BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23689_g3_i3 len=579 path=[5730:0-339 3384:340-381 10546:382-402
2599:403-578]

Length=579
                                                                      Score     E

ref|XP_009608696.1|  PREDICTED: F-box protein PP2-B10-like              107   2e-24   
ref|XP_010241135.1|  PREDICTED: putative F-box protein PP2-B12 is...    107   2e-24   
gb|EYU32653.1|  hypothetical protein MIMGU_mgv1a024376mg                102   2e-23   
ref|XP_006360349.1|  PREDICTED: F-box protein At2g02240-like isof...    103   2e-23   
gb|EYU32655.1|  hypothetical protein MIMGU_mgv1a025781mg                103   2e-23   
ref|XP_006360350.1|  PREDICTED: F-box protein At2g02240-like isof...    102   4e-23   
ref|XP_010241131.1|  PREDICTED: putative F-box protein PP2-B12          103   8e-23   
ref|XP_010264073.1|  PREDICTED: F-box protein PP2-B10-like              103   9e-23   
ref|XP_010241130.1|  PREDICTED: putative F-box protein PP2-B12 is...    102   1e-22   
ref|XP_010241129.1|  PREDICTED: putative F-box protein PP2-B12 is...    102   1e-22   
ref|XP_009780353.1|  PREDICTED: F-box protein At2g02240-like            100   5e-22   
ref|XP_009757437.1|  PREDICTED: F-box protein PP2-B10-like              100   5e-22   
emb|CDO99431.1|  unnamed protein product                              99.8    7e-22   
ref|XP_004252380.2|  PREDICTED: F-box protein PP2-B10                 99.4    1e-21   
ref|XP_009608697.1|  PREDICTED: F-box protein PP2-B10-like            99.0    2e-21   
ref|XP_009763471.1|  PREDICTED: F-box protein PP2-B3-like             95.9    3e-21   
ref|XP_009757438.1|  PREDICTED: F-box protein PP2-B10-like isofor...  97.8    3e-21   
ref|XP_009757439.1|  PREDICTED: F-box protein PP2-B10-like isofor...  97.1    7e-21   
ref|XP_008453630.1|  PREDICTED: F-box protein PP2-B10-like            96.7    1e-20   
ref|XP_002513763.1|  conserved hypothetical protein                   96.7    2e-20   Ricinus communis
ref|XP_006366161.1|  PREDICTED: F-box protein PP2-B10-like            95.9    2e-20   
ref|XP_006349935.1|  PREDICTED: F-box protein PP2-B10-like            95.5    2e-20   
emb|CBI38318.3|  unnamed protein product                              95.9    3e-20   
ref|XP_009379693.1|  PREDICTED: F-box protein PP2-B10-like            95.5    3e-20   
ref|XP_002270048.1|  PREDICTED: F-box protein PP2-B10                 95.9    3e-20   Vitis vinifera
ref|XP_010502236.1|  PREDICTED: putative F-box protein PP2-B2         94.7    7e-20   
ref|XP_004253004.1|  PREDICTED: putative F-box protein PP2-B12        94.0    8e-20   
ref|XP_006355999.1|  PREDICTED: F-box protein SKIP3-like              90.5    9e-20   
ref|XP_010518559.1|  PREDICTED: putative F-box protein PP2-B2         94.0    1e-19   
ref|XP_004288834.1|  PREDICTED: F-box protein At2g02240-like          94.0    1e-19   
ref|XP_009608698.1|  PREDICTED: F-box protein PP2-B10-like            93.2    2e-19   
ref|XP_004169477.1|  PREDICTED: F-box protein PP2-B10-like            93.6    2e-19   
ref|XP_010935983.1|  PREDICTED: putative F-box protein PP2-B12        93.6    2e-19   
ref|XP_011073773.1|  PREDICTED: F-box protein At2g02240-like          92.8    2e-19   
ref|XP_010935988.1|  PREDICTED: F-box protein At2g02240-like isof...  90.9    2e-19   
ref|XP_008453629.1|  PREDICTED: F-box protein PP2-B10-like            93.2    2e-19   
ref|XP_010264146.1|  PREDICTED: putative F-box protein PP2-B12        93.2    2e-19   
gb|EYU32966.1|  hypothetical protein MIMGU_mgv1a019579mg              92.8    3e-19   
emb|CAN65692.1|  hypothetical protein VITISV_022468                   92.0    3e-19   Vitis vinifera
gb|EYU22102.1|  hypothetical protein MIMGU_mgv1a020310mg              92.4    4e-19   
ref|XP_010241128.1|  PREDICTED: putative F-box protein PP2-B12 is...  92.4    4e-19   
ref|XP_006588465.1|  PREDICTED: uncharacterized protein LOC100800...  92.0    4e-19   
gb|KHN14786.1|  F-box protein PP2-B10                                 92.0    5e-19   
ref|XP_010241127.1|  PREDICTED: putative F-box protein PP2-B12 is...  92.4    5e-19   
ref|XP_002279245.1|  PREDICTED: F-box protein PP2-B15                 92.0    5e-19   Vitis vinifera
ref|XP_010430669.1|  PREDICTED: putative F-box protein PP2-B2         91.7    8e-19   
ref|XP_009764086.1|  PREDICTED: F-box protein PP2-B10-like            91.7    9e-19   
ref|XP_010935987.1|  PREDICTED: F-box protein At2g02240-like isof...  90.9    1e-18   
ref|XP_006353800.1|  PREDICTED: F-box protein PP2-B10-like            90.9    1e-18   
ref|XP_004298005.1|  PREDICTED: F-box protein PP2-B10-like            90.9    1e-18   
ref|NP_001242472.1|  uncharacterized protein LOC100800402             90.5    1e-18   
emb|CAN65691.1|  hypothetical protein VITISV_022467                   90.9    2e-18   Vitis vinifera
ref|XP_002529282.1|  conserved hypothetical protein                   89.7    3e-18   Ricinus communis
ref|XP_007147250.1|  hypothetical protein PHAVU_006G108500g           90.1    3e-18   
ref|XP_009602068.1|  PREDICTED: F-box protein PP2-B10-like            89.7    3e-18   
emb|CDO99429.1|  unnamed protein product                              91.3    4e-18   
ref|XP_010264074.1|  PREDICTED: putative F-box protein PP2-B12        89.4    4e-18   
ref|XP_006371768.1|  hypothetical protein POPTR_0018s02870g           89.0    4e-18   
ref|XP_004304800.1|  PREDICTED: F-box protein At2g02240-like          89.0    5e-18   
emb|CDP04245.1|  unnamed protein product                              89.4    5e-18   
emb|CBI39533.3|  unnamed protein product                              92.0    6e-18   
ref|NP_973399.1|  F-box domain protein MEE66                          89.4    6e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004302132.1|  PREDICTED: F-box protein At2g02240-like          89.0    6e-18   
ref|XP_009587732.1|  PREDICTED: F-box protein PP2-B10-like            89.0    6e-18   
ref|XP_010650201.1|  PREDICTED: F-box protein At2g02240-like isof...  88.6    7e-18   
ref|XP_002283524.1|  PREDICTED: F-box protein VBF-like                89.0    7e-18   Vitis vinifera
ref|XP_010650200.1|  PREDICTED: F-box protein PP2-B10-like isofor...  88.6    8e-18   
ref|XP_002282712.2|  PREDICTED: F-box protein PP2-B10-like isofor...  88.6    8e-18   Vitis vinifera
ref|XP_006430121.1|  hypothetical protein CICLE_v10013351mg           88.6    8e-18   
ref|XP_006382440.1|  SKP1 interacting partner 3-related family pr...  88.2    1e-17   
ref|XP_010106836.1|  Putative F-box protein                           88.2    1e-17   
ref|XP_006345814.1|  PREDICTED: F-box protein At2g02240-like          88.2    1e-17   
sp|Q9FV02.2|SKIP3_ARATH  RecName: Full=F-box protein SKIP3; AltNa...  88.2    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004302127.1|  PREDICTED: putative F-box protein PP2-B12-like   88.2    2e-17   
ref|XP_011031411.1|  PREDICTED: putative F-box protein PP2-B12        87.8    2e-17   
ref|NP_178332.2|  phloem protein 2-B2                                 87.4    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KCW60514.1|  hypothetical protein EUGRSUZ_H03260                   87.4    2e-17   
ref|XP_009763054.1|  PREDICTED: F-box protein PP2-B10-like            87.4    2e-17   
ref|XP_010024086.1|  PREDICTED: F-box protein PP2-B15-like            87.4    2e-17   
ref|XP_006471428.1|  PREDICTED: F-box protein At2g02240-like          87.0    2e-17   
gb|AAC78509.1|  lectin-like protein                                   87.4    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006489771.1|  PREDICTED: F-box protein At2g02240-like          87.0    3e-17   
gb|KDO54870.1|  hypothetical protein CISIN_1g034086mg                 84.0    3e-17   
ref|XP_006493712.1|  PREDICTED: putative F-box protein PP2-B2-like    84.3    3e-17   
ref|XP_004239687.1|  PREDICTED: putative F-box protein PP2-B12        87.0    3e-17   
ref|XP_008350797.1|  PREDICTED: F-box protein At2g02240-like          86.7    4e-17   
ref|XP_002876807.1|  phloem protein 2-B2                              86.7    4e-17   
ref|XP_010935985.1|  PREDICTED: putative F-box protein PP2-B12        86.7    4e-17   
ref|XP_010905842.1|  PREDICTED: putative F-box protein PP2-B12        86.7    4e-17   
ref|XP_009799500.1|  PREDICTED: F-box protein At2g02240-like isof...  84.3    4e-17   
ref|XP_008796436.1|  PREDICTED: uncharacterized protein LOC103711894  89.0    5e-17   
ref|XP_010935986.1|  PREDICTED: F-box protein At2g02240-like          86.3    6e-17   
gb|EYU37274.1|  hypothetical protein MIMGU_mgv1a023178mg              85.9    6e-17   
ref|XP_002876815.1|  hypothetical protein ARALYDRAFT_904464           85.9    7e-17   
ref|XP_002324125.2|  hypothetical protein POPTR_0018s00210g           82.4    8e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010425003.1|  PREDICTED: F-box protein At2g02240-like          85.5    8e-17   
emb|CDP04244.1|  unnamed protein product                              85.5    9e-17   
ref|XP_010109312.1|  F-box protein                                    86.3    9e-17   
ref|XP_002865264.1|  hypothetical protein ARALYDRAFT_330877           85.5    1e-16   
gb|KDO39882.1|  hypothetical protein CISIN_1g047756mg                 82.0    1e-16   
ref|XP_002876814.1|  hypothetical protein ARALYDRAFT_322564           85.5    1e-16   
ref|XP_010026191.1|  PREDICTED: putative F-box protein PP2-B12        85.5    1e-16   
gb|EYU32965.1|  hypothetical protein MIMGU_mgv1a023724mg              85.1    1e-16   
ref|XP_002876806.1|  hypothetical protein ARALYDRAFT_322561           85.5    1e-16   
ref|XP_010041709.1|  PREDICTED: F-box protein PP2-B10-like            85.1    1e-16   
ref|XP_010502235.1|  PREDICTED: F-box protein At2g02240               85.1    1e-16   
gb|KCW44149.1|  hypothetical protein EUGRSUZ_L02439                   85.1    1e-16   
ref|XP_010430674.1|  PREDICTED: F-box protein PP2-B10-like            85.5    1e-16   
emb|CBI38320.3|  unnamed protein product                              83.2    1e-16   
ref|XP_010269615.1|  PREDICTED: F-box protein PP2-B15-like            85.1    1e-16   
ref|XP_010502240.1|  PREDICTED: F-box protein PP2-B10-like            85.1    1e-16   
ref|XP_010070124.1|  PREDICTED: F-box protein PP2-B10-like            85.1    2e-16   
ref|XP_009618931.1|  PREDICTED: putative F-box protein PP2-B12        85.1    2e-16   
ref|XP_008803651.1|  PREDICTED: F-box protein PP2-B11-like            84.7    2e-16   
ref|XP_006344703.1|  PREDICTED: F-box protein PP2-B15-like            84.7    2e-16   
emb|CAN62941.1|  hypothetical protein VITISV_034195                   82.4    2e-16   Vitis vinifera
ref|XP_006481706.1|  PREDICTED: F-box protein PP2-B15-like isofor...  84.3    2e-16   
gb|KDP38872.1|  hypothetical protein JCGZ_05029                       84.3    2e-16   
emb|CAN62661.1|  hypothetical protein VITISV_027495                   83.6    2e-16   Vitis vinifera
ref|XP_006489774.1|  PREDICTED: putative F-box protein PP2-B2-like    84.3    2e-16   
ref|XP_006481707.1|  PREDICTED: F-box protein PP2-B15-like isofor...  84.3    2e-16   
gb|KDO70549.1|  hypothetical protein CISIN_1g039003mg                 84.3    2e-16   
ref|XP_008453631.1|  PREDICTED: F-box protein PP2-B10-like            84.3    3e-16   
ref|XP_004237494.1|  PREDICTED: F-box protein PP2-B10-like            84.3    3e-16   
ref|XP_008450565.1|  PREDICTED: putative F-box protein PP2-B12        84.0    3e-16   
ref|XP_006293187.1|  hypothetical protein CARUB_v10019504mg           84.0    3e-16   
ref|XP_010527859.1|  PREDICTED: F-box protein PP2-B1                  84.0    4e-16   
ref|XP_009619612.1|  PREDICTED: putative F-box protein PP2-B12 is...  83.6    4e-16   
ref|XP_006340500.1|  PREDICTED: F-box protein At2g02240-like          84.0    4e-16   
ref|XP_002270482.1|  PREDICTED: F-box protein PP2-B10                 84.3    4e-16   Vitis vinifera
ref|XP_007143948.1|  hypothetical protein PHAVU_007G116000g           83.6    4e-16   
gb|KCW45031.1|  hypothetical protein EUGRSUZ_L01379                   83.6    4e-16   
ref|XP_009619613.1|  PREDICTED: F-box protein PP2-B10-like isofor...  83.6    4e-16   
ref|XP_010070337.1|  PREDICTED: F-box protein At2g02240-like          82.8    4e-16   
ref|XP_006371767.1|  hypothetical protein POPTR_0018s02850g           83.6    5e-16   
ref|XP_010314855.1|  PREDICTED: F-box protein PP2-B10-like            83.6    5e-16   
ref|XP_006291645.1|  hypothetical protein CARUB_v10017801mg           83.6    5e-16   
gb|KCW59014.1|  hypothetical protein EUGRSUZ_H016412                  81.6    5e-16   
ref|XP_004230267.1|  PREDICTED: F-box protein PP2-B15-like            83.6    5e-16   
ref|XP_009379702.1|  PREDICTED: putative F-box protein PP2-B12 is...  83.2    6e-16   
ref|XP_006420860.1|  hypothetical protein CICLE_v10005617mg           83.2    6e-16   
ref|XP_006420865.1|  hypothetical protein CICLE_v10006813mg           80.5    6e-16   
ref|XP_006491826.1|  PREDICTED: F-box protein At2g02240-like          83.2    6e-16   
ref|XP_006493714.1|  PREDICTED: F-box protein PP2-B11-like            83.2    6e-16   
ref|XP_010041821.1|  PREDICTED: F-box protein PP2-B10-like            83.2    7e-16   
ref|XP_006420648.1|  hypothetical protein CICLE_v10005661mg           82.8    7e-16   
ref|XP_007015196.1|  F-box family protein, putative                   83.2    7e-16   
ref|XP_010026291.1|  PREDICTED: F-box protein At2g02240-like          82.4    8e-16   
ref|XP_008789432.1|  PREDICTED: putative F-box protein PP2-B12        82.8    8e-16   
ref|XP_008359908.1|  PREDICTED: F-box protein At2g02240-like          82.8    8e-16   
ref|XP_009101264.1|  PREDICTED: putative F-box protein PP2-B2         82.8    8e-16   
emb|CDY17600.1|  BnaA06g34190D                                        82.8    9e-16   
emb|CAN65690.1|  hypothetical protein VITISV_022466                   82.8    9e-16   Vitis vinifera
ref|XP_002324346.2|  hypothetical protein POPTR_0018s02860g           82.8    9e-16   Populus trichocarpa [western balsam poplar]
gb|KCW59018.1|  hypothetical protein EUGRSUZ_H01644                   82.4    1e-15   
emb|CAN62662.1|  hypothetical protein VITISV_027496                   82.4    1e-15   Vitis vinifera
ref|XP_004169480.1|  PREDICTED: F-box protein PP2-B10-like            82.8    1e-15   
ref|XP_010095574.1|  F-box protein                                    82.4    1e-15   
ref|XP_006395798.1|  hypothetical protein EUTSA_v10004729mg           82.4    1e-15   
ref|XP_010026288.1|  PREDICTED: F-box protein At2g02240-like          82.4    1e-15   
ref|XP_006420858.1|  hypothetical protein CICLE_v10005659mg           82.4    1e-15   
ref|XP_002876808.1|  hypothetical protein ARALYDRAFT_904457           82.4    1e-15   
ref|XP_004146355.1|  PREDICTED: F-box protein PP2-B10-like            82.4    1e-15   
gb|KGN65431.1|  hypothetical protein Csa_1G421910                     82.4    1e-15   
ref|XP_002270580.1|  PREDICTED: putative F-box protein PP2-B12        82.4    1e-15   Vitis vinifera
ref|XP_010514007.1|  PREDICTED: F-box protein PP2-B10-like            82.4    1e-15   
ref|XP_004146303.1|  PREDICTED: F-box protein PP2-B10-like            82.4    1e-15   
ref|XP_010065003.1|  PREDICTED: F-box protein PP2-B11-like            82.4    1e-15   
ref|XP_003638370.1|  F-box protein PP2-B1                             82.0    1e-15   
emb|CDY17599.1|  BnaA06g34180D                                        82.0    1e-15   
emb|CDY09382.1|  BnaA02g26280D                                        82.0    2e-15   
ref|XP_009338226.1|  PREDICTED: F-box protein PP2-B15-like            82.0    2e-15   
ref|XP_002512468.1|  conserved hypothetical protein                   82.0    2e-15   Ricinus communis
ref|XP_010923971.1|  PREDICTED: F-box protein PP2-B10-like            81.6    2e-15   
emb|CBI38323.3|  unnamed protein product                              82.0    2e-15   
ref|XP_002876816.1|  phloem protein 2-B10                             81.6    2e-15   
gb|ABB77431.1|  non-S-locus F-box-like protein 2011                   80.1    2e-15   Petunia integrifolia subsp. inflata
gb|KGN65433.1|  hypothetical protein Csa_1G421930                     82.0    2e-15   
ref|XP_004146357.1|  PREDICTED: F-box protein PP2-B10-like            82.0    2e-15   
ref|XP_002324345.1|  hypothetical protein POPTR_0018s02860g           83.2    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_004304799.1|  PREDICTED: putative F-box protein PP2-B12-like   81.6    2e-15   
gb|ADE77551.1|  unknown                                               81.6    2e-15   
ref|XP_004135585.1|  PREDICTED: F-box protein PP2-B15-like            81.3    2e-15   
gb|KGN65432.1|  hypothetical protein Csa_1G421920                     81.6    2e-15   
ref|XP_002308717.2|  hypothetical protein POPTR_0006s28280g           81.6    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_004146356.1|  PREDICTED: F-box protein PP2-B10-like            81.3    3e-15   
gb|EYU37273.1|  hypothetical protein MIMGU_mgv1a023496mg              81.3    3e-15   
emb|CDY03058.1|  BnaC07g21690D                                        81.3    3e-15   
ref|XP_011036720.1|  PREDICTED: putative F-box protein PP2-B2 iso...  83.6    3e-15   
ref|XP_009400485.1|  PREDICTED: F-box protein At2g02240-like          80.9    3e-15   
ref|XP_002279225.1|  PREDICTED: F-box protein PP2-B15 isoform X1      80.9    3e-15   Vitis vinifera
emb|CDO99428.1|  unnamed protein product                              79.3    3e-15   
ref|XP_007031053.1|  Phloem 2-B15-like protein                        81.6    4e-15   
ref|XP_010065005.1|  PREDICTED: F-box protein SKIP3-like              78.6    4e-15   
emb|CDP17217.1|  unnamed protein product                              80.9    4e-15   
ref|XP_010513999.1|  PREDICTED: F-box protein At2g02240-like          80.5    5e-15   
ref|XP_004237583.1|  PREDICTED: F-box protein PP2-B11-like            80.5    5e-15   
ref|XP_007031054.1|  Phloem protein 2-B15, putative                   81.3    5e-15   
ref|XP_008803664.1|  PREDICTED: F-box protein PP2-A13-like            79.3    5e-15   
emb|CDY03057.1|  BnaC07g21700D                                        80.1    5e-15   
ref|XP_008370414.1|  PREDICTED: F-box protein PP2-B15-like            80.5    6e-15   
emb|CDY70803.1|  BnaC02g47790D                                        80.1    6e-15   
gb|KDP32894.1|  hypothetical protein JCGZ_12186                       80.1    6e-15   
ref|XP_003590880.1|  F-box protein PP2-B1                             80.1    7e-15   
gb|AFK34389.1|  unknown                                               80.1    7e-15   
ref|XP_008453628.1|  PREDICTED: F-box protein PP2-B10-like            80.1    8e-15   
ref|XP_009129267.1|  PREDICTED: F-box protein At2g02240-like          79.7    8e-15   
emb|CDY09379.1|  BnaA02g26310D                                        79.7    9e-15   
ref|XP_010514002.1|  PREDICTED: F-box protein PP2-B10-like            79.7    9e-15   
ref|XP_008388763.1|  PREDICTED: F-box protein At2g02240-like          79.7    1e-14   
ref|XP_006664305.1|  PREDICTED: F-box protein At2g02240-like          79.7    1e-14   
ref|XP_008359993.1|  PREDICTED: F-box protein At2g02240-like          79.7    1e-14   
ref|XP_006480430.1|  PREDICTED: F-box protein At2g02240-like isof...  79.7    1e-14   
ref|XP_009129159.1|  PREDICTED: F-box protein At2g02240-like          79.3    1e-14   
ref|XP_003590890.1|  F-box protein PP2-B1                             79.3    1e-14   
emb|CBI38319.3|  unnamed protein product                              80.1    1e-14   
ref|XP_002270223.1|  PREDICTED: putative F-box protein PP2-B12        79.7    1e-14   Vitis vinifera
gb|KHG05962.1|  F-box PP2-B15 -like protein                           79.3    1e-14   
ref|XP_004302133.1|  PREDICTED: F-box protein At2g02240-like          79.3    1e-14   
ref|XP_002876809.1|  hypothetical protein ARALYDRAFT_904458           79.3    1e-14   
ref|XP_011036723.1|  PREDICTED: putative F-box protein PP2-B2 iso...  81.3    1e-14   
ref|XP_011036721.1|  PREDICTED: F-box protein VBF-like isoform X3     81.3    1e-14   
ref|XP_006395794.1|  hypothetical protein EUTSA_v10004854mg           79.0    1e-14   
ref|XP_009412445.1|  PREDICTED: F-box protein PP2-B1-like             79.3    1e-14   
ref|XP_006395797.1|  hypothetical protein EUTSA_v10004855mg           79.0    1e-14   
gb|KHN04971.1|  F-box protein PP2-B1                                  79.3    1e-14   
ref|XP_011036719.1|  PREDICTED: uncharacterized protein LOC105134...  81.3    1e-14   
ref|XP_010674196.1|  PREDICTED: putative F-box protein PP2-B12        79.3    1e-14   
ref|XP_009407173.1|  PREDICTED: putative F-box protein PP2-B2 iso...  78.6    1e-14   
gb|KGN60967.1|  hypothetical protein Csa_2G032730                     79.3    2e-14   
ref|XP_003556444.1|  PREDICTED: F-box protein At2g02240-like          79.3    2e-14   
ref|XP_002453018.1|  hypothetical protein SORBIDRAFT_04g036800        79.7    2e-14   Sorghum bicolor [broomcorn]
ref|XP_007031057.1|  Phloem protein 2-B15, putative                   79.3    2e-14   
ref|XP_009407172.1|  PREDICTED: putative F-box protein PP2-B12 is...  79.0    2e-14   
gb|KDP32800.1|  hypothetical protein JCGZ_12092                       79.0    2e-14   
ref|XP_003590879.1|  F-box protein PP2-B3                             79.0    2e-14   
gb|AFK47906.1|  unknown                                               77.0    2e-14   
ref|XP_006293085.1|  hypothetical protein CARUB_v10019372mg           79.0    2e-14   
ref|NP_178341.1|  F-box protein PP2-B10                               78.6    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KGN60966.1|  hypothetical protein Csa_2G032230                     79.0    2e-14   
ref|XP_004144818.1|  PREDICTED: F-box protein PP2-B15-like            79.0    2e-14   
ref|XP_007029416.1|  Phloem protein 2-B10, putative                   79.0    3e-14   
ref|XP_011031412.1|  PREDICTED: putative F-box protein PP2-B12        78.6    3e-14   
ref|XP_006428540.1|  hypothetical protein CICLE_v10013447mg           78.2    3e-14   
ref|XP_002876813.1|  hypothetical protein ARALYDRAFT_322563           78.6    3e-14   
ref|XP_006395795.1|  hypothetical protein EUTSA_v10005290mg           79.7    3e-14   
ref|XP_009101263.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...  78.2    3e-14   
ref|XP_006480431.1|  PREDICTED: F-box protein At2g02240-like isof...  78.2    3e-14   
ref|XP_010041708.1|  PREDICTED: F-box protein PP2-B11-like            78.2    3e-14   
gb|KDO50517.1|  hypothetical protein CISIN_1g045697mg                 76.3    3e-14   
ref|XP_010026192.1|  PREDICTED: F-box protein PP2-B11-like            78.2    3e-14   
ref|XP_006428593.1|  hypothetical protein CICLE_v10013632mg           78.2    3e-14   
ref|XP_011092102.1|  PREDICTED: F-box protein PP2-B15-like            78.2    3e-14   
ref|XP_008388772.1|  PREDICTED: putative F-box protein PP2-B12        78.2    4e-14   
sp|Q570N1.2|PP2B3_ARATH  RecName: Full=F-box protein PP2-B3; AltN...  75.9    4e-14   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93729.1|  putative phloem-specific lectin                      75.9    4e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006292530.1|  hypothetical protein CARUB_v10018760mg           78.2    4e-14   
ref|XP_007225602.1|  hypothetical protein PRUPE_ppb008326mg           77.8    4e-14   
ref|XP_010911397.1|  PREDICTED: putative F-box protein PP2-B2         75.5    4e-14   
gb|KDO54867.1|  hypothetical protein CISIN_1g023485mg                 77.8    4e-14   
gb|KDP23436.1|  hypothetical protein JCGZ_23269                       77.8    5e-14   
ref|XP_006289125.1|  hypothetical protein CARUB_v10002546mg           77.4    5e-14   
ref|XP_009379703.1|  PREDICTED: putative F-box protein PP2-B12 is...  77.8    5e-14   
ref|XP_003590877.1|  F-box protein PP2-B1                             77.8    5e-14   
ref|XP_008453627.1|  PREDICTED: F-box protein PP2-B10-like            77.8    5e-14   
ref|XP_009337968.1|  PREDICTED: F-box protein At2g02240-like          78.2    5e-14   
ref|NP_001140667.1|  hypothetical protein                             77.8    5e-14   Zea mays [maize]
ref|XP_010425002.1|  PREDICTED: putative F-box protein PP2-B2         77.4    5e-14   
ref|XP_009342988.1|  PREDICTED: F-box protein At2g02240-like          77.8    6e-14   
ref|XP_004495547.1|  PREDICTED: F-box protein PP2-B1-like             77.8    6e-14   
ref|XP_010043038.1|  PREDICTED: F-box protein PP2-B15-like            77.4    6e-14   
ref|XP_009781824.1|  PREDICTED: putative F-box protein PP2-B12 is...  77.4    6e-14   
ref|XP_010518562.1|  PREDICTED: putative F-box protein PP2-B2         77.0    7e-14   
ref|XP_006489770.1|  PREDICTED: F-box protein PP2-B10-like            77.0    7e-14   
gb|KHN46521.1|  Putative F-box protein PP2-B8                         74.7    8e-14   
gb|ACU24047.1|  unknown                                               76.6    8e-14   Glycine max [soybeans]
gb|EPS66496.1|  hypothetical protein M569_08282                       77.0    8e-14   
gb|AFK39520.1|  unknown                                               76.3    8e-14   
ref|XP_003590901.1|  F-box protein PP2-B1                             77.0    8e-14   
ref|XP_006420646.1|  hypothetical protein CICLE_v10006729mg           76.6    9e-14   
ref|XP_004138901.1|  PREDICTED: F-box protein At2g02240-like          77.4    9e-14   
ref|XP_009781822.1|  PREDICTED: putative F-box protein PP2-B12 is...  77.4    9e-14   
ref|XP_009417391.1|  PREDICTED: F-box protein PP2-B10-like            76.6    1e-13   
gb|EYU34847.1|  hypothetical protein MIMGU_mgv1a010720mg              77.0    1e-13   
ref|XP_006292650.1|  hypothetical protein CARUB_v10018893mg           77.0    1e-13   
ref|XP_010043203.1|  PREDICTED: F-box protein PP2-B15-like            76.6    1e-13   
ref|XP_011088096.1|  PREDICTED: F-box protein PP2-B15                 76.6    1e-13   
ref|XP_003521789.1|  PREDICTED: F-box protein PP2-B1                  77.0    1e-13   
ref|XP_006351708.1|  PREDICTED: F-box protein At2g02240-like          77.0    1e-13   
ref|XP_008348882.1|  PREDICTED: F-box protein PP2-B10-like            77.4    1e-13   
ref|XP_009419887.1|  PREDICTED: putative F-box protein PP2-B12        76.6    1e-13   
gb|AAC78510.1|  putative phloem-specific lectin                       76.3    1e-13   
ref|XP_008224591.1|  PREDICTED: putative F-box protein PP2-B12        76.6    1e-13   
ref|XP_008453983.1|  PREDICTED: F-box protein PP2-B13-like            76.6    1e-13   
ref|XP_010026431.1|  PREDICTED: F-box protein PP2-B1-like             76.3    1e-13   
gb|ACJ84267.1|  unknown                                               76.6    1e-13   
gb|KEH33690.1|  phloem protein 2-B13                                  76.3    2e-13   
ref|XP_010502237.1|  PREDICTED: putative F-box protein PP2-B2         76.3    2e-13   
ref|XP_003590868.1|  F-box protein PP2-B1                             76.6    2e-13   
gb|KDO36932.1|  hypothetical protein CISIN_1g0424791mg                74.3    2e-13   
gb|EPS66833.1|  hypothetical protein M569_07943                       75.9    2e-13   
gb|KHN20969.1|  F-box protein PP2-B10                                 75.9    2e-13   
ref|XP_010027241.1|  PREDICTED: F-box protein PP2-B15                 77.8    2e-13   
ref|XP_010514003.1|  PREDICTED: putative F-box protein PP2-B6         74.3    2e-13   
ref|XP_010070125.1|  PREDICTED: F-box protein At2g02240-like          75.1    2e-13   
ref|XP_006582754.1|  PREDICTED: putative F-box protein PP2-B8-like    74.3    2e-13   
ref|XP_011092025.1|  PREDICTED: putative F-box protein PP2-B12        75.9    2e-13   
gb|KFK33435.1|  hypothetical protein AALP_AA5G013300                  75.5    2e-13   
ref|XP_010043037.1|  PREDICTED: F-box protein PP2-B15-like            75.5    2e-13   
ref|XP_009795812.1|  PREDICTED: F-box protein PP2-B15-like            75.5    3e-13   
ref|XP_004955267.1|  PREDICTED: uncharacterized protein LOC101762624  78.2    3e-13   
ref|XP_006582756.1|  PREDICTED: putative F-box protein PP2-B8-like    74.3    3e-13   
emb|CDY65052.1|  BnaC02g47880D                                        77.0    3e-13   
emb|CDY09380.1|  BnaA02g26300D                                        75.9    3e-13   
gb|KDO81771.1|  hypothetical protein CISIN_1g045590mg                 75.5    3e-13   
ref|XP_007143988.1|  hypothetical protein PHAVU_007G119600g           75.5    3e-13   
ref|XP_006395796.1|  hypothetical protein EUTSA_v10005457mg           75.1    3e-13   
gb|ABD28337.1|  Cyclin-like F-box                                     73.6    3e-13   
ref|XP_006489777.1|  PREDICTED: F-box protein At2g02240-like isof...  72.8    3e-13   
emb|CBX24374.1|  hypothetical_protein                                 75.1    3e-13   
ref|XP_006489778.1|  PREDICTED: F-box protein At2g02240-like isof...  72.4    3e-13   
gb|KDO49394.1|  hypothetical protein CISIN_1g046155mg                 72.4    3e-13   
ref|XP_010026300.1|  PREDICTED: F-box protein PP2-B1-like             75.5    3e-13   
ref|NP_001176775.1|  Os12g0131600                                     74.3    3e-13   
ref|XP_006361502.1|  PREDICTED: F-box protein At2g02240-like          75.5    3e-13   
gb|KCW59048.1|  hypothetical protein EUGRSUZ_H01672                   75.1    3e-13   
ref|XP_006431808.1|  hypothetical protein CICLE_v10003407mg           75.5    3e-13   
ref|XP_010425006.1|  PREDICTED: F-box protein PP2-B10-like            73.6    4e-13   
ref|XP_006433472.1|  hypothetical protein CICLE_v10003574mg           77.0    4e-13   
emb|CDY17601.1|  BnaA06g34200D                                        75.1    4e-13   
ref|XP_006472973.1|  PREDICTED: F-box protein PP2-B15-like            77.0    4e-13   
gb|KEH33773.1|  F-box protein PP2-A13                                 74.7    4e-13   
ref|XP_006494544.1|  PREDICTED: putative F-box protein PP2-B2-like    75.1    4e-13   
gb|ADE77925.1|  unknown                                               75.1    5e-13   
ref|XP_009129155.1|  PREDICTED: putative F-box protein PP2-B6 iso...  75.1    5e-13   
gb|ADE76206.1|  unknown                                               75.1    5e-13   
ref|NP_178337.1|  putative F-box protein PP2-B6                       75.1    5e-13   
ref|XP_009129268.1|  PREDICTED: putative F-box protein PP2-B2         75.5    5e-13   
ref|XP_002512603.1|  conserved hypothetical protein                   75.1    5e-13   
ref|XP_006349644.1|  PREDICTED: putative F-box protein PP2-B12-like   75.1    6e-13   
gb|ACJ84585.1|  unknown                                               74.7    6e-13   
ref|XP_008364048.1|  PREDICTED: F-box protein PP2-B10-like            75.1    6e-13   
ref|XP_003591175.1|  F-box protein PP2-B3                             74.3    6e-13   
ref|NP_001242863.1|  uncharacterized protein LOC100795383             74.3    6e-13   
ref|XP_009101266.1|  PREDICTED: F-box protein PP2-B1-like isoform X2  75.1    7e-13   
ref|XP_007205591.1|  hypothetical protein PRUPE_ppa008879mg           74.7    7e-13   
ref|XP_010678582.1|  PREDICTED: putative F-box protein PP2-B12        74.3    7e-13   
gb|EAY82173.1|  hypothetical protein OsI_37373                        72.0    7e-13   
ref|XP_009391276.1|  PREDICTED: F-box protein PP2-B10-like            75.1    7e-13   
ref|XP_003590895.1|  F-box protein PP2-B1                             74.3    8e-13   
ref|XP_003526196.1|  PREDICTED: F-box protein At2g02240-like          73.9    8e-13   
ref|XP_008441744.1|  PREDICTED: F-box protein PP2-B10-like            74.7    8e-13   
ref|XP_008355837.1|  PREDICTED: F-box protein PP2-B10-like            74.7    8e-13   
gb|EMT14591.1|  hypothetical protein F775_17079                       72.4    8e-13   
ref|XP_011036730.1|  PREDICTED: F-box protein At2g02240-like isof...  73.9    9e-13   
ref|XP_008218394.1|  PREDICTED: F-box protein PP2-B10-like            74.7    9e-13   
ref|XP_002308716.1|  hypothetical protein POPTR_0006s28270g           75.1    9e-13   
ref|XP_011036726.1|  PREDICTED: putative F-box protein PP2-B12 is...  74.3    1e-12   
gb|EYU22101.1|  hypothetical protein MIMGU_mgv1a022775mg              73.9    1e-12   
ref|XP_011036729.1|  PREDICTED: putative F-box protein PP2-B12 is...  74.3    1e-12   
ref|XP_002270549.1|  PREDICTED: F-box protein PP2-B1                  74.3    1e-12   
ref|XP_006494556.1|  PREDICTED: putative F-box protein PP2-B2-lik...  75.5    1e-12   
ref|XP_004230266.1|  PREDICTED: F-box protein PP2-B15-like            73.6    1e-12   
gb|KDP23312.1|  hypothetical protein JCGZ_23145                       75.1    1e-12   
gb|ABA96399.2|  F-box domain containing protein, expressed            73.9    1e-12   
ref|XP_009391287.1|  PREDICTED: F-box protein PP2-B1-like             73.9    1e-12   
ref|XP_006420857.1|  hypothetical protein CICLE_v10005646mg           73.6    1e-12   
gb|KDO40885.1|  hypothetical protein CISIN_1g041394mg                 73.6    1e-12   
ref|XP_008245587.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...  73.9    1e-12   
gb|KHN28107.1|  Putative F-box protein PP2-B8-like protein            73.9    1e-12   
ref|XP_009129153.1|  PREDICTED: F-box protein PP2-B10-like            73.6    1e-12   
ref|XP_009129154.1|  PREDICTED: putative F-box protein PP2-B6 iso...  73.6    1e-12   
emb|CDY09375.1|  BnaA02g26350D                                        73.6    1e-12   
ref|XP_006494550.1|  PREDICTED: putative F-box protein PP2-B2-lik...  75.1    2e-12   
ref|XP_010430006.1|  PREDICTED: F-box protein PP2-B11-like            73.2    2e-12   
ref|XP_006413968.1|  hypothetical protein EUTSA_v10026793mg           74.3    2e-12   
ref|XP_006494554.1|  PREDICTED: putative F-box protein PP2-B2-lik...  75.1    2e-12   
ref|XP_006494548.1|  PREDICTED: putative F-box protein PP2-B2-lik...  75.1    2e-12   
ref|XP_004304879.1|  PREDICTED: F-box protein PP2-B15-like            73.2    2e-12   
ref|XP_006494553.1|  PREDICTED: putative F-box protein PP2-B2-lik...  74.7    2e-12   
ref|XP_006494545.1|  PREDICTED: putative F-box protein PP2-B2-lik...  75.1    2e-12   
ref|XP_006494551.1|  PREDICTED: putative F-box protein PP2-B2-lik...  74.7    2e-12   
ref|XP_006494552.1|  PREDICTED: putative F-box protein PP2-B2-lik...  74.7    2e-12   
ref|XP_002297813.1|  hypothetical protein POPTR_0001s14470g           72.8    2e-12   
gb|KHG10781.1|  F-box PP2-B11 -like protein                           72.8    2e-12   
ref|XP_009596287.1|  PREDICTED: F-box protein PP2-B13-like            73.2    2e-12   
ref|XP_006361490.1|  PREDICTED: F-box protein PP2-B1-like             73.6    2e-12   
ref|XP_002318973.2|  SKP1 interacting partner 3-related family pr...  72.8    2e-12   
ref|XP_011023725.1|  PREDICTED: F-box protein PP2-B15-like            72.8    2e-12   
ref|XP_007208595.1|  hypothetical protein PRUPE_ppa022668mg           72.8    2e-12   
ref|XP_007223592.1|  hypothetical protein PRUPE_ppa012404mg           71.6    3e-12   
ref|XP_006344702.1|  PREDICTED: F-box protein PP2-B15-like            72.4    3e-12   
ref|XP_003590893.1|  F-box protein PP2-B1                             72.8    3e-12   
ref|XP_006368903.1|  hypothetical protein POPTR_0001s14470g           72.4    3e-12   
ref|XP_002297814.2|  hypothetical protein POPTR_0001s14470g           72.4    3e-12   
ref|XP_006420632.1|  hypothetical protein CICLE_v10006747mg           72.4    3e-12   
emb|CDY17605.1|  BnaA06g34240D                                        72.8    3e-12   
gb|AFK47300.1|  unknown                                               72.0    3e-12   
ref|XP_006489773.1|  PREDICTED: F-box protein PP2-B10-like            72.4    3e-12   
ref|XP_009337962.1|  PREDICTED: putative F-box protein PP2-B12        72.4    4e-12   
ref|XP_006420633.1|  hypothetical protein CICLE_v10006558mg           72.0    4e-12   
ref|XP_009337949.1|  PREDICTED: F-box protein PP2-B10-like            72.8    4e-12   
ref|XP_010425008.1|  PREDICTED: putative F-box protein PP2-B6         72.4    4e-12   
ref|NP_001066067.1|  Os12g0129700                                     73.2    4e-12   
ref|XP_006493713.1|  PREDICTED: F-box protein At2g02240-like          70.9    4e-12   
ref|XP_007034421.1|  F-box family protein                             72.0    4e-12   
ref|XP_009101265.1|  PREDICTED: F-box protein PP2-B1-like isoform X1  72.8    4e-12   
ref|XP_010425001.1|  PREDICTED: putative F-box protein PP2-B6         72.0    4e-12   
ref|XP_011034480.1|  PREDICTED: F-box protein PP2-B10-like            71.6    5e-12   
emb|CDY03062.1|  BnaC07g21650D                                        72.4    5e-12   
ref|XP_004249952.2|  PREDICTED: putative F-box protein PP2-B12 is...  72.0    5e-12   
gb|AFK38779.1|  unknown                                               72.0    5e-12   
emb|CDY03059.1|  BnaC07g21680D                                        72.4    5e-12   
ref|XP_010514005.1|  PREDICTED: putative F-box protein PP2-B8         72.0    5e-12   
gb|ACN40875.1|  unknown                                               71.6    6e-12   
gb|KCW59023.1|  hypothetical protein EUGRSUZ_H01650                   70.9    6e-12   
ref|NP_178339.1|  phloem protein 2-B8                                 72.0    6e-12   
ref|XP_008345775.1|  PREDICTED: putative F-box protein PP2-B2         73.2    6e-12   
gb|KDO49395.1|  hypothetical protein CISIN_1g031412mg                 70.5    6e-12   
ref|XP_008370781.1|  PREDICTED: putative F-box protein PP2-B12        72.0    7e-12   
gb|AES61123.2|  phloem protein 2-B11                                  71.2    7e-12   
gb|KEH42965.1|  hypothetical protein MTR_1g078460                     70.1    7e-12   
ref|XP_002512467.1|  conserved hypothetical protein                   71.6    7e-12   
ref|XP_004248894.1|  PREDICTED: putative F-box protein PP2-B12        71.2    7e-12   
ref|XP_002324348.1|  F-box family protein                             71.6    8e-12   
ref|XP_010521507.1|  PREDICTED: F-box protein PP2-B11-like            70.9    9e-12   
emb|CDY03060.1|  BnaC07g21670D                                        71.6    1e-11   
ref|XP_008359910.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...  72.0    1e-11   
ref|XP_006494515.1|  PREDICTED: F-box protein At2g02240-like          70.1    1e-11   
ref|XP_007226015.1|  hypothetical protein PRUPE_ppa010122mg           70.9    1e-11   
ref|XP_010472988.1|  PREDICTED: F-box protein PP2-B11-like isofor...  70.9    1e-11   
gb|EAZ05585.1|  hypothetical protein OsI_27801                        71.2    1e-11   
ref|XP_006420855.1|  hypothetical protein CICLE_v10005670mg           70.9    1e-11   
ref|XP_003590874.1|  F-box protein PP2-B1                             70.9    1e-11   
gb|KFK42414.1|  hypothetical protein AALP_AA2G253100                  70.9    1e-11   
ref|XP_003572934.1|  PREDICTED: putative F-box protein PP2-B12        71.6    1e-11   
ref|XP_003590872.1|  F-box protein PP2-B1                             71.6    1e-11   
ref|XP_009342987.1|  PREDICTED: putative F-box protein PP2-B12        71.6    1e-11   
gb|AAC24090.1|  Contains similarity to phloem-specific lectin PP2...  70.9    1e-11   
ref|NP_563837.1|  phloem protein 2-B15                                70.9    1e-11   
gb|AAM64609.1|  phloem-specific lectin PP2-like protein               70.9    1e-11   
gb|KEH32832.1|  phloem protein 2-B5                                   71.2    1e-11   
ref|XP_010514004.1|  PREDICTED: putative F-box protein PP2-B8         71.2    1e-11   
emb|CBH32664.1|  F-box domain containing protein                      70.9    1e-11   
gb|EAZ19540.1|  hypothetical protein OsJ_35108                        71.2    1e-11   
ref|NP_001060994.1|  Os08g0150700                                     70.9    1e-11   
ref|XP_003590936.1|  F-box protein PP2-B3                             70.5    1e-11   
ref|XP_008224590.1|  PREDICTED: putative F-box protein PP2-B12 is...  70.1    2e-11   
ref|XP_009106768.1|  PREDICTED: F-box protein PP2-B11                 70.1    2e-11   
ref|XP_008224589.1|  PREDICTED: putative F-box protein PP2-B12 is...  70.5    2e-11   
ref|XP_009410733.1|  PREDICTED: putative F-box protein PP2-B12        70.5    2e-11   
ref|XP_007034420.1|  F-box family protein                             70.1    2e-11   
ref|XP_011091189.1|  PREDICTED: putative F-box protein PP2-B12        70.5    2e-11   
gb|EMT27134.1|  hypothetical protein F775_14212                       70.5    2e-11   
ref|XP_006606934.1|  PREDICTED: F-box protein At2g02240-like          70.5    2e-11   
gb|KDO39392.1|  hypothetical protein CISIN_1g042480mg                 69.7    2e-11   
ref|XP_007034411.1|  F-box family protein, putative                   70.1    2e-11   
gb|ACU23045.1|  unknown                                               69.7    2e-11   
emb|CDY39994.1|  BnaC06g40720D                                        70.1    2e-11   
ref|XP_002513764.1|  conserved hypothetical protein                   70.5    2e-11   
ref|XP_008224592.1|  PREDICTED: putative F-box protein PP2-B12        70.1    2e-11   
ref|XP_006433473.1|  hypothetical protein CICLE_v10003623mg           68.9    2e-11   
ref|NP_197844.1|  phloem protein 2-B12                                69.7    2e-11   
ref|XP_008370772.1|  PREDICTED: putative F-box protein PP2-B12        70.9    2e-11   
gb|ADE77144.1|  unknown                                               70.1    2e-11   
gb|AGH13618.1|  F-box protein PP2                                     69.7    2e-11   
ref|XP_004494572.1|  PREDICTED: F-box protein PP2-B15-like            69.7    2e-11   
ref|XP_003605073.1|  F-box protein PP2-B14                            69.3    2e-11   
ref|XP_004495549.1|  PREDICTED: F-box protein At2g02240-like          69.7    2e-11   
ref|XP_009416055.1|  PREDICTED: F-box protein PP2-B11-like            70.1    3e-11   
ref|XP_004289213.1|  PREDICTED: F-box protein PP2-B11-like            70.9    3e-11   
ref|XP_006431781.1|  hypothetical protein CICLE_v10002065mg           69.7    3e-11   
ref|XP_010458187.1|  PREDICTED: F-box protein PP2-B15-like            67.8    4e-11   
ref|XP_010514001.1|  PREDICTED: putative F-box protein PP2-B6         69.7    4e-11   
ref|XP_003521677.2|  PREDICTED: F-box protein PP2-B15-like            69.3    4e-11   
ref|XP_010417748.1|  PREDICTED: F-box protein PP2-B11-like            68.9    4e-11   
ref|XP_006302687.1|  hypothetical protein CARUB_v10020797mg           69.3    4e-11   
gb|KHN03957.1|  F-box protein PP2-B15                                 69.3    4e-11   
emb|CBI38321.3|  unnamed protein product                              68.2    5e-11   
gb|KFK33434.1|  hypothetical protein AALP_AA5G013000                  70.9    5e-11   
ref|XP_006431791.1|  hypothetical protein CICLE_v10003100mg           68.9    5e-11   
ref|XP_008803652.1|  PREDICTED: F-box protein PP2-B3-like             67.4    6e-11   
ref|XP_006428542.1|  hypothetical protein CICLE_v100122622mg          65.9    6e-11   
ref|XP_009795811.1|  PREDICTED: F-box protein PP2-B15-like            68.6    6e-11   
ref|XP_006495205.1|  PREDICTED: F-box protein PP2-B10-like            68.6    7e-11   
ref|XP_006420629.1|  hypothetical protein CICLE_v10005650mg           68.6    7e-11   
gb|EMS58370.1|  hypothetical protein TRIUR3_16487                     68.2    7e-11   
dbj|BAK01166.1|  predicted protein                                    68.9    7e-11   
gb|EMS54880.1|  Putative F-box protein PP2-B8                         68.9    7e-11   
ref|XP_010502246.1|  PREDICTED: putative F-box protein PP2-B8         68.9    8e-11   
gb|KDO49390.1|  hypothetical protein CISIN_1g036980mg                 67.8    8e-11   
ref|XP_004494571.1|  PREDICTED: F-box protein PP2-B15-like            68.6    8e-11   
ref|XP_002892485.1|  phloem protein 2-B15                             68.6    9e-11   
emb|CDY17602.1|  BnaA06g34210D                                        68.6    1e-10   
ref|XP_010109050.1|  F-box protein                                    68.2    1e-10   
ref|XP_009596288.1|  PREDICTED: F-box protein PP2-B15-like            69.3    1e-10   
gb|ADE77718.1|  unknown                                               68.2    1e-10   
ref|XP_006472974.1|  PREDICTED: F-box protein PP2-B15-like            65.9    1e-10   
gb|ADE77312.1|  unknown                                               68.6    1e-10   
ref|XP_010472538.1|  PREDICTED: F-box protein PP2-B11-like            67.8    1e-10   



>ref|XP_009608696.1| PREDICTED: F-box protein PP2-B10-like [Nicotiana tomentosiformis]
Length=267

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD+F  LPEG +SDIIS TS  DAA  S ISR FK+A+ESD++W +FLP D   I+ +S 
Sbjct  1    MDYFGLLPEGCVSDIISFTSPKDAAISSAISRGFKSASESDTIWEKFLPSDYQHIISKSD  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
            S +VFS+ KELYF+LC+SP+L+ DG KL F
Sbjct  61   SQLVFSSKKELYFSLCDSPVLV-DGGKLSF  89



>ref|XP_010241135.1| PREDICTED: putative F-box protein PP2-B12 isoform X1 [Nelumbo 
nucifera]
Length=300

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            +DF+A LPEG ISDIISLTS  DA R S +S VF++ AESD VW RFLP D  +IL RS 
Sbjct  12   VDFYA-LPEGCISDIISLTSPRDACRSSAVSLVFRSVAESDVVWERFLPSDYKEILSRSD  70

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSK  398
            SP++FS+ K L+F LC+ PIL+D+G+K
Sbjct  71   SPLLFSSKKHLFFHLCHHPILIDNGNK  97



>gb|EYU32653.1| hypothetical protein MIMGU_mgv1a024376mg, partial [Erythranthe 
guttata]
Length=174

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 69/96 (72%), Gaps = 1/96 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD FA LPEG IS+I+SLTSA+DA R S++S+ FK+AAE D VWGRFLP D  +I+  S 
Sbjct  1    MDCFARLPEGCISEIVSLTSALDATRASILSKQFKSAAECDYVWGRFLPPDYREIISTSV  60

Query  318  SPVVFSNM-KELYFTLCNSPILLDDGSKLRFVKMYG  422
            SP++  +  K+LYF+LC+SPIL++    L   K  G
Sbjct  61   SPLLKCDTKKDLYFSLCDSPILINGAKMLLLDKRNG  96



>ref|XP_006360349.1| PREDICTED: F-box protein At2g02240-like isoform X1 [Solanum tuberosum]
Length=234

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            M+ F  LPEG IS+IIS T+ VD  R SVISR FKAAAESD VW +FLP D  +I+ RS 
Sbjct  1    MNPFTMLPEGCISEIISFTTPVDTIRSSVISRGFKAAAESDIVWDKFLPSDHQNIVSRSV  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
            SP++F N ++LYF L  SPILLD+G    F
Sbjct  61   SPILFDNKEDLYFRLSESPILLDEGKMQSF  90



>gb|EYU32655.1| hypothetical protein MIMGU_mgv1a025781mg [Erythranthe guttata]
Length=256

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD FA LPEG IS+I+SLTSA+DA R S++S+ FK+AAE D VWGRFLP D  +I+  S 
Sbjct  1    MDCFARLPEGCISEILSLTSALDATRASILSKQFKSAAEGDYVWGRFLPPDYREIISTSV  60

Query  318  SPVVFSNM-KELYFTLCNSPILLDDGSKLRF  407
            SP++  +  K+LYF+LC+SPIL+ +G+K+ F
Sbjct  61   SPLLKCDTKKDLYFSLCDSPILI-NGAKMSF  90



>ref|XP_006360350.1| PREDICTED: F-box protein At2g02240-like isoform X2 [Solanum tuberosum]
Length=233

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 75/128 (59%), Gaps = 9/128 (7%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            M+ F  LPEG IS+IIS T+ VD  R SVISR FKAAAESD VW +FLP D  +I+ RS 
Sbjct  1    MNPFTMLPEGCISEIISFTTPVDTIRSSVISRGFKAAAESDIVWDKFLPSDHQNIVSRSV  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLYTCNEASFTCYGGIFLSDLLF  497
            SP++F N ++LYF L  SPILLD+G    ++      K Y  +    T    I  SD   
Sbjct  61   SPILFDNKEDLYFRLSESPILLDEGKMSFWLDKTNGKKCYLLSSRQLT----ISFSDT--  114

Query  498  V*RNFFWE  521
                 FWE
Sbjct  115  ---ELFWE  119



>ref|XP_010241131.1| PREDICTED: putative F-box protein PP2-B12 [Nelumbo nucifera]
Length=316

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 66/95 (69%), Gaps = 3/95 (3%)
 Frame = +3

Query  114  GSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDL  293
            GS    VG   F +LPEG IS+IISLTS  DA R  V+S  F++AA+SD+VW RFLP D 
Sbjct  21   GSSSTTVG---FYALPEGCISNIISLTSPQDACRSLVVSSEFRSAADSDAVWERFLPSDY  77

Query  294  SDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
             DIL RS S V F + K+LYF LC+ PIL+DDG K
Sbjct  78   RDILSRSASAVDFPSKKDLYFHLCDHPILIDDGQK  112



>ref|XP_010264073.1| PREDICTED: F-box protein PP2-B10-like [Nelumbo nucifera]
Length=322

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F+ LPEG IS+IISLTS  DA RLS +S VF++A +SDSVW RFLP D  +IL RS SP+
Sbjct  18   FSVLPEGCISNIISLTSPRDACRLSAVSSVFRSAVDSDSVWERFLPSDYQEILSRSVSPI  77

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             FS+ K+LYF L + PI++D G+K
Sbjct  78   AFSSKKDLYFYLTDHPIIIDGGNK  101



>ref|XP_010241130.1| PREDICTED: putative F-box protein PP2-B12 isoform X2 [Nelumbo 
nucifera]
Length=283

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F +LPEG IS+IISLTS  DA R  V+S  F++AA+SD+VW RFLP D  DIL RS S V
Sbjct  12   FYALPEGCISNIISLTSPQDACRSLVVSSEFRSAADSDAVWERFLPSDYRDILSRSVSAV  71

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             F + K+LYF LC+ PIL+DDG K
Sbjct  72   DFPSKKDLYFHLCDHPILIDDGQK  95



>ref|XP_010241129.1| PREDICTED: putative F-box protein PP2-B12 isoform X1 [Nelumbo 
nucifera]
Length=302

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F +LPEG IS+IISLTS  DA R  V+S  F++AA+SD+VW RFLP D  DIL RS S V
Sbjct  12   FYALPEGCISNIISLTSPQDACRSLVVSSEFRSAADSDAVWERFLPSDYRDILSRSVSAV  71

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             F + K+LYF LC+ PIL+DDG K
Sbjct  72   DFPSKKDLYFHLCDHPILIDDGQK  95



>ref|XP_009780353.1| PREDICTED: F-box protein At2g02240-like [Nicotiana sylvestris]
Length=267

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD+F  LPEG +SDIIS +S  DAA  S ISR FK+A+ESD++W +FLP D   I+ +S 
Sbjct  1    MDYFGLLPEGCVSDIISFSSPKDAAISSAISRGFKSASESDTIWEKFLPSDFQHIISKSD  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
            S ++FS+ K LYF LC+SP+L+ DG KL F
Sbjct  61   SQLLFSSKKVLYFCLCDSPLLI-DGGKLSF  89



>ref|XP_009757437.1| PREDICTED: F-box protein PP2-B10-like [Nicotiana sylvestris]
Length=302

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD+F+ LPEG IS+I+S TS  DAA  S ISR FK+AAESD VW +FLP D   I+ +S 
Sbjct  1    MDYFSLLPEGCISEILSFTSPKDAATSSAISRGFKSAAESDVVWEKFLPSDYQHIISKSD  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
            S +V  + KELYF+LC+SPIL+ DG KL F
Sbjct  61   SLLVSPSKKELYFSLCDSPILI-DGGKLSF  89



>emb|CDO99431.1| unnamed protein product [Coffea canephora]
Length=268

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            FA LPEG IS+I+SLTS VD  R SV+S+ FK AA+SD++W +FLP D  DI+ RS S V
Sbjct  5    FARLPEGFISEILSLTSPVDVIRASVVSKGFKPAADSDTIWEKFLPSDYQDIISRSDSAV  64

Query  327  VFSNMKELYFTLCNSPILLDDG  392
              S  K LYF+LC+SP+LLD G
Sbjct  65   DCSTKKALYFSLCDSPLLLDGG  86



>ref|XP_004252380.2| PREDICTED: F-box protein PP2-B10 [Solanum lycopersicum]
Length=273

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MDFF  LPEG +SDI+  TS  DAA  S +SR F +A ESD +WG+FLP D  DI  R  
Sbjct  12   MDFFRLLPEGCVSDILFFTSPKDAAISSAVSRGFNSATESDLLWGKFLPDDYEDISSRYV  71

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
            SP + S+ KELYF+LC+SP+L+ DG KL F
Sbjct  72   SPRICSSKKELYFSLCDSPVLM-DGGKLSF  100



>ref|XP_009608697.1| PREDICTED: F-box protein PP2-B10-like [Nicotiana tomentosiformis]
Length=298

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 64/91 (70%), Gaps = 1/91 (1%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
             MD+F  LPEG IS+I+S TS  DA   S ISR FK+AAESD VW +FLP D   I+ +S
Sbjct  15   AMDYFRLLPEGCISEILSFTSPKDAVSSSAISRGFKSAAESDVVWEKFLPSDYQHIISKS  74

Query  315  RSPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
             S +V S+ KELYF+LC+SPIL  DG KL F
Sbjct  75   DSLLVSSSKKELYFSLCDSPILT-DGGKLSF  104



>ref|XP_009763471.1| PREDICTED: F-box protein PP2-B3-like [Nicotiana sylvestris]
Length=155

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 61/90 (68%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            M++F  LPEG I +I+S T+ VDA R  ++SR FK A ES+ +W RFLP D  +I+ RS 
Sbjct  1    MNYFQRLPEGCILEILSRTTPVDAVRSCILSRGFKTALESEIIWERFLPSDYQEIIERSE  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
             P V +  KELYF+LC  PILL DG KL F
Sbjct  61   FPSVCTTKKELYFSLCEYPILL-DGGKLSF  89



>ref|XP_009757438.1| PREDICTED: F-box protein PP2-B10-like isoform X1 [Nicotiana sylvestris]
Length=261

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD+F+ LPEG IS+I+S TS  DAA  S ISR FK+AAESD VW +FLP D   I+ +S 
Sbjct  1    MDYFSLLPEGCISEILSFTSPKDAATSSAISRGFKSAAESDVVWEKFLPSDYQHIISKSD  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
            S +V  + KELYF+LC+SP L  DG KL F
Sbjct  61   SLLVSPSKKELYFSLCDSPFLT-DGGKLSF  89



>ref|XP_009757439.1| PREDICTED: F-box protein PP2-B10-like isoform X2 [Nicotiana sylvestris]
Length=255

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD+F+ LPEG IS+I+S TS  DAA  S ISR FK+AAESD VW +FLP D   I+ +S 
Sbjct  1    MDYFSLLPEGCISEILSFTSPKDAATSSAISRGFKSAAESDVVWEKFLPSDYQHIISKSD  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDG  392
            S +V  + KELYF+LC+SP L D G
Sbjct  61   SLLVSPSKKELYFSLCDSPFLTDGG  85



>ref|XP_008453630.1| PREDICTED: F-box protein PP2-B10-like [Cucumis melo]
Length=293

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%), Gaps = 7/90 (8%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR---  317
            F+ LPEG+I++I+SLT+ +DA R S +SR F AAA+SD VW RFLP DL D + RS+   
Sbjct  10   FSFLPEGVIANILSLTTPLDACRSSAVSRAFHAAAQSDIVWDRFLPNDLDDFICRSKPGG  69

Query  318  ---SPVVFSNMKELYFTLCNSPILLDDGSK  398
                P+  S  KE++F+LCNSP+L+DD  K
Sbjct  70   LNFDPITCSK-KEIFFSLCNSPLLIDDAKK  98



>ref|XP_002513763.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48346.1| conserved hypothetical protein [Ricinus communis]
Length=301

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 65/98 (66%), Gaps = 3/98 (3%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVV-  329
            SLPEG I+D++S T   DA RLS +S  F+ AA SD+VW +FLPQD   I+ RS    + 
Sbjct  14   SLPEGCIADVVSFTGPFDACRLSTVSSTFRDAANSDTVWEKFLPQDYHSIISRSSDSFLL  73

Query  330  --FSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
              FS+ K+LYF+LC++PIL+DDG K   ++ +   K Y
Sbjct  74   DRFSSKKQLYFSLCDNPILIDDGKKSFALEKWSGKKCY  111



>ref|XP_006366161.1| PREDICTED: F-box protein PP2-B10-like [Solanum tuberosum]
Length=264

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MDF   LPEG +SDI+S TS  DAA  S ISR F +AAESD +W +FLP+D  DI  R  
Sbjct  1    MDFIRLLPEGCVSDILSFTSPKDAAISSAISRGFNSAAESDLLWEKFLPEDYEDISSRYV  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
            S  + S+ KELYF+LC+SP+L+ DG +L F
Sbjct  61   SQRICSSKKELYFSLCDSPVLM-DGGRLSF  89



>ref|XP_006349935.1| PREDICTED: F-box protein PP2-B10-like [Solanum tuberosum]
Length=261

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 64/90 (71%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD+F  +PE  +S+I+S TS  D ARLS  SR F +AAESD VW +FLP D  +I+ +S+
Sbjct  1    MDYFGLMPEDCLSEILSFTSPEDTARLSTSSRGFNSAAESDVVWEKFLPSDYQNIISKSK  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
            S +   +MK+LYF+LC+SPIL  DG K+ F
Sbjct  61   SLLASPSMKQLYFSLCDSPILT-DGGKMSF  89



>emb|CBI38318.3| unnamed protein product [Vitis vinifera]
Length=287

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 71/112 (63%), Gaps = 3/112 (3%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR---SR  317
            F+SLPEG I+D+++LTS  D  R+S ++ VF +AAESD++W RFLP D  +I+ R   S 
Sbjct  20   FSSLPEGCIADVLALTSPRDVCRMSAVASVFLSAAESDALWERFLPADYREIIARSSESS  79

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLYTCNEASFTCYGG  473
            S   FS+ KELYFTLC+ P+L+D+G K  +++     K Y       T   G
Sbjct  80   SWRHFSSKKELYFTLCDYPLLIDEGKKSFWLEKRSGKKCYMLASRELTIIWG  131



>ref|XP_009379693.1| PREDICTED: F-box protein PP2-B10-like [Pyrus x bretschneideri]
Length=280

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 66/103 (64%), Gaps = 7/103 (7%)
 Frame = +3

Query  129  RVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILL  308
             V MD  A LPEG I++++SLT+  DA R S +SR F +AAESD+VW +FLP D+  IL 
Sbjct  13   HVHMDLQA-LPEGCIANVVSLTTPPDACRFSAVSRSFMSAAESDAVWDKFLPHDIPSILP  71

Query  309  RSRSPVVFSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
                   FS+ KELY TLC +P+LL+DG  + F+  +   K Y
Sbjct  72   H------FSSKKELYLTLCENPVLLEDGKMMFFLDKWSGKKCY  108



>ref|XP_002270048.1| PREDICTED: F-box protein PP2-B10 [Vitis vinifera]
Length=349

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 71/112 (63%), Gaps = 3/112 (3%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR---SR  317
            F+SLPEG I+D+++LTS  D  R+S ++ VF +AAESD++W RFLP D  +I+ R   S 
Sbjct  20   FSSLPEGCIADVLALTSPRDVCRMSAVASVFLSAAESDALWERFLPADYREIIARSSESS  79

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLYTCNEASFTCYGG  473
            S   FS+ KELYFTLC+ P+L+D+G K  +++     K Y       T   G
Sbjct  80   SWRHFSSKKELYFTLCDYPLLIDEGKKSFWLEKRSGKKCYMLASRELTIIWG  131



>ref|XP_010502236.1| PREDICTED: putative F-box protein PP2-B2 [Camelina sativa]
Length=285

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 66/102 (65%), Gaps = 3/102 (3%)
 Frame = +3

Query  108  NGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQ  287
            NGG   I  G   F  LPE  IS+IIS TS  DA   + +S+ F++A +SDSVW +FLP 
Sbjct  11   NGGGVAIVSGPSPFDDLPEDCISNIISFTSPRDACVAATVSKTFESAVQSDSVWDKFLPS  70

Query  288  DLSDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSKLRFVK  413
            D   ++  SR   VFS+ KELYF LC++PIL+DDG K  +++
Sbjct  71   DYPSLVPPSR---VFSSKKELYFALCDNPILIDDGKKSSWLE  109



>ref|XP_004253004.1| PREDICTED: putative F-box protein PP2-B12 [Solanum lycopersicum]
Length=261

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 63/90 (70%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD+F  +PE  +S+I+S TS  D ARLS  SR F  AAESD VW +FLP D  +I+ +S+
Sbjct  1    MDYFGLMPEDCLSEILSFTSPEDTARLSTSSRGFNFAAESDVVWEKFLPSDYQNIISKSK  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
            S +   +MK+LYF+LC+SPIL  DG K+ F
Sbjct  61   SLMASPSMKQLYFSLCDSPILT-DGGKMSF  89



>ref|XP_006355999.1| PREDICTED: F-box protein SKIP3-like [Solanum tuberosum]
Length=98

 Score = 90.5 bits (223),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD+F SL EG   +IIS T++ DA R  ++S+ FK  AE D +W RFLP+D  +I+ RS 
Sbjct  10   MDYFESLSEGCKFEIISKTTSTDAVRSIILSKGFKFVAELDEIWRRFLPRDYQEIIDRSE  69

Query  318  SPVVFSNMKELYFTLCNSPILLDDG  392
             P+V +  KEL+F LC+SPILLD G
Sbjct  70   FPLVCNTKKELFFRLCDSPILLDGG  94



>ref|XP_010518559.1| PREDICTED: putative F-box protein PP2-B2 [Camelina sativa]
Length=285

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 68/106 (64%), Gaps = 4/106 (4%)
 Frame = +3

Query  108  NGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQ  287
            NGG   I      F  LPE  IS+IIS TS  DA   + +S+ F++A +SDSVW +FLP 
Sbjct  11   NGGRVAIVSRPSPFDDLPEDCISNIISFTSPRDACVAATVSKTFESAVQSDSVWDKFLPS  70

Query  288  DLSDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSKLRFV-KMYG  422
            D S ++  SR   VFS+ KELYF LC++PIL+DDG K  ++ K YG
Sbjct  71   DFSSLVPPSR---VFSSKKELYFALCDNPILIDDGKKSSWLEKGYG  113



>ref|XP_004288834.1| PREDICTED: F-box protein At2g02240-like [Fragaria vesca subsp. 
vesca]
Length=265

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG IS +ISLTS  DA RLS++SRV K+AAESD+VW +F+P D   IL +S S     
Sbjct  33   LPEGCISHVISLTSPPDACRLSLLSRVIKSAAESDAVWDKFIPPDTHAILSQSNSLPFSK  92

Query  336  NMKELYFTLCNSPILLDDGS  395
            + KELY TLC++P+L++DG+
Sbjct  93   SKKELYMTLCDNPVLIEDGN  112



>ref|XP_009608698.1| PREDICTED: F-box protein PP2-B10-like [Nicotiana tomentosiformis]
Length=261

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD+F  LPEG IS+I+S TS  DAA  S IS  FK+AAESD VW +FLP D   I+  S 
Sbjct  1    MDYFRLLPEGCISEILSFTSPKDAASSSAISLGFKSAAESDVVWEKFLPSDYQHIISSSN  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDG  392
            S +V  + KELYF+LC+SPIL D G
Sbjct  61   SFLVSPSKKELYFSLCDSPILTDGG  85



>ref|XP_004169477.1| PREDICTED: F-box protein PP2-B10-like [Cucumis sativus]
 gb|KGN65430.1| hypothetical protein Csa_1G421900 [Cucumis sativus]
Length=293

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 66/96 (69%), Gaps = 7/96 (7%)
 Frame = +3

Query  129  RVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILL  308
            + G   F+SLPEG+I++I+SLT+ +D  R S +SR F AAA+SD VW  FLP DL D + 
Sbjct  4    KEGRTHFSSLPEGVIANILSLTTPLDVCRSSAVSRAFHAAAQSDIVWDTFLPNDLDDFIS  63

Query  309  RSR------SPVVFSNMKELYFTLCNSPILLDDGSK  398
            RS+       P+  S+ KE++F+LCNSP+L+D+  K
Sbjct  64   RSKPGGLNFDPIT-SSKKEIFFSLCNSPLLIDNAKK  98



>ref|XP_010935983.1| PREDICTED: putative F-box protein PP2-B12 [Elaeis guineensis]
 ref|XP_010935984.1| PREDICTED: putative F-box protein PP2-B12 [Elaeis guineensis]
Length=290

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/92 (53%), Positives = 62/92 (67%), Gaps = 2/92 (2%)
 Frame = +3

Query  132  VGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR  311
             G     +LPEG ISD+ISLTS VDA R + +   F++AA SD+VW RFLP D   IL R
Sbjct  3    TGCGDICALPEGCISDVISLTSPVDACRSAAVCTTFRSAAVSDTVWERFLPPDYRSILSR  62

Query  312  SRSPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
            +  PV +S+ KEL+F LC S IL+DDG K+ F
Sbjct  63   AVQPVEYSSKKELFFRLCES-ILIDDG-KMSF  92



>ref|XP_011073773.1| PREDICTED: F-box protein At2g02240-like [Sesamum indicum]
Length=251

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 64/91 (70%), Gaps = 1/91 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            M+ F  LPE  IS+I+S TSA+DA+R S++S+ F++AA +D VW RFLP D  DI+  S 
Sbjct  1    MEGFGRLPEECISEIMSYTSALDASRSSILSKEFRSAASNDVVWDRFLPPDYEDIVSASV  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRFV  410
            SPV +   K+LY +LC+ PIL+ +G K+ F 
Sbjct  61   SPVTYDTKKQLYLSLCDYPILI-NGGKMSFC  90



>ref|XP_010935988.1| PREDICTED: F-box protein At2g02240-like isoform X2 [Elaeis guineensis]
Length=141

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 61/92 (66%), Gaps = 2/92 (2%)
 Frame = +3

Query  132  VGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR  311
             G     +LPEG IS +ISLTS VD+ R + +   F++AA SD+VW RFLP D   IL R
Sbjct  3    TGCGDICTLPEGCISHVISLTSPVDSCRSAAVCTTFRSAAVSDTVWERFLPPDYRSILER  62

Query  312  SRSPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
            +  PV +S+ KEL+F LC  PIL+DDG K+ F
Sbjct  63   AVRPVEYSSKKELFFRLCE-PILIDDG-KMSF  92



>ref|XP_008453629.1| PREDICTED: F-box protein PP2-B10-like [Cucumis melo]
Length=293

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 66/89 (74%), Gaps = 7/89 (8%)
 Frame = +3

Query  150  ASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR----  317
            +SLPEG+I++I+SLT+ +DA R S +S VF AAA+SD VW RFLP DL D++ RS+    
Sbjct  11   SSLPEGVIANILSLTTPLDACRSSAVSWVFHAAAQSDIVWDRFLPNDLDDLISRSKPGGL  70

Query  318  --SPVVFSNMKELYFTLCNSPILLDDGSK  398
               P+  S+ KE++F+LCNSP+L+D+  K
Sbjct  71   NFDPIT-SSKKEIFFSLCNSPLLIDNAKK  98



>ref|XP_010264146.1| PREDICTED: putative F-box protein PP2-B12 [Nelumbo nucifera]
Length=321

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LP   IS IIS TS ++A R S +S +F++AA+SDSVW +FLP D  +IL RS S V
Sbjct  17   FNVLPLECISKIISFTSPLEACRSSAVSLIFRSAADSDSVWEKFLPSDYKNILSRSVSSV  76

Query  327  VFSNMKELYFTLCNSPILLDDG  392
             FS+ KELYF LC+ PIL+DDG
Sbjct  77   DFSSKKELYFRLCDDPILIDDG  98



>gb|EYU32966.1| hypothetical protein MIMGU_mgv1a019579mg [Erythranthe guttata]
Length=290

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F+ LPEG I++I+S TS  DA R + +S + K+AAESD+VW RFLP D  +I+  S SPV
Sbjct  11   FSLLPEGCIANIVSFTSPKDACRAAAVSLLVKSAAESDTVWERFLPPDYGEIVSGSNSPV  70

Query  327  -VFSNMKELYFTLCNSPILLDDGSKLRF  407
              +S  KELYF LC SP+LL DG KL F
Sbjct  71   AAYSTKKELYFLLCESPLLL-DGGKLSF  97



>emb|CAN65692.1| hypothetical protein VITISV_022468 [Vitis vinifera]
Length=248

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPEG +S I+SLTS  DA + S++S +F+AAAESD VW RFLP D  DIL R   P+
Sbjct  6    FNKLPEGCVSIILSLTSPPDACKSSLVSPMFRAAAESDVVWERFLPADYHDILCRLVEPL  65

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
            V S+ KEL+  LC+ PIL+D GSK
Sbjct  66   VCSSRKELFLRLCD-PILIDGGSK  88



>gb|EYU22102.1| hypothetical protein MIMGU_mgv1a020310mg [Erythranthe guttata]
Length=290

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 63/88 (72%), Gaps = 2/88 (2%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F+ LPEG I++I+S TS  DA R + +S + K+AAESD+VW RFLP D  +I+  S SPV
Sbjct  11   FSLLPEGCIANIVSFTSPKDACRAAAVSLLVKSAAESDTVWERFLPPDYGEIVSGSNSPV  70

Query  327  -VFSNMKELYFTLCNSPILLDDGSKLRF  407
              +S  KELYF LC+SP+LL DG K+ F
Sbjct  71   AAYSTKKELYFLLCDSPLLL-DGGKMSF  97



>ref|XP_010241128.1| PREDICTED: putative F-box protein PP2-B12 isoform X2 [Nelumbo 
nucifera]
Length=307

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 61/84 (73%), Gaps = 2/84 (2%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSP-  323
            F  LPE  +S+I+SLTSA++A R S  S VF++AA+SD VW RFLP D  +I+ R+  P 
Sbjct  5    FHLLPEECVSNIMSLTSALEACRSSAASPVFRSAADSDYVWERFLPSDYKEIISRAVXPL  64

Query  324  -VVFSNMKELYFTLCNSPILLDDG  392
             + F++ KELYF LCN PIL+DDG
Sbjct  65   GLDFASKKELYFRLCNDPILVDDG  88



>ref|XP_006588465.1| PREDICTED: uncharacterized protein LOC100800402 isoform X1 [Glycine 
max]
Length=263

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPEG I+ I+S T+  D  R SV+S++F++AAESD+VW RFLP D   I+ +S SP+
Sbjct  3    FQGLPEGCIASILSRTTPADVCRFSVVSKIFRSAAESDAVWKRFLPSDYHSIISQSPSPL  62

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             + + KELY  L + PI++D G K
Sbjct  63   NYPSKKELYLALSDRPIIIDQGKK  86



>gb|KHN14786.1| F-box protein PP2-B10 [Glycine soja]
Length=263

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPEG I+ I+S T+  D  R SV+S++F++AAESD+VW RFLP D   I+ +S SP+
Sbjct  3    FQGLPEGCIASILSRTTPADVCRFSVVSKIFRSAAESDAVWKRFLPSDYHSIISQSPSPL  62

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             + + KELY  L + PI++D G K
Sbjct  63   NYPSKKELYLALSDRPIVIDQGKK  86



>ref|XP_010241127.1| PREDICTED: putative F-box protein PP2-B12 isoform X1 [Nelumbo 
nucifera]
Length=315

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 61/84 (73%), Gaps = 2/84 (2%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSP-  323
            F  LPE  +S+I+SLTSA++A R S  S VF++AA+SD VW RFLP D  +I+ R+  P 
Sbjct  5    FHLLPEECVSNIMSLTSALEACRSSAASPVFRSAADSDYVWERFLPSDYKEIISRAVXPL  64

Query  324  -VVFSNMKELYFTLCNSPILLDDG  392
             + F++ KELYF LCN PIL+DDG
Sbjct  65   GLDFASKKELYFRLCNDPILVDDG  88



>ref|XP_002279245.1| PREDICTED: F-box protein PP2-B15 [Vitis vinifera]
Length=285

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPEG +S I+SLTS  DA + S++S +F+AAAESD VW RFLP D  DIL R   P+
Sbjct  6    FNKLPEGCVSIILSLTSPPDACKSSLVSPMFRAAAESDVVWERFLPADYHDILCRLVEPL  65

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
            V S+ KEL+  LC+ PIL+D GSK
Sbjct  66   VCSSRKELFLRLCD-PILIDGGSK  88



>ref|XP_010430669.1| PREDICTED: putative F-box protein PP2-B2 [Camelina sativa]
Length=285

 Score = 91.7 bits (226),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = +3

Query  108  NGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQ  287
            NGG   I      F  LPE  IS+IIS TS  DA   + +S+ F++A +SD+VW +FLP 
Sbjct  11   NGGGVAIVSAPSPFDDLPEDCISNIISFTSPRDACIAATVSKTFESAVQSDTVWDKFLPS  70

Query  288  DLSDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSKLRFVKM-YG  422
            D   ++  SR   VFS+ KELYF LC++PIL+DDG K  +++  YG
Sbjct  71   DYPSLIPPSR---VFSSKKELYFALCDNPILIDDGKKSSWLERGYG  113



>ref|XP_009764086.1| PREDICTED: F-box protein PP2-B10-like [Nicotiana sylvestris]
Length=307

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
            G+D +  LPEG I++++SLT   DA+RLS+++ VF++AAESD+VW RFLP D  DI+ RS
Sbjct  13   GVDIY-HLPEGCIANVLSLTCPRDASRLSLVASVFRSAAESDAVWDRFLPPDYRDIISRS  71

Query  315  ---RSPVVFSNMKELYFTLCNSPILLDDGSK  398
               +  +VF + KELY  LC+ P L+D  +K
Sbjct  72   SNGQDSIVFGSKKELYLYLCDHPFLIDGCTK  102



>ref|XP_010935987.1| PREDICTED: F-box protein At2g02240-like isoform X1 [Elaeis guineensis]
Length=261

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 1/87 (1%)
 Frame = +3

Query  132  VGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR  311
             G     +LPEG IS +ISLTS VD+ R + +   F++AA SD+VW RFLP D   IL R
Sbjct  3    TGCGDICTLPEGCISHVISLTSPVDSCRSAAVCTTFRSAAVSDTVWERFLPPDYRSILER  62

Query  312  SRSPVVFSNMKELYFTLCNSPILLDDG  392
            +  PV +S+ KEL+F LC  PIL+DDG
Sbjct  63   AVRPVEYSSKKELFFRLCE-PILIDDG  88



>ref|XP_006353800.1| PREDICTED: F-box protein PP2-B10-like [Solanum tuberosum]
Length=261

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            +D+F  LPEG I +IIS T+  DA + +++S+ FK   ESD +WGRFLP    +I+ RS 
Sbjct  10   IDYFERLPEGCIIEIISKTTPSDAVKSTILSKEFKRVVESDLIWGRFLPFGYQEIVDRSE  69

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
             P + +  KEL+F+LC+SPILL DG KL F
Sbjct  70   FPPICNTKKELFFSLCDSPILL-DGGKLSF  98



>ref|XP_004298005.1| PREDICTED: F-box protein PP2-B10-like [Fragaria vesca subsp. 
vesca]
Length=294

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPE  I  ++SLTS  DA R +++S  F +A  S  VW RFLP D  DI+ RS SP+ FS
Sbjct  7    LPEECIPYVLSLTSPKDACRSALVSSAFGSAVHSQVVWERFLPSDHRDIISRSVSPITFS  66

Query  336  NMKELYFTLCNSPILLDDGS  395
            + KELYF LC+SPI LDDG+
Sbjct  67   SKKELYFRLCDSPIFLDDGN  86



>ref|NP_001242472.1| uncharacterized protein LOC100800402 [Glycine max]
 gb|ACU16524.1| unknown [Glycine max]
Length=254

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPEG I+ I+S T+  D  R SV+S++F++ AESD+VW RFLP D   I+ +S SP+
Sbjct  3    FQGLPEGCIASILSRTTPADVCRFSVVSKIFRSTAESDAVWKRFLPSDYHSIISQSPSPL  62

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             + + KELY  L + PI++D G K
Sbjct  63   NYPSKKELYLALSDRPIIIDQGKK  86



>emb|CAN65691.1| hypothetical protein VITISV_022467 [Vitis vinifera]
Length=288

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F +LPEG +S I+SLTS  DA + S++S +F+AAAESD VW RFLP D  DIL R   P+
Sbjct  7    FNTLPEGCVSTILSLTSPPDACKSSLVSSIFRAAAESDVVWERFLPADYHDILSRLAEPL  66

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
            V S+ KEL+  LC+ P L+D G K
Sbjct  67   VVSSKKELFLRLCD-PSLIDGGKK  89



>ref|XP_002529282.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33114.1| conserved hypothetical protein [Ricinus communis]
Length=272

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG++S I+S TS VD  R SV+S  F++A ESD+VW RFLP D  +IL R  +P  FS
Sbjct  2    LPEGVVSTILSFTSPVDGCRSSVVSTSFRSAMESDAVWERFLPSDYHEILSRLLTPFTFS  61

Query  336  NMKELYFTLCNSPILLDDGSK  398
            + KEL+  LCN P+L+D G K
Sbjct  62   SKKELFLRLCN-PLLIDSGKK  81



>ref|XP_007147250.1| hypothetical protein PHAVU_006G108500g [Phaseolus vulgaris]
 gb|ESW19244.1| hypothetical protein PHAVU_006G108500g [Phaseolus vulgaris]
Length=326

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPEG I++I+S T+  DA  LS++S  F++AA+SD VW RFLP DL  I+ ++  P+
Sbjct  27   FEHLPEGCIANILSFTTPRDACVLSLVSSSFRSAAQSDVVWERFLPSDLHAIVSQTSKPL  86

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             +S+ KELY  LC++P+L+D G K
Sbjct  87   SYSSKKELYLHLCHNPLLIDAGQK  110



>ref|XP_009602068.1| PREDICTED: F-box protein PP2-B10-like [Nicotiana tomentosiformis]
Length=309

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 65/91 (71%), Gaps = 4/91 (4%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
            G+D +  LPEG I++I+SLT   DA+RLS+++ +F++AAESD+VW RFLP D  DI+ RS
Sbjct  13   GVDIY-HLPEGCIANILSLTCPRDASRLSLVASIFRSAAESDAVWDRFLPPDYRDIISRS  71

Query  315  R---SPVVFSNMKELYFTLCNSPILLDDGSK  398
                  ++F + KELY  LC+ P L++ G+K
Sbjct  72   SDGPDSIMFGSKKELYLYLCDYPFLIEGGTK  102



>emb|CDO99429.1| unnamed protein product [Coffea canephora]
Length=446

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPE  +S+IISLTS  DA   SVIS  FK+A+ESD+VW +FLP D  +I+  S SP+
Sbjct  185  FQFLPEDCVSNIISLTSPQDACGASVISVGFKSASESDTVWEKFLPSDYKEIISNSVSPL  244

Query  327  VFSNMKELYFTLCNSPILLDDGSKLRF  407
             ++  K LYF LC+SPIL+++G KL F
Sbjct  245  NYATKKHLYFHLCHSPILINNG-KLSF  270



>ref|XP_010264074.1| PREDICTED: putative F-box protein PP2-B12 [Nelumbo nucifera]
Length=298

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 60/87 (69%), Gaps = 3/87 (3%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSP-  323
             ++LPE  IS+I+S TS  DA R + +S VF++AAES++VW RFLP D  +IL R+ SP 
Sbjct  14   LSALPESCISNILSFTSPRDACRSAAVSSVFRSAAESNTVWDRFLPSDYQEILSRAISPP  73

Query  324  --VVFSNMKELYFTLCNSPILLDDGSK  398
               + S+ K  YF LC+ P+L+DDG K
Sbjct  74   PASILSSKKAFYFHLCDHPLLIDDGKK  100



>ref|XP_006371768.1| hypothetical protein POPTR_0018s02870g, partial [Populus trichocarpa]
 gb|ERP49565.1| hypothetical protein POPTR_0018s02870g, partial [Populus trichocarpa]
Length=241

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG I++++S TS + A RLS++S +F++AAE+ + W RFLP+DL   L  S SP++ S
Sbjct  16   LPEGCIANVLSFTSPLAACRLSIVSPLFRSAAETGAFWERFLPRDL---LSESDSPLLVS  72

Query  336  NMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLYT  440
            + K+LY +LC +PIL++DG K   ++     KLYT
Sbjct  73   SKKQLYLSLCGNPILIEDGKKSFSLEKKSGKKLYT  107



>ref|XP_004304800.1| PREDICTED: F-box protein At2g02240-like [Fragaria vesca subsp. 
vesca]
Length=235

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD  A LPEG I+++I +T+  DA RLS+ISR FK+AA+SD+VW +FLP + ++ILL   
Sbjct  1    MDLEA-LPEGCIAEVIGMTTPADACRLSLISRHFKSAADSDTVWDKFLPAETNEILLHFE  59

Query  318  SPVVFSNMKELYFTLCNSPILLDDG--SKLRFV  410
            S     + KELY TL ++PIL+D    +KLR V
Sbjct  60   SATDAKSKKELYLTLSDNPILIDRNMMAKLRAV  92



>emb|CDP04245.1| unnamed protein product [Coffea canephora]
Length=295

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 61/90 (68%), Gaps = 4/90 (4%)
 Frame = +3

Query  141  DFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRS  320
            D F +LPEG I+  +SLTS  DA RLS +S  F +AA+SD VW  FLP D  DIL RS  
Sbjct  7    DHFNALPEGCIAYTLSLTSPRDACRLSSVSSTFCSAAQSDDVWESFLPPDYRDILSRSEQ  66

Query  321  PV----VFSNMKELYFTLCNSPILLDDGSK  398
             +    ++++ K+LY  LC++PIL+D+G+K
Sbjct  67   GIQLLPLYTSKKQLYLHLCDNPILIDNGTK  96



>emb|CBI39533.3| unnamed protein product [Vitis vinifera]
Length=694

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPEG +S I+SLTS  DA + S++S +F+AAAESD VW RFLP D  DIL R   P+
Sbjct  6    FNKLPEGCVSIILSLTSPPDACKSSLVSPMFRAAAESDVVWERFLPADYHDILCRLVEPL  65

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
            V S+ KEL+  LC+ PIL+D GSK
Sbjct  66   VCSSRKELFLRLCD-PILIDGGSK  88


 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVF  332
            +LPEG +S I+SLTS  DA + S++S +F+AAAESD VW RFLP D  DIL R   P+V 
Sbjct  269  TLPEGCVSTILSLTSPPDACKSSLVSSIFRAAAESDVVWERFLPADYHDILSRLAEPLVV  328

Query  333  SNMKELYFTLCNSPILLDDGSK  398
            S+ KEL+  LC+ P L+D G K
Sbjct  329  SSKKELFLRLCD-PSLIDGGKK  349


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LP+  IS I+S TS  DA R  ++S   + A +SDSVW +FLP D  +IL R  SP+
Sbjct  485  FELLPQDCISHILSCTSPRDACRSGLVSTTVRHAGDSDSVWEKFLPSDYQEILSRLVSPL  544

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
            VF++ KELY  LC  P+L+D+G K
Sbjct  545  VFASKKELYSKLCR-PLLIDEGRK  567



>ref|NP_973399.1| F-box domain protein MEE66 [Arabidopsis thaliana]
 sp|Q3E6P4.1|FB95_ARATH RecName: Full=F-box protein At2g02240 [Arabidopsis thaliana]
 gb|AEC05560.1| F-box protein [Arabidopsis thaliana]
Length=320

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (65%), Gaps = 3/97 (3%)
 Frame = +3

Query  108  NGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQ  287
            + G E++  G   F  LPE  IS+IIS TS  DA   + +S+ F++A  SD VW +FLP 
Sbjct  48   HSGGEIVSPGTSPFDVLPEDCISNIISFTSPRDACVAASVSKTFESAVSSDCVWDKFLPP  107

Query  288  DLSDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
            +   ++ RSR   VF++ KELYF LC++P+L++DG K
Sbjct  108  EYESLVSRSR---VFASKKELYFALCHNPVLIEDGKK  141



>ref|XP_004302132.1| PREDICTED: F-box protein At2g02240-like [Fragaria vesca subsp. 
vesca]
Length=286

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG ++++I LT+  DA RLS+IS  FK+AA+SD+VW +FLP D ++I+  S S +   
Sbjct  10   LPEGCVANVIGLTTPRDACRLSLISTDFKSAADSDAVWDKFLPPDTNEIVSHSDSEIDAK  69

Query  336  NMKELYFTLCNSPILLDDG  392
            + KELYFTLC+ PIL+DDG
Sbjct  70   SKKELYFTLCD-PILIDDG  87



>ref|XP_009587732.1| PREDICTED: F-box protein PP2-B10-like [Nicotiana tomentosiformis]
Length=305

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 3/85 (4%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSP---  323
             LPEG I++ +SLTS  DA RLSV++  F++AAESD+VW RFLP D  DI+ RS      
Sbjct  14   ELPEGCIANALSLTSPKDACRLSVVASTFRSAAESDAVWERFLPPDYGDIISRSIDGLDL  73

Query  324  VVFSNMKELYFTLCNSPILLDDGSK  398
            +   + KELY  LC+ PIL+D GSK
Sbjct  74   LAVGSKKELYLHLCDHPILIDGGSK  98



>ref|XP_010650201.1| PREDICTED: F-box protein At2g02240-like isoform X3 [Vitis vinifera]
Length=264

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
            G+     LPE  +S I+SLTS  DAAR +V+S  F++AA SD VWG FLP    +I+ + 
Sbjct  3    GVKCITELPEECMSHILSLTSPRDAARSAVLSSEFRSAANSDVVWGSFLPSGFEEIISKL  62

Query  315  RSPVVFSNMKELYFTLCNSPILLDDGSK  398
             SP+VFS+ K+LY   CN P LL D +K
Sbjct  63   ESPLVFSSKKDLYLHFCNGPFLLKDNTK  90



>ref|XP_002283524.1| PREDICTED: F-box protein VBF-like [Vitis vinifera]
Length=301

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVF  332
            +LPEG +S I+SLTS  DA + S++S +F+AAAESD VW RFLP D  DIL R   P+V 
Sbjct  22   TLPEGCVSTILSLTSPPDACKSSLVSSIFRAAAESDVVWERFLPADYHDILSRLAEPLVV  81

Query  333  SNMKELYFTLCNSPILLDDGSK  398
            S+ KEL+  LC+ P L+D G K
Sbjct  82   SSKKELFLRLCD-PSLIDGGKK  102



>ref|XP_010650200.1| PREDICTED: F-box protein PP2-B10-like isoform X1 [Vitis vinifera]
Length=273

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
            G+     LPE  +S I+SLTS  DAAR +V+S  F++AA SD VWG FLP    +I+ + 
Sbjct  12   GVKCITELPEECMSHILSLTSPRDAARSAVLSSEFRSAANSDVVWGSFLPSGFEEIISKL  71

Query  315  RSPVVFSNMKELYFTLCNSPILLDDGSK  398
             SP+VFS+ K+LY   CN P LL D +K
Sbjct  72   ESPLVFSSKKDLYLHFCNGPFLLKDNTK  99



>ref|XP_002282712.2| PREDICTED: F-box protein PP2-B10-like isoform X2 [Vitis vinifera]
Length=272

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
            G+     LPE  +S I+SLTS  DAAR +V+S  F++AA SD VWG FLP    +I+ + 
Sbjct  11   GVKCITELPEECMSHILSLTSPRDAARSAVLSSEFRSAANSDVVWGSFLPSGFEEIISKL  70

Query  315  RSPVVFSNMKELYFTLCNSPILLDDGSK  398
             SP+VFS+ K+LY   CN P LL D +K
Sbjct  71   ESPLVFSSKKDLYLHFCNGPFLLKDNTK  98



>ref|XP_006430121.1| hypothetical protein CICLE_v10013351mg [Citrus clementina]
 gb|ESR43361.1| hypothetical protein CICLE_v10013351mg [Citrus clementina]
Length=282

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPE  +S IISLTS +DA R +++SR F++AAES+  W +FLP D  DI+ RS + + FS
Sbjct  9    LPEDCVSIIISLTSPLDACRATLVSRAFRSAAESNVAWEKFLPSDYEDIVSRSITSLKFS  68

Query  336  NMKELYFTLCNSPILLDDGSK  398
            + KELY  LCN PIL+D G K
Sbjct  69   SKKELYLHLCN-PILIDGGRK  88



>ref|XP_006382440.1| SKP1 interacting partner 3-related family protein [Populus trichocarpa]
 gb|ERP60237.1| SKP1 interacting partner 3-related family protein [Populus trichocarpa]
Length=287

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = +3

Query  141  DFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRS  320
            D F  LPEG +S I+S TS  DA + S++S +F++AA+SD VW RFLP D  DI+ +S  
Sbjct  8    DQFKILPEGCVSTILSFTSPQDACKSSLVSTIFQSAADSDIVWERFLPTDYQDIVSKSNV  67

Query  321  PVVFSNMKELYFTLCNSPILLDDGSK  398
            P  FS+ KEL+  LCNS +L+D G K
Sbjct  68   PFKFSSKKELFLQLCNS-LLIDGGRK  92



>ref|XP_010106836.1| Putative F-box protein [Morus notabilis]
 gb|EXC12065.1| Putative F-box protein [Morus notabilis]
Length=290

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +3

Query  150  ASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVV  329
            ++LP+  IS I+SLTS  DA R + +S  F +AAESD VW +FLP     I+ RS SP+V
Sbjct  12   SNLPKKCISHILSLTSPRDACRCTAVSTKFCSAAESDVVWEKFLPPCWEYIVSRSVSPLV  71

Query  330  FSNMKELYFTLCNSPILLDDGSKLRFV  410
            FS+ KELYF LC+SP+L+D      FV
Sbjct  72   FSSKKELYFRLCHSPVLVDGTKNKSFV  98



>ref|XP_006345814.1| PREDICTED: F-box protein At2g02240-like [Solanum tuberosum]
Length=313

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR---SPV  326
            LPEG I++++SLTS  DA+RLSVI  VF++AAESD+VW RFLP D  DI+ RS      +
Sbjct  24   LPEGCIANVLSLTSPRDASRLSVIGTVFRSAAESDAVWDRFLPPDYRDIISRSSDGPESI  83

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
               + KELY  LC+ P  +D G+K
Sbjct  84   NVGSKKELYLYLCDHPFFIDGGTK  107



>sp|Q9FV02.2|SKIP3_ARATH RecName: Full=F-box protein SKIP3; AltName: Full=F-box protein 
PP2-B9; AltName: Full=Protein PHLOEM PROTEIN 2-LIKE B9; AltName: 
Full=SKP1-interacting partner 3 [Arabidopsis thaliana]
Length=294

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 58/80 (73%), Gaps = 3/80 (4%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVF  332
            SLPEG IS+IIS TS  DA   + +S++F++A +SD VW +FLP D   ++  SR   VF
Sbjct  26   SLPEGCISNIISFTSPEDACVAAAVSKIFESAVKSDIVWEKFLPTDYESLITPSR---VF  82

Query  333  SNMKELYFTLCNSPILLDDG  392
            S+ KELYF+LCN P+L++DG
Sbjct  83   SSKKELYFSLCNDPLLIEDG  102



>ref|XP_004302127.1| PREDICTED: putative F-box protein PP2-B12-like [Fragaria vesca 
subsp. vesca]
Length=341

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 60/86 (70%), Gaps = 3/86 (3%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS--RSPVV  329
            LPEG I+++ISLT+  DA RLS +SR F++AAESD+VW +FLP D+   L  S   +P  
Sbjct  55   LPEGCIANVISLTTPPDACRLSSVSRSFRSAAESDAVWSKFLPPDIPTNLSHSGPDAPNC  114

Query  330  FSNMKELYFTLCNSPILLDDGSKLRF  407
             S  KELY  LC+ P+L+D+G K+ F
Sbjct  115  RSKSKELYLALCHDPVLIDEG-KMSF  139



>ref|XP_011031411.1| PREDICTED: putative F-box protein PP2-B12 [Populus euphratica]
Length=311

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG I+++++ T   DA RLS++S +FK+A ESD+VW RFLP+D   I+  S S V+ +
Sbjct  25   LPEGCIANVLAFTGPRDACRLSIVSSLFKSAEESDAVWERFLPRDYQSIIFTSDSYVLLA  84

Query  336  NM---KELYFTLCNSPILLDDGSK  398
            ++   K+LY  LC  PI++DDG K
Sbjct  85   SLSSKKQLYLRLCEKPIIIDDGKK  108



>ref|NP_178332.2| phloem protein 2-B2 [Arabidopsis thaliana]
 sp|Q9ZVR5.2|PP2B2_ARATH RecName: Full=Putative F-box protein PP2-B2; AltName: Full=Protein 
PHLOEM PROTEIN 2-LIKE B2; Short=AtPP2-B2 [Arabidopsis 
thaliana]
 gb|AEC05561.1| phloem protein 2-B2 [Arabidopsis thaliana]
Length=310

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 60/88 (68%), Gaps = 3/88 (3%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
            G   F +LPE  IS+IIS TS  DA   + +S+ F++A  SDSVW +FLP D S ++  S
Sbjct  43   GPSLFDNLPEDCISNIISFTSPRDACVAASVSKTFESAVNSDSVWDKFLPSDYSSLVPPS  102

Query  315  RSPVVFSNMKELYFTLCNSPILLDDGSK  398
            R   VFS+ KELYF +C++P+L++DG K
Sbjct  103  R---VFSSKKELYFAICDNPVLVEDGGK  127



>gb|KCW60514.1| hypothetical protein EUGRSUZ_H03260 [Eucalyptus grandis]
Length=287

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVF  332
            +LPE  +S I+S  S  +  RLS++S  F +AA+SD +W RFLP D +DI+ RS +PV F
Sbjct  3    ALPESCVSAILSFVSPANVCRLSLVSSTFLSAADSDIIWARFLPSDHADIVFRSAAPVEF  62

Query  333  SNMKELYFTLCNSPILLDDGSK  398
            S+ KEL+  LC  P+L+D G K
Sbjct  63   SSKKELFLWLCQRPLLIDGGRK  84



>ref|XP_009763054.1| PREDICTED: F-box protein PP2-B10-like [Nicotiana sylvestris]
Length=303

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 3/98 (3%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS---RSP  323
             LPEG +++ +SLTS  DA RLS+++  F++AAESD+VW RFLP D  DI+ RS      
Sbjct  14   ELPEGCLANALSLTSPKDACRLSLVASTFRSAAESDAVWERFLPPDYGDIISRSIDGPDS  73

Query  324  VVFSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
            +   + KELY  LC+ PIL+D G+K   ++ +   K Y
Sbjct  74   LAVGSKKELYLHLCDHPILIDGGTKSFSLEKWSGKKCY  111



>ref|XP_010024086.1| PREDICTED: F-box protein PP2-B15-like [Eucalyptus grandis]
Length=295

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVF  332
            +LPE  +S I+S  S  +  RLS++S  F +AA+SD +W RFLP D +DI+ RS +PV F
Sbjct  11   ALPESCVSAILSFVSPANVCRLSLVSSTFLSAADSDIIWARFLPSDHADIVFRSAAPVEF  70

Query  333  SNMKELYFTLCNSPILLDDGSK  398
            S+ KEL+  LC  P+L+D G K
Sbjct  71   SSKKELFLWLCQRPLLIDGGRK  92



>ref|XP_006471428.1| PREDICTED: F-box protein At2g02240-like [Citrus sinensis]
Length=260

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD   +LP   IS+IISLT+  DA RLSV+S VFK+AA+SDSVW  FLP D   I+  S 
Sbjct  1    MDITIALPAECISNIISLTTPRDACRLSVVSPVFKSAADSDSVWENFLPSDYKQIISNSV  60

Query  318  SPVVFS-NMKELYFTLCNSPILLDDGS  395
            S ++ S + K+LYF LC +PI++++G+
Sbjct  61   SSLITSLSKKDLYFHLCRNPIIINNGT  87



>gb|AAC78509.1| lectin-like protein [Arabidopsis thaliana]
Length=305

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 60/88 (68%), Gaps = 3/88 (3%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
            G   F +LPE  IS+IIS TS  DA   + +S+ F++A  SDSVW +FLP D S ++  S
Sbjct  38   GPSLFDNLPEDCISNIISFTSPRDACVAASVSKTFESAVNSDSVWDKFLPSDYSSLVPPS  97

Query  315  RSPVVFSNMKELYFTLCNSPILLDDGSK  398
            R   VFS+ KELYF +C++P+L++DG K
Sbjct  98   R---VFSSKKELYFAICDNPVLVEDGGK  122



>ref|XP_006489771.1| PREDICTED: F-box protein At2g02240-like [Citrus sinensis]
 gb|KDO50518.1| hypothetical protein CISIN_1g024966mg [Citrus sinensis]
Length=260

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD   +LP   IS+IISLT+  DA RLSV+S VFK+AA+SDSVW  FLP D   I+  S 
Sbjct  1    MDITIALPAECISNIISLTTPRDACRLSVVSPVFKSAADSDSVWENFLPSDYKQIISNSV  60

Query  318  SPVVFS-NMKELYFTLCNSPILLDDGS  395
            S ++ S + K+LYF LC +PI++++G+
Sbjct  61   SSLITSLSKKDLYFHLCRNPIIINNGT  87



>gb|KDO54870.1| hypothetical protein CISIN_1g034086mg [Citrus sinensis]
Length=104

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 62/88 (70%), Gaps = 6/88 (7%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG I+++ISLT+  DA RLS +S VFK+AAESD+VW RFLP D   +L  + S    S
Sbjct  8    LPEGCIANVISLTTPRDACRLSSVSTVFKSAAESDAVWERFLPPDYPTLLSDAASSSSSS  67

Query  336  NM------KELYFTLCNSPILLDDGSKL  401
            +       KELYF+LC++PIL+D+G K+
Sbjct  68   SSLHFSSKKELYFSLCHNPILIDEGKKV  95



>ref|XP_006493712.1| PREDICTED: putative F-box protein PP2-B2-like [Citrus sinensis]
Length=124

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 5/95 (5%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD   +LP   +S +ISLT+  DA RLSV  RVFK+AA+SDSVW +FLP D  +I+  S 
Sbjct  1    MDITDTLPAECMSHVISLTTPRDACRLSVACRVFKSAADSDSVWEKFLPSDYKEIISSSV  60

Query  318  SPVV----FSNMKELYFTLCNSPILLDDGSKLRFV  410
            S       FS+ K+LYF LC++PI+++ G+ LR V
Sbjct  61   SDSSLITSFSSKKDLYFHLCHNPIIINGGT-LRLV  94



>ref|XP_004239687.1| PREDICTED: putative F-box protein PP2-B12 [Solanum lycopersicum]
Length=308

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 59/86 (69%), Gaps = 3/86 (3%)
 Frame = +3

Query  150  ASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRS-PV  326
              LPEG I++++SLTS  DA+RLSV+  VF++A ESD+VW RFLP D  DI+ RS   P 
Sbjct  17   CHLPEGCIANVLSLTSPRDASRLSVVGTVFRSAGESDAVWDRFLPSDYRDIISRSSDGPE  76

Query  327  VFS--NMKELYFTLCNSPILLDDGSK  398
             F+  + KELY  LC+ P  +D G+K
Sbjct  77   SFNVGSKKELYLYLCDHPFFIDGGTK  102



>ref|XP_008350797.1| PREDICTED: F-box protein At2g02240-like [Malus domestica]
Length=262

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 2/104 (2%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVF  332
            +L EG I++++SLT+  DA R S +SR F +AAESD+VW +F+P D+  IL    S    
Sbjct  16   ALXEGCIANVVSLTTPXDACRFSAVSRSFMSAAESDAVWDKFVPHDIPSILSHHSSSSSS  75

Query  333  SNM--KELYFTLCNSPILLDDGSKLRFVKMYGVVKLYTCNEASF  458
            S    KELY TLC +PILLDDG  L F+  +   K Y  +   F
Sbjct  76   STSSKKELYLTLCENPILLDDGKMLFFLDKWSGKKCYMISARDF  119



>ref|XP_002876807.1| phloem protein 2-B2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53066.1| phloem protein 2-B2 [Arabidopsis lyrata subsp. lyrata]
Length=296

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 59/88 (67%), Gaps = 3/88 (3%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
            G   F +LPE  IS+IIS TS  DA   + +S+ F++A  SDSVW +FLP D S ++   
Sbjct  32   GPSLFDNLPEDCISNIISFTSPRDACVAASVSKTFESAVSSDSVWDKFLPPDYSSLIPPL  91

Query  315  RSPVVFSNMKELYFTLCNSPILLDDGSK  398
            R   VFS+ KELYF +C++P+L+DDG K
Sbjct  92   R---VFSSKKELYFAICDNPVLIDDGKK  116



>ref|XP_010935985.1| PREDICTED: putative F-box protein PP2-B12 [Elaeis guineensis]
Length=292

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
              +LPEG +S +ISLTS VD+ R + +   F++AA SD+VW RFLP D   IL R+  P+
Sbjct  10   ICTLPEGCVSHVISLTSPVDSCRSAAVCTTFRSAAVSDTVWERFLPPDYRSILSRAVHPL  69

Query  327  VFSNMKELYFTLCNSPILLDDGS  395
             +S+ KEL+  LC  PIL+DDG+
Sbjct  70   EYSSRKELFVRLCE-PILIDDGN  91



>ref|XP_010905842.1| PREDICTED: putative F-box protein PP2-B12 [Elaeis guineensis]
Length=293

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPE  IS +ISLTS +D+ R S +S  F++AA SD+VW  FLP D   IL R+  PV +S
Sbjct  11   LPEECISHVISLTSPLDSCRSSAVSTTFRSAASSDTVWEHFLPSDYKSILSRAVHPVEYS  70

Query  336  NMKELYFTLCNSPILLDDGSKLRF  407
            + +EL+F LC+ P+L+DDG K+ F
Sbjct  71   SKRELFFRLCD-PVLIDDG-KMSF  92



>ref|XP_009799500.1| PREDICTED: F-box protein At2g02240-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009799501.1| PREDICTED: F-box protein At2g02240-like isoform X2 [Nicotiana 
sylvestris]
Length=134

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPEG IS+IISLT   DAAR S ISR FK+AAESD VW +FLP D  DI+ RS S V
Sbjct  9    FTILPEGCISEIISLTIPADAARSSAISRGFKSAAESDVVWDKFLPSDHLDIVSRSVSVV  68

Query  327  VFSNMKELYFTLCNSPILLDDG  392
            V  + K+LYF L +SPILL +G
Sbjct  69   VCDSEKDLYFRLSHSPILLHEG  90



>ref|XP_008796436.1| PREDICTED: uncharacterized protein LOC103711894 [Phoenix dactylifera]
Length=732

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVF  332
            +LPEG IS +ISLTS  D+ R + +   F +AA SD+VW RFLP D   IL R+  PV +
Sbjct  453  TLPEGCISHVISLTSPADSCRSTAVCTTFLSAAVSDTVWERFLPPDYQSILSRAVHPVEY  512

Query  333  SNMKELYFTLCNSPILLDDGSKLRF  407
            S+ KEL+F LC  PIL+DDG K+ F
Sbjct  513  SSKKELFFRLC-EPILIDDG-KMSF  535


 Score = 85.5 bits (210),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVF  332
            +LPEG IS +ISLTS  D+ R   +   F++AA SD+VW RFL  D   IL R+  PV +
Sbjct  10   TLPEGCISHVISLTSPADSCRSMAVCTTFRSAAVSDTVWERFLLPDYQSILSRAVHPVEY  69

Query  333  SNMKELYFTLCNSPILLDDGSKLRF  407
            S+ KEL+F LC  PIL+DDG K+ F
Sbjct  70   SSKKELFFRLC-EPILIDDG-KMSF  92



>ref|XP_010935986.1| PREDICTED: F-box protein At2g02240-like [Elaeis guineensis]
Length=290

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
              +LPEG IS +ISLTS VD+ R + +   F++AAESD VW RFLP D   IL R+  PV
Sbjct  8    ICTLPEGCISHVISLTSPVDSCRSAAVCTTFRSAAESDIVWERFLPPDYPSILSRAVHPV  67

Query  327  VFSNMKELYFTLCNSPILLDDGS  395
             + + K+L+F LC + IL+DDG+
Sbjct  68   EYLSKKQLFFRLCET-ILIDDGN  89



>gb|EYU37274.1| hypothetical protein MIMGU_mgv1a023178mg [Erythranthe guttata]
Length=271

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVF  332
            SLPE  +S IISLT   DA R S++S +F+ AA+SDSVW +FLP D  DI+  S SP  F
Sbjct  10   SLPEECLSHIISLTCPQDACRSSLVSCIFRDAADSDSVWDKFLPLDYPDIISNSVSPFFF  69

Query  333  SNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
            S+ K+LY  L ++P+L+D G K   +  Y   + Y
Sbjct  70   SSKKDLYAKLSSTPLLIDGGRKTFLLDKYTNKRCY  104



>ref|XP_002876815.1| hypothetical protein ARALYDRAFT_904464 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53074.1| hypothetical protein ARALYDRAFT_904464 [Arabidopsis lyrata subsp. 
lyrata]
Length=279

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 3/84 (4%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F SLPE  I +IIS TS  DA   + IS+ F++A +SD VW +F+P D   ++ RSR   
Sbjct  24   FDSLPEECIPNIISFTSPRDACVAASISKTFESAVKSDFVWEKFIPPDYESLVPRSRE--  81

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             FS+ KELYF LCN P+L+DDG K
Sbjct  82   -FSSKKELYFALCNDPLLIDDGKK  104



>ref|XP_002324125.2| hypothetical protein POPTR_0018s00210g, partial [Populus trichocarpa]
 gb|EEF02690.2| hypothetical protein POPTR_0018s00210g, partial [Populus trichocarpa]
Length=96

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 61/96 (64%), Gaps = 8/96 (8%)
 Frame = +3

Query  129  RVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILL  308
            R G      LPEG I++ +S T+ +D AR S +S +FK+AA SD VW RFLP DL  +L 
Sbjct  3    RSGELHLNELPEGCIANALSFTAPLDVARFSAVSPMFKSAAISDVVWERFLPSDLESVL-  61

Query  309  RSRSP------VVFSNMKELYFTLCNSPILLDDGSK  398
             S SP         S+ +ELYF+LC++PIL+D+G K
Sbjct  62   -STSPDGSLLLASVSSKRELYFSLCDNPILVDNGRK  96



>ref|XP_010425003.1| PREDICTED: F-box protein At2g02240-like [Camelina sativa]
Length=276

 Score = 85.5 bits (210),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 64/97 (66%), Gaps = 3/97 (3%)
 Frame = +3

Query  108  NGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQ  287
            + G E++  G   F  LPE  IS+IIS TS  DA   + +S+ F++AA SD+VW +FLP 
Sbjct  6    HTGGEIVVAGPSPFDGLPEDCISNIISFTSPRDACVAASVSKTFESAANSDNVWEKFLPP  65

Query  288  DLSDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
            D S ++  S    VF++ KE+Y +LC++P+L++DG K
Sbjct  66   DYSSLIPPS---PVFASKKEIYLSLCHNPVLIEDGKK  99



>emb|CDP04244.1| unnamed protein product [Coffea canephora]
Length=283

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 60/92 (65%), Gaps = 5/92 (5%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
            G+D +A LPEG I++ +SLTS  DA RLS+++  F++AA  D VW RF P D  D+L RS
Sbjct  12   GIDLYA-LPEGCIANALSLTSPRDACRLSLVASTFRSAALCDEVWERFFPADYRDVLCRS  70

Query  315  RSPVVF----SNMKELYFTLCNSPILLDDGSK  398
               +       +MK+LY  LC+ P+L+D G+K
Sbjct  71   AEGIELLRSAISMKQLYLHLCDKPVLIDGGTK  102



>ref|XP_010109312.1| F-box protein [Morus notabilis]
 gb|EXC21744.1| F-box protein [Morus notabilis]
Length=374

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 64/94 (68%), Gaps = 3/94 (3%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            +D+F  LPEG I+DI+SLTS  DA RL ++S   ++ AESD+VW RFLP D   ++    
Sbjct  27   VDYFYVLPEGCIADIVSLTSPRDACRLCMVSTTLRSVAESDTVWERFLPPDYLSVVSPHS  86

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKL-RFVKM  416
             P   ++ K+L+F+LC+ P+L++ G+KL  FV +
Sbjct  87   LPC--TSKKDLFFSLCDRPLLIEQGTKLVHFVNL  118



>ref|XP_002865264.1| hypothetical protein ARALYDRAFT_330877 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41523.1| hypothetical protein ARALYDRAFT_330877 [Arabidopsis lyrata subsp. 
lyrata]
Length=275

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 58/82 (71%), Gaps = 3/82 (4%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F SLPE  IS+IIS TS +DA  ++ +SR+F+AAA+SD+VW +FLP D   ++  SR   
Sbjct  16   FNSLPEDCISNIISFTSPLDACVVASVSRLFEAAAKSDTVWEKFLPPDCESLVPGSRD--  73

Query  327  VFSNMKELYFTLCNSPILLDDG  392
             FS  KELYF LC  P+L+D+G
Sbjct  74   -FSLKKELYFALCGDPVLIDNG  94



>gb|KDO39882.1| hypothetical protein CISIN_1g047756mg, partial [Citrus sinensis]
Length=94

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 6/87 (7%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG I+++IS T+  DA RLS +S VFK+AAESD+VW RFLP D   +L  + S    S
Sbjct  8    LPEGCIANVISFTTPRDACRLSSVSTVFKSAAESDAVWERFLPPDYPSLLSDAASSSSSS  67

Query  336  NM------KELYFTLCNSPILLDDGSK  398
            +       KELYF+LC++PIL+D+G K
Sbjct  68   SSLHFSSKKELYFSLCHNPILIDEGKK  94



>ref|XP_002876814.1| hypothetical protein ARALYDRAFT_322564 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53073.1| hypothetical protein ARALYDRAFT_322564 [Arabidopsis lyrata subsp. 
lyrata]
Length=308

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 58/82 (71%), Gaps = 3/82 (4%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F SLPEG IS+IIS TS  DA   + +S++F++A +SD VW +FLP D   ++  SR   
Sbjct  24   FDSLPEGCISNIISFTSPEDACVAATVSKIFESAMKSDIVWEKFLPADYESLIPPSR---  80

Query  327  VFSNMKELYFTLCNSPILLDDG  392
            VFS+ KELYF+LC+ P+L+ DG
Sbjct  81   VFSSKKELYFSLCDDPLLIHDG  102



>ref|XP_010026191.1| PREDICTED: putative F-box protein PP2-B12 [Eucalyptus grandis]
Length=296

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +3

Query  129  RVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILL  308
            R G DF + LPEG I+ ++S TS  DA RL+ +S +FK+A +SD+VW  FLP +   ++ 
Sbjct  10   RDGPDF-SELPEGCIASVVSFTSPADACRLAPVSSLFKSACDSDAVWASFLPPECRQMV-  67

Query  309  RSRSPVVFSNMKELYFTLCNSPILLDDG  392
                P   S++KELYF+LC+ P+L+DDG
Sbjct  68   ----PRRVSSLKELYFSLCDDPVLVDDG  91



>gb|EYU32965.1| hypothetical protein MIMGU_mgv1a023724mg [Erythranthe guttata]
Length=293

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPEG I++IIS TS  DA   + +S   K+AAESD+VW RFLP D  +I+  S SPV
Sbjct  11   FNLLPEGCIANIISFTSPKDACTAAAVSVGLKSAAESDTVWERFLPPDYVEIVSGSSSPV  70

Query  327  -VFSNMKELYFTLCNSPILLDDGS-KLRFVKMYGVVKLYTCNEASFTCYG  470
              +S  KEL+F+LC+SP+L+D G   LR  K  G      C+      +G
Sbjct  71   AAYSTKKELFFSLCDSPLLVDGGKLSLRLDKSTGKKCYMLCSRQFQIAWG  120



>ref|XP_002876806.1| hypothetical protein ARALYDRAFT_322561 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53065.1| hypothetical protein ARALYDRAFT_322561 [Arabidopsis lyrata subsp. 
lyrata]
Length=317

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 64/97 (66%), Gaps = 3/97 (3%)
 Frame = +3

Query  108  NGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQ  287
            + G E++  G   F  LPE  IS+IIS TS  +A   + +S+ F++A  SDSVW +FLP 
Sbjct  45   SSGGEIVVPGPSPFDVLPEDCISNIISFTSPREACVAASVSKTFESAVNSDSVWDKFLPP  104

Query  288  DLSDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
            D S ++ +SR   VF++ KELYF LC++ +L++DG K
Sbjct  105  DYSSLVSQSR---VFASKKELYFALCHNHVLIEDGKK  138



>ref|XP_010041709.1| PREDICTED: F-box protein PP2-B10-like [Eucalyptus grandis]
Length=315

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +3

Query  129  RVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILL  308
            R G DF + LPEG I+ ++S TS  DA RL+ +S +FK+A +SD+VW  FLP +   ++ 
Sbjct  10   RDGPDF-SELPEGCIASVVSFTSPADACRLAPVSSLFKSACDSDAVWASFLPPECRQMV-  67

Query  309  RSRSPVVFSNMKELYFTLCNSPILLDDG  392
                P   S++KELYF+LC+ P+L+DDG
Sbjct  68   ----PRRVSSLKELYFSLCDDPVLVDDG  91



>ref|XP_010502235.1| PREDICTED: F-box protein At2g02240 [Camelina sativa]
Length=276

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 62/95 (65%), Gaps = 3/95 (3%)
 Frame = +3

Query  114  GSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDL  293
            G E++  G   F  LPE  IS+IIS TS  DA   + +S+ F++AA SD+VW +FLP D 
Sbjct  8    GGEIVGPGPSPFDGLPEDCISNIISFTSPRDACVAASVSKTFESAANSDNVWEKFLPPDY  67

Query  294  SDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
            S ++  S    VF++ KELY  LC++P+L++DG K
Sbjct  68   SSLIPPS---PVFASKKELYLALCHNPVLIEDGRK  99



>gb|KCW44149.1| hypothetical protein EUGRSUZ_L02439, partial [Eucalyptus grandis]
Length=307

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +3

Query  129  RVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILL  308
            R G DF + LPEG I+ ++S TS  DA RL+ +S +FK+A +SD+VW  FLP +   ++ 
Sbjct  2    RDGPDF-SELPEGCIASVVSFTSPADACRLAPVSSLFKSACDSDAVWASFLPPECRQMV-  59

Query  309  RSRSPVVFSNMKELYFTLCNSPILLDDG  392
                P   S++KELYF+LC+ P+L+DDG
Sbjct  60   ----PRRVSSLKELYFSLCDDPVLVDDG  83



>ref|XP_010430674.1| PREDICTED: F-box protein PP2-B10-like [Camelina sativa]
Length=330

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 60/84 (71%), Gaps = 3/84 (4%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPE  IS IIS TS  DA   +V+S++FK+A +SD +W +F+P+D   ++  SR   
Sbjct  33   FNWLPEECISSIISFTSPEDACVAAVVSKIFKSAVKSDIIWEKFIPEDYISLIPPSR---  89

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
            VFS+ K+LYF+LC+ P+L+DDG+K
Sbjct  90   VFSSKKDLYFSLCHDPLLIDDGNK  113



>emb|CBI38320.3| unnamed protein product [Vitis vinifera]
Length=160

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 65/100 (65%), Gaps = 3/100 (3%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F++LPEG I DI+ LT+  DA RLS ++ VF +AAESDS+W  FLP D  +I+ RS    
Sbjct  14   FSALPEGAIVDILKLTTPRDACRLSAVASVFSSAAESDSLWESFLPPDYLEIVSRSSESP  73

Query  327  V---FSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
                FS  KEL+F+LC+SP+L+D G +  +++     K Y
Sbjct  74   SRRDFSTKKELFFSLCDSPLLIDGGRRGFWLEKQSGKKCY  113



>ref|XP_010269615.1| PREDICTED: F-box protein PP2-B15-like [Nelumbo nucifera]
Length=277

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPE  +S I+SLTS  DA R  ++S   ++AA+S+ VW  FLP D  +IL  S SPV
Sbjct  3    FNLLPEDCVSHILSLTSPRDACRYCLVSTALRSAAQSNVVWENFLPSDFQEILWMSVSPV  62

Query  327  VFSNMKELYFTLCNSPILLDDGSKL  401
             F + KELYF+LC SPIL+D G K+
Sbjct  63   SFLSKKELYFSLC-SPILVDGGRKV  86



>ref|XP_010502240.1| PREDICTED: F-box protein PP2-B10-like [Camelina sativa]
Length=282

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 62/95 (65%), Gaps = 3/95 (3%)
 Frame = +3

Query  114  GSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDL  293
            G E++      F SLPE  IS IIS T+  DA   + +S+ F++AA+SD +W +F+P + 
Sbjct  3    GGEIVSKSSSPFDSLPEDCISTIISFTNPRDACVAATVSKTFESAAKSDIIWEKFIPAEY  62

Query  294  SDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
              ++  SR   VFS+ K+LYF+LCN P+L+DDG K
Sbjct  63   ESLVSSSR---VFSSKKKLYFSLCNDPLLIDDGKK  94



>ref|XP_010070124.1| PREDICTED: F-box protein PP2-B10-like [Eucalyptus grandis]
 gb|KCW58715.1| hypothetical protein EUGRSUZ_H01358 [Eucalyptus grandis]
Length=312

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 60/88 (68%), Gaps = 6/88 (7%)
 Frame = +3

Query  129  RVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILL  308
            R G DF + LPEG I+ ++S TS  DA RL+ +S +FK+A +SD+VW  FLP +   ++ 
Sbjct  12   RDGPDF-SELPEGCIASVVSFTSPADACRLAPVSSLFKSACDSDAVWASFLPPECRHMV-  69

Query  309  RSRSPVVFSNMKELYFTLCNSPILLDDG  392
                P   S++KELYF+LC+ P+L+DDG
Sbjct  70   ----PRRVSSLKELYFSLCDDPVLVDDG  93



>ref|XP_009618931.1| PREDICTED: putative F-box protein PP2-B12 [Nicotiana tomentosiformis]
Length=338

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVV-F  332
            LPEG I++I++LTS +D  RLS++S   ++AA+SDSVW +FLP D   I+ +S +P+  F
Sbjct  19   LPEGCIAEILTLTSPIDVCRLSLVSASVRSAADSDSVWAKFLPSDYRSIISQSLTPIPDF  78

Query  333  SNMKELYFTLCNSPILLDDGSK  398
             + K+LY  LC+ P+L+D+G K
Sbjct  79   RSNKDLYVYLCHHPVLIDEGRK  100



>ref|XP_008803651.1| PREDICTED: F-box protein PP2-B11-like [Phoenix dactylifera]
Length=291

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG IS ++SLT+  D+ R +++S  F++AA SD++W RFLP D   IL R+  PV +S
Sbjct  17   LPEGCISHVLSLTTPPDSCRSALVSAAFRSAANSDALWERFLPSDYESILSRAVDPVKYS  76

Query  336  NMKELYFTLCNSPILLDDGS  395
            + KELYF LC+S IL+D G+
Sbjct  77   SKKELYFRLCDS-ILVDGGT  95



>ref|XP_006344703.1| PREDICTED: F-box protein PP2-B15-like [Solanum tuberosum]
Length=282

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = +3

Query  141  DFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRS  320
            +    LPE  IS II LTS  DA +LS++S +F++ AE D VW  FLP D   I  +S +
Sbjct  6    EHLYDLPEDCISSIICLTSPRDALKLSLVSSIFRSVAELDCVWDAFLPSDWQHIATKSVT  65

Query  321  PVVFSNMKELYFTLCNSPILLDDGSK  398
            P+ FS+ ++L+F LCNS IL+DDG+K
Sbjct  66   PLKFSSKRDLFFCLCNS-ILIDDGNK  90



>emb|CAN62941.1| hypothetical protein VITISV_034195 [Vitis vinifera]
Length=137

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 61/89 (69%), Gaps = 3/89 (3%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F++LPEG I DI+ LT+  D  RLS ++ VF +AAESDS+W  FLP D  +I+ RS    
Sbjct  18   FSALPEGAIVDILKLTTPRDTCRLSAVASVFLSAAESDSLWESFLPPDYLEIVSRSSESS  77

Query  327  V---FSNMKELYFTLCNSPILLDDGSKLR  404
                FS  KEL+F+LC+SP+L+D G ++R
Sbjct  78   SRLDFSTKKELFFSLCDSPLLIDGGRRVR  106



>ref|XP_006481706.1| PREDICTED: F-box protein PP2-B15-like isoform X1 [Citrus sinensis]
Length=283

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPE  +S I+SLTS +DA R +++S  F++AAES+  W +FLP D  DI+ RS + + FS
Sbjct  2    LPEDCVSIILSLTSPLDACRATLVSWAFRSAAESNVAWEKFLPSDYQDIVSRSITSLKFS  61

Query  336  NMKELYFTLCNSPILLDDGSK  398
            + KELY  LCN PIL+D G K
Sbjct  62   SKKELYLHLCN-PILIDGGRK  81



>gb|KDP38872.1| hypothetical protein JCGZ_05029 [Jatropha curcas]
Length=272

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG +S I+S TS +D  R S++S  F++A +SD+VW RFLP D  DIL R  +P+ FS
Sbjct  2    LPEGCVSKILSFTSPLDVCRSSLVSSDFRSAMDSDAVWERFLPVDYHDILSRLVTPLKFS  61

Query  336  NMKELYFTLCNSPILLDDGSK  398
            + KELY  LC  P+L+D G K
Sbjct  62   SKKELYLRLCE-PVLIDAGRK  81



>emb|CAN62661.1| hypothetical protein VITISV_027495 [Vitis vinifera]
Length=211

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 67/104 (64%), Gaps = 4/104 (4%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDIL---  305
            G+D  ++LPEG I+ I++ TS  DA R+SV+S  F +AAESD++W  FLP D  +I+   
Sbjct  17   GVDL-SALPEGCIARILACTSPRDACRMSVVSPEFLSAAESDALWQTFLPDDYQEIIGGS  75

Query  306  LRSRSPVVFSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
              S + + FS+ KEL+F LCNSP+L+D G K  ++      K Y
Sbjct  76   SESSARLDFSSKKELFFRLCNSPLLIDGGKKSFWLDKESGKKCY  119



>ref|XP_006489774.1| PREDICTED: putative F-box protein PP2-B2-like [Citrus sinensis]
 gb|KDO40884.1| hypothetical protein CISIN_1g024822mg [Citrus sinensis]
Length=262

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 61/89 (69%), Gaps = 3/89 (3%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS-  314
            MD   +LP   IS+IISLT+  DA RLSV+SRVF++AA+SDS W  FLP D   I+  S 
Sbjct  1    MDITIALPAECISNIISLTTPRDACRLSVVSRVFRSAADSDSAWENFLPSDYKQIISNSV  60

Query  315  --RSPVVFSNMKELYFTLCNSPILLDDGS  395
               S +   + K+LYF LC++PI++++G+
Sbjct  61   SDSSLITSLSKKDLYFHLCHNPIIINNGT  89



>ref|XP_006481707.1| PREDICTED: F-box protein PP2-B15-like isoform X2 [Citrus sinensis]
Length=275

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPE  +S I+SLTS +DA R +++S  F++AAES+  W +FLP D  DI+ RS + + FS
Sbjct  2    LPEDCVSIILSLTSPLDACRATLVSWAFRSAAESNVAWEKFLPSDYQDIVSRSITSLKFS  61

Query  336  NMKELYFTLCNSPILLDDGSK  398
            + KELY  LCN PIL+D G K
Sbjct  62   SKKELYLHLCN-PILIDGGRK  81



>gb|KDO70549.1| hypothetical protein CISIN_1g039003mg [Citrus sinensis]
Length=286

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPE  +S I+SLTS +DA R +++S  F++AAES+  W +FLP D  DI+ RS + + FS
Sbjct  13   LPEDCVSIILSLTSPLDACRATLVSWAFRSAAESNVAWEKFLPSDYQDIVSRSITSLKFS  72

Query  336  NMKELYFTLCNSPILLDDGSK  398
            + KELY  LCN PIL+D G K
Sbjct  73   SKKELYLHLCN-PILIDGGRK  92



>ref|XP_008453631.1| PREDICTED: F-box protein PP2-B10-like [Cucumis melo]
Length=298

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 63/90 (70%), Gaps = 7/90 (8%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F+SLPEG+++ I+S T+  DA R SV+S  F AAA+SD VW  FLP D  +IL+  R P 
Sbjct  13   FSSLPEGVVAKILSFTTPSDACRSSVVSTTFVAAAQSDIVWDSFLPTDW-EILISRRKPS  71

Query  327  ------VFSNMKELYFTLCNSPILLDDGSK  398
                  + S+ KE++F+LC++P+++DDG+K
Sbjct  72   NLNFDPISSSKKEIFFSLCDTPLIIDDGNK  101



>ref|XP_004237494.1| PREDICTED: F-box protein PP2-B10-like [Solanum lycopersicum]
Length=297

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS---RSP  323
             LPEG I+  +SLTS  DA RL++++  F++AAESD+VW RFLP D  DI+ RS      
Sbjct  11   ELPEGCIATALSLTSPKDACRLALVASTFRSAAESDAVWERFLPPDYYDIISRSIDGPDS  70

Query  324  VVFSNMKELYFTLCNSPILLDDGSK  398
            + F + K+LY  LC++PIL+D G++
Sbjct  71   LNFGSKKDLYLYLCDNPILIDGGTR  95



>ref|XP_008450565.1| PREDICTED: putative F-box protein PP2-B12 [Cucumis melo]
Length=265

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LP+  I+ I+S  SA +A RLS++S +  + A+SD VW +FLP D  ++LLR  SP+V++
Sbjct  6    LPQDCIAHILSFASAREACRLSIVSEMMHSMADSDVVWEKFLPFDCKEVLLRLDSPLVYN  65

Query  336  NMKELYFTLCNSPILLDDGSKLRFV  410
              KELYF LC  P L+D G K+ ++
Sbjct  66   TKKELYFKLC-CPHLIDGGKKIFYI  89



>ref|XP_006293187.1| hypothetical protein CARUB_v10019504mg [Capsella rubella]
 gb|EOA26085.1| hypothetical protein CARUB_v10019504mg [Capsella rubella]
Length=307

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 62/98 (63%), Gaps = 4/98 (4%)
 Frame = +3

Query  105  GNGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLP  284
            G GG  L+  G   F  LP   IS+IIS TS  DA   + +S+ F++A +SD+VW +FLP
Sbjct  33   GQGGGALV-FGPSPFDDLPVDCISNIISFTSPRDACVAASVSKTFESAVQSDTVWDKFLP  91

Query  285  QDLSDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
             D S ++  SR   VF++ KELYF LC + +L+DDG K
Sbjct  92   SDYSSLIPPSR---VFASKKELYFALCENHVLIDDGKK  126



>ref|XP_010527859.1| PREDICTED: F-box protein PP2-B1 [Tarenaya hassleriana]
Length=307

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 71/115 (62%), Gaps = 4/115 (3%)
 Frame = +3

Query  132  VGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR  311
             G  +F  +PE  +S IIS T+  DA  +S +S++FK+AA+SD VW RFLP D S ++ +
Sbjct  22   TGESYFHVMPEDSVSCIISFTTPRDACVVSSVSKMFKSAAQSDVVWERFLPSDYSSLVPQ  81

Query  312  SRSPVVFSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLYTCNEASFT-CYGG  473
            S   +VFS+ KELY  L ++P+L+DDG K  +++     K Y  +    T  +GG
Sbjct  82   S---LVFSSKKELYLALSDNPVLIDDGKKSFWLEKPTGKKCYMISALDLTIIWGG  133



>ref|XP_009619612.1| PREDICTED: putative F-box protein PP2-B12 isoform X1 [Nicotiana 
tomentosiformis]
Length=269

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPEG IS+IIS T+  DAAR S IS+ FK+AAESD VW +FLP D  DI+  S S V
Sbjct  9    FTILPEGCISEIISFTTPADAARSSAISKGFKSAAESDVVWDKFLPSDHQDIVSTSVSVV  68

Query  327  VFSNMKELYFTLCNSPILLDDG  392
            V    K+LYF L +SPILL +G
Sbjct  69   VTDCKKDLYFRLSHSPILLREG  90



>ref|XP_006340500.1| PREDICTED: F-box protein At2g02240-like [Solanum tuberosum]
Length=297

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 63/98 (64%), Gaps = 3/98 (3%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS---RSP  323
             LPEG I+  +SLTS  DA RL++++  F++AAESD+VW RFLP D  DI+ RS      
Sbjct  11   ELPEGCIATALSLTSPKDACRLALVASTFRSAAESDAVWDRFLPPDYYDIISRSIDGSDS  70

Query  324  VVFSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
            +   + K+LY  LC++PIL+D G+K   ++ +   K Y
Sbjct  71   LNVGSKKDLYLYLCDNPILIDGGTKSFSLEKWSGKKCY  108



>ref|XP_002270482.1| PREDICTED: F-box protein PP2-B10 [Vitis vinifera]
Length=337

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 65/100 (65%), Gaps = 3/100 (3%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F++LPEG I DI+ LT+  DA RLS ++ VF +AAESDS+W  FLP D  +I+ RS    
Sbjct  14   FSALPEGAIVDILKLTTPRDACRLSAVASVFSSAAESDSLWESFLPPDYLEIVSRSSESP  73

Query  327  V---FSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
                FS  KEL+F+LC+SP+L+D G +  +++     K Y
Sbjct  74   SRRDFSTKKELFFSLCDSPLLIDGGRRGFWLEKQSGKKCY  113



>ref|XP_007143948.1| hypothetical protein PHAVU_007G116000g [Phaseolus vulgaris]
 gb|ESW15942.1| hypothetical protein PHAVU_007G116000g [Phaseolus vulgaris]
Length=264

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPEG I+DI+S T+ +DA RLS++S++F +AA+SD+VW RFLP D   I+ +   P 
Sbjct  3    FEGLPEGCIADILSRTTPIDACRLSMVSKLFHSAADSDAVWERFLPSDYHSIISQCLLP-  61

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             + + K LY  L + P++LD+G K
Sbjct  62   NYPSKKALYLALSDHPVILDEGKK  85



>gb|KCW45031.1| hypothetical protein EUGRSUZ_L01379 [Eucalyptus grandis]
Length=274

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 61/93 (66%), Gaps = 7/93 (8%)
 Frame = +3

Query  129  RVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILL  308
            R G DF A LPEG I+ ++SLTS  DA RL+ +S  FK+A +SD VW  FLP +    + 
Sbjct  11   RNGPDFSA-LPEGCIARVVSLTSPADACRLATLSPAFKSACDSDVVWASFLPPERPQTVS  69

Query  309  RSRSPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
            RS      S++KELYF+LC+ PIL+ DG K+ F
Sbjct  70   RS-----VSSLKELYFSLCDYPILIGDG-KMSF  96



>ref|XP_009619613.1| PREDICTED: F-box protein PP2-B10-like isoform X2 [Nicotiana tomentosiformis]
Length=246

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPEG IS+IIS T+  DAAR S IS+ FK+AAESD VW +FLP D  DI+  S S V
Sbjct  9    FTILPEGCISEIISFTTPADAARSSAISKGFKSAAESDVVWDKFLPSDHQDIVSTSVSVV  68

Query  327  VFSNMKELYFTLCNSPILLDDG  392
            V    K+LYF L +SPILL +G
Sbjct  69   VTDCKKDLYFRLSHSPILLREG  90



>ref|XP_010070337.1| PREDICTED: F-box protein At2g02240-like [Eucalyptus grandis]
Length=197

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 56/82 (68%), Gaps = 5/82 (6%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F++LPEG I+ ++SLTS  DA RL+ +S  FK+A ESD VW  FLP +    + RS    
Sbjct  12   FSALPEGCIARVVSLTSPADACRLATLSLNFKSACESDVVWASFLPPERPQTVSRS----  67

Query  327  VFSNMKELYFTLCNSPILLDDG  392
              S++KELYF+LC+ P+L+ DG
Sbjct  68   -VSSLKELYFSLCDDPVLVRDG  88



>ref|XP_006371767.1| hypothetical protein POPTR_0018s02850g [Populus trichocarpa]
 gb|ERP49564.1| hypothetical protein POPTR_0018s02850g [Populus trichocarpa]
Length=290

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 60/92 (65%), Gaps = 4/92 (4%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
            G+     LPEG +++++SLT+  D  RLS +S +FK+AAESD VW RFLP DL  IL  +
Sbjct  11   GVPLNIDLPEGCVANVLSLTTPQDVCRLSAVSPIFKSAAESDDVWQRFLPNDLESILSTA  70

Query  315  ----RSPVVFSNMKELYFTLCNSPILLDDGSK  398
                      S+ KE+YF+LC++PI++D G K
Sbjct  71   LDGSLLLSSASSKKEVYFSLCDNPIIVDHGRK  102



>ref|XP_010314855.1| PREDICTED: F-box protein PP2-B10-like [Solanum lycopersicum]
Length=266

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD+F  LPEG + DI+S TS  D    S ISR F + AE D +W  FLP D  DI  R  
Sbjct  1    MDYFLLLPEGCVCDILSFTSPKDVVIASAISRGFNSVAEFDVIWENFLPDDYEDINSRYV  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSKLRF  407
            SP +  + ++LYF+LC+ P+L+ DG KL F
Sbjct  61   SPRISPSKRQLYFSLCDFPVLM-DGGKLSF  89



>ref|XP_006291645.1| hypothetical protein CARUB_v10017801mg [Capsella rubella]
 gb|EOA24543.1| hypothetical protein CARUB_v10017801mg [Capsella rubella]
Length=278

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 62/95 (65%), Gaps = 3/95 (3%)
 Frame = +3

Query  114  GSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDL  293
            G E++  G   F  LPE  IS+IIS TS  DA   + +S+ F++AA SD+VW +FLP D 
Sbjct  8    GGEIVVPGPSPFDGLPEDCISNIISFTSPRDACVAASVSKTFESAANSDNVWDKFLPWDY  67

Query  294  SDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
            S ++    SPV+ S  KELY  LC++P+L++DG K
Sbjct  68   SSLI--PPSPVLASK-KELYLALCHNPVLIEDGKK  99



>gb|KCW59014.1| hypothetical protein EUGRSUZ_H016412, partial [Eucalyptus grandis]
Length=149

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 5/82 (6%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F++LPEG I+ ++SLTS  DA RL+ +S  FK+A  SD VW  FLP +    + RS    
Sbjct  12   FSALPEGCIARVVSLTSPADACRLATLSPSFKSACNSDVVWASFLPPECPQTVSRS----  67

Query  327  VFSNMKELYFTLCNSPILLDDG  392
              S++KELYF+LC+ P+L+ DG
Sbjct  68   -VSSLKELYFSLCDDPVLIGDG  88



>ref|XP_004230267.1| PREDICTED: F-box protein PP2-B15-like [Solanum lycopersicum]
Length=278

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 56/87 (64%), Gaps = 1/87 (1%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            M+    LPE  IS II LTS  DA +LS +S +F++ AE D VW  FLP D   I  +S 
Sbjct  1    MEHLYDLPEDCISSIICLTSPPDALKLSQVSSIFRSVAELDCVWDAFLPSDWQHIATKSV  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSK  398
            +P+ FS+ + L+  LCNS IL+DDG+K
Sbjct  61   TPLKFSSKRHLFICLCNS-ILIDDGNK  86



>ref|XP_009379702.1| PREDICTED: putative F-box protein PP2-B12 isoform X1 [Pyrus x 
bretschneideri]
Length=306

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 63/101 (62%), Gaps = 13/101 (13%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD  A LPEG I+ +ISLT+  DAA +S +SR F++A ESDSVWGRFLP D+  IL  S 
Sbjct  1    MDLQA-LPEGCIATVISLTTPRDAATMSSVSRSFRSATESDSVWGRFLPPDIHTILSSSS  59

Query  318  ----------SPVVFSNM-KELYFTLCNSPILLDDGSKLRF  407
                      SP   S   KELY  LC++P+L++ G KL F
Sbjct  60   PFMSVQPPHVSPSSASKTKKELYLALCDNPVLIEQG-KLSF  99



>ref|XP_006420860.1| hypothetical protein CICLE_v10005617mg [Citrus clementina]
 gb|ESR34100.1| hypothetical protein CICLE_v10005617mg [Citrus clementina]
Length=271

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 3/89 (3%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS-  314
            MD   +LP   IS+IISLT+  DA RLSV+S VFK+AA+SDSVW  FLP D   I+  S 
Sbjct  10   MDITIALPAECISNIISLTTPRDACRLSVVSPVFKSAADSDSVWENFLPSDYKQIISNSV  69

Query  315  --RSPVVFSNMKELYFTLCNSPILLDDGS  395
               S +   + K+LYF LC +PI++++G+
Sbjct  70   SDSSLITSLSKKDLYFHLCRNPIIINNGT  98



>ref|XP_006420865.1| hypothetical protein CICLE_v10006813mg, partial [Citrus clementina]
 gb|ESR34105.1| hypothetical protein CICLE_v10006813mg, partial [Citrus clementina]
Length=109

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 62/95 (65%), Gaps = 5/95 (5%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD   +LP   +S IISLT+  DA R SV  RVFK+AA+SD VW +FLP D  +I+  S 
Sbjct  1    MDITDTLPAECMSHIISLTTPRDACRFSVACRVFKSAADSDFVWEKFLPSDYKEIISSSV  60

Query  318  SPVV----FSNMKELYFTLCNSPILLDDGSKLRFV  410
            S       FS+ K+LY  LC++PI++++G+ LR V
Sbjct  61   SDSSLITSFSSKKDLYLHLCHNPIIINNGT-LRLV  94



>ref|XP_006491826.1| PREDICTED: F-box protein At2g02240-like [Citrus sinensis]
Length=314

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 61/87 (70%), Gaps = 6/87 (7%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG I+++ISLT+  DA RLS +S VFK+AAESD+VW RFLP D   +L  + S    S
Sbjct  8    LPEGCIANVISLTTPRDACRLSSVSTVFKSAAESDAVWERFLPPDYPTLLSDAASSSSSS  67

Query  336  NM------KELYFTLCNSPILLDDGSK  398
            +       KELYF+LC++PIL+D+G K
Sbjct  68   SSLHFSSKKELYFSLCHNPILIDEGKK  94



>ref|XP_006493714.1| PREDICTED: F-box protein PP2-B11-like [Citrus sinensis]
Length=262

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 3/89 (3%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS-  314
            MD   +LP   IS+IISLT+  DA RLSV+S VFK+AA+SDSVW  FLP D   I+  S 
Sbjct  1    MDITIALPAECISNIISLTTPRDACRLSVVSPVFKSAADSDSVWENFLPSDYKQIISNSV  60

Query  315  --RSPVVFSNMKELYFTLCNSPILLDDGS  395
               S +   + K+LYF LC +PI++++G+
Sbjct  61   SDSSLITSLSKKDLYFHLCRNPIIINNGT  89



>ref|XP_010041821.1| PREDICTED: F-box protein PP2-B10-like [Eucalyptus grandis]
Length=301

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 59/83 (71%), Gaps = 5/83 (6%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F++LPEG I+ ++S TS  DA RL+ +S +FK+A +SD+VW  FLP D   ++ RS    
Sbjct  14   FSALPEGCIATVVSFTSPPDACRLASVSSIFKSACDSDAVWASFLPPDWLPMVSRS----  69

Query  327  VFSNMKELYFTLCNSPILLDDGS  395
              S++KELYF+LC+ P+L+ DG+
Sbjct  70   -ASSLKELYFSLCDDPVLVGDGT  91



>ref|XP_006420648.1| hypothetical protein CICLE_v10005661mg [Citrus clementina]
 gb|ESR33888.1| hypothetical protein CICLE_v10005661mg [Citrus clementina]
Length=262

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 3/89 (3%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS-  314
            MD   +LP   IS+IISLT+  DA RLSV+S VFK+AA+SDSVW  FLP D   I+  S 
Sbjct  1    MDITIALPAECISNIISLTTPRDACRLSVVSPVFKSAADSDSVWENFLPSDYKQIISNSV  60

Query  315  --RSPVVFSNMKELYFTLCNSPILLDDGS  395
               S +   + K+LYF LC +PI++++G+
Sbjct  61   SDSSLITSLSKKDLYFHLCRNPIIINNGT  89



>ref|XP_007015196.1| F-box family protein, putative [Theobroma cacao]
 gb|EOY32815.1| F-box family protein, putative [Theobroma cacao]
Length=329

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 4/89 (4%)
 Frame = +3

Query  144  FFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR----  311
            F   LPE  ++ I+S T+  DA RLS +S  F++AA SDSVW  FLP D   IL R    
Sbjct  49   FLNELPEECVAKILSATTPADACRLSCLSATFRSAAASDSVWNSFLPPDYQTILSRWAEA  108

Query  312  SRSPVVFSNMKELYFTLCNSPILLDDGSK  398
              S + FS+ K+L+F LC+ PIL+D+G K
Sbjct  109  DSSSLTFSSKKDLFFHLCHVPILVDEGRK  137



>ref|XP_010026291.1| PREDICTED: F-box protein At2g02240-like [Eucalyptus grandis]
Length=221

 Score = 82.4 bits (202),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 5/82 (6%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F++LPEG I+ ++SLTS  DA RL+ +S  FK+A  SD VW  FLP +    + RS    
Sbjct  12   FSALPEGCIARVVSLTSPADACRLATLSPSFKSACNSDVVWASFLPPECPQTVSRS----  67

Query  327  VFSNMKELYFTLCNSPILLDDG  392
              S++KELYF+LC+ P+L+ DG
Sbjct  68   -VSSLKELYFSLCDDPVLIGDG  88



>ref|XP_008789432.1| PREDICTED: putative F-box protein PP2-B12 [Phoenix dactylifera]
Length=292

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +3

Query  150  ASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVV  329
            +SLPE  +S +IS TS +D+ R S +S  F +AA SD+VW  FLP D   IL R+  PV 
Sbjct  9    SSLPEECLSHVISQTSPLDSCRSSAVSTTFCSAASSDTVWEHFLPSDYKSILSRAVHPVE  68

Query  330  FSNMKELYFTLCNSPILLDDG  392
            +++ +EL+F LC+ PIL+DDG
Sbjct  69   YASKRELFFRLCD-PILIDDG  88



>ref|XP_008359908.1| PREDICTED: F-box protein At2g02240-like [Malus domestica]
Length=264

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 59/95 (62%), Gaps = 11/95 (12%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD  A LPEG I+ +ISLT+  DAA +S +SR F++AAES +VWGRFLP DL  IL  S 
Sbjct  1    MDLQA-LPEGCIATVISLTTPRDAATMSSVSRSFRSAAESXAVWGRFLPPDLHTILSSSS  59

Query  318  ----------SPVVFSNMKELYFTLCNSPILLDDG  392
                      +P      KELY  LC++P+L++ G
Sbjct  60   PSMSVHPPHVAPSASKTKKELYLALCDNPVLVEQG  94



>ref|XP_009101264.1| PREDICTED: putative F-box protein PP2-B2 [Brassica rapa]
Length=286

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 3/93 (3%)
 Frame = +3

Query  120  ELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSD  299
            ++I  G   F  LPE  IS IIS TS  DA   + +S+ F++A +SD VW +FLP + S 
Sbjct  18   DIIMTGPSPFDFLPEDCISKIISFTSPRDACVAASVSKTFESAVKSDIVWEKFLPPEYSS  77

Query  300  ILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
            ++ RSR+   FS+ KELYF LC+ P+L+++G K
Sbjct  78   LIPRSRA---FSSKKELYFALCDYPVLIEEGKK  107



>emb|CDY17600.1| BnaA06g34190D [Brassica napus]
Length=286

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 61/93 (66%), Gaps = 3/93 (3%)
 Frame = +3

Query  120  ELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSD  299
            ++I  G   F  LPE  IS IIS TS  DA   + +S+ F++A +SD VW +FLP + S 
Sbjct  18   DIIMTGPSPFDFLPEDCISKIISFTSPRDACVAASVSKTFESAVKSDIVWEKFLPPEYSS  77

Query  300  ILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
            ++ RSR+   FS+ KELYF LC+ P+L+++G K
Sbjct  78   LIPRSRA---FSSKKELYFVLCDYPVLIEEGKK  107



>emb|CAN65690.1| hypothetical protein VITISV_022466 [Vitis vinifera]
Length=277

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LP+  IS I+S TS  DA R  ++S   + A +SDSVW +FLP D  +IL R  SP+
Sbjct  3    FELLPQDCISHILSCTSPRDACRSELVSTTVRHAGDSDSVWEKFLPSDYQEILSRLVSPL  62

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
            VF++ KELY  LC SP+L+D+G K
Sbjct  63   VFASKKELYSKLC-SPLLIDEGRK  85



>ref|XP_002324346.2| hypothetical protein POPTR_0018s02860g [Populus trichocarpa]
 gb|EEF02911.2| hypothetical protein POPTR_0018s02860g [Populus trichocarpa]
Length=299

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 62/96 (65%), Gaps = 8/96 (8%)
 Frame = +3

Query  129  RVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILL  308
            R G      LPEG I++ +S T+ +D ARLS +S +FK+AA SD VW RFLP DL  +L 
Sbjct  3    RSGELHLNELPEGCIANALSFTAPLDVARLSAVSPMFKSAAISDVVWERFLPSDLESVL-  61

Query  309  RSRSP------VVFSNMKELYFTLCNSPILLDDGSK  398
             S SP         S+ +ELYF+LC++PIL+++G K
Sbjct  62   -STSPDGSLLLASVSSKRELYFSLCDNPILVENGRK  96



>gb|KCW59018.1| hypothetical protein EUGRSUZ_H01644 [Eucalyptus grandis]
Length=274

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 5/82 (6%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F++LPEG I+ ++SLTS  DA RL+ +S  FK+A  SD VW  FLP +    + RS    
Sbjct  12   FSALPEGCIARVVSLTSPADACRLATLSPSFKSACNSDVVWASFLPPECPQTVSRS----  67

Query  327  VFSNMKELYFTLCNSPILLDDG  392
              S++KELYF+LC+ P+L+ DG
Sbjct  68   -VSSLKELYFSLCDDPVLIGDG  88



>emb|CAN62662.1| hypothetical protein VITISV_027496 [Vitis vinifera]
Length=266

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 65/105 (62%), Gaps = 4/105 (4%)
 Frame = +3

Query  132  VGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR  311
             G+DF ++LPE  I+ I++ TS  DA R+S +S  F +AAESD++W  FLP D  +I+ R
Sbjct  16   AGVDF-SALPEDCIAGILARTSIRDACRMSTVSPEFLSAAESDALWETFLPADYREIIGR  74

Query  312  SRSPVV---FSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
            S        FS+ KEL+F LCNSP+L+D G K  ++      K Y
Sbjct  75   SSESSARQDFSSKKELFFRLCNSPLLIDGGKKSFWLDKESGKKCY  119



>ref|XP_004169480.1| PREDICTED: F-box protein PP2-B10-like [Cucumis sativus]
Length=316

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 61/83 (73%), Gaps = 3/83 (4%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV--V  329
            LPEG+I++++S T+ +DA   + +SRVF AAA+SD VW RFLP D  D+L+  R     +
Sbjct  27   LPEGVIANVLSFTTPIDACTAAAVSRVFNAAAQSDFVWDRFLPPDW-DVLISHRKSFDPL  85

Query  330  FSNMKELYFTLCNSPILLDDGSK  398
             S+ K+++F+LCN+P+L+DD +K
Sbjct  86   SSSKKDIFFSLCNNPVLIDDRNK  108



>ref|XP_010095574.1| F-box protein [Morus notabilis]
 gb|EXB60973.1| F-box protein [Morus notabilis]
Length=271

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR--SRSPVV  329
            LPE  +S I+SLTS  DA R S++S  F +AAESD VW +FLP D  ++LLR  + +P+ 
Sbjct  3    LPEDCVSTILSLTSPQDACRSSLVSSTFNSAAESDVVWEKFLPSDYQELLLRLVNDNPLK  62

Query  330  FSNMKELYFTLCNSPILLDDGSK  398
                KEL+F LCN P+L+D G K
Sbjct  63   HPTKKELFFHLCN-PVLIDGGRK  84



>ref|XP_006395798.1| hypothetical protein EUTSA_v10004729mg [Eutrema salsugineum]
 gb|ESQ33084.1| hypothetical protein EUTSA_v10004729mg [Eutrema salsugineum]
Length=285

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 61/97 (63%), Gaps = 3/97 (3%)
 Frame = +3

Query  108  NGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQ  287
              G E+I  G   F SLP   IS IIS TS  DA   + +S+ F++A +SDSVW +FLP 
Sbjct  13   ESGGEIIISGTSPFDSLPVDCISKIISFTSPRDACVAASVSKTFESAVKSDSVWEKFLPS  72

Query  288  DLSDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
            + S ++  SR   VFS+ KE+YF+LCN   L+++G K
Sbjct  73   EYSSLIPASR---VFSSKKEIYFSLCNDHRLIEEGKK  106



>ref|XP_010026288.1| PREDICTED: F-box protein At2g02240-like [Eucalyptus grandis]
Length=267

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 5/82 (6%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F++LPEG I+ ++SLTS  DA RL+ +S  FK+A  SD VW  FLP +    + RS    
Sbjct  12   FSALPEGCIARVVSLTSPADACRLATLSPSFKSACNSDVVWASFLPPECPQTVSRS----  67

Query  327  VFSNMKELYFTLCNSPILLDDG  392
              S++KELYF+LC+ P+L+ DG
Sbjct  68   -VSSLKELYFSLCDDPVLIGDG  88



>ref|XP_006420858.1| hypothetical protein CICLE_v10005659mg [Citrus clementina]
 gb|ESR34098.1| hypothetical protein CICLE_v10005659mg [Citrus clementina]
Length=262

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 60/89 (67%), Gaps = 3/89 (3%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS-  314
            MD   +LP   IS+IISLT+  DA RLSV+SRVF++AA+SDS W  FLP D   I+  S 
Sbjct  1    MDITIALPAECISNIISLTTPRDACRLSVVSRVFRSAADSDSAWENFLPSDYKQIISNSV  60

Query  315  --RSPVVFSNMKELYFTLCNSPILLDDGS  395
               S     + K+LYF LC++PI++++G+
Sbjct  61   SDSSLTTSLSKKDLYFHLCHNPIIINNGN  89



>ref|XP_002876808.1| hypothetical protein ARALYDRAFT_904457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53067.1| hypothetical protein ARALYDRAFT_904457 [Arabidopsis lyrata subsp. 
lyrata]
Length=317

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 59/84 (70%), Gaps = 3/84 (4%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPE  IS+IIS T+  DA   + +S+ F++A +SD+VW +FLP D S ++ +SR   
Sbjct  25   FDYLPEDCISNIISFTTPRDACVAASVSKTFESAVQSDTVWEKFLPPDYSSLVPQSR---  81

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
            VF + K+LYF+LC+ P+L++DG K
Sbjct  82   VFLSKKDLYFSLCHEPLLIEDGKK  105



>ref|XP_004146355.1| PREDICTED: F-box protein PP2-B10-like [Cucumis sativus]
Length=277

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 60/84 (71%), Gaps = 2/84 (2%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F+SLPEG+I++I+SLTS +D  RLS +S  F AAA+SD  W RF+P D    LL SR   
Sbjct  4    FSSLPEGVIANILSLTSPLDNCRLSAVSWTFHAAAQSDVAWERFIPSDYH--LLISRMNP  61

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
              S+ K+++F+L ++P+L+DDG +
Sbjct  62   TSSSKKDIFFSLSDTPLLIDDGKQ  85



>gb|KGN65431.1| hypothetical protein Csa_1G421910 [Cucumis sativus]
Length=308

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 64/95 (67%), Gaps = 7/95 (7%)
 Frame = +3

Query  114  GSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDL  293
            G E++      F+SLPEG+I++I+SLTS +D  RLS +S  F AAA+SD  W RF+P D 
Sbjct  23   GKEMVE-----FSSLPEGVIANILSLTSPLDNCRLSAVSWTFHAAAQSDVAWERFIPSDY  77

Query  294  SDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
               LL SR     S+ K+++F+L ++P+L+DDG +
Sbjct  78   H--LLISRMNPTSSSKKDIFFSLSDTPLLIDDGKQ  110



>ref|XP_002270580.1| PREDICTED: putative F-box protein PP2-B12 [Vitis vinifera]
Length=277

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 65/105 (62%), Gaps = 4/105 (4%)
 Frame = +3

Query  132  VGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR  311
             G+DF ++LPE  I+ I++ TS  DA R+S +S  F +AAESD++W  FLP D  +I+ R
Sbjct  16   AGVDF-SALPEDCIAGILARTSIRDACRMSTVSPEFLSAAESDALWETFLPADYREIIGR  74

Query  312  SRSPVV---FSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
            S        FS+ KEL+F LCNSP+L+D G K  ++      K Y
Sbjct  75   SSESSARQDFSSKKELFFRLCNSPLLIDGGKKSFWLDKESGKKCY  119



>ref|XP_010514007.1| PREDICTED: F-box protein PP2-B10-like [Camelina sativa]
 ref|XP_010514008.1| PREDICTED: F-box protein PP2-B10-like [Camelina sativa]
Length=300

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPE  IS IIS TS  DA   +V+S++FK+A +SD +W +F+ +D   ++  SR   
Sbjct  34   FNWLPEECISSIISFTSPEDACVSAVVSKIFKSAVKSDIIWEKFISEDYKSLIPPSR---  90

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
            VFS+ KELYF+LC+ P+L++DG K
Sbjct  91   VFSSKKELYFSLCHDPLLIEDGKK  114



>ref|XP_004146303.1| PREDICTED: F-box protein PP2-B10-like [Cucumis sativus]
 gb|KGN65429.1| hypothetical protein Csa_1G421890 [Cucumis sativus]
Length=299

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 64/94 (68%), Gaps = 7/94 (7%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
            G+  F+SLPEG+++ I+S T+  DA R SV+S  F AAA+SD VW  FLP D  +IL+  
Sbjct  9    GISDFSSLPEGVVAKILSFTTPSDACRSSVVSTTFVAAAQSDIVWDSFLPTDW-EILISR  67

Query  315  RSPV------VFSNMKELYFTLCNSPILLDDGSK  398
            R P       + S+ K ++F+LC++P+++DDG+K
Sbjct  68   RKPSNLNFDPISSSKKGIFFSLCDTPLIIDDGNK  101



>ref|XP_010065003.1| PREDICTED: F-box protein PP2-B11-like [Eucalyptus grandis]
 gb|KCW70612.1| hypothetical protein EUGRSUZ_F03790 [Eucalyptus grandis]
Length=301

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 57/82 (70%), Gaps = 5/82 (6%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F+ LPEG I+ ++S TS  DA RL+ +S +FK+A +SD+VW  FLP D   ++ RS    
Sbjct  14   FSVLPEGCIATVVSFTSPPDACRLASVSSIFKSACDSDAVWASFLPPDWRPMVSRS----  69

Query  327  VFSNMKELYFTLCNSPILLDDG  392
              S++KELYF+LC+ P+L+ DG
Sbjct  70   -ASSLKELYFSLCDDPVLVGDG  90



>ref|XP_003638370.1| F-box protein PP2-B1 [Medicago truncatula]
 gb|KEH43703.1| phloem protein 2-B11 [Medicago truncatula]
Length=275

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            M  F  L EG IS I+S T+ VDA RLSV+S+ F +AA+SD+VW  FLP D++ I+ +S 
Sbjct  1    MTGFEDLAEGCISSILSRTTPVDAGRLSVVSKTFLSAADSDAVWNHFLPSDVNSIISQSP  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSK  398
            S     + K LY TL + PI++DD  K
Sbjct  61   SLANAPSKKALYLTLSDRPIIIDDAKK  87



>emb|CDY17599.1| BnaA06g34180D [Brassica napus]
Length=283

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F S PE  IS IIS TS  D    + +S+ F++A +SD VW +FLP +   ++ RSR   
Sbjct  24   FDSFPEDCISKIISFTSPRDTCVAATVSKAFESAVKSDVVWEKFLPLEYESLVPRSRE--  81

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             FS+ KE+YF LC+ P+L+DDG+K
Sbjct  82   -FSSKKEMYFALCDEPVLIDDGTK  104



>emb|CDY09382.1| BnaA02g26280D [Brassica napus]
Length=266

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 64/104 (62%), Gaps = 3/104 (3%)
 Frame = +3

Query  114  GSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDL  293
            G E I  G   F +LP   IS IIS TS  DA   + +S+  ++AA+SDS+W +FLP + 
Sbjct  10   GRESIISGPSPFDTLPVDCISSIISFTSPRDACNAASVSKTLESAAKSDSLWEKFLPLEY  69

Query  294  SDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK-LRFVKMYG  422
            + ++   + P VFS+ KELYF LC+ P+L++DG K  R  K  G
Sbjct  70   TSLI--PQYPRVFSSKKELYFALCDDPLLIEDGKKSFRLEKASG  111



>ref|XP_009338226.1| PREDICTED: F-box protein PP2-B15-like [Pyrus x bretschneideri]
Length=282

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 60/97 (62%), Gaps = 1/97 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPE   + I+S TS  DA R S++S  F+A A++DSVW +FLP D   IL R  SP+
Sbjct  3    FDQLPEDCFAHILSFTSPGDACRSSLVSSSFRATADADSVWRKFLPSDHKQILSRFVSPI  62

Query  327  VFSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
             +S+ K+L+  LC SP L+D G K+ F++     K Y
Sbjct  63   AYSSSKDLFMKLC-SPNLIDGGDKMFFIEKSTGKKCY  98



>ref|XP_002512468.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49920.1| conserved hypothetical protein [Ricinus communis]
Length=283

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F SLPEG +S ++S TS +   + S++S  F++AA+SD VW  FLP D  DI+ RS +P+
Sbjct  3    FTSLPEGCLSTVLSFTSPLHVCKSSLVSTSFQSAADSDIVWESFLPCDYPDIISRSITPL  62

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             FS+ KEL+  LC+ PI LD G K
Sbjct  63   KFSSKKELFICLCD-PIFLDGGRK  85



>ref|XP_010923971.1| PREDICTED: F-box protein PP2-B10-like [Elaeis guineensis]
Length=262

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 58/84 (69%), Gaps = 2/84 (2%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG IS ++S T+  D+ R +++S  F++AA SD++W RFLP D   IL ++  PV +S
Sbjct  18   LPEGCISHVLSFTTPRDSCRSALVSPTFRSAASSDALWERFLPSDHQSILSQAVDPVRYS  77

Query  336  NMKELYFTLCNSPILLDDGSKLRF  407
            + KELYF LC+S  +L DG K+ F
Sbjct  78   SKKELYFRLCDS--ILIDGGKMSF  99



>emb|CBI38323.3| unnamed protein product [Vitis vinifera]
Length=311

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 65/105 (62%), Gaps = 4/105 (4%)
 Frame = +3

Query  132  VGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR  311
             G+DF ++LPE  I+ I++ TS  DA R+S +S  F +AAESD++W  FLP D  +I+ R
Sbjct  50   AGVDF-SALPEDCIAGILARTSIRDACRMSTVSPEFLSAAESDALWETFLPADYREIIGR  108

Query  312  SRSPVV---FSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
            S        FS+ KEL+F LCNSP+L+D G K  ++      K Y
Sbjct  109  SSESSARQDFSSKKELFFRLCNSPLLIDGGKKSFWLDKESGKKCY  153



>ref|XP_002876816.1| phloem protein 2-B10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53075.1| phloem protein 2-B10 [Arabidopsis lyrata subsp. lyrata]
Length=273

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F SLPE  I++IIS T+  DA   + +S+ F++A +SD +W +FLP +   ++  SRS  
Sbjct  14   FDSLPEDCIANIISFTNPRDACVAATVSKTFESAVKSDIIWEKFLPAEYESLIPPSRS--  71

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             FS+ KELYF+LCN P+L+DD  K
Sbjct  72   -FSSKKELYFSLCNDPVLIDDDKK  94



>gb|ABB77431.1| non-S-locus F-box-like protein 2011 [Petunia integrifolia subsp. 
inflata]
Length=143

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDIL--LRSRSPV  326
             LPEG I++++SLTS +D  RLS+++ +F++AA+SD+VW RFLP D  DI+  +   S +
Sbjct  15   QLPEGCIANVLSLTSPMDTCRLSLVASIFRSAADSDAVWDRFLPPDYRDIISGIGPGSII  74

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             F + KELY  L + P L+D G+K
Sbjct  75   GFGSKKELYLYLSDHPFLIDGGTK  98



>gb|KGN65433.1| hypothetical protein Csa_1G421930 [Cucumis sativus]
Length=315

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 61/83 (73%), Gaps = 3/83 (4%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV--V  329
            LPEG+I++++S T+ +DA   + +SRVF AAA+SD VW RFLP D  D+L+  R     +
Sbjct  27   LPEGVIANVLSFTTPIDACTAAAVSRVFNAAAQSDFVWDRFLPPDW-DVLISYRKSFDPL  85

Query  330  FSNMKELYFTLCNSPILLDDGSK  398
             S+ K+++F+LCN+P+L+DD +K
Sbjct  86   SSSKKDIFFSLCNNPVLIDDRNK  108



>ref|XP_004146357.1| PREDICTED: F-box protein PP2-B10-like [Cucumis sativus]
Length=316

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 61/83 (73%), Gaps = 3/83 (4%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV--V  329
            LPEG+I++++S T+ +DA   + +SRVF AAA+SD VW RFLP D  D+L+  R     +
Sbjct  27   LPEGVIANVLSFTTPIDACTAAAVSRVFNAAAQSDFVWDRFLPPDW-DVLISYRKSFDPL  85

Query  330  FSNMKELYFTLCNSPILLDDGSK  398
             S+ K+++F+LCN+P+L+DD +K
Sbjct  86   SSSKKDIFFSLCNNPVLIDDRNK  108



>ref|XP_002324345.1| hypothetical protein POPTR_0018s02860g [Populus trichocarpa]
 gb|EEF02910.1| hypothetical protein POPTR_0018s02860g [Populus trichocarpa]
Length=398

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 62/96 (65%), Gaps = 8/96 (8%)
 Frame = +3

Query  129  RVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILL  308
            R G      LPEG I++ +S T+ +D ARLS +S +FK+AA SD VW RFLP DL  +L 
Sbjct  3    RSGELHLNELPEGCIANALSFTAPLDVARLSAVSPMFKSAAISDVVWERFLPSDLESVL-  61

Query  309  RSRSP------VVFSNMKELYFTLCNSPILLDDGSK  398
             S SP         S+ +ELYF+LC++PIL+++G K
Sbjct  62   -STSPDGSLLLASVSSKRELYFSLCDNPILVENGRK  96



>ref|XP_004304799.1| PREDICTED: putative F-box protein PP2-B12-like [Fragaria vesca 
subsp. vesca]
Length=283

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 62/86 (72%), Gaps = 3/86 (3%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILL---RSR  317
            F +LPEG I+ +ISLTS  DA RLS++S+V ++AAESD+VW +F+P +    +L    S 
Sbjct  8    FQALPEGCIATVISLTSPPDACRLSLLSKVVRSAAESDAVWDKFIPPETQITILSHPNSL  67

Query  318  SPVVFSNMKELYFTLCNSPILLDDGS  395
            S   F + K+L+ TLC++P+L+++G+
Sbjct  68   SSPNFKSKKDLFMTLCDNPVLINEGT  93



>gb|ADE77551.1| unknown [Picea sitchensis]
Length=291

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            L E  IS I+S T+  D  RLS +SR+F AAA  DS+W +F+PQ    IL R+ +P+ F+
Sbjct  26   LTESCISAILSFTTPRDVCRLSAVSRLFTAAANGDSLWNKFIPQQCYQILSRAVTPIEFA  85

Query  336  NMKELYFTLCNSPILLDDGSKL  401
            + +ELYF LC+S +L+D G+++
Sbjct  86   SKRELYFRLCDS-VLIDGGTQI  106



>ref|XP_004135585.1| PREDICTED: F-box protein PP2-B15-like [Cucumis sativus]
 ref|XP_004157234.1| PREDICTED: F-box protein PP2-B15-like [Cucumis sativus]
Length=270

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 58/94 (62%), Gaps = 1/94 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LP+  I+ I+S  SA +A RLS++S +  +  +SD VW +FLP D   +LLR  SP+V++
Sbjct  6    LPQDCIAHILSFASAREACRLSIVSEMMHSMVDSDVVWEKFLPFDCKKVLLRLDSPIVYA  65

Query  336  NMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
              KELYF LC  P L+D G K+ ++      K Y
Sbjct  66   TKKELYFKLC-CPHLVDGGKKIFYIDKETGKKCY  98



>gb|KGN65432.1| hypothetical protein Csa_1G421920 [Cucumis sativus]
Length=308

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS----  314
            F+SLPEG+++ I+SLT+  DA   S +S++F AAA+SD VW +FLP D    + RS    
Sbjct  18   FSSLPEGVVAKILSLTTPPDACVSSAVSKIFHAAAQSDIVWNQFLPTDWELFISRSNPNK  77

Query  315  -RSPVVFSNMKELYFTLCNSPILLDDGSK  398
             +   +FS  K+++F+LC  P+L+DDG+K
Sbjct  78   LKFDPIFSPKKDIFFSLCYFPVLIDDGNK  106



>ref|XP_002308717.2| hypothetical protein POPTR_0006s28280g [Populus trichocarpa]
 gb|EEE92240.2| hypothetical protein POPTR_0006s28280g [Populus trichocarpa]
Length=311

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 3/84 (4%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILL---RSRSPV  326
            LPEG I+++++ T   DA RLS++S +FK+A ESD+VW RFLP+D   I+          
Sbjct  25   LPEGCIANVLAFTGPRDACRLSIVSSLFKSAGESDAVWERFLPRDYQSIIFTSDSYVLLS  84

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
              S+ KELY  LC  PI++DDG K
Sbjct  85   SLSSKKELYLRLCEKPIIIDDGKK  108



>ref|XP_004146356.1| PREDICTED: F-box protein PP2-B10-like [Cucumis sativus]
Length=299

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS----  314
            F+SLPEG+++ I+SLT+  DA   S +S++F AAA+SD VW +FLP D    + RS    
Sbjct  9    FSSLPEGVVAKILSLTTPPDACVSSAVSKIFHAAAQSDIVWNQFLPTDWELFISRSNPNK  68

Query  315  -RSPVVFSNMKELYFTLCNSPILLDDGSK  398
             +   +FS  K+++F+LC  P+L+DDG+K
Sbjct  69   LKFDPIFSPKKDIFFSLCYFPVLIDDGNK  97



>gb|EYU37273.1| hypothetical protein MIMGU_mgv1a023496mg [Erythranthe guttata]
Length=269

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVF  332
            SLPE  +S IISLT   DA R S++S  F+ AA+SD VW +FLP D SDI+  S SP  F
Sbjct  10   SLPEECLSHIISLTCPKDACRSSLVSCTFRDAADSDLVWNKFLPLDYSDIISNSVSPFFF  69

Query  333  SNMKELYFTLCNSPILLDD  389
            S+ K+LY  L ++P+L+D+
Sbjct  70   SSKKDLYAKLSSTPLLIDE  88



>emb|CDY03058.1| BnaC07g21690D [Brassica napus]
Length=286

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPE  IS IIS TS  DA   + +S+ F++A +SD VW +FLP + S ++ RSR+  
Sbjct  27   FDFLPEDCISKIISFTSPRDACVAASVSKTFESAVKSDIVWEKFLPPEYSSLIPRSRA--  84

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             FS+ KELYF LC+ P+L+++G K
Sbjct  85   -FSSKKELYFALCDDPVLIEEGKK  107



>ref|XP_011036720.1| PREDICTED: putative F-box protein PP2-B2 isoform X2 [Populus 
euphratica]
Length=532

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 67/110 (61%), Gaps = 4/110 (4%)
 Frame = +3

Query  117  SELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLS  296
            S+++  G+      PEG +++++SLT+  D  RLS +S +FK+AAESD  W RFLP DL 
Sbjct  3    SDMVVGGVPLNFDQPEGCVANVLSLTTPQDVCRLSAVSPIFKSAAESDVAWQRFLPNDLE  62

Query  297  DILLRS----RSPVVFSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKL  434
             IL  +          S+ KE+YF+LC++PI++D G K + +K   +  L
Sbjct  63   SILSTALDGSLLLSSASSKKEVYFSLCDNPIIVDHGRKFKRIKRTAIKSL  112



>ref|XP_009400485.1| PREDICTED: F-box protein At2g02240-like [Musa acuminata subsp. 
malaccensis]
Length=262

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            +P  ++S +++ T+  DA R S +SR+F+AA+ SD +W RFLP ++ +IL R+ +P+ FS
Sbjct  10   MPSDVVSKVLAFTTPADAGRSSAVSRLFRAASSSDELWKRFLPSNIDEILPRAVAPIEFS  69

Query  336  NMKELYFTLCNSPILLDDGSK  398
            + KEL+  LC+ PIL+D G+K
Sbjct  70   SKKELFSRLCD-PILIDGGNK  89



>ref|XP_002279225.1| PREDICTED: F-box protein PP2-B15 isoform X1 [Vitis vinifera]
Length=277

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LP+  IS I+S TS  DA R  ++S   + A +SDSVW +FLP D  +IL R  SP+
Sbjct  3    FELLPQDCISHILSCTSPRDACRSGLVSTTVRHAGDSDSVWEKFLPSDYQEILSRLVSPL  62

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
            VF++ KELY  LC  P+L+D+G K
Sbjct  63   VFASKKELYSKLCR-PLLIDEGRK  85



>emb|CDO99428.1| unnamed protein product [Coffea canephora]
Length=147

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%), Gaps = 2/85 (2%)
 Frame = +3

Query  147  FASLPEGLISDIISL-TSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRS-  320
            F+ LPEG +S+IISL  S  DA R S++S  FK+A+ESD++W +F P D  +I+  S S 
Sbjct  12   FSCLPEGCVSNIISLMASPKDAGRASLVSWEFKSASESDTIWEQFFPADYEEIISSSASP  71

Query  321  PVVFSNMKELYFTLCNSPILLDDGS  395
            P+  +  KEL+  LC+ PIL++DG+
Sbjct  72   PLSCATKKELFSHLCHCPILINDGT  96



>ref|XP_007031053.1| Phloem 2-B15-like protein [Theobroma cacao]
 gb|EOY11555.1| Phloem 2-B15-like protein [Theobroma cacao]
Length=365

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 1/82 (1%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVF  332
             LP+   + I+SL S +DA R+SV+S   + AA+SD+VW +FLP D  DIL R   P+V+
Sbjct  5    QLPQDCFAQILSLASPIDACRISVLSSTIRVAADSDNVWEKFLPSDYQDILSRLLHPLVY  64

Query  333  SNMKELYFTLCNSPILLDDGSK  398
            S+ K+L+  LCN P L+D G K
Sbjct  65   SSKKKLFLRLCN-PHLIDGGHK  85



>ref|XP_010065005.1| PREDICTED: F-box protein SKIP3-like [Eucalyptus grandis]
Length=120

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = +3

Query  129  RVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILL  308
            R G DF + LPEG I+ ++S TS  DA RL+ +S +FK+A +SD+VW  FLP D   +  
Sbjct  9    RDGPDF-SVLPEGCIATVVSFTSPSDACRLASVSSIFKSACDSDAVWASFLPPDWRPMDS  67

Query  309  RSRSPVVFSNMKELYFTLCNSPILLDD  389
            RS      S++KELYF+LC+ P+L+ D
Sbjct  68   RSA-----SSLKELYFSLCDDPVLVGD  89



>emb|CDP17217.1| unnamed protein product [Coffea canephora]
Length=280

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPE   S I SLTS  DA RLS++S  F++AA SD VW RFLP D  DIL R+  P+
Sbjct  6    FNMLPEDCASTICSLTSPEDACRLSMVSSSFRSAAGSDLVWERFLPSDYRDILARTLKPL  65

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             FS+ KEL+F    S ILLD G +
Sbjct  66   KFSSKKELFFLFSES-ILLDGGKQ  88



>ref|XP_010513999.1| PREDICTED: F-box protein At2g02240-like [Camelina sativa]
Length=276

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 61/97 (63%), Gaps = 3/97 (3%)
 Frame = +3

Query  108  NGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQ  287
            + G E++  G   F   PE  IS+IIS TS  DA   + +S+ F++AA S +VW +FLP 
Sbjct  6    HTGGEIVVPGPSPFDGFPEDCISNIISFTSPRDACVAASVSKTFESAANSYTVWEKFLPP  65

Query  288  DLSDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
            D S ++  S    VF++ KELY  LC++P+L++DG K
Sbjct  66   DYSSLIPPS---PVFASKKELYLALCHNPVLIEDGRK  99



>ref|XP_004237583.1| PREDICTED: F-box protein PP2-B11-like [Solanum lycopersicum]
Length=256

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG +S I+SLTS  DAAR S +++ F +AAE D+VW  F+P D    + RS + + F 
Sbjct  4    LPEGCVSKILSLTSPKDAARSSAVAKKFMSAAECDNVWEAFIPSDYLQAISRSGNLMGFP  63

Query  336  NMKELYFTLCNSPILLDDG  392
            + K+LYF+LC++ ILLD G
Sbjct  64   SKKQLYFSLCDTSILLDGG  82



>ref|XP_007031054.1| Phloem protein 2-B15, putative [Theobroma cacao]
 gb|EOY11556.1| Phloem protein 2-B15, putative [Theobroma cacao]
Length=350

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPE  ++ I+SLTS  DA + S++S  F++A+ESDSVW RFLP D  +I+ ++   + FS
Sbjct  78   LPESCVAVILSLTSPADACKSSLVSSTFQSASESDSVWERFLPSDYGEIVSKASDNLEFS  137

Query  336  NMKELYFTLCNSPILLDDG  392
            + KELY  LCN P+L+ DG
Sbjct  138  SKKELYLLLCN-PVLVADG  155



>ref|XP_008803664.1| PREDICTED: F-box protein PP2-A13-like [Phoenix dactylifera]
Length=177

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 63/105 (60%), Gaps = 1/105 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPE  IS ++S T+  D+ R +++S  F++AA SD+VWGRFLP D   IL R+  PV +S
Sbjct  17   LPEECISRVLSFTTTRDSCRPALVSVAFRSAASSDAVWGRFLPSDYESILSRAVDPVEYS  76

Query  336  NMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLYTCNEASFTCYG  470
            +  ELY  LC+S IL+D G  + +  +   + L + +      YG
Sbjct  77   SKSELYLRLCDS-ILVDGGLTVNYFLLEQPMLLMSSSNWPLKSYG  120



>emb|CDY03057.1| BnaC07g21700D [Brassica napus]
Length=237

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 3/84 (4%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F S PE  IS I+S TS  +A   + +S+ F++AA SD VW +FLP +   ++ RSR   
Sbjct  24   FDSFPEDCISKIVSFTSPREACVAAAVSKAFESAANSDVVWEKFLPPEYESLVPRSRD--  81

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
              S+ KE+YF LC+ P+L+DDG+K
Sbjct  82   -LSSKKEVYFALCDEPVLIDDGTK  104



>ref|XP_008370414.1| PREDICTED: F-box protein PP2-B15-like [Malus domestica]
Length=281

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 59/97 (61%), Gaps = 1/97 (1%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPE   + I+S TS  DA R S++S  F+A  ++DSVW +FLP D   IL R  SP+
Sbjct  3    FDHLPEDCFAHILSFTSPGDACRSSLVSSSFRATXDADSVWRKFLPSDHKQILSRFVSPI  62

Query  327  VFSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
             +S+ K+L+  LC SP L+D G K+ FV+     K Y
Sbjct  63   AYSSSKDLFMKLC-SPNLIDGGDKMFFVEKSTGKKCY  98



>emb|CDY70803.1| BnaC02g47790D [Brassica napus]
Length=266

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 62/96 (65%), Gaps = 4/96 (4%)
 Frame = +3

Query  114  GSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDL  293
            G E I  G   F SLP   IS IIS TS  DA   + +S+  ++AA+SDS+W +FLP + 
Sbjct  10   GRESIISGPSPFDSLPVDCISSIISFTSPRDACNAASVSKTLESAAKSDSLWEKFLPSEY  69

Query  294  SDILLR-SRSPVVFSNMKELYFTLCNSPILLDDGSK  398
            + ++ + SR   VFS+ KELYF LC+ P+L++DG K
Sbjct  70   TSLVPQYSR---VFSSKKELYFALCDEPLLIEDGKK  102



>gb|KDP32894.1| hypothetical protein JCGZ_12186 [Jatropha curcas]
Length=272

 Score = 80.1 bits (196),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 3/82 (4%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPE  +++++S TS  DA RLS+IS +FK AAESD+VW RFLP D   I+ RS    +  
Sbjct  12   LPESCVANVLSFTSPPDACRLSLISTIFKKAAESDTVWERFLPTDSQAIVFRSSQSSLLR  71

Query  336  ---NMKELYFTLCNSPILLDDG  392
               + K+L+F+LC++PIL+DDG
Sbjct  72   SRISKKQLFFSLCDNPILIDDG  93



>ref|XP_003590880.1| F-box protein PP2-B1 [Medicago truncatula]
 gb|AES61131.1| phloem protein 2-B2 [Medicago truncatula]
Length=275

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            M  F  LPEG I+ ++S T+ VDA RLS IS+ F +A++SD+VW RFLP D+S I+ +  
Sbjct  1    MTAFEELPEGCIAAVLSSTTPVDACRLSFISKNFLSASDSDAVWNRFLPSDISSIISQFP  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSK  398
            S       K+LY  L + PI++D+G K
Sbjct  61   SLSNIPTKKDLYIALSDRPIIIDNGKK  87



>gb|AFK34389.1| unknown [Medicago truncatula]
Length=275

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            M  F  LPEG I+ ++S T+ VDA RLS IS+ F +A++SD+VW RFLP D+S I+ +  
Sbjct  1    MTAFEELPEGCIAAVLSSTTPVDACRLSFISKNFLSASDSDAVWNRFLPSDISSIISQFP  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSK  398
            S       K+LY  L + PI++D+G K
Sbjct  61   SLSNIPTKKDLYIALSDRPIIIDNGKK  87



>ref|XP_008453628.1| PREDICTED: F-box protein PP2-B10-like [Cucumis melo]
Length=310

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 60/83 (72%), Gaps = 3/83 (4%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV--V  329
            LPEG+I++++S T+ +DA   + +SRVF AAA+SD VW RFLP D  D+L+  R     +
Sbjct  16   LPEGVIANVLSFTTPIDACTAAAVSRVFNAAAQSDFVWDRFLPPDW-DVLISHRKSFDPL  74

Query  330  FSNMKELYFTLCNSPILLDDGSK  398
             S+ K+++F+LCN+P+ +DD +K
Sbjct  75   SSSKKDIFFSLCNNPVPIDDRNK  97



>ref|XP_009129267.1| PREDICTED: F-box protein At2g02240-like [Brassica rapa]
Length=284

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = +3

Query  105  GNGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLP  284
            G  G E + V   F  +LP+  I++IISLTS  DA   + +S+ FK+ +E +SVW +FLP
Sbjct  11   GKIGQERVSVSSPF-DNLPDDCIANIISLTSPRDACIAASVSKTFKSTSEFNSVWEKFLP  69

Query  285  QDLSDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
             + S ++L S+   VF+  KELY  LCN P+L++DG K
Sbjct  70   PEYSSLILGSQ---VFTLKKELYLALCNDPVLIEDGQK  104



>emb|CDY09379.1| BnaA02g26310D [Brassica napus]
Length=248

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = +3

Query  105  GNGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLP  284
            G  G E + V   F  +LP+  I++IISLTS  DA   + +S+ FK+ +E ++VW +FLP
Sbjct  11   GKIGQERVSVSSPF-DNLPDDCIANIISLTSPRDACIAASVSKTFKSTSEFNTVWEKFLP  69

Query  285  QDLSDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
             + S ++L S+   VF+  KELY  LCN P+L++DG K
Sbjct  70   PEYSSLILGSQ---VFTLKKELYLALCNDPVLIEDGQK  104



>ref|XP_010514002.1| PREDICTED: F-box protein PP2-B10-like [Camelina sativa]
Length=282

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 60/95 (63%), Gaps = 3/95 (3%)
 Frame = +3

Query  114  GSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDL  293
            G +++      F   PE  IS+IIS T+  DA   + +S+ F++AA+SD +W +F+P + 
Sbjct  3    GGDIVSKSSSPFDYFPEDCISNIISFTNPRDACVAATVSKTFESAAKSDIIWEKFIPAEY  62

Query  294  SDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
              ++  SR   VFS+ K+ YF+LCN P+L+DDG K
Sbjct  63   ESLIPPSR---VFSSKKKFYFSLCNDPLLIDDGKK  94



>ref|XP_008388763.1| PREDICTED: F-box protein At2g02240-like [Malus domestica]
Length=265

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 59/96 (61%), Gaps = 12/96 (13%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS-  314
            MD  A LPEG I+ +ISLT+  DAA +S +SR F++AAES +VWGRFLP DL  IL  S 
Sbjct  1    MDLQA-LPEGCIATVISLTTPRDAATMSSVSRSFRSAAESXAVWGRFLPPDLHTILSSSS  59

Query  315  -----RSPVVF-----SNMKELYFTLCNSPILLDDG  392
                   P V         KELY  LC++P+L++ G
Sbjct  60   PSMSVHPPHVAPSSASKTKKELYLALCDNPVLVEQG  95



>ref|XP_006664305.1| PREDICTED: F-box protein At2g02240-like [Oryza brachyantha]
Length=300

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = +3

Query  132  VGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR  311
            +G      LPE  +S  ISLT+  DA R S +SR F+AAA+ D+VW RFLP D S IL R
Sbjct  13   IGSLLLLDLPEACVSHAISLTTPGDACRCSAVSRAFQAAADLDAVWERFLPTDYSSILAR  72

Query  312  SRSPV-VFSNMKELYFTLCNSPILLDDGSK  398
            +  PV + S  K+L+ +L    +LLD G+K
Sbjct  73   ADDPVDLSSTKKDLFRSLVQEHVLLDKGTK  102



>ref|XP_008359993.1| PREDICTED: F-box protein At2g02240-like [Malus domestica]
Length=278

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 61/104 (59%), Gaps = 2/104 (2%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDL--SDILLRSRSPV  326
            +L EG I++++SLT+  DA R S +SR F +AAESD+VW +F P D+        S S  
Sbjct  16   ALLEGCIANVVSLTTPTDACRFSAVSRSFMSAAESDAVWDKFXPHDIPSILSHXSSSSSS  75

Query  327  VFSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLYTCNEASF  458
              S+ KELY TLC +PILLDDG    F+  +   K Y  +   F
Sbjct  76   STSSKKELYLTLCENPILLDDGKMXFFLDKWSGKKCYMISARDF  119



>ref|XP_006480430.1| PREDICTED: F-box protein At2g02240-like isoform X1 [Citrus sinensis]
Length=284

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 59/88 (67%), Gaps = 4/88 (5%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG I++ IS T+  DA RLS +S +FK+AAESD+VW  FLP D S +L  S S    S
Sbjct  4    LPEGCIANAISFTTPRDACRLSSVSTIFKSAAESDAVWESFLPPDYSTLLSSSSSSSSSS  63

Query  336  NM----KELYFTLCNSPILLDDGSKLRF  407
                  KELYF+LC++PIL+D+G K  F
Sbjct  64   LRSSSKKELYFSLCHNPILIDEGKKQSF  91



>ref|XP_009129159.1| PREDICTED: F-box protein At2g02240-like [Brassica rapa]
Length=278

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 62/96 (65%), Gaps = 4/96 (4%)
 Frame = +3

Query  114  GSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDL  293
            G E I  G   F +LP   IS IIS TS  DA   + +S+  ++AA+SDS+W +FLP + 
Sbjct  10   GRESIISGPSPFDTLPVDCISSIISFTSPRDACNAASVSKTLESAAKSDSLWEKFLPSEY  69

Query  294  SDILLR-SRSPVVFSNMKELYFTLCNSPILLDDGSK  398
            + ++ + SR   VFS+ KELYF LC+ P+L++DG K
Sbjct  70   TSLIPQYSR---VFSSKKELYFALCDEPLLIEDGKK  102



>ref|XP_003590890.1| F-box protein PP2-B1 [Medicago truncatula]
 gb|AES61141.1| phloem protein 2-B5 [Medicago truncatula]
Length=265

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 0/87 (0%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            M     LPEG I+ I+S T+ VDA RLSV+S+ F++A++SD+VW +FLP D+S ++  S 
Sbjct  1    MTEIQDLPEGCIATIVSRTTPVDAGRLSVVSKTFRSASDSDAVWNQFLPSDISSVISHSP  60

Query  318  SPVVFSNMKELYFTLCNSPILLDDGSK  398
            S       K LY  L + PI++D   K
Sbjct  61   SLANAPTKKALYLALSDRPIIIDHDKK  87



>emb|CBI38319.3| unnamed protein product [Vitis vinifera]
Length=327

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 61/100 (61%), Gaps = 3/100 (3%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F++LPE  I  I++LTS  D  R+  +++    A ESD++W RFLP D   IL RS  P 
Sbjct  102  FSTLPEACIVYILALTSPPDVCRMRAVAQWLLPAVESDALWLRFLPDDYQQILARSAEPP  161

Query  327  VFSN---MKELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
              S+    KEL+F LC+SP+L+D+G K+ +++     K +
Sbjct  162  SLSDSSSKKELFFRLCDSPLLIDEGKKMFWLEKRSGKKCF  201



>ref|XP_002270223.1| PREDICTED: putative F-box protein PP2-B12 [Vitis vinifera]
Length=287

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F++LPE  I  I++LTS  D  R+  +++    A ESD++W RFLP D   IL RS  P 
Sbjct  23   FSTLPEACIVYILALTSPPDVCRMRAVAQWLLPAVESDALWLRFLPDDYQQILARSAEPP  82

Query  327  VFSN---MKELYFTLCNSPILLDDGSKLRFVK  413
              S+    KEL+F LC+SP+L+D+G K+ +++
Sbjct  83   SLSDSSSKKELFFRLCDSPLLIDEGKKMFWLE  114



>gb|KHG05962.1| F-box PP2-B15 -like protein [Gossypium arboreum]
Length=288

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LP+   + I+SLTS +DA R+S++S   + +A SDSVW +FLP D   IL R   P++FS
Sbjct  6    LPDDCFAHILSLTSPIDACRISLVSSSIRISANSDSVWEKFLPPDYQQILTRLCHPLIFS  65

Query  336  NMKELYFTLCNSPILLDDGSK  398
            + K L+F LCN P L+D G K
Sbjct  66   SKKHLFFRLCN-PHLIDGGLK  85



>ref|XP_004302133.1| PREDICTED: F-box protein At2g02240-like [Fragaria vesca subsp. 
vesca]
Length=289

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 64/94 (68%), Gaps = 3/94 (3%)
 Frame = +3

Query  120  ELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSD  299
            E+ +  MD  A LPEG I+++ISLTS  DA RL ++S++ K+AAESD+VW +F+P +   
Sbjct  2    EMQQPQMDLQA-LPEGCIANVISLTSPADACRLPLLSKIIKSAAESDAVWNKFIPPETHT  60

Query  300  I--LLRSRSPVVFSNMKELYFTLCNSPILLDDGS  395
            I     S S     + KELY +LC++P+L+D+G+
Sbjct  61   ILSRSNSLSSSPLKSKKELYMSLCDNPVLIDEGN  94



>ref|XP_002876809.1| hypothetical protein ARALYDRAFT_904458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53068.1| hypothetical protein ARALYDRAFT_904458 [Arabidopsis lyrata subsp. 
lyrata]
Length=299

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = +3

Query  114  GSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDL  293
            G E I   +  F  LPE  +S+IISLTS  DA   + +SR  +   +SDSVW +FLP + 
Sbjct  26   GIEEIVSRLSPFDELPEDCVSNIISLTSPRDACIAASVSRTLRLTVQSDSVWEKFLPTEY  85

Query  294  SDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
            + ++   R   VF + KELYF+LC  PIL++DG K
Sbjct  86   ASLIHEWR---VFLSKKELYFSLCQVPILIEDGQK  117



>ref|XP_011036723.1| PREDICTED: putative F-box protein PP2-B2 isoform X4 [Populus 
euphratica]
Length=509

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = +3

Query  117  SELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLS  296
            S+++  G+      PEG +++++SLT+  D  RLS +S +FK+AAESD  W RFLP DL 
Sbjct  3    SDMVVGGVPLNFDQPEGCVANVLSLTTPQDVCRLSAVSPIFKSAAESDVAWQRFLPNDLE  62

Query  297  DILLRS----RSPVVFSNMKELYFTLCNSPILLDDGSKL  401
             IL  +          S+ KE+YF+LC++PI++D G KL
Sbjct  63   SILSTALDGSLLLSSASSKKEVYFSLCDNPIIVDHGRKL  101



>ref|XP_011036721.1| PREDICTED: F-box protein VBF-like isoform X3 [Populus euphratica]
Length=509

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = +3

Query  117  SELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLS  296
            S+++  G+      PEG +++++SLT+  D  RLS +S +FK+AAESD  W RFLP DL 
Sbjct  3    SDMVVGGVPLNFDQPEGCVANVLSLTTPQDVCRLSAVSPIFKSAAESDVAWQRFLPNDLE  62

Query  297  DILLRS----RSPVVFSNMKELYFTLCNSPILLDDGSKL  401
             IL  +          S+ KE+YF+LC++PI++D G KL
Sbjct  63   SILSTALDGSLLLSSASSKKEVYFSLCDNPIIVDHGRKL  101



>ref|XP_006395794.1| hypothetical protein EUTSA_v10004854mg [Eutrema salsugineum]
 gb|ESQ33080.1| hypothetical protein EUTSA_v10004854mg [Eutrema salsugineum]
Length=233

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 55/77 (71%), Gaps = 3/77 (4%)
 Frame = +3

Query  168  LISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFSNMKE  347
             IS IIS TS  DA  ++ +S+ F++AA+SD VW +F+P + + ++ RSR   VFS+ KE
Sbjct  4    CISKIISFTSPRDACVVASVSKTFESAAKSDIVWDKFVPPEYASLVPRSR---VFSSKKE  60

Query  348  LYFTLCNSPILLDDGSK  398
            LYF LC+ P+L+DDG K
Sbjct  61   LYFALCDDPVLIDDGKK  77



>ref|XP_009412445.1| PREDICTED: F-box protein PP2-B1-like [Musa acuminata subsp. malaccensis]
Length=286

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 69/123 (56%), Gaps = 11/123 (9%)
 Frame = +3

Query  108  NGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQ  287
             GG EL R+        PE  +  ++S TS  D+ R +++S  F +AA SD++W RFLP 
Sbjct  10   EGGGELARI--------PEECVVLVLSHTSPRDSCRSALVSSAFLSAANSDALWERFLPS  61

Query  288  DLSDILLRSRSPVVFSNMKELYFTLCNSPILLDDGS-KLRFVKMYGVVKLYTCNEASFTC  464
            D +DIL R+  PV +S+ K+LY  LC+S ILLDDG    R  K  G  K Y  +  S T 
Sbjct  62   DYADILSRAVHPVEYSSKKQLYIRLCDS-ILLDDGKVSFRLEKSTG-GKCYMVSAESMTI  119

Query  465  YGG  473
              G
Sbjct  120  IWG  122



>ref|XP_006395797.1| hypothetical protein EUTSA_v10004855mg [Eutrema salsugineum]
 gb|ESQ33083.1| hypothetical protein EUTSA_v10004855mg [Eutrema salsugineum]
Length=233

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
            G     SLPE  IS+IIS TS  DA   + +S+ FK+A  SD +W +FLP D   ++  S
Sbjct  18   GSSSLDSLPEECISNIISFTSTRDACVAASVSKTFKSAVNSDIIWEKFLPPDYPSLIPSS  77

Query  315  RSPVVFSNMKELYFTLCNSPILLDDG  392
            R   +FS  KELYF LCN  +L++DG
Sbjct  78   R---IFSTKKELYFALCNDSVLIEDG  100



>gb|KHN04971.1| F-box protein PP2-B1 [Glycine soja]
Length=303

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F +LPEG I++I+S TS  D  RLS++S  F++AA+SD+VW +FLP D   IL +S S +
Sbjct  9    FNNLPEGCIANILSFTSPRDVCRLSLLSSTFRSAAQSDAVWNKFLPSDFHTILSQSSS-L  67

Query  327  VFSNMKELYFTLCNSPILLDDGSK-LRFVKMYG  422
               + K+L+  LC  P+L+DDG K  +  K+YG
Sbjct  68   SLPSKKDLFLYLCQKPLLIDDGKKSFQLDKVYG  100



>ref|XP_011036719.1| PREDICTED: uncharacterized protein LOC105134126 isoform X1 [Populus 
euphratica]
Length=541

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (64%), Gaps = 4/99 (4%)
 Frame = +3

Query  117  SELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLS  296
            S+++  G+      PEG +++++SLT+  D  RLS +S +FK+AAESD  W RFLP DL 
Sbjct  3    SDMVVGGVPLNFDQPEGCVANVLSLTTPQDVCRLSAVSPIFKSAAESDVAWQRFLPNDLE  62

Query  297  DILLRS----RSPVVFSNMKELYFTLCNSPILLDDGSKL  401
             IL  +          S+ KE+YF+LC++PI++D G KL
Sbjct  63   SILSTALDGSLLLSSASSKKEVYFSLCDNPIIVDHGRKL  101



>ref|XP_010674196.1| PREDICTED: putative F-box protein PP2-B12 [Beta vulgaris subsp. 
vulgaris]
Length=314

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 66/99 (67%), Gaps = 5/99 (5%)
 Frame = +3

Query  108  NGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQ  287
            N G E+   G+DF+  LPEG I+ + S TS  DA R + IS++FK+AA+SD+VW  FLP 
Sbjct  19   NEGGEIF-CGIDFYV-LPEGCIAAVTSFTSPRDACRFASISKIFKSAADSDAVWEHFLPS  76

Query  288  DLSDILLRS---RSPVVFSNMKELYFTLCNSPILLDDGS  395
            D  +I+++S   +S +   + K L+  L ++P+L+DDG+
Sbjct  77   DYREIIVKSDGAQSLLDSLSSKHLFMHLADTPLLIDDGA  115



>ref|XP_009407173.1| PREDICTED: putative F-box protein PP2-B2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=213

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 4/86 (5%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
            GMD    LPEG ++  I+LTS  D  R S +S  F++AA  D+VW RFLP D   IL R+
Sbjct  5    GMD---RLPEGCVAHAIALTSPRDVCRFSAVSSAFRSAAAYDTVWDRFLPSDYRSILSRA  61

Query  315  RSPVVFSNMKELYFTLCNSPILLDDG  392
              PVV S+ ++L+F LC+S +L+D G
Sbjct  62   VRPVVCSSKRDLFFRLCDS-LLIDAG  86



>gb|KGN60967.1| hypothetical protein Csa_2G032730 [Cucumis sativus]
Length=303

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 69/114 (61%), Gaps = 5/114 (4%)
 Frame = +3

Query  132  VGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR  311
             G+     LPE  +S I+SLTS  DA +L+++S +F++AAESD VWGRFLP++  +I+  
Sbjct  2    AGISSIGVLPEDCVSAILSLTSPSDAGKLALVSSMFRSAAESDVVWGRFLPENYEEIVAA  61

Query  312  SR--SPVVFSNMKELYFTLCNSPILLDDGSK-LRFVKMYG-VVKLYTCNEASFT  461
            S         + +E +F LC SPIL+D+G K     K+ G V+ + +  E S T
Sbjct  62   SEMSGEAPLRSKREAFFRLC-SPILVDEGKKSFELEKLSGKVIYMLSARELSIT  114



>ref|XP_003556444.1| PREDICTED: F-box protein At2g02240-like [Glycine max]
Length=303

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F +LPEG I++I+S TS  D  RLS++S  F++AA+SD+VW +FLP D   IL +S S +
Sbjct  9    FNNLPEGCIANILSFTSPRDVCRLSLLSSTFRSAAQSDAVWNKFLPSDFHTILSQSSS-L  67

Query  327  VFSNMKELYFTLCNSPILLDDGSK-LRFVKMYG  422
               + K+L+  LC  P+L+DDG K  +  K+YG
Sbjct  68   SLPSKKDLFLYLCQKPLLIDDGKKSFQLDKVYG  100



>ref|XP_002453018.1| hypothetical protein SORBIDRAFT_04g036800 [Sorghum bicolor]
 gb|EES05994.1| hypothetical protein SORBIDRAFT_04g036800 [Sorghum bicolor]
Length=338

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 59/87 (68%), Gaps = 4/87 (5%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVF-  332
            LPE  ++  ISLT+  DA   S +S  F+AAA+S++VW RFLP D +D+L R+  PV   
Sbjct  11   LPEECVAYAISLTTPGDACHSSAVSPAFRAAADSNAVWARFLPPDHADVLARADEPVAAV  70

Query  333  --SNMKELYFTLCNSPILLDDGSKLRF  407
              ++ KEL+ +LC+SP+LL DG+ + F
Sbjct  71   GGASKKELFSSLCDSPVLL-DGATMSF  96



>ref|XP_007031057.1| Phloem protein 2-B15, putative [Theobroma cacao]
 gb|EOY11559.1| Phloem protein 2-B15, putative [Theobroma cacao]
Length=302

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPE  +S I+S T+  DA R S++S  F++A +SD VW  FLP D  +I+L S SP+ FS
Sbjct  2    LPEDCLSAILSFTTPEDAFRSSLVSSTFRSAVDSDVVWESFLPPDYPEIVLSSVSPLKFS  61

Query  336  NMKELYFTLCNSPILLDDGSKLRFV  410
            + KEL+  LC+ P+L+D G+K+ F+
Sbjct  62   SKKELFQCLCD-PVLIDGGNKVNFL  85



>ref|XP_009407172.1| PREDICTED: putative F-box protein PP2-B12 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=291

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 65/113 (58%), Gaps = 4/113 (4%)
 Frame = +3

Query  135  GMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRS  314
            GMD    LPEG ++  I+LTS  D  R S +S  F++AA  D+VW RFLP D   IL R+
Sbjct  5    GMD---RLPEGCVAHAIALTSPRDVCRFSAVSSAFRSAAAYDTVWDRFLPSDYRSILSRA  61

Query  315  RSPVVFSNMKELYFTLCNSPILLDDGSKLRFVKMYGVVKLYTCNEASFTCYGG  473
              PVV S+ ++L+F LC+S +L+D G    +++     K Y  +  S +   G
Sbjct  62   VRPVVCSSKRDLFFRLCDS-LLIDAGKMSFWLERSSGAKCYMLSARSLSITWG  113



>gb|KDP32800.1| hypothetical protein JCGZ_12092 [Jatropha curcas]
Length=261

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +3

Query  150  ASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSP--  323
            + LPE  I++I+S T  + A  LS++S  F+ AA SD+VW RFLP D   I+ RS  P  
Sbjct  2    SDLPEACIANILSFTDPLVACNLSMVSSTFRNAARSDTVWQRFLPPDCVSIISRSSDPNL  61

Query  324  VVFSNMKELYFTLCNSPILLDDGSK  398
            ++  + K+L+F+LC +PIL+DDG +
Sbjct  62   LLAYSKKQLFFSLCRNPILIDDGKR  86



>ref|XP_003590879.1| F-box protein PP2-B3 [Medicago truncatula]
 gb|AES61130.1| phloem protein 2-B5 [Medicago truncatula]
Length=300

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 55/90 (61%), Gaps = 3/90 (3%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFL---PQDLSDILL  308
            M  F  LPEG I+ ++SLT+  DA RL+V+S+ F++AA+SD+VW  FL   PQ    I+ 
Sbjct  1    MGAFEELPEGCIAAVLSLTTPADAGRLAVVSKTFRSAADSDAVWNHFLRSDPQFFDFIIS  60

Query  309  RSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
             S S       K LY  L N PI++DDG K
Sbjct  61   HSPSFANIPTKKSLYLALSNHPIIIDDGKK  90



>gb|AFK47906.1| unknown [Lotus japonicus]
Length=135

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = +3

Query  153  SLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSP--V  326
            SLPE  +S+I+S TS  DA R S++S   ++AA+SD VW  FLP D  DI+ R+ +P  +
Sbjct  3    SLPEDCVSEILSHTSPPDACRFSLVSSTLRSAADSDMVWRSFLPSDYEDIVSRAVNPSAL  62

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             FS+ K+L+  LC SP+LLD G+K
Sbjct  63   QFSSYKQLFHALC-SPLLLDGGNK  85



>ref|XP_006293085.1| hypothetical protein CARUB_v10019372mg [Capsella rubella]
 gb|EOA25983.1| hypothetical protein CARUB_v10019372mg [Capsella rubella]
Length=282

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 63/107 (59%), Gaps = 3/107 (3%)
 Frame = +3

Query  105  GNGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLP  284
            G  G E++   + F   LPE  IS I + TS  DA   + +S+ F++   SD+VW +FLP
Sbjct  7    GEDGGEIVHETLSF-NDLPEDCISHIFTFTSPRDACVAASVSKTFESVVNSDNVWEKFLP  65

Query  285  QDLSDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK-LRFVKMYG  422
             D + ++L  +S V  S  KELYF LC+ P+L++DG K L   KM G
Sbjct  66   PDYASLVLLPQSRVPLSK-KELYFALCHDPLLIEDGKKSLWLEKMSG  111



>ref|NP_178341.1| F-box protein PP2-B10 [Arabidopsis thaliana]
 sp|Q9ZVQ6.1|P2B10_ARATH RecName: Full=F-box protein PP2-B10; AltName: Full=Protein PHLOEM 
PROTEIN 2-LIKE B10; Short=AtPP2-B10 [Arabidopsis thaliana]
 gb|AAC78518.1| putative phloem-specific lectin [Arabidopsis thaliana]
 gb|ABF83689.1| At2g02360 [Arabidopsis thaliana]
 dbj|BAE99245.1| putative phloem-specific lectin [Arabidopsis thaliana]
 gb|AEC05569.1| F-box protein PP2-B10 [Arabidopsis thaliana]
Length=272

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 53/84 (63%), Gaps = 3/84 (4%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F S PE  IS IIS T+  DA   + +S+ F++  +SD +W +FLP D   ++  SR   
Sbjct  14   FDSFPEDCISYIISFTNPRDACVAATVSKTFESTVKSDIIWEKFLPADYESLIPPSR---  70

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
            VFS+ KELYF+LCN P+L DD  K
Sbjct  71   VFSSKKELYFSLCNDPVLFDDDKK  94



>gb|KGN60966.1| hypothetical protein Csa_2G032230 [Cucumis sativus]
Length=303

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 69/114 (61%), Gaps = 5/114 (4%)
 Frame = +3

Query  132  VGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR  311
             G+     LPE  IS I+SLT+  DA +L+++S +F++AAESD VWGRFLP++  +I+  
Sbjct  2    AGISSIGVLPEDCISAILSLTTPSDAGKLALVSSMFRSAAESDVVWGRFLPENYEEIVAA  61

Query  312  SR--SPVVFSNMKELYFTLCNSPILLDDGSK-LRFVKMYG-VVKLYTCNEASFT  461
            S         + +E +F LC SPIL+D+G K     K+ G V+ + +  E S T
Sbjct  62   SEMSGEAPLRSKREAFFRLC-SPILVDEGKKSFELEKLSGKVIYMLSARELSIT  114



>ref|XP_004144818.1| PREDICTED: F-box protein PP2-B15-like [Cucumis sativus]
Length=303

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 69/114 (61%), Gaps = 5/114 (4%)
 Frame = +3

Query  132  VGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLR  311
             G+     LPE  IS I+SLT+  DA +L+++S +F++AAESD VWGRFLP++  +I+  
Sbjct  2    AGISSIGVLPEDCISAILSLTTPSDAGKLALVSSMFRSAAESDVVWGRFLPENYEEIVAA  61

Query  312  SR--SPVVFSNMKELYFTLCNSPILLDDGSK-LRFVKMYG-VVKLYTCNEASFT  461
            S         + +E +F LC SPIL+D+G K     K+ G V+ + +  E S T
Sbjct  62   SELSGEAPLRSKREAFFRLC-SPILVDEGKKSFELEKLSGKVIYMLSARELSIT  114



>ref|XP_007029416.1| Phloem protein 2-B10, putative [Theobroma cacao]
 gb|EOY09918.1| Phloem protein 2-B10, putative [Theobroma cacao]
Length=342

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = +3

Query  105  GNGGSELIRVGMDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLP  284
            G GG  L    +D  A LP+  I+ I+S T+  DA RLS +S VFK+AAESD+VW  FLP
Sbjct  12   GRGGPSLPSPLLDLNA-LPQDCIAAILSFTTPRDACRLSAVSTVFKSAAESDAVWECFLP  70

Query  285  QDLSDILLRSRSPVVFSNMKELYFTLCNSPILLDDGSK  398
             D   I+     P   ++ K LY +LC++P+L+D G K
Sbjct  71   SDYRAII-----PSSLASKKALYLSLCDNPVLIDGGRK  103



>ref|XP_011031412.1| PREDICTED: putative F-box protein PP2-B12 [Populus euphratica]
Length=304

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 8/87 (9%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSP----  323
            LPEG I++ +S T+  D  RLSV+S +F  AA SD VW RFLP+DL  IL  S SP    
Sbjct  12   LPEGCIANALSFTTPQDVGRLSVVSPMFMLAAVSDVVWERFLPRDLESIL--STSPDGSC  69

Query  324  --VVFSNMKELYFTLCNSPILLDDGSK  398
                 ++ KELYF+LC +P+L+D+G K
Sbjct  70   LMASAASRKELYFSLCENPVLVDNGRK  96



>ref|XP_006428540.1| hypothetical protein CICLE_v10013447mg [Citrus clementina]
 ref|XP_006491782.1| PREDICTED: F-box protein At2g02240-like [Citrus sinensis]
 gb|ESR41780.1| hypothetical protein CICLE_v10013447mg [Citrus clementina]
Length=283

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG I++ IS T+  DA RLS +S +FK+AAESD+VW  FLP D S +L  S S    S
Sbjct  4    LPEGCIANAISFTTPRDACRLSSVSTIFKSAAESDAVWESFLPPDYSTLLSSSSSSSSSS  63

Query  336  NM----KELYFTLCNSPILLDDGSK  398
                  KELYF+LC++PIL+D+G K
Sbjct  64   LRSSSKKELYFSLCHNPILIDEGKK  88



>ref|XP_002876813.1| hypothetical protein ARALYDRAFT_322563 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53072.1| hypothetical protein ARALYDRAFT_322563 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 58/86 (67%), Gaps = 3/86 (3%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPE  IS IIS TS +DA  L+ +S+ F++A +SD VW +F+P +   ++ +SR    FS
Sbjct  42   LPEECISIIISFTSPLDACVLASVSKTFESAVKSDIVWEKFIPPEYESLISQSRD---FS  98

Query  336  NMKELYFTLCNSPILLDDGSKLRFVK  413
            + KELYF LC+  +L+DDG K  +++
Sbjct  99   SKKELYFALCDESVLIDDGKKFLWIE  124



>ref|XP_006395795.1| hypothetical protein EUTSA_v10005290mg [Eutrema salsugineum]
 gb|ESQ33081.1| hypothetical protein EUTSA_v10005290mg [Eutrema salsugineum]
Length=414

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 4/84 (5%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F  LPE  IS+IISLTS  DA   +++S+ FK+A +SD++W +FLP D + ++  SR   
Sbjct  85   FEDLPEECISNIISLTSPRDACVAALVSKTFKSAVDSDAMWEKFLPPDYASLIPGSR---  141

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
            VFS+ KELYF LC+   L++DGSK
Sbjct  142  VFSSKKELYFALCDH-FLIEDGSK  164



>ref|XP_009101263.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein PP2-B10-like [Brassica 
rapa]
Length=284

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 3/84 (4%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F S PE  IS I+S TS  D    + +S+ F++A  SD  W +FLP +   ++ RSR   
Sbjct  25   FDSFPEDCISKIVSFTSPRDTCVAATVSKAFESAVNSDVAWEKFLPPEYESLVPRSRD--  82

Query  327  VFSNMKELYFTLCNSPILLDDGSK  398
             FS+ K++YF LC+ P+L+DDG+K
Sbjct  83   -FSSKKDMYFALCDEPVLIDDGTK  105



>ref|XP_006480431.1| PREDICTED: F-box protein At2g02240-like isoform X2 [Citrus sinensis]
Length=283

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 4/85 (5%)
 Frame = +3

Query  156  LPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPVVFS  335
            LPEG I++ IS T+  DA RLS +S +FK+AAESD+VW  FLP D S +L  S S    S
Sbjct  4    LPEGCIANAISFTTPRDACRLSSVSTIFKSAAESDAVWESFLPPDYSTLLSSSSSSSSSS  63

Query  336  NM----KELYFTLCNSPILLDDGSK  398
                  KELYF+LC++PIL+D+G K
Sbjct  64   LRSSSKKELYFSLCHNPILIDEGKK  88



>ref|XP_010041708.1| PREDICTED: F-box protein PP2-B11-like [Eucalyptus grandis]
Length=289

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 57/82 (70%), Gaps = 5/82 (6%)
 Frame = +3

Query  147  FASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSRSPV  326
            F++LPEG I+ ++S TS  DA RL+ +S +FK A +SD VW  FLP D   ++ RS +P 
Sbjct  15   FSALPEGCIASVVSFTSPPDACRLASVSSIFKLACDSDVVWASFLPPDCCLMVHRS-AP-  72

Query  327  VFSNMKELYFTLCNSPILLDDG  392
               ++KEL+F+LC+ P+L+ DG
Sbjct  73   ---SLKELFFSLCDDPVLVGDG  91



>gb|KDO50517.1| hypothetical protein CISIN_1g045697mg [Citrus sinensis]
Length=130

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 62/103 (60%), Gaps = 3/103 (3%)
 Frame = +3

Query  138  MDFFASLPEGLISDIISLTSAVDAARLSVISRVFKAAAESDSVWGRFLPQDLSDILLRSR  317
            MD   +LP   IS IISLT+  DA RL+V+S VFK+AA+SD VW RFLP D   I+  S 
Sbjct  1    MDITNALPVECISHIISLTTPGDACRLAVVSPVFKSAADSDLVWERFLPSDYKLIISNSV  60

Query  318  SPVVFSNM---KELYFTLCNSPILLDDGSKLRFVKMYGVVKLY  437
            S     +    K+LYF LC+ PIL+++G+    V+     K Y
Sbjct  61   SSSSLISSLSKKDLYFHLCHHPILINNGTMSSAVEKQTGKKCY  103



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669965605652