W  DAG I INGT Y + QCHWH+PSE+TVN K  D+E+HLVH+S   +
Sbjct  95   LENRGHDIMLKWEADAGFIRINGTLYQLKQCHWHSPSEHTVNDKSFDLEVHLVHQSPTGK  154

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVD---RNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A   ILYKIG+PD FL  +++ +  +       K +G ++P +I     KYYR+IGSLT
Sbjct  155  NAVTGILYKIGEPDPFLTSIMDYLADISGTCEKQKVVGMVDPKQIKAGSIKYYRYIGSLT  214

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
             PPC+Q VIWT+ ++V++VS EQ+ LL+ AV DG + NARP+QP N R V L +P
Sbjct  215  IPPCTQDVIWTIVEKVRSVSSEQVKLLRVAVHDGSDTNARPVQPRNRRVVQLYKP  269



>ref|XP_011040911.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=274

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 154/235 (66%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y    E GP +WG++H  +  C+ G+MQSPI++ +  V + S  G L R YK   A 
Sbjct  35   EFDYNPDGEKGPAQWGRIHPEWGACSNGSMQSPIDLLNERVDIVSHLGRLNRSYKPGNAT  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W   AG I INGT+Y + QCHWH+PSE+T+NGK++ +E+H+VH S   +
Sbjct  95   LRNRGHDMMLKWESGAGTIEINGTEYVLNQCHWHSPSEHTINGKRLALEVHMVHESLDGK  154

Query  538  FAAVSILYKIGKPDKFLGQL---LNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A V ILYKIG+PD FL  L   L S+   +     +G ++P  I    +KYYR++GSLT
Sbjct  155  VAVVGILYKIGRPDSFLSSLTEQLQSVAGTNERDTVVGIVDPRNIKIGSRKYYRYLGSLT  214

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
             PPC++ V+WT+ K+V+T ++EQ+ LL+ AV D  + NARPLQPLN R V L  P
Sbjct  215  IPPCTENVLWTIVKKVRTATREQVRLLRVAVHDDSDTNARPLQPLNSRPVKLFVP  269



>gb|KCW47834.1| hypothetical protein EUGRSUZ_K01571 [Eucalyptus grandis]
Length=278

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 156/235 (66%), Gaps = 13/235 (6%)
 Frame = +1

Query  157  ASESE---GTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGEL  327
            ASESE    T FTYI G   GP +WG++   +  C  G +QSPI++ +  V+V    G+L
Sbjct  51   ASESEVDDETPFTYIEGTGKGPKEWGQIDPRWQACGMGKLQSPIDLLNERVQVFPNLGKL  110

Query  328  IRRYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEI  507
             R YK + AI+ N+GH + + W GDAGKI INGT Y +LQCHWH+PSE+T NG + D+E+
Sbjct  111  KRDYKPAPAIVRNRGHDITVMWKGDAGKININGTYYKLLQCHWHSPSEHTFNGSRYDLEL  170

Query  508  HLVHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYY  687
            H+VH S+  E A + I+YK G+PD FL +LL  I  V +    LG +NPG I +  +KY+
Sbjct  171  HMVHLSSHGEIAVIGIVYKYGRPDPFLTKLLEHITVVGKEDTDLGVINPGIIKFGSRKYF  230

Query  688  RFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGR  852
            R+IGSLT PPC++GV+WT+ ++V+TVS++Q+  L+EAV D          P+ GR
Sbjct  231  RYIGSLTVPPCTEGVVWTIVRKVRTVSRKQVEALREAVHD----------PMQGR  275



>ref|XP_004249474.1| PREDICTED: alpha carbonic anhydrase 7-like [Solanum lycopersicum]
Length=269

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/245 (47%), Positives = 163/245 (67%), Gaps = 8/245 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y   +E GP  WGKL   +  CN G MQSPI++    V++  K  +  R
Sbjct  23   AQEVEDEREFDYGEKSEKGPKMWGKLKKEWEACNNGEMQSPIDMSHERVRIIQKPDK--R  80

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK   A + N+GH + +QW GDAG + INGT+Y + Q HWH+PSE+TVNG++ DME+H+
Sbjct  81   HYKLCNATVKNRGHDISLQWHGDAGSVTINGTNYPLQQAHWHSPSEHTVNGRRYDMEMHM  140

Query  514  VH--RSAKDEFAAVSILYKIGKPDKFLGQLLNSIR-QVDRNG--KALGALNPGKITYEGK  678
            VH   +A ++   + +LYKIGKPD+FL +L+ +I   +D+    K  G ++P +I    +
Sbjct  141  VHLNENATNKIVVIGVLYKIGKPDRFLSKLIRNISSMIDKKDEVKNAGMIDPREIKIGSR  200

Query  679  KYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTV  858
            KYYR++GSLT PPC++GVIWT+ K+V+TVS+ Q+ +L+EAV D  E+N RPLQP N R +
Sbjct  201  KYYRYMGSLTVPPCTEGVIWTIKKKVRTVSRAQVKMLREAVHDYAEKNGRPLQPKNKRPI  260

Query  859  YLNQP  873
            YL  P
Sbjct  261  YLMAP  265



>ref|XP_004973745.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Setaria italica]
Length=282

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 168/236 (71%), Gaps = 6/236 (3%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            F+Y+ G+ NGP +WGK++T +  C+ G MQSPI++ D  V +    G L   Y+ +EA I
Sbjct  42   FSYVPGSPNGPDRWGKINTLWAECSNGEMQSPIDLSDDRVTLVRSLGFLNYSYRPAEASI  101

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
            +N+GH +Q++++GDAG+++INGT Y + Q HWHTPSE+TV+G++  ME+HLVH++ +++ 
Sbjct  102  VNRGHDIQVKFSGDAGRLVINGTVYHLRQLHWHTPSEHTVDGRRYVMELHLVHQTTENKT  161

Query  541  AAVSILYKIGK-PDKFLGQLLNSIRQV----DRNGKALGALNPGKITYEGKKYYRFIGSL  705
            A + + Y+ G  PD FL  L  SIR++    DR  + +G ++P      G  YYR++GSL
Sbjct  162  AVIGVFYETGNIPDLFLKTLEPSIRRIGDTRDRE-EPIGVVDPNGARATGSVYYRYMGSL  220

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTPPC++GV+WTV K V+ V++ Q+++L+EAV DGYE+NARPLQ +N R + + +P
Sbjct  221  TTPPCTEGVVWTVFKTVRHVAKYQLDILREAVADGYEDNARPLQEVNNRDISIFRP  276



>ref|XP_007144380.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
 gb|ESW16374.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
Length=280

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 155/230 (67%), Gaps = 3/230 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y+ G+E GPG WG+L   ++ C  G MQSPI++  + VK+  +  +L   Y SS A 
Sbjct  38   EFDYMRGSEKGPGYWGELKKEWSACKHGVMQSPIDLSCARVKIIPRCQQLYTDYFSSNAT  97

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            IIN+GH L + W GDAG I INGT++F+ QCHWH+PSE+++NG+K D+E+H+VH S + +
Sbjct  98   IINRGHDLAVYWKGDAGSIHINGTEFFLKQCHWHSPSEHSINGRKYDLEMHMVHVSQEKK  157

Query  538  FAAVSILYKIG-KPDKFLGQLLNSIRQV--DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
               V   YKIG +PD+FL QL   I  +  +   + +G  NP  I   G  YYR++GSLT
Sbjct  158  ILVVGAFYKIGHRPDRFLSQLEKEIVHLVDEEVEREIGERNPSGIQTRGNMYYRYLGSLT  217

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTV  858
            TPPC++GVIW + ++++TVS+ Q+ LL+EAV D  + N+RP QP N R +
Sbjct  218  TPPCTEGVIWNIDRKIRTVSEAQVRLLREAVHDHAQRNSRPRQPRNQRDI  267



>ref|XP_010098809.1| hypothetical protein L484_022574 [Morus notabilis]
 gb|EXB75897.1| hypothetical protein L484_022574 [Morus notabilis]
Length=243

 Score =   238 bits (608),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 156/231 (68%), Gaps = 6/231 (3%)
 Frame = +1

Query  199  AENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAIIINKGHA  378
            +E GP  WG+L   +  C  G +QSPI++ +  VKV  K G++   YK + A I N+GH 
Sbjct  4    SEKGPRHWGELKKEWKACKHGKLQSPIDLLNHRVKVIPKLGDIKMNYKPANATIKNRGHD  63

Query  379  LQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSA----KDEFAA  546
            + I W  DAG I INGTDYF+ QCHWH+PSE+++NG+++D+E+H+VH S     +   A 
Sbjct  64   ISIVWLDDAGSIQINGTDYFLQQCHWHSPSEHSINGRRLDLELHIVHSSPDVKIERRIAV  123

Query  547  VSILYKIGKPDKFLGQLLNSIRQVDRNGKAL--GALNPGKITYEGKKYYRFIGSLTTPPC  720
            +++LYK GKPD+FL +    +  +    + +  G ++P ++   G KYYR+IGSLT PPC
Sbjct  124  IAMLYKFGKPDRFLSKFTKDMVSITDTKQEVHKGVIDPRELKMGGLKYYRYIGSLTIPPC  183

Query  721  SQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            ++GVIWT+ K + TVS+EQ++LL+EAV D  E NARPLQPLN R +++  P
Sbjct  184  TEGVIWTMNKRISTVSREQVSLLREAVHDHAEMNARPLQPLNERDIHICGP  234



>ref|XP_009380700.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=273

 Score =   239 bits (610),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 159/235 (68%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y  G++ GP  WG++H  +  C  G  QSPI++ D  V+V    G L R Y+ ++AI
Sbjct  33   EFSYQRGSQIGPEHWGEIHHEWAACGKGRTQSPIDLSDERVQVFPCLGRLRRSYRPADAI  92

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W  +AG I INGT+Y + Q HWH+PSE+T+NG++  ME+H+VH SA ++
Sbjct  93   LKNRGHDIMLKWEDEAGGIWINGTEYGLKQMHWHSPSEHTINGRRYPMEMHMVHESADNK  152

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA---LGALNPGKITYEGKKYYRFIGSLT  708
             A V ILYKIG  D FL +L   I ++    +A   +G ++P  +    +KYYR+ GSLT
Sbjct  153  IAVVGILYKIGHRDPFLAELERYIERISDKHEAEEVVGMVDPRHVRKGSRKYYRYTGSLT  212

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC++GV WT+ K+V+TVS+EQ+ LL+EAV DG E NARP Q +N R V L +P
Sbjct  213  TPPCTEGVAWTIIKKVRTVSREQLALLREAVHDGSEMNARPTQKMNKRIVGLYRP  267



>ref|XP_007144381.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
 gb|ESW16375.1| hypothetical protein PHAVU_007G151500g [Phaseolus vulgaris]
Length=295

 Score =   240 bits (612),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 155/230 (67%), Gaps = 3/230 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y+ G+E GPG WG+L   ++ C  G MQSPI++  + VK+  +  +L   Y SS A 
Sbjct  53   EFDYMRGSEKGPGYWGELKKEWSACKHGVMQSPIDLSCARVKIIPRCQQLYTDYFSSNAT  112

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            IIN+GH L + W GDAG I INGT++F+ QCHWH+PSE+++NG+K D+E+H+VH S + +
Sbjct  113  IINRGHDLAVYWKGDAGSIHINGTEFFLKQCHWHSPSEHSINGRKYDLEMHMVHVSQEKK  172

Query  538  FAAVSILYKIG-KPDKFLGQLLNSIRQV--DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
               V   YKIG +PD+FL QL   I  +  +   + +G  NP  I   G  YYR++GSLT
Sbjct  173  ILVVGAFYKIGHRPDRFLSQLEKEIVHLVDEEVEREIGERNPSGIQTRGNMYYRYLGSLT  232

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTV  858
            TPPC++GVIW + ++++TVS+ Q+ LL+EAV D  + N+RP QP N R +
Sbjct  233  TPPCTEGVIWNIDRKIRTVSEAQVRLLREAVHDHAQRNSRPRQPRNQRDI  282



>ref|XP_008226047.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3 [Prunus mume]
Length=275

 Score =   239 bits (610),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 156/235 (66%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y   +E GP +WG++   +++CN G+MQSPI++ D  V+V S  G L   Y+   A 
Sbjct  35   EFNYEDDSEKGPARWGEIRQEWSMCNKGSMQSPIDLLDDRVEVVSDLGRLQGSYRPCNAT  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W  DAG I INGT Y + QCHWH+PSE+TVN K  D+E+HL+H+S   +
Sbjct  95   LKNRGHDIMLKWEADAGFIRINGTLYQLKQCHWHSPSEHTVNDKSFDLEVHLLHQSPTGK  154

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A   ILYKIG+PD FL  +++ +  +       K +G ++P +I     KYYR+IGSLT
Sbjct  155  IAVTGILYKIGEPDPFLTSIMDYLADISGTSEKQKVVGMVDPKQIKTGSIKYYRYIGSLT  214

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
             PPC+Q VIWT+ ++V++VS EQ+ LL+ AV D  + NARP+QP NGR V L +P
Sbjct  215  IPPCTQDVIWTIVEKVRSVSSEQVKLLRVAVHDESDTNARPVQPRNGRVVQLCKP  269



>ref|XP_009599195.1| PREDICTED: alpha carbonic anhydrase 4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=265

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/230 (47%), Positives = 152/230 (66%), Gaps = 0/230 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            +KFTY+ G   GP  WG L   + +C  G  QSP+NI + TV VT+    L  +YK + A
Sbjct  34   SKFTYLLGTNEGPENWGNLKPEWKLCTTGKFQSPVNIRNKTVTVTTALQHLKPKYKIAPA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            IIIN+GH +++QW GDAG I I+GT+Y + QCHWHTPSE+ +N K   ME H+VH+S   
Sbjct  94   IIINRGHDIKLQWEGDAGYINIDGTEYKLQQCHWHTPSEHKLNNKCFAMEAHMVHQSGDG  153

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTP  714
            + A V+I +KIG P+ F  +L++ I  VD  G  LG ++P ++    + +YR+IGSLT P
Sbjct  154  KIAVVAIPFKIGSPNPFFEELMHHIETVDDKGLKLGLIHPQQLGVGDEPFYRYIGSLTVP  213

Query  715  PCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            PC++G+ W V  + +TVS EQ+   + AV DG+E NARP+Q L+ R VYL
Sbjct  214  PCTEGITWNVLHKARTVSMEQLMAYRSAVHDGFEANARPVQSLHKRPVYL  263



>ref|XP_002529419.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF32945.1| carbonic anhydrase, putative [Ricinus communis]
Length=272

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/237 (46%), Positives = 159/237 (67%), Gaps = 4/237 (2%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y   +E GP +WG+LH  +  C+ G+MQSPI++ +  V++ S  G LIR YK S A 
Sbjct  35   EFDY-RNSEKGPNRWGELHHEWGACSNGSMQSPIDLFNERVEIVSYLGRLIRSYKPSNAT  93

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + +QW   AG + INGT+Y + QCHWH+PSE+TVNGK   +E+H+VH S   +
Sbjct  94   LKNRGHDMMLQWETGAGTLRINGTEYILKQCHWHSPSEHTVNGKSYALELHMVHESLDGK  153

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVDRNGK---ALGALNPGKITYEGKKYYRFIGSLT  708
             A V I+Y IG+PD FL  L + ++ V    +   A G +NP  I    +KYYR++GSLT
Sbjct  154  IAVVGIMYTIGRPDSFLSSLTDRLQLVAGTREYETAAGTVNPKDIKIGSRKYYRYMGSLT  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*E  879
             PPC++ V+WT+ ++V+TV++EQ+ LL+ AV D    NARP+Q +NGR+V L +P E
Sbjct  214  VPPCTENVLWTIVRKVRTVTREQVRLLRVAVHDESNSNARPIQGINGRSVQLYRPEE  270



>ref|XP_006340169.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=275

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/240 (45%), Positives = 165/240 (69%), Gaps = 10/240 (4%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYK-SSE  351
            ++F+Y   +ENGP  WG+++  + +CN+G +QSPI++ +  V+V S  G L R YK SS 
Sbjct  34   SEFSYDRESENGPTHWGEINPEWKMCNSGKLQSPIDLLNERVEVVSHLGRLHRSYKTSSY  93

Query  352  AIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK  531
            A ++N+GH + ++W G AG I INGT Y + Q HWH+PSE+T+NG++ D+E+HLVH S  
Sbjct  94   ATLLNRGHDMMLRWEGGAGHIKINGTKYQLNQAHWHSPSEHTINGRRFDLEVHLVHESED  153

Query  532  DEFAAVSILYKIGKPDKFLGQL------LNSIRQVDRNGKALGALNPGKITYEGKKYYRF  693
             + A V I+YKIG+ D FL  +      L   + V+RN   +G ++P K+    +KYYR+
Sbjct  154  GKTAVVGIMYKIGRADPFLSMIESDLKALAHTKNVERN---IGVIDPKKVKLGSRKYYRY  210

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            IGSLT PPC+Q V+WT+ ++V+TV++EQ+ L++EAV D  E N+RP+Q  N RT+ L +P
Sbjct  211  IGSLTVPPCTQDVVWTIVRKVRTVTKEQMKLIREAVHDESETNSRPVQATNKRTIRLYRP  270



>ref|XP_009367040.1| PREDICTED: alpha carbonic anhydrase 7-like [Pyrus x bretschneideri]
Length=275

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/237 (46%), Positives = 157/237 (66%), Gaps = 3/237 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y   +E GP +WG++   +++C+ G+MQSPI++ D  V+V S FG L   Y+   A 
Sbjct  35   EFNYKEDSEKGPARWGEIRQEWSMCSKGSMQSPIDLLDDRVEVVSNFGILQGSYRPCNAT  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W  DAG I +NGT Y + QCHWH+ SE+T+NGK+ D+E HLVH S+  +
Sbjct  95   LKNRGHDMMLKWEADAGFIQLNGTLYKLKQCHWHSSSEHTINGKRFDLEAHLVHESSTGK  154

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A   ILYKIG PD FL  +++S+ +V       + +G ++P KI     KYYR+IGSLT
Sbjct  155  IAVTGILYKIGAPDPFLSSMMDSLAEVSGTSEEEEVVGTVDPKKIKTRSTKYYRYIGSLT  214

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP*E  879
             PPC+Q V WT+ +EV+TVS+EQ+  L+ AV D  + NARP+Q  NGR V + +P E
Sbjct  215  IPPCTQNVTWTIDQEVRTVSKEQVKFLRVAVHDDSKTNARPVQQRNGRVVQVYRPKE  271



>ref|XP_010439534.1| PREDICTED: alpha carbonic anhydrase 4-like [Camelina sativa]
Length=267

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 160/228 (70%), Gaps = 2/228 (1%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            +TY    + GP  WG ++ ++ VCN GN QSPI++ +  V +       +  YK + A+I
Sbjct  37   YTYKQKTDKGPEGWGNINPDWKVCNTGNFQSPIDLTNERVSLVHDQAWKLD-YKPAPAVI  95

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
            +N+GH + + W GDAGK+ I+ TDY ++QCHWHTPSE+T+NG   D+E+H+VH SA  + 
Sbjct  96   VNRGHDIMVSWKGDAGKVTIHQTDYKLVQCHWHTPSEHTINGTSYDLELHMVHTSAHGKN  155

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTPPC  720
            + + +LYK+G+P++F+ +LLN I+ V++  K +G ++P +  +   K YR+IGSLT PPC
Sbjct  156  SVIGVLYKLGEPNEFIAKLLNGIKGVEKKEKDIGMVDPREARFHS-KIYRYIGSLTAPPC  214

Query  721  SQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            ++GVIWTV  +V TVS EQI  LKEAVDDG+E N+RP+Q  +GR+V+ 
Sbjct  215  TEGVIWTVLTKVNTVSMEQITALKEAVDDGFEANSRPVQDPHGRSVWF  262



>ref|XP_006424534.1| hypothetical protein CICLE_v10030314mg [Citrus clementina]
 gb|ESR37774.1| hypothetical protein CICLE_v10030314mg [Citrus clementina]
Length=275

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 155/235 (66%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y  G ENGP KWG+LH+ ++ C  G MQSPI++ +  V+V S  G L R YK S A 
Sbjct  34   EFNYEEGGENGPSKWGELHSKWSACKNGRMQSPIDLLNERVQVVSHLGRLKRSYKPSNAT  93

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + +QW G AG + ING +Y + QCHWH+PSE+T+NG++  +E H+VH S   +
Sbjct  94   LKNRGHDMMLQWEGGAGTLRINGIEYVLQQCHWHSPSEHTINGQRFALEAHMVHVSQDGK  153

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A V I+YKIG+PD FL  + + + QV   +      G ++P  I    +KYYR+IGSLT
Sbjct  154  IAVVGIMYKIGRPDSFLESISDHLTQVAGSNERETVAGVIDPRGIKIGSRKYYRYIGSLT  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
             PPC++ V+WT+ ++V+TV++EQ+  L+ AV D  + NARP QP+N R V   +P
Sbjct  214  IPPCTENVLWTIVRKVRTVTREQVRSLRVAVHDESDTNARPQQPINLRIVKSYRP  268



>ref|XP_004142716.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=303

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/221 (50%), Positives = 153/221 (69%), Gaps = 4/221 (2%)
 Frame = +1

Query  157  ASESE---GTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGEL  327
            ASESE    + F+Y  G  NGP +WGKL  ++  C  G  QSPINI +  V+V  K G+L
Sbjct  36   ASESEVGDESAFSYNEGNGNGPKEWGKLKADWKSCEEGKYQSPINIVEEDVQVLPKLGKL  95

Query  328  IRRYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEI  507
             R Y  + AI+ N+GH + I+W  DAGKI INGT Y + QCHWH PSE++ NG + D+E+
Sbjct  96   RRDYNPAPAIVKNRGHDILIRWETDAGKITINGTKYKLSQCHWHAPSEHSFNGIRYDLEM  155

Query  508  HLVHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQV-DRNGKALGALNPGKITYEGKKY  684
            HLVH S   E A V+ILYK G+PD+FL +L + ++ +  +  K +G +NPG I + G+KY
Sbjct  156  HLVHTSDHKETAVVAILYKFGRPDRFLSKLFHHLKSIGKKEEKEIGIVNPGDIKFGGRKY  215

Query  685  YRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDD  807
            YR+IGSLT PPC++GV+WT+ K+V+TVS+EQ+  LK A+ D
Sbjct  216  YRYIGSLTVPPCTEGVLWTIQKKVRTVSREQVRALKTAIHD  256



>ref|XP_009399717.1| PREDICTED: alpha carbonic anhydrase 7-like [Musa acuminata subsp. 
malaccensis]
Length=272

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 163/235 (69%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y  G+E GP  WG++H ++  C  G+MQSPI++    V++    G L R Y  +EAI
Sbjct  33   EFSYEKGSETGPEHWGEIHKDWAACGKGHMQSPIDLTHKRVQILPHLGRLRRSYHPAEAI  92

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W  +AG + INGT+Y + Q HWH+PSE+TV+G++  +E+H+VH S  ++
Sbjct  93   LKNRGHDIMLKWEEEAGGLWINGTEYALKQLHWHSPSEHTVDGRRYSLEMHMVHESTDNK  152

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV-DRN--GKALGALNPGKITYEGKKYYRFIGSLT  708
             A V ILY IG+ D FL +L   I ++ D++   +A+G ++P  I    +KYYR++GSLT
Sbjct  153  TAVVGILYTIGRHDPFLAKLERYIEKIADKHEAEEAVGMVDPRHIKRGSRKYYRYMGSLT  212

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC++GV+WT+ K+V+TV++EQ+ LL+EAV D  E NARP Q +N R + L +P
Sbjct  213  TPPCTEGVVWTIVKKVRTVTREQVALLREAVHDDSEMNARPTQKINDRMIGLYRP  267



>ref|XP_007162157.1| hypothetical protein PHAVU_001G129100g [Phaseolus vulgaris]
 gb|ESW34151.1| hypothetical protein PHAVU_001G129100g [Phaseolus vulgaris]
Length=270

 Score =   237 bits (604),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 164/229 (72%), Gaps = 0/229 (0%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            ++TY   +  GP  W +++  + VC  G +QSPI+I D  V+   + G+L + Y+ + A+
Sbjct  32   EYTYKEESSKGPKNWWRINPKWKVCGNGKLQSPIDILDKRVQEFPQLGKLQKDYQPAPAV  91

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N GHA+ +QW G+AG++ INGT Y ++QCHWHTPSE+T+NG+K D+E+H VH+++K E
Sbjct  92   LKNTGHAIMMQWNGNAGQLNINGTYYKLIQCHWHTPSEHTLNGRKFDLELHAVHQNSKGE  151

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTPP  717
             A + I YKIG+PD+ L +LL  ++ +      LG +NPG I +  +KYYR++GSLTTPP
Sbjct  152  TAVIGIWYKIGRPDRLLSKLLKDLKSLGDKDLDLGVINPGIIKFGSRKYYRYVGSLTTPP  211

Query  718  CSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            C++GV+WT+ K+V+TVS+EQ+  LK A+   YE+NARP Q +NGR V+L
Sbjct  212  CTEGVVWTIVKKVRTVSREQLRALKAALHHEYEDNARPTQEVNGREVWL  260



>ref|XP_008664513.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3 [Zea mays]
 tpg|DAA48424.1| TPA: hypothetical protein ZEAMMB73_580242 [Zea mays]
Length=298

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 159/236 (67%), Gaps = 6/236 (3%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            F+Y+ G E+GP  WG +   +  C AG MQSPI++    V +    G L   Y+ +EA I
Sbjct  58   FSYVPGDEHGPEHWGSIKAEWAACGAGRMQSPIDLSHERVSLVRSLGYLSHSYRPAEASI  117

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
            +N+GH + +++ GDAG ++INGT Y++ Q HWH+P+E+TV+G++ DME+HLVH SA+++ 
Sbjct  118  VNRGHDIMVRFEGDAGSLVINGTAYYLRQLHWHSPTEHTVDGRRYDMELHLVHESAENKA  177

Query  541  AAVSILYKI-GKPDKFLGQLLNSIRQV----DRNGKALGALNPGKITYEGKKYYRFIGSL  705
            A +++LY+I G  D  L QL  +IR+V    DR  + +G ++P +       YYR++GSL
Sbjct  178  AVIAVLYEIGGHDDALLRQLEPAIRRVADVRDREMR-VGVVDPRRARGRASVYYRYVGSL  236

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            T PPC++GVIWT+ K V++VS+ Q+ LL+EAV D  E NARPLQ  N R V + +P
Sbjct  237  TAPPCTEGVIWTIVKRVRSVSKHQLELLREAVHDDMENNARPLQEANHRDVSMFRP  292



>ref|XP_010449136.1| PREDICTED: alpha carbonic anhydrase 4-like [Camelina sativa]
Length=267

 Score =   236 bits (603),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 159/228 (70%), Gaps = 2/228 (1%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            +TY    + GP  WG +  ++ VCN G  QSPI++ +  V +       +  YK + A+I
Sbjct  37   YTYKQKTDKGPEGWGNIDPDWKVCNTGKFQSPIDLTNERVSLVHDQAWKLD-YKPAPAVI  95

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
            +N+GH + + W GDAGK+ I+ TD+ ++QCHWHTPSE+T+NG   D+E+H+VH SA  + 
Sbjct  96   VNRGHDIMVSWKGDAGKVTIHQTDFKLVQCHWHTPSEHTINGTSYDLELHMVHTSAHGKH  155

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTPPC  720
            A + +LYK+G+P++F+ +LLN I+ V++  K +G ++P +  ++  K YR+IGSLT PPC
Sbjct  156  AVIGVLYKLGEPNEFIAKLLNGIKGVEKKEKDIGMVDPREARFQS-KIYRYIGSLTAPPC  214

Query  721  SQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            ++GVIWTV  +V TVS EQI  LKEAVDDG+E N+RP+Q  +GR+V+ 
Sbjct  215  TEGVIWTVLTKVNTVSMEQITALKEAVDDGFEVNSRPVQDPHGRSVWF  262



>gb|KDP44023.1| hypothetical protein JCGZ_05490 [Jatropha curcas]
Length=275

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/234 (46%), Positives = 156/234 (67%), Gaps = 4/234 (2%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            F Y  G E GP +WG+LH  ++ CN G+MQSPI++ +  V+V S  G+L R YKSS A +
Sbjct  37   FDYYEG-EKGPSRWGELHPEWSACNNGSMQSPIDLLNERVEVVSHLGKLKREYKSSNATL  95

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
             N+GH + ++W   AG   INGT+Y + QCHWH+PSE++VNG +  +E+H+VH S   + 
Sbjct  96   KNRGHDMMMEWENGAGITEINGTEYILKQCHWHSPSEHSVNGVRFALELHMVHESLDGKV  155

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQVDRNGK---ALGALNPGKITYEGKKYYRFIGSLTT  711
            A + ++Y IG+PD FL  +   +R V    K    +G +NP  I    +KYYR+ GSLT 
Sbjct  156  AVIGVMYIIGRPDSFLSSVDKHLRSVAGTRKLQTVVGMVNPKSIKLRSRKYYRYKGSLTV  215

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PPC++ V+WT+  +V+TVS+EQ+ LL+ AV D  + NARP+Q +NGR+V L +P
Sbjct  216  PPCTENVLWTIVTKVRTVSREQVRLLRVAVHDESDTNARPIQLMNGRSVQLYKP  269



>ref|XP_010521744.1| PREDICTED: alpha carbonic anhydrase 7-like [Tarenaya hassleriana]
Length=274

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 155/235 (66%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y    E GP  WGKL   + +C  G MQSPI++ +  V++ S  G L R Y+ S A 
Sbjct  37   EFNYEMEGERGPKNWGKLKPEWKMCGRGKMQSPIDLLNKRVRIVSHLGRLKRDYRPSNAT  96

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + +++   AG+I + G  Y + Q HWH+PSE+T+NGK+  +E+H+VH S    
Sbjct  97   LKNRGHDMMLRFEDGAGRIHVKGRPYTLRQIHWHSPSEHTINGKRFALELHMVHESKNGR  156

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA---LGALNPGKITYEGKKYYRFIGSLT  708
            FA V+ILYKIG+PD FL  L N + +V    +A   +G ++P KI +  +KYYR+IGSLT
Sbjct  157  FAVVTILYKIGRPDTFLQSLENGLEEVSDKHEAEKNIGIIDPKKIKFGSRKYYRYIGSLT  216

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC+Q V+WTV K+V+TV++EQ+ LL+ +V D    NARP+Q  N R VYL +P
Sbjct  217  TPPCTQNVVWTVLKKVRTVTREQVRLLRVSVHDDSNSNARPIQRRNKRRVYLYRP  271



>ref|XP_009776894.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3, partial [Nicotiana sylvestris]
Length=260

 Score =   236 bits (602),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 101/230 (44%), Positives = 160/230 (70%), Gaps = 9/230 (4%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++FTY   +E GP  WG++H+ +++CN+G +QSPI++ +  V++ S  G L R YK S +
Sbjct  33   SEFTYDEESEKGPSHWGEIHSEWSMCNSGKLQSPIDLLNERVEIVSHLGRLHRSYKPSNS  92

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             ++N+GH + ++W G AG I INGT Y + Q HWH+PSE+T+NG++ D+E+HLVH S   
Sbjct  93   TLLNRGHDMMLRWEGGAGHIKINGTQYQLNQAHWHSPSEHTINGRRFDLEVHLVHESNDG  152

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQ------VDRNGKALGALNPGKITYEGKKYYRFI  696
            + A V I+YKIG+ D FL  + + ++       V+RN   +G ++P ++    +KYYR+I
Sbjct  153  KTAVVGIMYKIGRADSFLSMIEDDLKALAHTKGVERN---IGVIDPKQVKLGSRKYYRYI  209

Query  697  GSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLN  846
            GSLT PPC+Q V+WT+ ++V+TV++EQ+ L++EAV D  E N+RP+Q  N
Sbjct  210  GSLTVPPCTQDVVWTIVRKVRTVTREQMKLIREAVHDESETNSRPVQAAN  259



>ref|XP_009113037.1| PREDICTED: alpha carbonic anhydrase 2-like [Brassica rapa]
Length=271

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 154/235 (66%), Gaps = 2/235 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y+   ENGP KWGKL   + +C  G MQSPI++    V++ S  G L R YK S A
Sbjct  34   SEFSYMRNQENGPEKWGKLKPEWKMCGKGEMQSPIDLMHKRVRIVSHLGRLTRNYKPSNA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + +++   +  I IN  +Y + Q HWH+PSE+T+NG++  +E+H+VH S   
Sbjct  94   TLRNRGHDMMVRFEEGSSSIKINNVEYQLHQLHWHSPSEHTINGRRFALELHMVHESLNG  153

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQV-DRN-GKALGALNPGKITYEGKKYYRFIGSLT  708
              A V++LYKIG+PD FL  L N +  + D N  K +G ++P  I +  +KYYR+IGSLT
Sbjct  154  SLAVVTVLYKIGRPDSFLNLLENKLSAMTDPNEEKNIGMIDPRGIKFGSRKYYRYIGSLT  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
             PPC+Q VIWTV KEVKTV++ Q+ LL+ AV D    NARP+QP N R V  N+P
Sbjct  214  IPPCTQNVIWTVVKEVKTVARNQVKLLRVAVHDHSNTNARPVQPTNMRVVKFNRP  268



>ref|XP_002445624.1| hypothetical protein SORBIDRAFT_07g022880 [Sorghum bicolor]
 gb|EES15119.1| hypothetical protein SORBIDRAFT_07g022880 [Sorghum bicolor]
Length=280

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 160/234 (68%), Gaps = 3/234 (1%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            F+Y+ G ENGP  WG +   +  C+AG MQSPI++    V +    G L   Y+ ++A I
Sbjct  41   FSYVVGDENGPAHWGGIKAEWANCSAGRMQSPIDLSHERVSLVRSLGYLTHSYRPADASI  100

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
            +N+GH + +++ GDAG ++I+GT Y++ Q HWH+P+E+TV+G++ DME+HLVH++  ++ 
Sbjct  101  VNRGHDIMVRFNGDAGSLVIHGTAYYLRQMHWHSPTEHTVDGRRYDMELHLVHQTLANKT  160

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQV-DRNGK--ALGALNPGKITYEGKKYYRFIGSLTT  711
            A + ILY+IG  D FL  L   I ++ DR  +   +G ++P +       YYR++GSLTT
Sbjct  161  AVIGILYEIGGEDPFLQALEPFIHRIADRKDREEPVGVVDPRRARGRASVYYRYMGSLTT  220

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PPC++GVIWTV K V+TVS+ Q+ LL+EAV DG E+NARP+Q +N R + + +P
Sbjct  221  PPCTEGVIWTVVKRVRTVSKHQMELLREAVHDGMEKNARPVQDVNDRDISIFRP  274



>emb|CDP11563.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 156/237 (66%), Gaps = 3/237 (1%)
 Frame = +1

Query  163  ESEGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYK  342
            E +   F+Y   +  GP  WG+L   +  C+ G MQSPI++ D+ V+V    G+L R Y+
Sbjct  29   EDDQHGFSYDENSPRGPAHWGELKEEWCTCSHGRMQSPIDLPDAEVQVDPSLGKLHRHYR  88

Query  343  SSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHR  522
             S A +IN+GH + ++W  DAG I I+GT Y + QCHWH+P+E+ +NG++ D+E HLVH+
Sbjct  89   PSNATLINRGHDIMLRWVDDAGYIRIDGTLYQLQQCHWHSPTEHAINGERYDLEAHLVHQ  148

Query  523  SAKDEFAAVSILYKIGKPDKFLGQL---LNSIRQVDRNGKALGALNPGKITYEGKKYYRF  693
            S   + A + ILYKIG+PD FL  L   L ++       + +G ++P +IT+  K YYR+
Sbjct  149  SPDGKIAVIGILYKIGRPDPFLSMLEHYLEALADTLEEEEVVGFVDPNQITFGSKGYYRY  208

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
             GSLTTPPC++ V+WT+  +V TVS+ Q+ L++ AV DG + NARPLQP+N R + L
Sbjct  209  SGSLTTPPCTEDVLWTIVDKVGTVSRHQVKLIRNAVHDGSKMNARPLQPINDRPIRL  265



>ref|XP_002314288.2| hypothetical protein POPTR_0009s01540g [Populus trichocarpa]
 gb|EEE88243.2| hypothetical protein POPTR_0009s01540g [Populus trichocarpa]
Length=277

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 155/235 (66%), Gaps = 5/235 (2%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            F Y    E GP  WG++H  +  C+ G+MQSPI++    V V S  G L R YK + A +
Sbjct  39   FNYDPNGEKGPANWGRIHPEWGACSNGSMQSPIDLLSERVDVVSHLGRLSRSYKPANATL  98

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
             N+GH + ++W G AG I INGT+Y + QCHWH+PSE+T+NGK++ +E+H+VH S   + 
Sbjct  99   RNRGHDMMLKWEGAAGSIEINGTEYLLKQCHWHSPSEHTINGKRLALEVHMVHESLDGKV  158

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQV----DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
            A V I+Y IG+PD FL  L   ++ V    +R+  A G ++P  I    +KYYR+IGSLT
Sbjct  159  AVVGIMYMIGRPDSFLSSLTKQLQSVAGTYERDTVA-GVVDPRNIKIGSRKYYRYIGSLT  217

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
             PPC++ V+WT+ ++V+T ++EQ+ +L+ AV D  + NAR +QP+N RTV L +P
Sbjct  218  IPPCTENVLWTIVRKVRTATREQVRMLRVAVHDESDTNARQIQPINSRTVKLFRP  272



>ref|XP_010090214.1| hypothetical protein L484_016553 [Morus notabilis]
 gb|EXB39083.1| hypothetical protein L484_016553 [Morus notabilis]
Length=292

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 159/239 (67%), Gaps = 11/239 (5%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +++Y      GP +WG+L  N+ +C  G  QSPINI+ STV++  + G L   Y  + A 
Sbjct  49   RYSYNESTLRGPSRWGQLDPNWFLCGNGTRQSPININASTVQLRPQLGGLQTNYSPAPAT  108

Query  358  IINKGHALQIQWTG-DAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            + N+G+ +++ W G DAG + +NGT Y +L+CHWHTPSE+ +NG++ DMEIHLVH++ + 
Sbjct  109  LFNRGNEIEVNWNGSDAGNLTVNGTVYKLLECHWHTPSEHRLNGRRFDMEIHLVHKNDRG  168

Query  535  EFAAVSILYKI---GKPDKFLGQLLNSIRQVDRNGK---ALGALNPGKITYEGKK---YY  687
            E A V ILYK     KPD FL  +   I  + RNG     LG +NP  I   G++   YY
Sbjct  169  EIAVVGILYKYMRWSKPDPFLSSIYQQILSL-RNGTKQIPLGIVNPRDIESPGRRWRSYY  227

Query  688  RFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            R+ GSLTTPPC++ V+WTV K V+TVS +Q+  L+EAVDDG+EENARP QPLNGR V L
Sbjct  228  RYNGSLTTPPCAENVLWTVLKRVQTVSPKQVQALQEAVDDGFEENARPTQPLNGRKVSL  286



>ref|XP_003625103.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Medicago truncatula]
 gb|AES81321.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=270

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 157/235 (67%), Gaps = 2/235 (1%)
 Frame = +1

Query  172  GTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSE  351
            G ++ Y  G   GP  WG L   + +C  G +QSPI+I +  V+   + G+L + YK   
Sbjct  30   GNEYNYKKGDSKGPENWGNLKPEWKLCGNGKLQSPIDILNKRVQELPQLGKLEKDYKLGP  89

Query  352  AIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK  531
            A + N+ + + +QW G AGK+ +NGT Y ++QCHWHTPSE+T+NG K DME H VH+++K
Sbjct  90   AFLKNRFNDVMLQWKGYAGKLNLNGTYYKLIQCHWHTPSEHTLNGSKFDMEQHCVHQNSK  149

Query  532  DEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKI-TYEGKKYYRFIGSLT  708
            DE A + I YKIG+PD  L +LLN I+ +      +G +NP  I  + G KYYR+IGSLT
Sbjct  150  DEIAVIGIWYKIGRPDPLLSKLLNHIKSIRDKEIDVGIINPADIFKFGGTKYYRYIGSLT  209

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            +PPC++ VIWTV K+VKTVS EQ+  LK AV+ G+EENARP Q L+GR V+   P
Sbjct  210  SPPCTEDVIWTVLKKVKTVSVEQLKALK-AVNHGFEENARPTQDLDGRKVWFYNP  263



>ref|XP_006340168.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=275

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/237 (46%), Positives = 163/237 (69%), Gaps = 10/237 (4%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYK-SSE  351
            ++F+Y   +ENGP  WG+++  + +CN+G +QSPI++ +  V+V S  G L R YK SS 
Sbjct  34   SEFSYDRESENGPTHWGEINPEWKMCNSGKLQSPIDLLNERVEVVSHLGRLHRSYKTSSY  93

Query  352  AIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK  531
            A ++N+GH + ++W G AG I INGT Y + Q HWH+PSE+T+NG++ D+E+HLVH S  
Sbjct  94   ATLLNRGHDMMLRWEGGAGHIKINGTKYQLNQAHWHSPSEHTINGRRFDLEVHLVHESED  153

Query  532  DEFAAVSILYKIGKPDKFLGQL------LNSIRQVDRNGKALGALNPGKITYEGKKYYRF  693
             + A V I+YKIG+ D FL  +      L   + V+RN   +G ++P K+    +KYYR+
Sbjct  154  GKTAVVGIMYKIGRADPFLTMIESDLKALAHTKNVERN---IGVIDPKKVKLGSRKYYRY  210

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            IGSLT PPC+Q V+WT+ ++V+TV++EQ+ L++EAV D  E N+RP+Q  N RT+ L
Sbjct  211  IGSLTVPPCTQDVVWTIVRKVRTVTKEQMKLIREAVHDESETNSRPVQATNKRTIRL  267



>ref|XP_010696307.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=279

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 156/234 (67%), Gaps = 5/234 (2%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T+F Y+ G+E GP +WG +   +  C  G  QSPI++    V+V  K  E+++ YK+  A
Sbjct  34   TEFDYLRGSERGPDRWGHIREEWATCRTGRYQSPIDLLHRRVQVIPKSAEIVKFYKAGNA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSA-K  531
             + N+GH + I+W G+  KI INGT Y + QCHWH+PSE+T+NG +   E+HLVH++   
Sbjct  94   TVRNRGHDIMIEWEGEDSKIQINGTTYILRQCHWHSPSEHTINGSRFAAELHLVHQTPDN  153

Query  532  DEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKAL---GALNPGKITYEGKKYYRFIGS  702
            +  A + +LYK+GKP++FL  L+  +  V  N   L   G +NPG+I   G+KYYR++GS
Sbjct  154  NSIAVIGLLYKLGKPNRFLTTLMEKLELVP-NALDLTNAGEINPGEIKLRGRKYYRYMGS  212

Query  703  LTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            LTTPPC++GV+WT+ + + T+S+ Q+  ++E V D  E NARP+QPLNGR V L
Sbjct  213  LTTPPCTEGVLWTLDRRIATISEGQVAKMREVVHDDAERNARPVQPLNGRKVGL  266



>ref|XP_011044411.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=274

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 155/235 (66%), Gaps = 5/235 (2%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            F Y    E GP  WG++H  +  C+ G+MQSPI++    V V S  G L R YK + A +
Sbjct  36   FNYDPNGEKGPANWGRIHPEWGACSNGSMQSPIDLLSERVDVVSHLGRLSRSYKPANATL  95

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
             N+GH + ++W G AG I INGT+Y + QCHWH+PSE+T+NGK++ +E+H+VH S   + 
Sbjct  96   RNRGHDMMLKWEGAAGSIEINGTEYLLKQCHWHSPSEHTINGKRLALEVHMVHESLDGKV  155

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQV----DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
            A V I+Y IG+PD FL  L   ++ V    +R+  A G ++P  I    +KYYR++GSLT
Sbjct  156  AVVGIMYMIGRPDSFLSSLTKQLQLVAGTYERDTVA-GVVDPRNIKIGSRKYYRYMGSLT  214

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
             PPC++ V+WT+ ++V+T ++EQ+ +L+ AV D  + NAR +QP+N RTV L +P
Sbjct  215  IPPCTENVLWTIVRKVRTATREQVRMLRVAVHDESDTNARQIQPINSRTVKLFRP  269



>ref|XP_006339092.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=269

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 161/245 (66%), Gaps = 8/245 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y   +E GP  WGKL   +  CN G MQSPI++    V++  K  +  R
Sbjct  23   AQEVEDEREFDYGEKSEKGPKMWGKLKKEWEACNNGEMQSPIDMSHERVRIIQKPDK--R  80

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK   A + N+GH + +QW GDAG + INGT+Y + Q HWH+PSE+TVNG++ DME+H+
Sbjct  81   HYKLCNATVKNRGHDISLQWHGDAGSVSINGTNYPLQQAHWHSPSEHTVNGRRYDMEMHM  140

Query  514  VH--RSAKDEFAAVSILYKIGKPDKFLGQLLNSIR-QVDRNG--KALGALNPGKITYEGK  678
            VH   +A ++   + +LYKIGKPD+FL +L+ +I   +D+    K  G ++P +I    +
Sbjct  141  VHLNENATNKIVVIGVLYKIGKPDRFLSKLIRNISSMIDKKDEVKNAGMIDPREIKIGSR  200

Query  679  KYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTV  858
            KYYR++GSLT PPC++GVIWT+ K+V+TVS+ Q+ +L+EAV D  E N RPLQ  N R +
Sbjct  201  KYYRYMGSLTVPPCTEGVIWTIKKKVRTVSRAQVKMLREAVHDYAERNGRPLQSKNKRPI  260

Query  859  YLNQP  873
            YL  P
Sbjct  261  YLMAP  265



>gb|KFK28694.1| hypothetical protein AALP_AA7G034200 [Arabis alpina]
Length=269

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 161/234 (69%), Gaps = 3/234 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T FTY    E GP  WGK+  ++ +CN G  QSPI++ +  V + + +G   R+Y+ + A
Sbjct  36   TPFTY-EHTEKGPEGWGKIDPHWRICNTGKFQSPIDLTNQRVSLIN-YGAWSRQYQPALA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + + W GDAGKI I   ++ ++QCHWH+PSE+TVNG + DME+H+VH+S + 
Sbjct  94   SLKNRGHDIMVSWKGDAGKITIRQKEFKLVQCHWHSPSEHTVNGTRYDMELHMVHQSDRG  153

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKIT-YEGKKYYRFIGSLTT  711
            + A + +L+K+G+P+KFL +LLN I+ + +    +G +NP  I  ++ +K+YR+IGSLT 
Sbjct  154  KLAVIGVLFKLGQPNKFLTKLLNGIKAIGKEEINIGIVNPHDIIRFQTRKFYRYIGSLTV  213

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PPC++GVIWTV K V T+S EQI  L+ AV DG+E N+RP+Q  + RTV+   P
Sbjct  214  PPCTEGVIWTVVKRVNTISAEQIAALRNAVHDGFETNSRPVQNTHSRTVWYYDP  267



>emb|CDY45963.1| BnaA09g13030D [Brassica napus]
Length=271

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 154/235 (66%), Gaps = 2/235 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y+   ENGP KWGKL   + +C  G MQSPI++    V++ S  G L R YK S A
Sbjct  34   SEFSYMRNQENGPEKWGKLKPEWKMCGKGEMQSPIDLMHKRVRIVSHLGRLTRNYKPSNA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + +++   +  I IN  +Y + Q HWH+PSE+T+NG++  +E+H+VH S   
Sbjct  94   TLRNRGHDMMVRFEEGSSSIKINNVEYQLHQLHWHSPSEHTINGRRFALELHMVHESLNG  153

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQV-DRN-GKALGALNPGKITYEGKKYYRFIGSLT  708
              A V++LYKIG+PD FL  L N +  + D N  K +G ++P  I +  +KYYR+IGSLT
Sbjct  154  SLAVVTVLYKIGRPDSFLNLLENKLSAMTDPNEEKNIGMIDPRGIKFGSRKYYRYIGSLT  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
             PPC+Q VIWTV KEVKTV++ Q+ +L+ AV D    NARP+QP N R V  N+P
Sbjct  214  IPPCTQNVIWTVVKEVKTVARNQVKILRVAVHDHSNTNARPVQPTNMRVVKFNRP  268



>emb|CDY45480.1| BnaC09g12980D [Brassica napus]
Length=271

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 154/235 (66%), Gaps = 2/235 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y+   ENGP KWGKL   + +C  G MQSPI++    V++ S  G L R YK S A
Sbjct  34   SEFSYMRNQENGPEKWGKLKPEWKMCGKGEMQSPIDLMHKRVRIVSHLGRLTRNYKPSNA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + +++   +  I IN  +Y + Q HWH+PSE+T+NG++  +E+H+VH S   
Sbjct  94   TLRNRGHDMMVRFEEGSSSIRINNVEYQLHQLHWHSPSEHTINGRRFALELHMVHESLNG  153

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQV-DRN-GKALGALNPGKITYEGKKYYRFIGSLT  708
              A V++LYKIG+PD FL  L N +  + D N  K +G ++P  I +  +KYYR+IGSLT
Sbjct  154  SLAVVTVLYKIGRPDSFLNLLENKLSAMTDPNEEKNIGMIDPRGIKFGSRKYYRYIGSLT  213

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
             PPC+Q VIWTV KEVKTV++ Q+ +L+ AV D    NARP+QP N R V  N+P
Sbjct  214  IPPCTQNVIWTVVKEVKTVARNQVKILRVAVHDHSNTNARPVQPTNMRVVKFNRP  268



>ref|XP_006845947.1| hypothetical protein AMTR_s00157p00092470 [Amborella trichopoda]
 gb|ERN07622.1| hypothetical protein AMTR_s00157p00092470 [Amborella trichopoda]
Length=253

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 159/236 (67%), Gaps = 4/236 (2%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y+  +E GP  WG+L+  +  C+ G+MQSPI++    V+V    G L R+YK ++AI
Sbjct  7    EFDYLEDSERGPKHWGELYPEWRACSNGDMQSPIDLLHERVEVLPNLGRLQRKYKPAKAI  66

Query  358  IINKGHALQIQW-TGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            + N+GH + ++W    AG + IN T+Y + QCHWH+PSE+T NG +  +E+HLVH+S   
Sbjct  67   LKNRGHDIMLKWGKSGAGTLEINQTEYVLKQCHWHSPSEHTFNGSRYHLEVHLVHQSKDG  126

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQV--DRNGKA-LGALNPGKITYEGKKYYRFIGSL  705
            + A V I YKIG+PD FL +L+ +I  +   +N +A +G ++P  I    +KYYR++GSL
Sbjct  127  KNAVVGITYKIGRPDTFLKELMGNISSIADSKNAEAQVGVVDPRHIKMGSRKYYRYMGSL  186

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTPPC+QGV W + K+V+TVS+EQ+ LL+ AV D  E NARP QP+N R V L  P
Sbjct  187  TTPPCTQGVAWNIVKKVRTVSREQLRLLRAAVHDEAEANARPTQPINKRVVDLYTP  242



>ref|XP_009132759.1| PREDICTED: alpha carbonic anhydrase 2-like [Brassica rapa]
Length=268

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 156/236 (66%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y    ENGP KWGKL   + +C  G MQSPI++ +  VK+ S  G L R YK + A
Sbjct  30   SEFSYEGNQENGPEKWGKLKPEWKMCGKGEMQSPIDLMNKRVKIVSHLGRLTRDYKPANA  89

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + +++    G I IN  +Y + Q HWH+PSE+T+NG++  +E+H+VH S   
Sbjct  90   TLRNRGHDMMVRFEEGPGSIKINNIEYQLHQLHWHSPSEHTINGRRFALELHMVHESING  149

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA---LGALNPGKITYEGKKYYRFIGSL  705
              A V++LYKIG+PD FL  L N +  +  + +A   +G ++P  I +  +KYYR+IGSL
Sbjct  150  SMAVVTVLYKIGRPDSFLSLLENKLCAITDHNEAEINIGMIDPKDIKFGSRKYYRYIGSL  209

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            T PPC+Q VIWTV K+V+TVS+ Q+ LL+ AV D  + NARP+QP N RTV L +P
Sbjct  210  TIPPCTQNVIWTVIKKVRTVSRNQVKLLRVAVHDYSDTNARPVQPTNMRTVKLYRP  265



>ref|XP_007203913.1| hypothetical protein PRUPE_ppa016859mg [Prunus persica]
 gb|EMJ05112.1| hypothetical protein PRUPE_ppa016859mg [Prunus persica]
Length=340

 Score =   237 bits (604),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/240 (45%), Positives = 159/240 (66%), Gaps = 6/240 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y+ G++ GP  WG++   +  C  G MQSPI++   + ++     EL R
Sbjct  31   AQEVEDERDFDYVEGSKKGPAYWGEIKKEWAACKHGGMQSPIDLPRKSFQILPSLVELKR  90

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK S A + N+GH ++I+W GDAG I INGTDYF  QCHWHTPSE+++NG + D+E+H+
Sbjct  91   IYKPSNATLKNRGHDIKIEWEGDAGSIKINGTDYFFKQCHWHTPSEHSINGIRYDLELHM  150

Query  514  VHRSA----KDEFAAVSILYKIGKPDKFLGQLLNSI-RQVDRNGKALGALNPGKITYEGK  678
            VH+S     ++  A ++ LY IG P+ FL ++   I  +V      LG ++P +I +   
Sbjct  151  VHQSTDPKIRNSIAVLAFLYHIGNPNLFLSKVNKDIMSEVATKEVHLGVIDPREIKWTSF  210

Query  679  KYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTV  858
             +YR++GSLT+PPC++GVIWT+ ++VK VS+EQ+ LL+EAVDD  E N RPLQPLN R +
Sbjct  211  SFYRYVGSLTSPPCAEGVIWTINEKVKHVSREQVELLQEAVDDYAEMNTRPLQPLNDREI  270



>ref|XP_006301790.1| hypothetical protein CARUB_v10022254mg [Capsella rubella]
 gb|EOA34688.1| hypothetical protein CARUB_v10022254mg [Capsella rubella]
Length=269

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 162/228 (71%), Gaps = 2/228 (1%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            FTY    + GP  W K++ ++ VCN G +QSPI++ +  V +          YK + A+I
Sbjct  39   FTYKQKTDKGPEGWSKINPDWKVCNTGKLQSPIDLTNERVSLVHD-QPWNMDYKPAPAVI  97

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
            +N+GH + I W  DAGK+ I+ TDY ++Q HWH+PSE+T+NG + D+E+H+VH SA+ + 
Sbjct  98   VNRGHEIMISWKEDAGKVTIHQTDYKLVQSHWHSPSEHTINGTRYDLELHMVHTSAQGKH  157

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTPPC  720
            A + +LYK+G+P++FL +LL++I+ V++  K LG ++P +I +   K YR++GSLT PPC
Sbjct  158  AVIGLLYKLGEPNEFLAKLLDAIKGVEKKEKNLGMVDPREIKFHS-KIYRYMGSLTAPPC  216

Query  721  SQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            ++GV+WTV  +V+TVS EQ+  LKEAVDDG+E N+RP+Q  +GR+++ 
Sbjct  217  TEGVLWTVLTKVETVSMEQLTTLKEAVDDGFETNSRPVQDPHGRSIWF  264



>gb|AFK47340.1| unknown [Medicago truncatula]
Length=270

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 156/235 (66%), Gaps = 2/235 (1%)
 Frame = +1

Query  172  GTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSE  351
            G ++ Y  G   GP  WG L   + +C  G +QSPI+I +  V+   + G+L + YK   
Sbjct  30   GNEYNYKKGDSKGPENWGNLKPEWKLCGNGKLQSPIDILNKRVQELPQLGKLEKDYKLGP  89

Query  352  AIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK  531
            A + N+ + + +QW G AGK+ +NGT Y ++QCHWHTPSE+T+NG K DME H VH+++K
Sbjct  90   AFLKNRFNDVMLQWKGYAGKLNLNGTYYKLIQCHWHTPSEHTLNGSKFDMEQHCVHQNSK  149

Query  532  DEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKI-TYEGKKYYRFIGSLT  708
            DE A + I YKIG+PD  L +LLN I+ +      +G +NP  I  + G KYYR IGSLT
Sbjct  150  DEIAVIGIWYKIGRPDPLLSKLLNHIKSIRDKEIDVGIINPADIFKFGGTKYYRHIGSLT  209

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            +PPC++ VIWTV K+VKTVS EQ+  LK AV+ G+EENARP Q L+GR V+   P
Sbjct  210  SPPCTEDVIWTVLKKVKTVSVEQLKALK-AVNHGFEENARPTQDLDGRKVWFYNP  263



>ref|XP_008385339.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=275

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 153/232 (66%), Gaps = 3/232 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y   +E GP +WG++  ++++C+ G+MQSPI++ D  V++ S  G L   Y+   A 
Sbjct  35   EFNYEEDSEKGPVRWGEIRQDWSMCSKGSMQSPIDLLDDRVELVSHLGILKSNYRPCNAT  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W  D G I++NGT Y + QCHWH  SE+T+NGK+ D+E+HLVH SA   
Sbjct  95   LKNRGHDMMLKWEADPGFILLNGTLYKLKQCHWHASSEHTINGKRFDLEVHLVHESATGN  154

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVD---RNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A   ILY+IG PD FL  +++ +  V     + + +G ++P ++     KYYR+IGSLT
Sbjct  155  IAVTGILYRIGAPDPFLSSIMDYLADVSDTTEDEEVVGMVDPRQMKTSSTKYYRYIGSLT  214

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            TPPC+Q VIWT+ +EV TVS+EQ+  L+ AV D  + NARP+QP N R V L
Sbjct  215  TPPCTQNVIWTIAREVSTVSEEQVKALRVAVHDDSDTNARPVQPRNRRIVQL  266



>ref|XP_009356885.1| PREDICTED: alpha carbonic anhydrase 7-like [Pyrus x bretschneideri]
Length=275

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 152/232 (66%), Gaps = 3/232 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y   +E GP +WG++   +++C+ G+MQSPI++ D  V++ S  G L   Y+   A 
Sbjct  35   EFNYEEDSEKGPLRWGEIRQEWSMCSKGSMQSPIDLSDDRVELVSHLGILKSNYRPCNAT  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + ++W  DAG I++NGT Y + QCHWH  SE+T+NGK+ D+E+HLVH SA   
Sbjct  95   LKNRGHDMMLKWETDAGFILLNGTLYKLKQCHWHASSEHTINGKRFDLEVHLVHESATGN  154

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVD---RNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A   +LY+IG PD FL  +++ +  V       + +G ++P ++     KYYR+IGSLT
Sbjct  155  IAVTGVLYRIGAPDPFLSSIMDYLADVSDTTEEEEVVGMVDPRQMKTSSTKYYRYIGSLT  214

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            TPPC+Q VIWT+ +EV TVS+EQ+  L+ AV D  + NARP+QP N R V L
Sbjct  215  TPPCTQNVIWTIAREVSTVSEEQVKSLRVAVHDDSDTNARPVQPRNRRIVQL  266



>ref|XP_004241280.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Solanum lycopersicum]
Length=273

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/235 (49%), Positives = 164/235 (70%), Gaps = 8/235 (3%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y   A NGP KWG++ +N   CN GN+QSPI++D+  V+V S  G L + YK S A 
Sbjct  34   EFSYDQYANNGPAKWGEISSN---CN-GNLQSPIDLDNKVVEVVSNLGILQKYYKPSNAT  89

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            ++N+GH + ++W GDAG + IN T Y +LQ HWHTPSE++++GK+ DME HLVH S+  +
Sbjct  90   LVNRGHDIMLRWDGDAGYLKINETQYQLLQIHWHTPSEHSIDGKRYDMEAHLVHMSSDGK  149

Query  538  FAAVSILYKIG-KPDKFLGQLLNSIRQV-DRNG--KALGALNPGKITYEGKKYYRFIGSL  705
             A ++ILY+IG  PD  L  L   +  V D+ G  K +G ++P  I  +   YYR+IGSL
Sbjct  150  IAVIAILYEIGLLPDDLLTILEGDLIAVADKKGAEKPMGIIDPNIIKLDVNIYYRYIGSL  209

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQ  870
            TTPPC+QGV+WT+  +V +V+  QI LL++AV +G+E NARP+QPLN R++ LN+
Sbjct  210  TTPPCTQGVVWTIDGKVNSVTARQIKLLQDAVVNGFESNARPVQPLNERSIKLNK  264



>ref|XP_010434246.1| PREDICTED: alpha carbonic anhydrase 4-like [Camelina sativa]
Length=266

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 160/229 (70%), Gaps = 3/229 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            K+TY    + GP  WGK++ ++ VCN G  QSPI++ +  V +       +  YK + A+
Sbjct  36   KYTYEQKTDKGPEGWGKINPDWKVCNTGKFQSPIDLTNERVSLVYDQAWKLD-YKPAPAV  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            I+N+GH + + W GDAGK+ I+ TDY ++QCHWHTPSE+T+NG   D+E+H+VH SA  +
Sbjct  95   IVNRGHDIMVSWKGDAGKVTIHQTDYKLVQCHWHTPSEHTINGTSYDLELHMVHTSAHGK  154

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTPP  717
             A + +LYK+G+P++F+ +LLN I+ V++  K +G ++P ++ +   K YR+IGS T  P
Sbjct  155  NAVIGVLYKLGEPNEFIAKLLNGIKGVEKKEKDIGTVDPREVRFHS-KIYRYIGSFTA-P  212

Query  718  CSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            C++GVIWTV  +V TVS EQI  LKEAVDDG+E N+RP+Q  +GR+V+ 
Sbjct  213  CTEGVIWTVLTKVNTVSMEQITALKEAVDDGFEANSRPVQDPHGRSVWF  261



>gb|KFK32339.1| hypothetical protein AALP_AA6G228800 [Arabis alpina]
Length=271

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 155/234 (66%), Gaps = 3/234 (1%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            F+Y    E GP KWGKL   + +C  G +QSPI++ +  VK+    G L + YK S A +
Sbjct  35   FSYEQNKETGPEKWGKLKPEWKMCGKGELQSPIDLTNDRVKLVYHLGRLTKDYKPSNATL  94

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
             N+GH + +++  ++G I INGT+Y +LQ HWH+PSE+T+NG++  +E+H+VH S     
Sbjct  95   KNRGHDMMLRFEEESGSIKINGTEYQLLQLHWHSPSEHTINGRRFALELHMVHESINGTM  154

Query  541  AAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLTT  711
            A ++ILYKIG+PD FL  + N +  V       K +G ++P KI    +K+YR+IGSLTT
Sbjct  155  AVLTILYKIGRPDSFLRLMENKLGAVTDQHEGEKNVGMIDPQKIEIGSRKFYRYIGSLTT  214

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PPC+Q V WT+ K+++TV++EQI LL+ AV D    NARP+QP N R V+L +P
Sbjct  215  PPCTQNVTWTIVKKIRTVTKEQIRLLRVAVHDDSNTNARPVQPTNMRVVHLFRP  268



>emb|CDY23976.1| BnaC03g17150D [Brassica napus]
Length=272

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 155/236 (66%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y    ENGP KWGKL   + +C  G MQSPI++    V++ S  G L R YK + A
Sbjct  34   SEFSYERNQENGPEKWGKLKPEWKMCGKGEMQSPIDLLHKRVRIVSHLGRLTRDYKPANA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + +++    G I IN  +Y + Q HWH+PSE+T+NG++  +E+H+VH SA  
Sbjct  94   TLRNRGHDMMVRFEEGPGSIKINNIEYQLHQLHWHSPSEHTINGRRFALELHMVHESANG  153

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA---LGALNPGKITYEGKKYYRFIGSL  705
              A V++LYKIG+PD FL  L N +  +  + +A   +G ++P  I +  +KYYR+IGSL
Sbjct  154  SLAVVTVLYKIGRPDSFLSLLENKLCAITDHNEAEVNIGMIDPKDIKFGSRKYYRYIGSL  213

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            T PPC+Q VIWTV K+V+TV++ Q+ LL+ AV D  + NARP+QP N R V L +P
Sbjct  214  TIPPCTQNVIWTVIKKVRTVARHQVKLLRVAVHDYSDTNARPVQPTNKRPVKLYKP  269



>ref|XP_003541987.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
 gb|KHN21504.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=274

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 160/233 (69%), Gaps = 3/233 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y   +ENGP  WG +H  +++CN G+MQSPI++ +  V++ S  G L   Y+ S A
Sbjct  31   SEFSYDEKSENGPSNWGDIHPEWSLCNNGSMQSPIDLLNERVQIVSHLGRLQMNYQPSNA  90

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             I N+GH ++++W   AG + IN T+Y + QCHWH+PSE+T++GK++D+E+H+VH +   
Sbjct  91   TIKNRGHDIKLEWVAGAGYLQINETEYVLKQCHWHSPSEHTIDGKRLDLELHMVHETPSG  150

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA---LGALNPGKITYEGKKYYRFIGSL  705
            + A + +LYKIG PD FL  L + ++ +    +A   +G ++P +I    K+YYR+IGSL
Sbjct  151  QSAVIGMLYKIGSPDSFLSSLTDHLKAISDTTEAERVVGVVDPRQIKIFYKQYYRYIGSL  210

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            T PPC++ V WT+ +++++VS+EQ+ LL+ AV D  + NARPLQ +N R V L
Sbjct  211  TIPPCTENVSWTIIRKIQSVSKEQVRLLRVAVHDESDTNARPLQLINNRLVKL  263



>gb|EMT11024.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Aegilops tauschii]
Length=285

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 155/236 (66%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F YI G++NGP  WGK+   +  C  G MQSPI++ D         G L   Y   EA
Sbjct  37   SEFNYIRGSKNGPENWGKIKEEWATCGTGQMQSPIDLSDHRTSRAPNLGYLNHSYLPVEA  96

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             I+N+GH + +++ GDAG + INGT Y + Q HWH+PSE+ VNG++ ++E+H+VH SA++
Sbjct  97   SIVNRGHDIMVKFNGDAGSLWINGTAYHLRQVHWHSPSEHRVNGRRYNLELHMVHLSAEN  156

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSL  705
            + A + ILYKIG+ D FL +L + +R++       + +G ++P +   +G+ YYR++GSL
Sbjct  157  KTAVIGILYKIGRRDHFLHELESYLRRIADTKEKEEMVGVVDPWEARGDGEAYYRYMGSL  216

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTP C +GVIWTV K V TVS  Q+ LL +AV DG+E NARPLQ +NGR +    P
Sbjct  217  TTPACDEGVIWTVIKRVATVSSHQLKLLTDAVHDGFEMNARPLQKVNGRDISFFCP  272



>ref|XP_010414580.1| PREDICTED: alpha carbonic anhydrase 2-like [Camelina sativa]
Length=276

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/237 (46%), Positives = 157/237 (66%), Gaps = 4/237 (2%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y    ENGP  WGKL   + +C  G MQSPI++ +  VK+ S  G+L R YK S A
Sbjct  37   SEFSYEHNKENGPKNWGKLKPEWNMCGKGEMQSPIDLTNKRVKLVSHLGKLSRNYKPSNA  96

Query  355  IIINKGHALQIQWTGD-AGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK  531
             + N+GH + +++  + AG   INGT+Y +LQ HWH+PSE+TVNGK+  +E+H+VH S  
Sbjct  97   TLKNRGHDMMLKFGEEGAGSFKINGTEYKLLQLHWHSPSEHTVNGKRFALELHMVHESKN  156

Query  532  DEFAAVSILYKIGKPDKFLG---QLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGS  702
               A V++LYKIG+P+ FL    Q L +I       + +  ++P KI  E + YYR+IGS
Sbjct  157  GSMAVVTVLYKIGRPNSFLKLLEQKLVAITDQHDAERNVVMIDPNKIKTESRNYYRYIGS  216

Query  703  LTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            LTTPPC+Q + WT+ K+++TVS+ Q+NLL+ AV D    NARP+QP N R ++L +P
Sbjct  217  LTTPPCTQNITWTILKKIRTVSKSQVNLLRVAVHDDSNSNARPVQPTNKRVIHLYRP  273



>ref|XP_002445628.1| hypothetical protein SORBIDRAFT_07g022910 [Sorghum bicolor]
 gb|EES15123.1| hypothetical protein SORBIDRAFT_07g022910 [Sorghum bicolor]
Length=281

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/246 (45%), Positives = 163/246 (66%), Gaps = 8/246 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E+E  + F+YI G E+GP  WG +   +  C  G MQSPI++    V +    G L  
Sbjct  31   AQETEHEEEFSYIPGDEHGPEHWGHIKAEWAACGTGRMQSPIDLSHERVSLVRSLGYLHH  90

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             Y+ +EA I+N+GH + +++ GDAG ++INGT Y++ Q HWH+P+E+TV+G + DME+HL
Sbjct  91   SYRPAEASIVNRGHDIMVRFEGDAGSLVINGTAYYLKQLHWHSPAEHTVDGHRHDMELHL  150

Query  514  VHRSAKDEFAAV-SILYKIGK-PDKFLGQLLNSIRQV----DRNGKALGALNPGKITYEG  675
            VH SA D+ AAV +ILY++G+  D FL  L   IR++    DR  + +G ++P +     
Sbjct  151  VHESADDKKAAVIAILYEVGRHEDAFLRHLEPFIRRIADVRDREER-VGVVDPRRARGTA  209

Query  676  KKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRT  855
              YYR++GSLT PPC++GVIWT+ K V++VS+ Q+ LL+EAV D  E+NARPLQ  N R 
Sbjct  210  SVYYRYMGSLTAPPCTEGVIWTIVKRVRSVSKYQLELLREAVHDDMEDNARPLQEANNRR  269

Query  856  VYLNQP  873
            + + +P
Sbjct  270  ISIFRP  275



>ref|XP_010696308.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=289

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 152/242 (63%), Gaps = 6/242 (2%)
 Frame = +1

Query  157  ASESEG-TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E+E  ++F YI G E GP  WG +   +  CN G  QSPIN+  S  +       + R
Sbjct  28   AQEAEDESEFNYIQGDEIGPENWGNIKPEWATCNTGRKQSPINLLASNPQRVPSSERITR  87

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK  + II N+GH ++++WT  + +I ING DY + QCHWH+PSE+T+NGK+  +E HL
Sbjct  88   FYKPGQTIIKNRGHDIKLEWTEGSSRIQINGVDYILRQCHWHSPSEHTINGKRYALEAHL  147

Query  514  VHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA-----LGALNPGKITYEGK  678
             H S  ++ A +  LY+ G PD FL  + + IR +  N  A      G ++P ++  EG 
Sbjct  148  THESVDNKVAVIGFLYQYGSPDPFLSSIEDKIRSIANNASAHQDVMAGRISPSQVRMEGF  207

Query  679  KYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTV  858
            +YY +IGSLTTP C +GVIW V  ++ TVS+EQ+ LL++AVDDG   NARPLQP+NGR V
Sbjct  208  QYYSYIGSLTTPACDEGVIWIVENKLGTVSKEQVKLLRDAVDDGSRTNARPLQPVNGRCV  267

Query  859  YL  864
             L
Sbjct  268  NL  269



>ref|XP_002445625.1| hypothetical protein SORBIDRAFT_07g022890 [Sorghum bicolor]
 gb|EES15120.1| hypothetical protein SORBIDRAFT_07g022890 [Sorghum bicolor]
Length=281

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 162/245 (66%), Gaps = 7/245 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E+E  + F+YI G E+GP  WG++   +  C  G +QSPI++    V +    G L  
Sbjct  32   AQETEHEEEFSYIPGDEHGPEHWGRIKEEWAACGTGRLQSPIDLSHERVSLVRSLGYLHH  91

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             Y+ +EA I+N+GH + +++ GDAG ++INGT Y++ Q HWH+P+E+TV+G++ DME+HL
Sbjct  92   SYRPAEASIVNRGHDIMVRFEGDAGSLVINGTAYYLKQLHWHSPAEHTVDGRRYDMELHL  151

Query  514  VHRSAKDEFAAVSILYKIGK-PDKFLGQLLNSIRQV----DRNGKALGALNPGKITYEGK  678
            VH SA  + A ++ILY++G+  D FL  L   IR++    DR  + +G ++P +      
Sbjct  152  VHESADKKAAVIAILYEVGRHEDAFLRHLEPFIRRIADVRDREER-VGVVDPRRARGTAS  210

Query  679  KYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTV  858
             YYR++GSLT PPC++GVIWT+ K V++VS+ Q+ LL+EAV D  E NARPLQ  N R +
Sbjct  211  VYYRYMGSLTAPPCTEGVIWTIVKRVRSVSKYQLELLREAVHDDMENNARPLQEANNRHI  270

Query  859  YLNQP  873
             + +P
Sbjct  271  SIFRP  275



>gb|KEH16352.1| eukaryotic-type carbonic anhydrase [Medicago truncatula]
Length=274

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/236 (47%), Positives = 155/236 (66%), Gaps = 6/236 (3%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTN-YTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSE  351
            T+F Y   +  GP  WG +  N + +C  G MQSPI++ D  V++ S  G L   Y  S 
Sbjct  34   TEFNYDEASPLGPPNWGHIKPNEWFLCKNGTMQSPIDLRDEVVQI-SNLGPLQTNYNPSN  92

Query  352  AIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK  531
            A + N+GH ++++   ++  + I+GT Y +LQ HWHTPSE+T+NG + D+E+HLVH++  
Sbjct  93   ATLKNRGHDVKVELMSNSSYLQIDGTQYELLQFHWHTPSEHTINGVRFDLELHLVHQTPL  152

Query  532  DEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNG----KALGALNPGKITYEGKKYYRFIG  699
            +E A + +LY IG PD FL  L + +  +  N     +A+G ++P +I +   KYYR++G
Sbjct  153  NETAVIGVLYTIGMPDPFLSLLEDDLEAISNNTAGEERAVGVIDPNQINFNTTKYYRYMG  212

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLN  867
            SLTTPPCS+ V WTV KEVK+VSQEQI LL+ AV D Y+ NARPLQPLN R V LN
Sbjct  213  SLTTPPCSENVTWTVIKEVKSVSQEQIELLQAAVHDDYDYNARPLQPLNNRLVQLN  268



>ref|XP_004973662.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Setaria italica]
Length=277

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 158/236 (67%), Gaps = 6/236 (3%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            F+Y+ G E+GP  WG++   +  C AG MQSPI++    V +    G L   Y+ ++A I
Sbjct  36   FSYVHGDEHGPEHWGEIKAEWAACGAGRMQSPIDLHHERVSLVRGLGYLDHSYRPAQASI  95

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
            +N+GH + +++ GDAG ++INGT Y + Q HWH+P+E+TV+G++ D+E+HLVH SA+ + 
Sbjct  96   VNRGHDIMVRFEGDAGSLVINGTAYHLKQLHWHSPTEHTVDGRRYDLELHLVHESAEKKA  155

Query  541  AAVSILYKIGK-PDKFLGQLLNSIRQV----DRNGKALGALNPGKITYEGKKYYRFIGSL  705
            A ++ILY+IG+  D  L Q+   IRQ+    DR  + +  ++P  +      YYR++GSL
Sbjct  156  AVIAILYEIGRGHDPLLHQMEPFIRQIADKRDREER-VSVVDPRAVRGRASVYYRYMGSL  214

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            T PPC++GVIWT+ K V TVS+ Q+ LL+EAV D  E+NARPLQ +N R V L +P
Sbjct  215  TVPPCTEGVIWTIVKRVHTVSKYQLELLREAVHDDMEKNARPLQEVNSRDVSLFRP  270



>ref|XP_010696309.1| PREDICTED: alpha carbonic anhydrase 7-like [Beta vulgaris subsp. 
vulgaris]
Length=285

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 144/231 (62%), Gaps = 1/231 (0%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F YI G E GP  WG +   +  CN G  QSPIN+     +    F  + R Y+  + 
Sbjct  35   SEFNYIQGDERGPENWGNIKPEWATCNTGRKQSPINLFAPFPETVPNFVRITRLYQPGQT  94

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             I N+GH ++++WT  +  I ING DY + QCHWH+PSE+ +NG++  +E H VH+S  +
Sbjct  95   TIKNRGHDIKLEWTEGSSSIQINGVDYILRQCHWHSPSEHAINGRRYALEAHFVHQSLDN  154

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA-LGALNPGKITYEGKKYYRFIGSLTT  711
            + A +  LY  G PD FL  + + IR +  N     G ++P ++  EG +YYR+ GSLTT
Sbjct  155  KVAVIGFLYHYGNPDPFLSSIEDKIRSISNNASTDAGVISPSQVRMEGSQYYRYSGSLTT  214

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            PPC +GVIWTV   + TVS EQ+ LL+ AVDDG  ENARPLQP+N R V+L
Sbjct  215  PPCDEGVIWTVENMLGTVSIEQVQLLRNAVDDGSRENARPLQPVNRRWVHL  265



>ref|XP_007027463.1| Alpha carbonic anhydrase 7 isoform 1 [Theobroma cacao]
 gb|EOY07965.1| Alpha carbonic anhydrase 7 isoform 1 [Theobroma cacao]
Length=282

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 162/244 (66%), Gaps = 8/244 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y+  +  GP +WG L   +  C  G +QSPI++    VKV +K GEL +
Sbjct  29   AQEVEDEREFDYLENSGKGPSQWGDLKKEWVACKNGGLQSPIDMSSLRVKVINKSGELKK  88

Query  334  RYKSSEAIIINKGHALQIQWTG-DAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIH  510
            RYK   AI+ N+GH + +QW   DAG I  NGT+YF+ Q HWH+PSE+T+NG++  +E+H
Sbjct  89   RYKPCHAIVKNRGHDISLQWPNYDAGSIKTNGTEYFLQQAHWHSPSEHTINGRRYALELH  148

Query  511  LVHR----SAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRN--GKALGALNPGKITYE  672
            +VH+    + K+  A V +LYK G PD FL +L+ +I  ++ +   + +G ++P  I   
Sbjct  149  MVHQCKDPNVKNNLAVVGLLYKFGAPDAFLSKLIGNITSMNDHVQERYMGLIDPSLIKMG  208

Query  673  GKKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGR  852
            GKKYYR++GSLT PPC++GVIWT+ K+++TVS++Q+  L+ AV D  E NARP+QPLN R
Sbjct  209  GKKYYRYMGSLTVPPCTEGVIWTMNKKIRTVSRDQVRALRIAVHDYAEANARPVQPLNRR  268

Query  853  TVYL  864
             + L
Sbjct  269  EIEL  272



>gb|EEE68846.1| hypothetical protein OsJ_27636 [Oryza sativa Japonica Group]
Length=272

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 156/235 (66%), Gaps = 5/235 (2%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            KF Y+ G ENGPG W +L   +  CN GNMQSPI++  S  ++    G L   Y  +EA 
Sbjct  35   KFGYVPGTENGPGNWSRLDPRWAKCNTGNMQSPIDL--SHERLMRNLGYLDYSYLPAEAS  92

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            ++N+GH +++++ G+AG+++ING  Y + Q HWHTPSE+TVNG++ DME+HLVH      
Sbjct  93   MVNRGHDIEVKFMGNAGRVVINGKAYKLKQLHWHTPSEHTVNGRRYDMELHLVHDDGNSN  152

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV-DRNGKA--LGALNPGKITYEGKKYYRFIGSLT  708
             A +  LY+IG PD FL  L   IR++ D   K+  +G ++P         YYR++GSLT
Sbjct  153  TAVIGNLYQIGNPDPFLLMLEPFIRRIADTKDKSEPIGVVDPQLAKSPDAVYYRYMGSLT  212

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC++GVIWTV K  +TV+Q Q++LL+EAV DGYE NARPLQ +N R + +  P
Sbjct  213  TPPCTEGVIWTVFKRAQTVAQYQLDLLREAVADGYENNARPLQKVNNRNISIFIP  267



>ref|XP_004300792.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Fragaria vesca subsp. vesca]
Length=283

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 156/235 (66%), Gaps = 7/235 (3%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            T+F Y+  +  GP  WG L  ++  C  G MQSPI++    V+V    GE+  +YK S A
Sbjct  37   TEFDYLKDSGKGPEHWGDLREDWAACKNGTMQSPIDLRSEIVQVRPNKGEVKLKYKPSNA  96

Query  355  IIINKGHALQIQWT-GDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVH----  519
             I N+GH + IQW  GDAG + INGTDY+++Q HWH+PSE+T+NGK+ D+E+H+VH    
Sbjct  97   TIRNRGHDISIQWKLGDAGSVEINGTDYWLIQGHWHSPSEHTINGKRFDLELHMVHLIPD  156

Query  520  RSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQV--DRNGKALGALNPGKITYEGKKYYRF  693
             + ++  A ++ LYKIGKPDKFL ++   I+ +   +  + +G ++P  +      +Y++
Sbjct  157  ANVENNIAVLAYLYKIGKPDKFLSEVSKDIKSLINVKEERHIGVVDPRNVRKGSANFYKY  216

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTV  858
             GSLT PPC++GV W V KE+ TVS+EQ+ LL+EAVDD  E NARPLQ LNGR V
Sbjct  217  KGSLTVPPCTEGVTWIVDKELTTVSREQVELLREAVDDSAETNARPLQALNGRKV  271



>ref|XP_009599194.1| PREDICTED: alpha carbonic anhydrase 4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=272

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/237 (46%), Positives = 152/237 (64%), Gaps = 7/237 (3%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            +KFTY+ G   GP  WG L   + +C  G  QSP+NI + TV VT+    L  +YK + A
Sbjct  34   SKFTYLLGTNEGPENWGNLKPEWKLCTTGKFQSPVNIRNKTVTVTTALQHLKPKYKIAPA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGK-------KVDMEIHL  513
            IIIN+GH +++QW GDAG I I+GT+Y + QCHWHTPSE+ +N K          ME H+
Sbjct  94   IIINRGHDIKLQWEGDAGYINIDGTEYKLQQCHWHTPSEHKLNNKWFVYRYICFAMEAHM  153

Query  514  VHRSAKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRF  693
            VH+S   + A V+I +KIG P+ F  +L++ I  VD  G  LG ++P ++    + +YR+
Sbjct  154  VHQSGDGKIAVVAIPFKIGSPNPFFEELMHHIETVDDKGLKLGLIHPQQLGVGDEPFYRY  213

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            IGSLT PPC++G+ W V  + +TVS EQ+   + AV DG+E NARP+Q L+ R VYL
Sbjct  214  IGSLTVPPCTEGITWNVLHKARTVSMEQLMAYRSAVHDGFEANARPVQSLHKRPVYL  270



>gb|EEC83720.1| hypothetical protein OsI_29556 [Oryza sativa Indica Group]
Length=271

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/236 (47%), Positives = 156/236 (66%), Gaps = 7/236 (3%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            KF Y+ G ENGPG W +L   +  CN GNMQSPI++  S  ++    G L   Y  +EA 
Sbjct  34   KFGYVPGTENGPGNWSRLDPRWAKCNTGNMQSPIDL--SHERLMRNLGYLDYSYLPAEAS  91

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            ++N+GH +++++ G+AG+++ING  Y + Q HWHTPSE+TVNG++ DME+HLVH      
Sbjct  92   MVNRGHDIEVKFMGNAGRVVINGKAYKLKQLHWHTPSEHTVNGRRYDMELHLVHDDGNSN  151

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV----DRNGKALGALNPGKITYEGKKYYRFIGSL  705
               +  LY+IG PD FL  L   IR++    DR+ + +G ++P         YYR++GSL
Sbjct  152  TVVIGNLYQIGNPDPFLLMLEPFIRRIADTKDRS-EPIGVVDPQLAKSPDAVYYRYMGSL  210

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTPPC++GVIWTV K  +TV+Q Q++LL+EAV DGYE NARPLQ +N R + +  P
Sbjct  211  TTPPCTEGVIWTVFKRAQTVAQYQLDLLREAVADGYENNARPLQKVNNRNISIFIP  266



>ref|XP_009358738.1| PREDICTED: alpha carbonic anhydrase 4-like [Pyrus x bretschneideri]
Length=339

 Score =   234 bits (596),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 154/232 (66%), Gaps = 3/232 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINI-DDSTVKVTSKFGELIRRYKSSEA  354
            +F Y  G+E GP  WG+L   +T C  G  QSPI++ +D   KV   F +L   +K S A
Sbjct  37   EFDYREGSEKGPQHWGELKKEWTACKDGKSQSPIDLMEDGATKVIPTFRDLTMHHKPSGA  96

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSA-K  531
             + N GH + ++W GDAG I INGT+YF+ QCHWHTPSE+T+NG + D+E+H+VHRSA K
Sbjct  97   TLKNDGHYVALEWEGDAGSIQINGTNYFLKQCHWHTPSEHTINGIRYDLELHMVHRSADK  156

Query  532  DEFAAVSILYKIGKPDKFLGQLLNSIRQV-DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
            +  A ++ LY++G P+ FL ++   I  V     K LG +NP +I +   ++YR++GSLT
Sbjct  157  NSVAVIAFLYQVGPPNPFLLKVSKDILSVIGTKEKHLGVINPSEIKWPSLRFYRYVGSLT  216

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            TPPC++GVIWTV + V  VS+ Q+ LLK+ VDD    NARPLQP N R + L
Sbjct  217  TPPCTEGVIWTVNEGVNIVSRRQLELLKQVVDDYAVMNARPLQPANDRGIKL  268



>ref|XP_004973661.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Setaria italica]
Length=285

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/235 (43%), Positives = 159/235 (68%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y    E+GP  WG++   +  C+AG MQSPI++    V +    G L   Y+ ++A 
Sbjct  45   EFSYDPRDEHGPAHWGRIKAEWANCSAGGMQSPIDLAHERVTLVRALGYLDHSYRPAQAS  104

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            I+N+GH + +++ GDAG ++INGT Y++ Q HWH P+E+TV+G++ DME+HLVH+SA+ +
Sbjct  105  IVNRGHDIMVRFKGDAGSVVINGTAYYLRQLHWHAPTEHTVDGRQYDMELHLVHQSAEGK  164

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV-DRNGK--ALGALNPGKITYEGKKYYRFIGSLT  708
             A + +LY++G  D FL  L  +I ++ DR  +   +G ++P         YYR++GSLT
Sbjct  165  AAVIGVLYEVGAHDAFLHALEPAIHRIADRRDREEPVGVVDPRGARGRASVYYRYMGSLT  224

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC++GVIWT+ K V+TVS+ Q+ LL+EAV D  E+NARPLQ +N R + + +P
Sbjct  225  TPPCTEGVIWTIVKRVRTVSKYQLELLREAVHDDMEKNARPLQEVNDRDISIFRP  279



>ref|XP_008383977.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=339

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 154/232 (66%), Gaps = 3/232 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINI-DDSTVKVTSKFGELIRRYKSSEA  354
            +F Y  G+E GP  WG+L   +T C  G  QSPI++ +D   KV   F +L   +K S A
Sbjct  37   EFDYREGSEKGPQHWGELKKEWTACKDGKSQSPIDLMEDGATKVIPTFRDLTMHHKPSGA  96

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSA-K  531
             + N+GH + ++W GDAG I INGT+YF+ QCHWHTPSE+T+NG + D+E+H+VHRSA K
Sbjct  97   TLKNEGHYIALEWEGDAGSIQINGTNYFLKQCHWHTPSEHTINGIRYDLELHMVHRSADK  156

Query  532  DEFAAVSILYKIGKPDKFLGQLLNSIRQV-DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
            +  A ++ LY++G P+ FL ++   I  V     K LG +NP +I +   ++YR++GSLT
Sbjct  157  NSVAVIAFLYQVGPPNPFLLKVSKDILSVIGTKEKHLGVINPSEIKWPSLRFYRYVGSLT  216

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            TPPC++ VIWTV + V  VS+ Q+ LLK+ VDD    NARPLQP N R + L
Sbjct  217  TPPCTEAVIWTVNEGVSIVSRRQLELLKQVVDDYAVMNARPLQPXNDRGIKL  268



>ref|XP_004168623.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
Length=280

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/237 (46%), Positives = 156/237 (66%), Gaps = 5/237 (2%)
 Frame = +1

Query  169  EGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSS  348
            E  +F YI G+  GP KWG +   ++ CN G MQSPI++  +T+ V +  G L R Y   
Sbjct  32   EVCEFDYIGGSNKGPTKWGAIKEEWSKCNNGKMQSPIDLSTNTINVVNSLGPLTREYNPF  91

Query  349  EAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS-  525
             A + N+GH + + W G+ G I IN T Y + Q HWH+PSE+T+NG++ D+E+H+VH S 
Sbjct  92   SATLRNRGHDISVAWEGNVGSIEINWTKYLLKQIHWHSPSEHTLNGRRYDLELHVVHESL  151

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA--LGALNPGKI-TYEGKKYYRF  693
             +  ++A VS LY+IG PD FL ++   I+++    K   LG++NP +I    G  YYR+
Sbjct  152  NSNAKYAVVSHLYEIGPPDAFLSKVSGGIKELSTGKKEIKLGSINPDEIRNASGINYYRY  211

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            IGSLT PPC++GV+W++ K++ TVSQEQ+ LL+  V+   E NARP+QPLNGR V L
Sbjct  212  IGSLTAPPCTEGVVWSINKQIGTVSQEQVMLLRSTVEHCAETNARPVQPLNGRHVQL  268



>ref|XP_009103655.1| PREDICTED: alpha carbonic anhydrase 2 [Brassica rapa]
 emb|CDX71369.1| BnaC04g16040D [Brassica napus]
Length=272

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 153/236 (65%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y    ENGP KWGKL   + +C  G MQSPI++ +  V++ S  G L R YK   A
Sbjct  34   SEFSYEQNVENGPEKWGKLKPEWKMCGKGEMQSPIDLMNERVRIVSHLGRLTRNYKPCNA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + +++    G I ING +Y +LQ HWH+PSE+T+NG++  +E+H+VH S   
Sbjct  94   SLKNRGHDMMLRFEERPGSIKINGIEYQLLQLHWHSPSEHTINGRRFALELHMVHESING  153

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA---LGALNPGKITYEGKKYYRFIGSL  705
              A V++LYKIG+ D FL  L N +  +    +A   +G ++P +I    +KYYR++GSL
Sbjct  154  SMAVVTVLYKIGRSDSFLTLLENKLSAMTDQNEAEFNIGMIDPKEIKIGSRKYYRYVGSL  213

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTPPC+Q + WTV K+V+TV++ Q+ LL+ AV D    NARP+QP N R V L +P
Sbjct  214  TTPPCTQNITWTVVKKVRTVARNQVRLLRVAVHDDSNTNARPVQPTNKRVVKLYRP  269



>ref|XP_006365755.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum tuberosum]
Length=270

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/238 (47%), Positives = 161/238 (68%), Gaps = 8/238 (3%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+YI  AENGP  W  +H N+  C  G +QSPI+  ++ V++ S  G L + YK S A
Sbjct  32   SEFSYIENAENGPANWSNIHPNWIKCKTGKLQSPIDFPNNKVEIVSNLGILQKFYKPSNA  91

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             ++N+GH + ++W  D G + INGT Y + Q HWHTPSE+T++GK+ DME HLVH +   
Sbjct  92   TLLNRGHDIMLRW-DDGGFLKINGTQYRLKQVHWHTPSEHTIDGKRFDMEGHLVHETNDG  150

Query  535  E-FAAVSILYKIGK-PDKFLGQL---LNSIRQVDRNGKALGALNPGKITYEGKKYYRFIG  699
            +  A + ILY+IG  PD FL  +   L ++R  D+  KA+G   P  I  + K+YYR++G
Sbjct  151  KNIAVIGILYEIGLFPDLFLTMIEKDLEALRLADQ--KAIGINYPNLIKIDEKRYYRYMG  208

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            SLT PPC++ VIWT+  +VKTV+++QI LL++ V DG+E NARP+QPLNGR +  N+P
Sbjct  209  SLTVPPCTENVIWTIDGKVKTVTRKQIQLLRDVVHDGFEYNARPIQPLNGRPIKFNKP  266



>dbj|BAK03530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 153/236 (65%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+YI GA+NGP  WG     +  C  G MQSPI++ D     +   G L   Y  ++A
Sbjct  37   SEFSYIRGAKNGPENWGTFKEEWATCGTGQMQSPIDLSDRRASPSPDLGYLNHSYVPADA  96

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             I+N+GH + + + GDAG + I+GT Y + Q HWH PSE+ VNG++  +E+H+VH SA++
Sbjct  97   SIVNRGHDIAVMFHGDAGSLSIDGTAYHLRQVHWHAPSEHRVNGRRYSLELHMVHLSAQN  156

Query  535  EFAAVSILYKIGKPDKFLGQL---LNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSL  705
            + A + +LYKIG+ D FL +L   L  +  +    + +G ++PG+   +G+ YYR++GSL
Sbjct  157  KTAVIGLLYKIGRRDHFLHKLEPYLMRMADMKEKEEKVGLVDPGEARGDGEAYYRYMGSL  216

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTPPC +GVIWTV K V TVS +Q+ LL +AV DG+E NARPLQ +N R +    P
Sbjct  217  TTPPCDEGVIWTVIKRVATVSTDQLKLLTDAVHDGFEMNARPLQKVNDRDIRFFCP  272



>ref|NP_001149032.1| carbonic anhydrase precursor [Zea mays]
 gb|ACG33896.1| carbonic anhydrase precursor [Zea mays]
Length=291

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 158/235 (67%), Gaps = 4/235 (2%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            F YI G  NGP  WG +   +  C+AG MQSPI++    V +    G L   Y+ ++A I
Sbjct  40   FNYIPGDANGPENWGSIKPEWANCSAGRMQSPIDLARERVTLVPALGFLNHSYRPAQASI  99

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
            +N+GH + +++ GDAG+++INGT Y + Q HWH+PSE+TV+G++  ME+H+VH SA  + 
Sbjct  100  VNRGHDIMVRFNGDAGRLVINGTAYDLRQMHWHSPSEHTVDGRRYAMELHMVHESAAGKA  159

Query  541  AAVSILYKIG-KPDKFLGQLLNSIRQV-DRNGK--ALGALNPGKITYEGKKYYRFIGSLT  708
            A + ILY+IG  PD FL +L   IR++ DR  +   +G ++P         YYR++GSLT
Sbjct  160  AVIGILYEIGLVPDPFLLRLEPFIRRIADRKDREEPIGVVDPRLARGTASAYYRYMGSLT  219

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPCS+GV+WT+ K+V++VS+ Q+ LL+EAV DG E NARP+Q LN R + L +P
Sbjct  220  TPPCSEGVVWTIIKKVRSVSKRQLELLREAVHDGNENNARPVQDLNDRDISLFRP  274



>gb|AAD29832.1| putative carbonic anhydrase [Arabidopsis thaliana]
Length=248

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 159/236 (67%), Gaps = 4/236 (2%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y    ENGP KWGKL   + +C  G MQSPI++ +  V++ +   +L R YK   A 
Sbjct  10   EFSYEWNQENGPAKWGKLRPEWKMCGKGEMQSPIDLMNKRVRLVTHLKKLTRHYKPCNAT  69

Query  358  IINKGHALQIQWTGD-AGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
            + N+GH + +++  + +G I +NGT+Y +LQ HWH+PSE+T+NG++  +E+H+VH +   
Sbjct  70   LKNRGHDMMLKFGEEGSGSITVNGTEYKLLQLHWHSPSEHTMNGRRFALELHMVHENING  129

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQV-DRNG--KALGALNPGKITYEGKKYYRFIGSL  705
              A V++LYKIG+PD FLG L N +  + D+N   K +  ++P  I    +K+YR+IGSL
Sbjct  130  SLAVVTVLYKIGRPDSFLGLLENKLSAITDQNEAEKYVDVIDPRDIKIGSRKFYRYIGSL  189

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTPPC+Q VIWTV K+V+TV++ Q+ LL+ AV D  + NARP+QP N R V L +P
Sbjct  190  TTPPCTQNVIWTVVKKVRTVTKNQVKLLRVAVHDNSDTNARPVQPTNKRVVKLYKP  245



>dbj|BAJ99342.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/237 (46%), Positives = 155/237 (65%), Gaps = 5/237 (2%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y+ GAENGPG WG +   +  C  G MQSPI++ D  V      G L   Y  ++A
Sbjct  37   SEFSYVCGAENGPGNWGNIKEEWATCGTGVMQSPIDLSDHLVSPAPHIGYLNHSYLPAQA  96

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             I+N+GH + + + G+AG + INGT Y + Q HWHTPSE+ VNG + +ME+H+VH SA++
Sbjct  97   SIVNRGHDITVMFHGNAGSMWINGTAYHLRQLHWHTPSEHGVNGHRYNMELHMVHLSAEN  156

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQV----DRNGKALGALNPGKITYEGKKYYRFIGS  702
            + A +   YKIG+ D FL QL   +R++    D+  K +G ++P     +G+ YYR++GS
Sbjct  157  KAAVIGRFYKIGRRDHFLHQLEPYLRRMASTNDKEDK-VGVVDPWVARGDGEAYYRYMGS  215

Query  703  LTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            LTTP C +GVIWTV K V TVS +Q+ LLK+AV DG++ NARPLQ +N R +    P
Sbjct  216  LTTPKCDEGVIWTVVKRVATVSSDQVKLLKDAVHDGFDMNARPLQKVNDRDISFFSP  272



>ref|XP_010510675.1| PREDICTED: alpha carbonic anhydrase 7-like isoform X2 [Camelina 
sativa]
Length=248

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/238 (44%), Positives = 158/238 (66%), Gaps = 6/238 (3%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y    ENGP KWGKL   + +C  G +QSPI++ +  V++ + F +L + YK   A 
Sbjct  8    EFSYERNKENGPEKWGKLKPEWKLCGKGELQSPIDLMNKRVRLVTDFEKLTKDYKPCNAT  67

Query  358  IINKGHALQIQWTGD---AGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSA  528
            +IN+GH + +++  +    G   INGT+Y +LQ HWH+PSE+T+NG++  +E+HLVH + 
Sbjct  68   LINRGHDMMLRFEEEEEGPGSFKINGTEYKLLQLHWHSPSEHTINGRRFALELHLVHENI  127

Query  529  KDEFAAVSILYKIGKPDKFLGQL---LNSIRQVDRNGKALGALNPGKITYEGKKYYRFIG  699
                A V++LYKIG+PD FL  L   L+ I   +   K +  ++P  I    +K+YR++G
Sbjct  128  NGSLAVVTVLYKIGRPDSFLESLEKKLSVITDQNEAEKNVEMIDPRNIQIGSRKFYRYLG  187

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            SLTTPPC+Q VIWTV K+V+TV++ Q+ LL+ AV D Y+ NARP+QP+N R V L +P
Sbjct  188  SLTTPPCTQNVIWTVVKKVRTVTKSQVKLLRVAVHDNYDTNARPVQPINKRVVKLFRP  245



>ref|XP_006660200.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Oryza brachyantha]
Length=303

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 162/237 (68%), Gaps = 5/237 (2%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            KF+Y++GA+NGP  W KL+ ++  CN G+ QSPI++     K     G L   Y+ S A 
Sbjct  67   KFSYVAGAKNGPENWSKLNASWAKCNTGDRQSPIDLATGRAKPMRSLGYLDYSYRPSPAN  126

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            ++N+GH +++++TG+AG+++I G  Y + Q HWHTPSE+T +G++ DME+HLVH    D 
Sbjct  127  VVNRGHDIEVKFTGNAGRLVIGGRAYQLQQLHWHTPSEHTADGRRYDMELHLVHDDGNDN  186

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV-DRNGKA--LGALNPGKITYEGKKYYRFIGSLT  708
             A + I Y IG  D  L QL  +IR++ DR  ++  + +++P     +G  YYR++GSLT
Sbjct  187  IAVIGIFYVIGNADPLLRQLEPAIRKIADRKDQSEPVESVDPRLAKSQGAVYYRYMGSLT  246

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGR--TVYLNQP  873
            TPPC++GVIWTV +  +TV++ Q++LL+EAV DGYE NARP+Q LN R  ++++ +P
Sbjct  247  TPPCTEGVIWTVFQRPRTVAKYQLDLLREAVADGYENNARPIQKLNNREISIFIPEP  303



>ref|XP_010470128.1| PREDICTED: alpha carbonic anhydrase 2-like isoform X2 [Camelina 
sativa]
Length=276

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 156/237 (66%), Gaps = 4/237 (2%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y    ENGP  WGKL   + +C  G MQSPI++ +  VK+ S  G+L R YK S A
Sbjct  37   SEFSYEHNKENGPKNWGKLKPEWNMCGKGEMQSPIDLMNKRVKLVSHLGKLSRNYKPSNA  96

Query  355  IIINKGHALQIQWTGD-AGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK  531
             + N+GH + +++  + AG   INGT+Y +LQ HWH+PSE+T+NG +  +E+H+VH S  
Sbjct  97   TLKNRGHDMMLKFGEEGAGSFKINGTEYRLLQLHWHSPSEHTINGXRFALELHMVHESKN  156

Query  532  DEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA---LGALNPGKITYEGKKYYRFIGS  702
               A V++LYKIG+P+ FL  L + +  +     A   +  ++P KI  E + YYR+IGS
Sbjct  157  GSMAVVTVLYKIGRPNSFLKLLEHKLVAITDQHDAERNVVMIDPSKIKTESRNYYRYIGS  216

Query  703  LTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            LTTPPC+Q + WT+ K+++TVS+ Q+NLL+ AV D    NARP+QP N R ++L +P
Sbjct  217  LTTPPCTQNITWTILKKIRTVSKSQVNLLRVAVHDDSNSNARPVQPANKRVIHLYRP  273



>gb|KGN58999.1| hypothetical protein Csa_3G742870 [Cucumis sativus]
Length=280

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/237 (46%), Positives = 156/237 (66%), Gaps = 5/237 (2%)
 Frame = +1

Query  169  EGTKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSS  348
            E  +F YI G+  GP KWG +   ++ CN G MQSPI++  +T+ V +  G L R Y   
Sbjct  32   EVCEFDYIGGSNKGPTKWGAIKEEWSKCNNGKMQSPIDLSTNTINVVNSLGPLNREYNPF  91

Query  349  EAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRS-  525
             A + N+GH + + W G+ G I IN T Y + Q HWH+PSE+T+NG++ D+E+H+VH S 
Sbjct  92   SATLRNRGHDISVAWEGNVGSIEINWTKYLLKQIHWHSPSEHTLNGRRYDLELHVVHESL  151

Query  526  -AKDEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA--LGALNPGKI-TYEGKKYYRF  693
             +  ++A VS LY+IG PD FL ++   I+++    K   LG++NP +I    G  YYR+
Sbjct  152  NSNAKYAVVSHLYEIGPPDAFLSKVSGGIKELSTGKKEIKLGSINPDEIRNASGINYYRY  211

Query  694  IGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            IGSLT PPC++GV+W++ K++ TVSQEQ+ LL+  V+   E NARP+QPLNGR V L
Sbjct  212  IGSLTAPPCTEGVVWSINKQIGTVSQEQVMLLRSTVEHCAETNARPVQPLNGRHVQL  268



>tpg|DAA48425.1| TPA: carbonic anhydrase [Zea mays]
Length=291

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 157/235 (67%), Gaps = 4/235 (2%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAII  360
            F YI G  NGP  WG +   +  C+AG MQSPI++    V +    G L   Y+ ++A I
Sbjct  40   FNYIPGDANGPENWGSIKPEWANCSAGRMQSPIDLARERVSLVPALGFLNHSYRPAQASI  99

Query  361  INKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEF  540
            +N+GH + +++ GDAG ++INGT Y + Q HWH+PSE+TV+G++  ME+H+VH SA  + 
Sbjct  100  VNRGHDIMVRFNGDAGSLVINGTAYDLRQMHWHSPSEHTVDGRRYAMELHMVHESAAGKA  159

Query  541  AAVSILYKIGK-PDKFLGQLLNSIRQV-DRNGK--ALGALNPGKITYEGKKYYRFIGSLT  708
            A + ILY+IG  PD FL +L   IR++ DR  +   +G ++P         YYR++GSLT
Sbjct  160  AVIGILYEIGLVPDPFLLRLEPFIRRIADRKDREEPIGVVDPRLARGTASAYYRYMGSLT  219

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPCS+GV+WT+ K+V++VS+ Q+ LL+EAV DG E NARP+Q LN R + L +P
Sbjct  220  TPPCSEGVVWTIIKKVRSVSKRQLELLREAVHDGNENNARPVQDLNDRDISLFRP  274



>ref|XP_009377055.1| PREDICTED: alpha carbonic anhydrase 4-like [Pyrus x bretschneideri]
Length=337

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 156/235 (66%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPIN-IDDSTVKVTSKFGELIRRYKSSEA  354
            +F Y  G E GP  WG+L   +  C  G  Q+PI+ +++   KV     +L +R+K S+A
Sbjct  37   EFDYTEGNEKGPQHWGELKKEWVACKDGKSQAPIDLVENQAAKVIPTLRDLTQRHKPSDA  96

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSA-K  531
             + N+GH + ++W GDAG I INGT+YF+ +CHWHTPSE+T+NG + D+E+H+VHR A K
Sbjct  97   TLKNEGHYIALEWEGDAGSIQINGTEYFLNECHWHTPSEHTINGVRYDLELHMVHRGADK  156

Query  532  DEFAAVSILYKIGKPDKFLGQLLNSI-RQVDRNGKALGALNPGKITYEGKKYYRFIGSLT  708
            +  A ++ LY++G P+ FL ++   I   + R  K LG +NP  I +   +++R+IGSLT
Sbjct  157  NSVAVIAFLYQVGPPNPFLLKVNKDILSMIGRKEKQLGVINPRDIIWRSLRFHRYIGSLT  216

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC++GVIWTV + V  VS+EQ+ LLK+ VDD    NARPLQ  NGR + L  P
Sbjct  217  TPPCTEGVIWTVNERVNIVSREQLELLKQVVDDYAVMNARPLQLANGRGIKLYVP  271



>ref|XP_008241384.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=288

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/249 (44%), Positives = 164/249 (66%), Gaps = 10/249 (4%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y+ G++ GP  WG++   +  C  G MQSPI++   + ++     EL R
Sbjct  34   AQEVEDERDFDYVEGSKKGPAYWGEIKKEWAACKHGGMQSPIDLPGKSFQILPSLVELKR  93

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK S A + N+GH ++++W G+AG I ING  YF+ Q HWH+PSE+++NGK+ DME+H+
Sbjct  94   TYKPSNATLKNRGHDIKLEWAGNAGSIEINGIQYFLKQSHWHSPSEHSINGKRYDMELHM  153

Query  514  VHRSAKDEF----AAVSILYKIGKPDKFLGQLLNSIRQV--DRNGKALGALNPGKIT-YE  672
            V++S   +     A V +LY+IG+PD FL +L   I  +   +  +++G ++P +I   +
Sbjct  154  VYQSPDPKVESNTAVVGVLYQIGRPDAFLSKLTRDIASMTDKKIERSVGVIDPAEIVELD  213

Query  673  GKKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGR  852
            GK YYR+IGSLT PPC++GVIW ++K+  TVS+EQI+LL+ +V D  E NARPLQPLN R
Sbjct  214  GKNYYRYIGSLTIPPCTEGVIWIMSKQFGTVSREQIDLLRVSVYDYAETNARPLQPLNRR  273

Query  853  TV--YLNQP  873
             +  Y  +P
Sbjct  274  IIRLYFQKP  282



>ref|XP_008387558.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=299

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 157/234 (67%), Gaps = 3/234 (1%)
 Frame = +1

Query  181  FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDS-TVKVTSKFGELIRRYKSSEAI  357
            F Y  G+E GP  WG+L   +  C  G  QSPI +D+S   KV     +L   YK S+A 
Sbjct  41   FDYREGSEKGPEHWGELKQEWAACKDGRSQSPIGLDESRATKVIQSSRDLTVSYKPSDAT  100

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSA-KD  534
            + N+GH + ++W GDAG I I+ +DYF+ +CHWHTPSE+TVNG + D+E+H+VH+SA ++
Sbjct  101  LKNEGHYIALEWEGDAGSIQIDDSDYFLKRCHWHTPSEHTVNGARYDLELHMVHQSADQN  160

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNG-KALGALNPGKITYEGKKYYRFIGSLTT  711
              A V+ LY++G+P+ FL ++   I  V     K LG ++P +I ++  ++YR++GSLTT
Sbjct  161  NIAVVAFLYEVGQPNAFLSKINQDISFVTSTKEKKLGVIDPREIKWDSSRFYRYMGSLTT  220

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            PPC++GVIWTV ++V  VS+EQ++LLKEAV D    NARPLQ   GR + L  P
Sbjct  221  PPCTEGVIWTVNEKVDIVSREQLDLLKEAVYDYAAANARPLQRDEGRDIKLYGP  274



>emb|CDX84811.1| BnaA03g14190D [Brassica napus]
Length=242

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/236 (45%), Positives = 154/236 (65%), Gaps = 6/236 (3%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y    ENGP KWGKL   + +C  G MQSPI++ +  VK+ S  G L R YK + A
Sbjct  7    SEFSYEGNQENGPEKWGKLKPEWKMCGKGEMQSPIDLMNKRVKIVSHLGRLTRDYKPANA  66

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + +++    G I IN  +Y + Q HWH+PSE+T+NG++  +E+H+VH S   
Sbjct  67   TLRNRGHDMMVRFEEGPGSIKINNIEYQLHQLHWHSPSEHTINGRRFALELHMVHESING  126

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA---LGALNPGKITYEGKKYYRFIGSL  705
              A V++LYKIG+PD FL  L N +  +  + +A   +G ++P  I +  +KYYR+IGSL
Sbjct  127  SMAVVTVLYKIGRPDSFLSLLENKLCAITDHNEAEINIGMIDPKDIKFGSRKYYRYIGSL  186

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            T PPC+Q VIWTV K+V+TVS+ Q+ LL+ A  D    NARP+QP N RTV L +P
Sbjct  187  TIPPCTQNVIWTVIKKVRTVSRNQVKLLRVAYSD---TNARPVQPTNMRTVKLYRP  239



>ref|XP_010510674.1| PREDICTED: alpha carbonic anhydrase 2-like isoform X1 [Camelina 
sativa]
Length=278

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/238 (44%), Positives = 158/238 (66%), Gaps = 6/238 (3%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y    ENGP KWGKL   + +C  G +QSPI++ +  V++ + F +L + YK   A 
Sbjct  38   EFSYERNKENGPEKWGKLKPEWKLCGKGELQSPIDLMNKRVRLVTDFEKLTKDYKPCNAT  97

Query  358  IINKGHALQIQWTGD---AGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSA  528
            +IN+GH + +++  +    G   INGT+Y +LQ HWH+PSE+T+NG++  +E+HLVH + 
Sbjct  98   LINRGHDMMLRFEEEEEGPGSFKINGTEYKLLQLHWHSPSEHTINGRRFALELHLVHENI  157

Query  529  KDEFAAVSILYKIGKPDKFLGQL---LNSIRQVDRNGKALGALNPGKITYEGKKYYRFIG  699
                A V++LYKIG+PD FL  L   L+ I   +   K +  ++P  I    +K+YR++G
Sbjct  158  NGSLAVVTVLYKIGRPDSFLESLEKKLSVITDQNEAEKNVEMIDPRNIQIGSRKFYRYLG  217

Query  700  SLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            SLTTPPC+Q VIWTV K+V+TV++ Q+ LL+ AV D Y+ NARP+QP+N R V L +P
Sbjct  218  SLTTPPCTQNVIWTVVKKVRTVTKSQVKLLRVAVHDNYDTNARPVQPINKRVVKLFRP  275



>ref|XP_004160914.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis sativus]
 gb|KGN64829.1| hypothetical protein Csa_1G120450 [Cucumis sativus]
Length=275

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 147/231 (64%), Gaps = 2/231 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y +    GP  WG L   +  CN G MQSPI++ +  V++ S F +L   Y SS A 
Sbjct  35   EFDYNANGTRGPAHWGVLRPEWHTCNTGQMQSPIDLLNQRVRIVSHFTDLKINYSSSNAT  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + +QW+G AG + +N T YF+ Q HWH+PSE+T+NG++  +E HLVH+S   +
Sbjct  95   LKNRGHDIMLQWSGRAGYMEVNKTQYFLRQIHWHSPSEHTINGRRFALEAHLVHQSQTGK  154

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVD--RNGKALGALNPGKITYEGKKYYRFIGSLTT  711
             A + ILY IG+PD FL  +   + ++   +  + L  +NP  +      YYR+IGSLT 
Sbjct  155  IAVIGILYNIGQPDYFLSTMRPHLIEISGTQRDRLLNVVNPSLLRMRSSLYYRYIGSLTV  214

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            PPCSQ V+WT+ ++V+TV+ EQ+NLL+ AV D    NARPLQPLN R V L
Sbjct  215  PPCSQNVLWTLVRKVRTVAPEQVNLLRVAVHDDSNTNARPLQPLNNRNVQL  265



>ref|XP_008227264.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Prunus mume]
Length=282

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/243 (43%), Positives = 161/243 (66%), Gaps = 7/243 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y+  +  GP +WG++   +  C  G++QSPI++    VK+    G L  
Sbjct  29   AQEVEDEREFDYLHESGKGPKQWGEIKEEWAACKNGSLQSPIDLSSHRVKLIPHLGNLKT  88

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK   A + N+GH + +QW  +AG I INGT+YF+ QCHWH+PSE+++N +  DME+H+
Sbjct  89   SYKPDNATLKNRGHDISVQWETNAGSIEINGTEYFLKQCHWHSPSEHSINNRSYDMELHM  148

Query  514  VHRS----AKDEFAAVSILYKIGKPDKFLGQLLNSIR-QVDRNGK-ALGALNPGKITYEG  675
            +H S      ++ A +++LYKIG+ + FL  L   ++  +D N + ++G  +P KI   G
Sbjct  149  IHISPDLNVTNKIAVIAVLYKIGRANSFLSTLTRHVKSMIDENHEISIGMTDPRKIKIGG  208

Query  676  KKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRT  855
            K YYR++GSLT PPC++GVIWT+TK+++TVS++Q+ L +EAV D  E NARP+QPLN R 
Sbjct  209  KNYYRYMGSLTVPPCTEGVIWTITKKIRTVSRDQVKLFREAVHDYAEVNARPVQPLNLRE  268

Query  856  VYL  864
            +++
Sbjct  269  IHV  271



>gb|ABK22387.1| unknown [Picea sitchensis]
Length=271

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 154/232 (66%), Gaps = 4/232 (2%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y  G + GP  WG+L   +  C  G  QSPI++      ++   G L R Y  + A 
Sbjct  31   EFEYKEGPK-GPEHWGELKEEWKACGRGTQQSPIDVVKRNAIISPNLGTLHRIYHPANAT  89

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            ++N+GH + + W+  AG + I G  + + QCHWHTP+E+T++GK+  +EIHLVH++   E
Sbjct  90   LVNRGHDIMVNWSEGAGSVEIKGKRFTLKQCHWHTPAEHTIDGKQHPLEIHLVHQAVDGE  149

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV---DRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A + I+++ G+PD FL +L ++I  +   +   K LG ++P  I ++ +KYYR++GSLT
Sbjct  150  IAVIGIIFEFGRPDTFLAELRDAIMAIAHMEPPVKPLGMVDPYDIKFDSRKYYRYMGSLT  209

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            TPPC++GVIW V  EV+TVS++Q+  L+EAV DGYE+NARP+QPLNGR V L
Sbjct  210  TPPCTEGVIWNVIDEVRTVSEDQVRALQEAVHDGYEKNARPIQPLNGRIVGL  261



>ref|XP_007213463.1| hypothetical protein PRUPE_ppa024299mg [Prunus persica]
 gb|EMJ14662.1| hypothetical protein PRUPE_ppa024299mg [Prunus persica]
Length=282

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 161/243 (66%), Gaps = 7/243 (3%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y+  +  GP +WG++   +  C  G++QSPI++    VK+    G L  
Sbjct  29   AQEVEDEREFDYLHESGKGPKQWGEIKEEWAACKNGSLQSPIDLSSHRVKLIPHLGNLKT  88

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHL  513
             YK   A + N+GH + IQW  +AG I INGT+YF+ QCHWH+PSE+++N +  DME+H+
Sbjct  89   GYKPDNATLKNRGHDISIQWETNAGSIEINGTEYFLKQCHWHSPSEHSINNRSYDMELHM  148

Query  514  VHRS----AKDEFAAVSILYKIGKPDKFLGQLLNSIR-QVDRNGK-ALGALNPGKITYEG  675
            +H S      ++ A +++LYKIG+ + FL  L   ++  +D N + ++G  +P KI   G
Sbjct  149  IHISPDLNVTNKIAVIAVLYKIGRANSFLSTLTRHVKSMIDENHEISIGMTDPRKIRIGG  208

Query  676  KKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRT  855
            K YYR++GSLT PPC++GVIWT+TK+++TVS++Q+ L +EAV D  E NARP+QPLN R 
Sbjct  209  KNYYRYMGSLTVPPCTEGVIWTITKKIRTVSRDQVKLFREAVHDYAEVNARPVQPLNLRE  268

Query  856  VYL  864
            +++
Sbjct  269  IHV  271



>ref|XP_008462808.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=275

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 145/231 (63%), Gaps = 2/231 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y +    GP  WG L   +  CN G MQSPI++ +  V++ S F +    Y+SS A 
Sbjct  35   EFDYNTNGTRGPAHWGDLRPEWHNCNTGRMQSPIDLLNQRVRIVSHFTDFQIDYRSSNAT  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + +QW+G AG + +N + YF+ Q HWH+PSE+T+NGK+  +E HLVH+S    
Sbjct  95   LKNRGHDMMLQWSGAAGHMEVNRSRYFLRQIHWHSPSEHTLNGKRFALEAHLVHQSQTGN  154

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVD--RNGKALGALNPGKITYEGKKYYRFIGSLTT  711
             A + ILY IG+PD FL  +     ++   +  K L  +NP  +      YYR+IGSLT 
Sbjct  155  IAVIGILYNIGQPDYFLSTMRQHFVEISATQRDKLLNMVNPSLLKMRSSLYYRYIGSLTV  214

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            PPCSQ V+WT+ ++V+TV+ EQ+NLL+ AV D    NARPLQPLN R V L
Sbjct  215  PPCSQNVLWTIVRKVRTVAPEQVNLLRVAVHDDSNTNARPLQPLNNRNVQL  265



>gb|EMT14740.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Aegilops tauschii]
Length=285

 Score =   229 bits (584),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 153/236 (65%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y+ GA+NGP  WGK+   +  C  G MQSPI++ D         G LI  Y  ++A
Sbjct  37   SEFSYVRGAKNGPENWGKIKEEWATCGTGRMQSPIHLSDRRASRAPHLGYLITAYAPAKA  96

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             I+N+GH + + + GDAG + IN T Y + Q HWH+PSE+ +NG++  +E+H+VH SA++
Sbjct  97   SIVNRGHDIAVMFHGDAGSLWINDTLYHLSQVHWHSPSEHRLNGRRYSLELHMVHLSAEN  156

Query  535  EFAAVSILYKIGKPDKFLGQL---LNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSL  705
            + A + +LY IG PD FL +L   L  +  +    + +G ++P     +G+ YYR++GSL
Sbjct  157  KAAVIGLLYDIGSPDDFLHKLEPYLRRMADMKEKEEKVGVVDPWVARGDGEAYYRYMGSL  216

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTP C +GVIWTV K V TVS +Q+ LL +AV DG+E NARPLQ +NGR + L  P
Sbjct  217  TTPACDEGVIWTVIKRVATVSSDQLKLLTDAVHDGFEMNARPLQKVNGRDIGLFCP  272



>ref|XP_010262876.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=294

 Score =   229 bits (585),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 149/214 (70%), Gaps = 4/214 (2%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y+ G+  GP +WG++H  + +C  G MQSPI++ +  V++ S  G L R Y+ S A 
Sbjct  58   EFDYVEGSGKGPEQWGEIHPEWALCKNGEMQSPIDLLNKRVQIVSHLGRLKRNYRPSNAT  117

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD-  534
            I N+GH + ++W   AG I INGT Y + QCHWH+PSE+T+NGK+ D+E+H+VH+S  D 
Sbjct  118  IKNRGHDIMLKWVDGAGWIEINGTQYVLQQCHWHSPSEHTINGKRFDLEVHMVHQSISDN  177

Query  535  EFAAVSILYKIGKPDKFLGQLL---NSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSL  705
            + + V I+YKIG+PD FL +++   NSI +       +G ++P  I    +KYYR++GSL
Sbjct  178  KTSVVGIMYKIGRPDTFLSKIMGYINSIAETKEKETVVGVVDPKNIKLGSRKYYRYMGSL  237

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDD  807
            T PPC+Q V+WT+ ++V+TVS+EQ+ LL+EAVDD
Sbjct  238  TVPPCTQDVVWTIVRKVRTVSREQVRLLREAVDD  271



>dbj|BAD09858.1| putative dioscorin class A precursor [Oryza sativa Japonica Group]
Length=275

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 112/239 (47%), Positives = 157/239 (66%), Gaps = 9/239 (4%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            KF Y+ G ENGPG W +L   +  CN GNMQSPI++  S  ++    G L   Y  +EA 
Sbjct  34   KFGYVPGTENGPGNWSRLDPRWAKCNTGNMQSPIDL--SHERLMRNLGYLDYSYLPAEAS  91

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            ++N+GH +++++ G+AG+++ING  Y + Q HWHTPSE+TVNG++ DME+HLVH      
Sbjct  92   MVNRGHDIEVKFMGNAGRVVINGKAYKLKQLHWHTPSEHTVNGRRYDMELHLVHDDGNSN  151

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV-DRNGKA--LGALNPGKITYEGKKYYRFIGSLT  708
             A +  LY+IG PD FL  L   IR++ D   K+  +G ++P         YYR++GSLT
Sbjct  152  TAVIGNLYQIGNPDPFLLMLEPFIRRIADTKDKSEPIGVVDPQLAKSPDAVYYRYMGSLT  211

Query  709  TPPCSQGVIWTVTKEV----KTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC++GVIWTV K V    +TV+Q Q++LL+EAV DGYE NARPLQ +N R + +  P
Sbjct  212  TPPCTEGVIWTVFKRVFLLAQTVAQYQLDLLREAVADGYENNARPLQKVNNRNISIFIP  270



>emb|CDY04545.1| BnaA07g13710D [Brassica napus]
Length=272

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 152/236 (64%), Gaps = 3/236 (1%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y    ENGP KWGKL   + +C  G MQSPI++ +  V++ S  G L R YK   A
Sbjct  34   SEFSYEQNVENGPEKWGKLKPEWKMCGKGEMQSPIDLMNERVRIVSHLGRLTRNYKPCNA  93

Query  355  IIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKD  534
             + N+GH + +++    G I ING  Y +LQ HWH+PSE+T+NG++  +E+H+VH S   
Sbjct  94   SLKNRGHDMMLRFEERPGSIKINGIIYQLLQLHWHSPSEHTINGRRFALELHMVHESING  153

Query  535  EFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA---LGALNPGKITYEGKKYYRFIGSL  705
              A V++LYKIG+ D FL  L N +  +    +A   +G ++P +I    +KYYR++GSL
Sbjct  154  SMAVVTVLYKIGRSDSFLTLLENKLSAMTDQNEAEFNIGMIDPKEIKIGSRKYYRYVGSL  213

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTPPC+Q + WTV K+V+TV++ Q+ LL+ AV D    NARP+QP N R V L +P
Sbjct  214  TTPPCTQNITWTVVKKVRTVARNQVRLLRVAVHDDSNTNARPVQPTNKRVVKLYRP  269



>ref|XP_010510673.1| PREDICTED: alpha carbonic anhydrase 2-like [Camelina sativa]
Length=276

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 156/237 (66%), Gaps = 4/237 (2%)
 Frame = +1

Query  175  TKFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEA  354
            ++F+Y    ENGP  WGKL   + +C  G MQSPI++ +  VK+ S  G+L R YK S A
Sbjct  37   SEFSYEHNKENGPKNWGKLKPEWNMCGKGEMQSPIDLMNKRVKLVSHLGKLSRNYKPSNA  96

Query  355  IIINKGHALQIQWTGD-AGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK  531
             + N+GH + +++  + AG   INGT+Y +LQ HWH+PSE+T+NG++  +E+H+VH S  
Sbjct  97   TLKNRGHDMMLKFGEEGAGSFKINGTEYKLLQLHWHSPSEHTINGRRFALELHMVHESKN  156

Query  532  DEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA---LGALNPGKITYEGKKYYRFIGS  702
               A V++LYKIG+P+ FL  L + +  +     A   +  ++P KI  E + YYR+IGS
Sbjct  157  GSMAVVTVLYKIGRPNSFLKLLEHKLVAITDQHDAERNVIMIDPSKIKTESRNYYRYIGS  216

Query  703  LTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            LTTPPC+Q + WT+ K+V  VS+ Q+NLL+ AV D  + NARP+QP N R ++L +P
Sbjct  217  LTTPPCTQNITWTILKKVXXVSKSQVNLLRVAVHDDSDSNARPVQPTNKRVIHLYRP  273



>gb|KHN39017.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=296

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 154/230 (67%), Gaps = 3/230 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F YI  +E GP  WG++   ++ C  G++QSPI++  + VK+  +  +    Y ++ A 
Sbjct  53   EFDYIGASEKGPRHWGEMKKEWSSCKNGHLQSPIDLSCARVKIIPRCRQPDIYYTATNAT  112

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            IIN+GH + + W  DAG + +NGT+YF+ QCHWH+PSE+++NG++ D+E+H+VH S  ++
Sbjct  113  IINRGHDIAVYWKDDAGSVYLNGTEYFLKQCHWHSPSEHSMNGRRYDLEMHMVHVSPDNK  172

Query  538  FAAVSILYKIG-KPDKFLGQLLNSIRQVDRN--GKALGALNPGKITYEGKKYYRFIGSLT  708
               V  LYK G +PD+FL QL   I+ +  N   +A+G  NP  +   G  YYR++GSLT
Sbjct  173  IFVVGALYKFGHRPDRFLSQLEKDIKHLVDNEVERAIGETNPSGLQTRGNAYYRYVGSLT  232

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTV  858
            TPPC++GVIW + ++++TVS+EQ+ LL+EAV D  E NARP+Q    R +
Sbjct  233  TPPCTEGVIWNIDRKIRTVSEEQVRLLREAVHDHAERNARPMQRRYNRDI  282



>ref|XP_003574630.1| PREDICTED: alpha carbonic anhydrase 7-like [Brachypodium distachyon]
Length=276

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/236 (42%), Positives = 155/236 (66%), Gaps = 5/236 (2%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y   AENGP  WG++   ++ C  G+MQSPI++    V +    G L   Y+ ++A 
Sbjct  36   EFSYSLDAENGPAHWGEIKEEWSACGKGDMQSPIDLSSPRVSLVRGLGYLNHSYRPAQAS  95

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            I+N+GH + +++ GDAG + INGT Y++ Q HWH+PSE+++NG++ DME+H+VH SA+++
Sbjct  96   IVNRGHDIMVRFEGDAGSVSINGTAYYLRQLHWHSPSEHSLNGRRYDMEMHMVHESAQNK  155

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQV----DRNGKALGALNPGKITYEGKKYYRFIGSL  705
             A + + Y++G  D FL +L   +  +    DR  K +G ++P         YYR++GSL
Sbjct  156  AAVIGVFYQVGAHDAFLHKLEPYLEMIADKKDREEK-VGLIDPRGARGRASVYYRYMGSL  214

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTPPC++GVIWT+ K V+TVS  Q+ LL+EAV D  E+NARP Q  N R + + +P
Sbjct  215  TTPPCAEGVIWTIVKRVRTVSSAQLELLREAVHDDMEKNARPRQETNNRVISMFRP  270



>ref|XP_010470127.1| PREDICTED: alpha carbonic anhydrase 2-like isoform X1 [Camelina 
sativa]
Length=277

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/237 (43%), Positives = 158/237 (67%), Gaps = 5/237 (2%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y    ENGP KWGKL   + +C  G +QSPI++ +  V++ + F +L + YK   A 
Sbjct  38   EFSYERKKENGPEKWGKLKPEWKLCGKGELQSPIDLMNKRVRLVTDFQKLTKDYKPCNAT  97

Query  358  IINKGHALQIQWTGD--AGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK  531
            +IN+GH + +++  +  +G + INGT+Y +LQ HWH+PSE+T+NG++  +E+H+VH S  
Sbjct  98   LINRGHDMMLRFEEEEGSGSLKINGTEYKLLQLHWHSPSEHTINGRRFALELHMVHESKN  157

Query  532  DEFAAVSILYKIGKPDKFLGQLLNSIRQVDRNGKA---LGALNPGKITYEGKKYYRFIGS  702
               A V++LYKIG+P+ FL  L + +  +     A   +  ++P KI  E + YYR+IGS
Sbjct  158  GSMAVVTVLYKIGRPNSFLKLLEHKLVAITDQHDAERNVVMIDPSKIKTESRNYYRYIGS  217

Query  703  LTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            LTTPPC+Q + WT+ K+++TVS+ Q+NLL+ AV D    NARP+QP N R ++L +P
Sbjct  218  LTTPPCTQNITWTILKKIRTVSKSQVNLLRVAVHDDSNSNARPVQPANKRVIHLYRP  274



>ref|XP_006286119.1| hypothetical protein CARUB_v10007668mg [Capsella rubella]
 gb|EOA19017.1| hypothetical protein CARUB_v10007668mg [Capsella rubella]
Length=255

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 159/224 (71%), Gaps = 2/224 (1%)
 Frame = +1

Query  193  SGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAIIINKG  372
            S  + GP  WGK++ ++ VCN G +QSPI++ +  V +          YK + A+I+N+G
Sbjct  29   SEVDKGPEGWGKINPDWKVCNTGKLQSPIDLTNERVSLVHD-QPWNMDYKPAPAVIVNRG  87

Query  373  HALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDEFAAVS  552
            H + + W  DAGK+ I+ TDY ++Q HWH+PSE+T+NG + D+E+H+VH SA+ + A + 
Sbjct  88   HDIMVSWKEDAGKVTIHQTDYKLVQSHWHSPSEHTINGTRYDLELHMVHTSAQGKNAVIG  147

Query  553  ILYKIGKPDKFLGQLLNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLTTPPCSQGV  732
            +LYK+G+P++FL +LL+ I+ V++  K +G ++P +I +   K YR++GSLT PPC++GV
Sbjct  148  LLYKLGEPNEFLAKLLDGIKGVEKKEKNIGMVDPREIKFHS-KIYRYMGSLTAPPCTEGV  206

Query  733  IWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            +WTV  +V+TVS EQ+  LKE VDDG+E N+RP+Q  +GR+++ 
Sbjct  207  LWTVLTKVETVSMEQLTALKETVDDGFEANSRPIQDPHGRSIWF  250



>ref|XP_007211988.1| hypothetical protein PRUPE_ppa010973mg [Prunus persica]
 gb|EMJ13187.1| hypothetical protein PRUPE_ppa010973mg [Prunus persica]
Length=228

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 148/214 (69%), Gaps = 6/214 (3%)
 Frame = +1

Query  241  YTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAIIINKGHALQIQWTGDAGKIII  420
            +  C  G MQSPI++    VK+    G+L   YK S A + N+GH + I+W GDAG + I
Sbjct  5    WAACKNGGMQSPIDLSSQRVKLIPNLGKLNTAYKPSNATVKNRGHDISIEWVGDAGSLKI  64

Query  421  NGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAK----DEFAAVSILYKIGKPDKFL  588
            NGT+Y + QCHWH+PSE+++NG++ DME+H+VH S      ++ A V+ LYKIG+PD FL
Sbjct  65   NGTEYLLKQCHWHSPSEHSINGRRYDMELHMVHLSPNPNVTNKIAVVAALYKIGRPDSFL  124

Query  589  GQLLNSIRQV--DRNGKALGALNPGKITYEGKKYYRFIGSLTTPPCSQGVIWTVTKEVKT  762
             +L   I+ +   +  +++G ++P KI   GK YYR++GSLT PPC++GVIWT+ K+++T
Sbjct  125  TKLTRDIQSMTDQKEERSVGIIDPNKIKIPGKSYYRYMGSLTVPPCTEGVIWTINKKIRT  184

Query  763  VSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            VS++Q+ L + AV D  E NARP+QPLN R +++
Sbjct  185  VSRDQVKLFRVAVHDYAETNARPVQPLNLREIHV  218



>gb|KFK43125.1| hypothetical protein AALP_AA1G083600 [Arabis alpina]
Length=272

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 153/235 (65%), Gaps = 3/235 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y    E GP +WGKL   + +C  G +QSPI++ +  V + S  G L R YK S A 
Sbjct  36   EFNYKKNDEKGPERWGKLKPEWEMCGKGEIQSPIDLMNERVNIVSHLGRLNRNYKPSNAT  95

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + +++   AG I ING+ Y + Q HWH+PSE++VNG++  +E+H+VH +    
Sbjct  96   LKNRGHDIMLRFENGAGSIKINGSQYELQQLHWHSPSEHSVNGRRFALELHMVHEAKNGR  155

Query  538  FAAVSILYKIGKPDKFLGQL---LNSIRQVDRNGKALGALNPGKITYEGKKYYRFIGSLT  708
             A V++LYKIG+ D FLG L   L  I  ++   K  G ++P KI    +KYYR+IGSLT
Sbjct  156  MAVVTVLYKIGRADTFLGSLEKELEGIAVLEEAEKNAGIIDPKKIKIGSRKYYRYIGSLT  215

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TPPC+Q V W+V ++V+TV+++Q+ LL+ AV D  + NARP+QP+N R V L +P
Sbjct  216  TPPCTQNVTWSVVRKVRTVTRKQVRLLRVAVHDDQDTNARPVQPINKRMVKLYRP  270



>ref|XP_003537009.2| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=296

 Score =   227 bits (579),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 153/230 (67%), Gaps = 3/230 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F YI  +E GP  WG++   ++ C  G++QSPI++  + VK+  +  +    Y ++ A 
Sbjct  53   EFDYIGASEKGPRHWGEMKKEWSSCKNGHLQSPIDLSCARVKIIPRCRQPDIYYTATNAT  112

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            IIN+GH + + W  DAG + +NGT+YF+ QCHWH+PSE+++NG++ D+E+H+VH S  ++
Sbjct  113  IINRGHDIAVYWKDDAGSVYLNGTEYFLKQCHWHSPSEHSMNGRRYDLEMHMVHVSPDNK  172

Query  538  FAAVSILYKIG-KPDKFLGQLLNSIRQVDRN--GKALGALNPGKITYEGKKYYRFIGSLT  708
               V  LYK G +PD+FL QL   I+ +  N   + +G  NP  +   G  YYR++GSLT
Sbjct  173  IFVVGALYKFGHRPDRFLSQLEKDIKHLVDNEVEREIGETNPSGLQTRGNAYYRYVGSLT  232

Query  709  TPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTV  858
            TPPC++GVIW + ++++TVS+EQ+ LL+EAV D  E NARP+Q    R +
Sbjct  233  TPPCTEGVIWNIDRKIRTVSEEQVRLLREAVHDHAERNARPMQRRYNRDI  282



>ref|XP_008462817.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Cucumis melo]
Length=275

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 144/231 (62%), Gaps = 2/231 (1%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F Y +    GP  WG +   +  C  G MQSPI++ +  V++ S F +L   Y SS A 
Sbjct  35   EFDYNTNGTRGPAHWGDIRPEWHTCRTGQMQSPIDLLNQRVRIVSHFTDLKINYSSSNAT  94

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            + N+GH + +QW+G AG + +N + YF+ Q HWH+PSE+T+NG++  +E HLVH+S    
Sbjct  95   LKNRGHDIMLQWSGSAGYMEVNRSRYFLRQIHWHSPSEHTINGRRFALEAHLVHQSQTGN  154

Query  538  FAAVSILYKIGKPDKFLGQLLNSIRQVD--RNGKALGALNPGKITYEGKKYYRFIGSLTT  711
             A + ILY IG+PD FL  +      +   +  K L  +NP ++      YYR+IGSLT 
Sbjct  155  IAVIGILYNIGQPDYFLSTMRQHFIDISTTQRDKLLNVVNPSRLRMRSSLYYRYIGSLTV  214

Query  712  PPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYL  864
            PPCSQ V+WT+ ++V+TV+ +Q+NLL+ AV D    NARPLQPLN R V L
Sbjct  215  PPCSQNVLWTIVRKVRTVAPDQVNLLRVAVHDDSNTNARPLQPLNNRNVQL  265



>ref|XP_004242096.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Solanum lycopersicum]
Length=264

 Score =   226 bits (576),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 161/236 (68%), Gaps = 8/236 (3%)
 Frame = +1

Query  178  KFTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIRRYKSSEAI  357
            +F+Y   A+NGP KWG++ +    CN GN+QSPI+ D+  V+V S  G L + YK S A 
Sbjct  32   EFSYDQNAKNGPSKWGEISS---YCN-GNLQSPIDFDNKVVEVVSNLGILQKYYKPSNAT  87

Query  358  IINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKKVDMEIHLVHRSAKDE  537
            ++N+GH + ++W GD+G + IN T Y + Q HWHTPSE+++NGK+ DME HLVH S+  +
Sbjct  88   LVNRGHNIMLRWDGDSGYLKINETQYQLQQIHWHTPSEHSINGKRYDMEAHLVHMSSDRK  147

Query  538  FAAVSILYKIGK-PDKFLGQLLNSIRQV-DRNG--KALGALNPGKITYEGKKYYRFIGSL  705
             A + ILY+IG  PD  L  L   ++ V D+ G  K +G ++P  I  +   YYR+IGSL
Sbjct  148  TAVIGILYEIGSLPDDLLTILEGDLKAVADKRGAEKGMGIIDPNIIKLDDNIYYRYIGSL  207

Query  706  TTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDGYEENARPLQPLNGRTVYLNQP  873
            TTPPC++G++WT+  +V +V+  QI LL++A  +G+E NARP+Q LNGR++  N+P
Sbjct  208  TTPPCTEGLVWTIDGKVNSVTARQIKLLQDAAVNGFEFNARPVQLLNGRSIKFNKP  263



>emb|CDP15287.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   227 bits (578),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 114/261 (44%), Positives = 165/261 (63%), Gaps = 24/261 (9%)
 Frame = +1

Query  157  ASESEGTK-FTYISGAENGPGKWGKLHTNYTVCNAGNMQSPINIDDSTVKVTSKFGELIR  333
            A E E  + F Y  G++ GP +WGKL   +  C+ G  QSPI++ +  V++ SK    I 
Sbjct  36   AQEVEDEREFDYAEGSKKGPKRWGKLKKEWAACSNGAFQSPIDMSNERVRLISKPERPI-  94

Query  334  RYKSSEAIIINKGHALQIQWTGDAGKIIINGTDYFMLQCHWHTPSENTVNGKK-------  492
             YK + A I N+GH + +QW GDAG I INGT Y + Q HWH+PSE+T+ G++       
Sbjct  95   -YKPTNATIKNRGHDISLQWGGDAGSIAINGTVYPLRQAHWHSPSEHTIRGRRHLSLFSG  153

Query  493  -------VDMEIHLVHRSA----KDEFAAVSILYKIGKPDKFLGQLLNSIR-QVDRNG--  630
                    D+E+H+VH S     K++ A + +LYKIGKPDKFL +L + I   +D     
Sbjct  154  FLRSFFRYDLELHMVHLSTDPNLKNKIAVIGVLYKIGKPDKFLSKLTSYISTMIDEKDEQ  213

Query  631  KALGALNPGKITYEGKKYYRFIGSLTTPPCSQGVIWTVTKEVKTVSQEQINLLKEAVDDG  810
            ++L  ++P +I    K+YYR++GSLT PPC++GVIWT+ ++V+TVS++Q+ LL+EAV D 
Sbjct  214  RSLDVVDPRQIEMHSKRYYRYMGSLTVPPCTEGVIWTINRKVRTVSRDQVMLLREAVHDY  273

Query  811  YEENARPLQPLNGRTVYLNQP  873
             E NARP+Q  NGR +YL  P
Sbjct  274  AERNARPIQQQNGRDIYLYGP  294



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2581342896576