BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23685_g1_i4 len=851 path=[1:0-63 65:64-187 456:188-850]

Length=851
                                                                      Score     E

ref|XP_009765257.1|  PREDICTED: probable serine/threonine-protein...    232   2e-69   
ref|XP_009765256.1|  PREDICTED: probable serine/threonine-protein...    232   2e-69   
ref|XP_009590741.1|  PREDICTED: probable serine/threonine-protein...    225   4e-69   
ref|XP_009590736.1|  PREDICTED: probable serine/threonine-protein...    225   5e-69   
emb|CDP07284.1|  unnamed protein product                                231   9e-69   
gb|KCW70322.1|  hypothetical protein EUGRSUZ_F03566                     227   3e-68   
gb|KCW70323.1|  hypothetical protein EUGRSUZ_F03566                     227   4e-68   
ref|XP_010064951.1|  PREDICTED: probable serine/threonine-protein...    227   1e-67   
ref|XP_009622684.1|  PREDICTED: probable serine/threonine-protein...    228   1e-67   
ref|XP_009622683.1|  PREDICTED: probable serine/threonine-protein...    228   1e-67   
ref|XP_009622682.1|  PREDICTED: probable serine/threonine-protein...    228   1e-67   
ref|XP_006342141.1|  PREDICTED: probable serine/threonine-protein...    226   3e-67   
gb|KDP36787.1|  hypothetical protein JCGZ_08078                         226   3e-67   
ref|XP_009792375.1|  PREDICTED: probable serine/threonine-protein...    225   8e-67   
ref|XP_009792373.1|  PREDICTED: probable serine/threonine-protein...    225   1e-66   
ref|XP_009792374.1|  PREDICTED: probable serine/threonine-protein...    225   1e-66   
ref|XP_004238436.1|  PREDICTED: probable serine/threonine-protein...    223   6e-66   
ref|XP_010320466.1|  PREDICTED: probable serine/threonine-protein...    223   6e-66   
ref|XP_011041221.1|  PREDICTED: probable serine/threonine-protein...    220   1e-64   
ref|XP_007018056.1|  Kinase superfamily protein                         219   2e-64   
ref|XP_010040704.1|  PREDICTED: probable serine/threonine-protein...    220   2e-64   
ref|XP_010061181.1|  PREDICTED: probable serine/threonine-protein...    219   4e-64   
ref|XP_010663976.1|  PREDICTED: probable serine/threonine-protein...    218   4e-64   
ref|XP_010663975.1|  PREDICTED: probable serine/threonine-protein...    218   4e-64   
gb|EYU36568.1|  hypothetical protein MIMGU_mgv1a007211mg                218   6e-64   
ref|XP_002510681.1|  serine/threonine-protein kinase cx32, putative     218   9e-64   Ricinus communis
ref|XP_002307794.2|  hypothetical protein POPTR_0005s27330g             218   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010663977.1|  PREDICTED: protein kinase APK1B, chloroplastic     217   1e-63   
emb|CBI40719.3|  unnamed protein product                                217   1e-63   
ref|XP_011074087.1|  PREDICTED: probable serine/threonine-protein...    217   2e-63   
emb|CBI40720.3|  unnamed protein product                                218   3e-63   
gb|AAS65788.1|  putative protein kinase                                 209   5e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007157996.1|  hypothetical protein PHAVU_002G115800g             210   9e-63   
ref|XP_002521714.1|  serine/threonine-protein kinase cx32, putative     214   2e-62   Ricinus communis
ref|NP_001234995.1|  protein kinase                                     209   3e-62   
ref|XP_004512261.1|  PREDICTED: probable serine/threonine-protein...    213   4e-62   
ref|XP_007156235.1|  hypothetical protein PHAVU_003G269700g             212   5e-62   
emb|CDX68102.1|  BnaA07g21420D                                          213   5e-62   
gb|EPS70761.1|  hypothetical protein M569_03998                         211   6e-62   
ref|XP_006390207.1|  hypothetical protein EUTSA_v10018510mg             213   7e-62   
ref|XP_009104679.1|  PREDICTED: probable serine/threonine-protein...    213   8e-62   
dbj|BAC43515.1|  putative protein kinase                                210   8e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536475.1|  PREDICTED: probable serine/threonine-protein...    213   1e-61   
ref|XP_008781319.1|  PREDICTED: probable serine/threonine-protein...    212   1e-61   
ref|XP_006302239.1|  hypothetical protein CARUB_v10020265mg             213   1e-61   
ref|XP_003533415.1|  PREDICTED: probable serine/threonine-protein...    211   2e-61   
ref|XP_009773233.1|  PREDICTED: probable serine/threonine-protein...    211   2e-61   
ref|XP_007157997.1|  hypothetical protein PHAVU_002G115800g             209   2e-61   
ref|XP_004290061.1|  PREDICTED: probable serine/threonine-protein...    211   3e-61   
gb|AAF16665.1|AC012394_14  putative protein kinase; 59396-62219         211   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471786.1|  PREDICTED: probable serine/threonine-protein...    211   4e-61   
ref|XP_010247082.1|  PREDICTED: probable serine/threonine-protein...    210   4e-61   
ref|XP_010416550.1|  PREDICTED: probable serine/threonine-protein...    211   5e-61   
ref|XP_002889077.1|  hypothetical protein ARALYDRAFT_476789             213   5e-61   
gb|AES95298.2|  Serine/Threonine-kinase Cx32, related protein           209   5e-61   
ref|XP_007210594.1|  hypothetical protein PRUPE_ppa016837mg             207   5e-61   
ref|XP_006598681.1|  PREDICTED: protein kinase isoform X1               210   5e-61   
emb|CDX88265.1|  BnaC06g37090D                                          211   6e-61   
ref|XP_010416552.1|  PREDICTED: probable serine/threonine-protein...    212   6e-61   
ref|XP_008663505.1|  PREDICTED: probable serine/threonine-protein...    214   6e-61   
ref|XP_010428693.1|  PREDICTED: probable serine/threonine-protein...    211   6e-61   
ref|NP_177762.3|  putative protein kinase                               211   7e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85943.1|  BnaC06g21910D                                          210   7e-61   
gb|KHN38873.1|  Putative serine/threonine-protein kinase Cx32, ch...    211   8e-61   
ref|XP_008663503.1|  PREDICTED: probable serine/threonine-protein...    213   8e-61   
ref|XP_008663504.1|  PREDICTED: probable serine/threonine-protein...    213   8e-61   
gb|AAM61685.1|  putative protein kinase                                 209   8e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008237981.1|  PREDICTED: probable serine/threonine-protein...    209   1e-60   
ref|XP_010935290.1|  PREDICTED: probable serine/threonine-protein...    209   1e-60   
ref|XP_006656517.1|  PREDICTED: probable serine/threonine-protein...    209   1e-60   
gb|KHN07820.1|  Putative serine/threonine-protein kinase Cx32, ch...    209   1e-60   
gb|KDP42038.1|  hypothetical protein JCGZ_03101                         209   1e-60   
ref|XP_002886105.1|  hypothetical protein ARALYDRAFT_480605             209   1e-60   
ref|XP_007202257.1|  hypothetical protein PRUPE_ppa007710mg             207   2e-60   
ref|NP_973478.1|  putative serine/threonine-specific protein kina...    209   2e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87609.1|  BnaA07g32640D                                          209   2e-60   
gb|KHG23247.1|  hypothetical protein F383_30094                         208   2e-60   
ref|NP_565408.1|  putative serine/threonine-specific protein kina...    208   2e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KHG23246.1|  hypothetical protein F383_30094                         209   2e-60   
ref|XP_006467073.1|  PREDICTED: probable serine/threonine-protein...    208   2e-60   
ref|XP_006425293.1|  hypothetical protein CICLE_v10025699mg             208   2e-60   
ref|XP_009106296.1|  PREDICTED: probable serine/threonine-protein...    209   2e-60   
ref|XP_003612340.1|  Serine/threonine protein kinase                    209   2e-60   
ref|XP_006425292.1|  hypothetical protein CICLE_v10025699mg             208   3e-60   
ref|XP_008663506.1|  PREDICTED: probable serine/threonine-protein...    211   3e-60   
emb|CAH66747.1|  H0409D10.5                                             209   3e-60   Oryza sativa [red rice]
gb|ACJ84370.1|  unknown                                                 207   4e-60   Medicago truncatula
ref|XP_003581530.2|  PREDICTED: probable serine/threonine-protein...    211   4e-60   
emb|CAE03087.2|  OSJNBa0017B10.2                                        209   4e-60   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK05598.1|  predicted protein                                      209   4e-60   
ref|XP_010240264.1|  PREDICTED: probable serine/threonine-protein...    211   4e-60   
ref|XP_007157998.1|  hypothetical protein PHAVU_002G115900g             207   5e-60   
gb|KHG09399.1|  hypothetical protein F383_14054                         207   6e-60   
ref|XP_009345926.1|  PREDICTED: probable serine/threonine-protein...    207   6e-60   
ref|XP_009128175.1|  PREDICTED: probable serine/threonine-protein...    208   7e-60   
ref|XP_007043058.1|  Serine/threonine-protein kinase cx32 isoform 2     207   7e-60   
ref|XP_009593137.1|  PREDICTED: probable serine/threonine-protein...    207   7e-60   
ref|XP_004976505.1|  PREDICTED: probable serine/threonine-protein...    207   8e-60   
gb|KHN41825.1|  Putative serine/threonine-protein kinase Cx32, ch...    204   9e-60   
ref|XP_010918257.1|  PREDICTED: probable serine/threonine-protein...    207   1e-59   
ref|XP_006300039.1|  hypothetical protein CARUB_v10016265mg             206   1e-59   
ref|XP_003519694.1|  PREDICTED: probable serine/threonine-protein...    206   1e-59   
ref|XP_004509435.1|  PREDICTED: probable serine/threonine-protein...    206   1e-59   
gb|AET03604.2|  Serine/Threonine-kinase Cx32, related protein           206   1e-59   
ref|XP_007199945.1|  hypothetical protein PRUPE_ppa006347mg             206   2e-59   
ref|XP_003538908.2|  PREDICTED: probable serine/threonine-protein...    205   2e-59   
ref|XP_007142571.1|  hypothetical protein PHAVU_008G292000g             206   2e-59   
ref|XP_009597877.1|  PREDICTED: probable serine/threonine-protein...    206   2e-59   
ref|XP_008235964.1|  PREDICTED: probable serine/threonine-protein...    206   2e-59   
ref|XP_010548159.1|  PREDICTED: probable serine/threonine-protein...    206   2e-59   
ref|XP_007043057.1|  Serine/threonine-protein kinase cx32 isoform 1     207   2e-59   
ref|XP_003629128.1|  Serine/threonine protein kinase BIK1               206   2e-59   
ref|XP_004509434.1|  PREDICTED: probable serine/threonine-protein...    206   2e-59   
gb|KFK42056.1|  hypothetical protein AALP_AA2G205700                    207   2e-59   
ref|XP_002279800.2|  PREDICTED: probable serine/threonine-protein...    206   3e-59   Vitis vinifera
ref|NP_001174044.1|  Os04g0563900                                       209   3e-59   
ref|XP_007142572.1|  hypothetical protein PHAVU_008G292000g             206   3e-59   
ref|XP_011088714.1|  PREDICTED: probable serine/threonine-protein...    206   3e-59   
ref|XP_011088711.1|  PREDICTED: probable serine/threonine-protein...    206   4e-59   
ref|XP_006379372.1|  hypothetical protein POPTR_0009s16860g             205   4e-59   
gb|EYU43737.1|  hypothetical protein MIMGU_mgv1a007465mg                205   4e-59   
ref|NP_001058637.1|  Os06g0727400                                       205   4e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452769.1|  hypothetical protein SORBIDRAFT_04g032190          206   4e-59   Sorghum bicolor [broomcorn]
ref|XP_003629135.1|  Protein kinase APK1B                               201   5e-59   
ref|XP_009344675.1|  PREDICTED: probable serine/threonine-protein...    205   5e-59   
ref|XP_010941423.1|  PREDICTED: probable serine/threonine-protein...    205   5e-59   
ref|XP_002312803.2|  hypothetical protein POPTR_0009s16860g             205   5e-59   Populus trichocarpa [western balsam poplar]
ref|XP_004231098.1|  PREDICTED: probable serine/threonine-protein...    204   7e-59   
ref|XP_011096982.1|  PREDICTED: probable serine/threonine-protein...    204   7e-59   
ref|XP_006409336.1|  hypothetical protein EUTSA_v10022708mg             204   7e-59   
emb|CBI37741.3|  unnamed protein product                                205   7e-59   
ref|XP_003572799.1|  PREDICTED: probable serine/threonine-protein...    205   8e-59   
ref|XP_008813320.1|  PREDICTED: protein kinase APK1B, chloroplast...    204   9e-59   
emb|CDP14494.1|  unnamed protein product                                204   9e-59   
ref|XP_011092993.1|  PREDICTED: probable serine/threonine-protein...    204   1e-58   
emb|CDY31372.1|  BnaA07g03070D                                          204   1e-58   
ref|XP_009373402.1|  PREDICTED: probable serine/threonine-protein...    204   1e-58   
ref|XP_008382436.1|  PREDICTED: probable serine/threonine-protein...    204   1e-58   
ref|XP_008241951.1|  PREDICTED: probable serine/threonine-protein...    204   1e-58   
dbj|BAK06515.1|  predicted protein                                      205   1e-58   
ref|XP_002527153.1|  serine/threonine-protein kinase cx32, putative     204   2e-58   Ricinus communis
ref|XP_009121148.1|  PREDICTED: probable serine/threonine-protein...    203   2e-58   
ref|XP_008364420.1|  PREDICTED: probable serine/threonine-protein...    202   2e-58   
dbj|BAK03372.1|  predicted protein                                      203   2e-58   
emb|CDX71350.1|  BnaC07g06290D                                          203   2e-58   
gb|KEH36322.1|  Serine/Threonine kinase family protein                  203   2e-58   
ref|XP_009392863.1|  PREDICTED: probable serine/threonine-protein...    203   2e-58   
ref|XP_010690221.1|  PREDICTED: probable serine/threonine-protein...    202   3e-58   
ref|XP_002300641.2|  hypothetical protein POPTR_0002s01040g             204   3e-58   Populus trichocarpa [western balsam poplar]
ref|XP_009392862.1|  PREDICTED: probable serine/threonine-protein...    203   3e-58   
ref|XP_010515408.1|  PREDICTED: probable serine/threonine-protein...    202   3e-58   
ref|XP_009788445.1|  PREDICTED: probable serine/threonine-protein...    202   3e-58   
ref|XP_010515435.1|  PREDICTED: probable serine/threonine-protein...    202   4e-58   
ref|XP_004287732.1|  PREDICTED: probable serine/threonine-protein...    202   4e-58   
ref|XP_006473798.1|  PREDICTED: probable serine/threonine-protein...    203   4e-58   
ref|XP_006435368.1|  hypothetical protein CICLE_v10001177mg             203   4e-58   
ref|XP_010029583.1|  PREDICTED: probable serine/threonine-protein...    202   4e-58   
ref|XP_009788446.1|  PREDICTED: probable serine/threonine-protein...    202   4e-58   
ref|XP_010530963.1|  PREDICTED: probable serine/threonine-protein...    202   4e-58   
ref|XP_008393454.1|  PREDICTED: probable serine/threonine-protein...    202   4e-58   
ref|NP_001235086.1|  protein kinase                                     202   5e-58   
ref|XP_008372852.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    202   5e-58   
emb|CDP16537.1|  unnamed protein product                                201   5e-58   
ref|XP_004955142.1|  PREDICTED: protein kinase APK1B, chloroplast...    203   5e-58   
ref|XP_011000883.1|  PREDICTED: probable serine/threonine-protein...    202   5e-58   
ref|XP_011000882.1|  PREDICTED: probable serine/threonine-protein...    202   6e-58   
gb|EMT24247.1|  Putative serine/threonine-protein kinase Cx32, ch...    202   6e-58   
ref|XP_006364355.1|  PREDICTED: probable serine/threonine-protein...    202   6e-58   
ref|NP_001045693.1|  Os02g0118200                                       202   7e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006422428.1|  hypothetical protein CICLE_v10028539mg             201   7e-58   
gb|AFW59201.1|  putative protein kinase superfamily protein             205   7e-58   
gb|EMS52039.1|  putative serine/threonine-protein kinase Cx32, ch...    202   7e-58   
ref|XP_002451394.1|  hypothetical protein SORBIDRAFT_04g001360          202   9e-58   Sorghum bicolor [broomcorn]
ref|XP_010066335.1|  PREDICTED: probable serine/threonine-protein...    201   9e-58   
gb|AFW63337.1|  putative protein kinase superfamily protein             202   1e-57   
ref|NP_001148215.1|  protein kinase APK1B                               202   1e-57   Zea mays [maize]
ref|XP_006422427.1|  hypothetical protein CICLE_v10028539mg             201   1e-57   
gb|KFK40106.1|  hypothetical protein AALP_AA3G331300                    201   1e-57   
gb|KFK40107.1|  hypothetical protein AALP_AA3G331300                    201   1e-57   
gb|KCW70320.1|  hypothetical protein EUGRSUZ_F035642                    200   1e-57   
ref|XP_006376784.1|  hypothetical protein POPTR_0012s06370g             201   1e-57   
ref|XP_006590748.1|  PREDICTED: probable serine/threonine-protein...    200   1e-57   
ref|XP_003523529.1|  PREDICTED: protein kinase APK1B, chloroplast...    199   2e-57   
ref|XP_006590747.1|  PREDICTED: probable serine/threonine-protein...    200   2e-57   
gb|EYU38037.1|  hypothetical protein MIMGU_mgv1a007214mg                201   2e-57   
ref|XP_010266182.1|  PREDICTED: probable serine/threonine-protein...    201   2e-57   
ref|XP_006340004.1|  PREDICTED: probable serine/threonine-protein...    201   2e-57   
ref|XP_011040800.1|  PREDICTED: probable serine/threonine-protein...    201   2e-57   
ref|XP_006384848.1|  kinase family protein                              201   2e-57   
ref|XP_003538909.1|  PREDICTED: probable serine/threonine-protein...    200   2e-57   
ref|XP_002280326.3|  PREDICTED: probable serine/threonine-protein...    201   3e-57   Vitis vinifera
ref|XP_008367929.1|  PREDICTED: probable serine/threonine-protein...    200   3e-57   
gb|EPS65362.1|  hypothetical protein M569_09414                         195   3e-57   
ref|XP_010103259.1|  putative serine/threonine-protein kinase Cx32      198   3e-57   
dbj|BAJ91759.1|  predicted protein                                      200   3e-57   
ref|XP_009764652.1|  PREDICTED: probable serine/threonine-protein...    199   3e-57   
ref|XP_011016043.1|  PREDICTED: probable serine/threonine-protein...    201   3e-57   
ref|XP_004234513.1|  PREDICTED: probable serine/threonine-protein...    200   5e-57   
ref|XP_004154762.1|  PREDICTED: probable serine/threonine-protein...    197   6e-57   
ref|XP_007046513.1|  Kinase superfamily protein, 32                     201   7e-57   
gb|EMT33274.1|  Protein kinase APK1A, chloroplastic                     199   7e-57   
dbj|BAD28317.1|  putative protein kinase                                200   7e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011013448.1|  PREDICTED: probable serine/threonine-protein...    199   8e-57   
ref|XP_008781318.1|  PREDICTED: probable serine/threonine-protein...    198   8e-57   
ref|NP_001047694.1|  Os02g0670100                                       200   8e-57   Oryza sativa Japonica Group [Japonica rice]
gb|KDP43763.1|  hypothetical protein JCGZ_22390                         199   9e-57   
gb|EAY87019.1|  hypothetical protein OsI_08416                          200   9e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_006646791.1|  PREDICTED: probable serine/threonine-protein...    199   9e-57   
ref|XP_010040702.1|  PREDICTED: probable serine/threonine-protein...    201   1e-56   
ref|XP_010489344.1|  PREDICTED: probable serine/threonine-protein...    199   1e-56   
ref|XP_010489347.1|  PREDICTED: probable serine/threonine-protein...    199   1e-56   
ref|XP_008812270.1|  PREDICTED: probable serine/threonine-protein...    199   1e-56   
ref|XP_008447840.1|  PREDICTED: probable serine/threonine-protein...    199   1e-56   
ref|XP_009395361.1|  PREDICTED: protein kinase APK1B, chloroplast...    198   1e-56   
ref|XP_009382066.1|  PREDICTED: probable serine/threonine-protein...    199   1e-56   
ref|XP_010040701.1|  PREDICTED: probable serine/threonine-protein...    201   1e-56   
ref|XP_009392329.1|  PREDICTED: probable serine/threonine-protein...    198   2e-56   
ref|XP_010679959.1|  PREDICTED: probable serine/threonine-protein...    198   2e-56   
gb|EYU40476.1|  hypothetical protein MIMGU_mgv1a006634mg                198   2e-56   
gb|KHN09350.1|  Putative serine/threonine-protein kinase Cx32, ch...    198   2e-56   
emb|CDY26797.1|  BnaC09g09240D                                          198   3e-56   
ref|XP_010040700.1|  PREDICTED: probable serine/threonine-protein...    199   3e-56   
ref|XP_002307210.1|  hypothetical protein POPTR_0005s10390g             198   3e-56   Populus trichocarpa [western balsam poplar]
emb|CDY47489.1|  BnaA09g08980D                                          197   3e-56   
gb|EPS71474.1|  hypothetical protein M569_03280                         197   3e-56   
gb|EEC81341.1|  hypothetical protein OsI_24527                          204   3e-56   Oryza sativa Indica Group [Indian rice]
gb|AFK43900.1|  unknown                                                 197   3e-56   
ref|XP_010064950.1|  PREDICTED: probable serine/threonine-protein...    201   3e-56   
ref|XP_004144887.1|  PREDICTED: probable serine/threonine-protein...    197   3e-56   
ref|XP_009112418.1|  PREDICTED: probable serine/threonine-protein...    197   4e-56   
ref|NP_001147720.1|  serine/threonine-protein kinase Cx32               198   4e-56   Zea mays [maize]
ref|XP_009397897.1|  PREDICTED: probable serine/threonine-protein...    197   4e-56   
ref|XP_010233714.1|  PREDICTED: probable serine/threonine-protein...    197   4e-56   
gb|KHN20110.1|  Putative serine/threonine-protein kinase NAK            195   5e-56   
gb|EAZ24138.1|  hypothetical protein OsJ_07878                          198   5e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004253237.1|  PREDICTED: probable serine/threonine-protein...    197   6e-56   
ref|XP_010040699.1|  PREDICTED: probable serine/threonine-protein...    199   6e-56   
gb|KDP43762.1|  hypothetical protein JCGZ_22389                         196   7e-56   
ref|XP_006855749.1|  hypothetical protein AMTR_s00044p00168360          203   8e-56   
emb|CDP01798.1|  unnamed protein product                                196   9e-56   
ref|XP_003527639.1|  PREDICTED: probable serine/threonine-protein...    195   9e-56   
ref|XP_006343333.1|  PREDICTED: probable serine/threonine-protein...    196   1e-55   
ref|XP_009601926.1|  PREDICTED: probable serine/threonine-protein...    196   1e-55   
ref|XP_009365764.1|  PREDICTED: protein kinase 2A, chloroplastic-...    192   1e-55   
ref|XP_011022164.1|  PREDICTED: probable serine/threonine-protein...    196   1e-55   
gb|KGN43339.1|  hypothetical protein Csa_7G024130                       197   1e-55   
ref|XP_003563244.1|  PREDICTED: probable serine/threonine-protein...    195   2e-55   
ref|XP_004500872.1|  PREDICTED: probable serine/threonine-protein...    193   3e-55   
ref|XP_004500871.1|  PREDICTED: probable serine/threonine-protein...    194   3e-55   
ref|XP_004500870.1|  PREDICTED: probable serine/threonine-protein...    194   4e-55   
ref|XP_004500869.1|  PREDICTED: probable serine/threonine-protein...    194   5e-55   
ref|XP_009804656.1|  PREDICTED: probable serine/threonine-protein...    194   1e-54   
ref|XP_009396689.1|  PREDICTED: probable serine/threonine-protein...    193   1e-54   
ref|XP_002439066.1|  hypothetical protein SORBIDRAFT_10g030880          193   1e-54   Sorghum bicolor [broomcorn]
gb|EYU33216.1|  hypothetical protein MIMGU_mgv1a011111mg                190   1e-54   
ref|XP_010094560.1|  putative serine/threonine-protein kinase Cx32      194   1e-54   
ref|XP_010111698.1|  putative serine/threonine-protein kinase Cx32      194   2e-54   
ref|XP_008809115.1|  PREDICTED: probable serine/threonine-protein...    192   2e-54   
ref|XP_004966517.1|  PREDICTED: probable serine/threonine-protein...    192   2e-54   
gb|KCW55673.1|  hypothetical protein EUGRSUZ_I01524                     192   3e-54   
ref|XP_009362864.1|  PREDICTED: probable serine/threonine-protein...    193   3e-54   
ref|XP_006354974.1|  PREDICTED: receptor-like protein kinase FERO...    201   3e-54   
ref|XP_009337112.1|  PREDICTED: probable serine/threonine-protein...    192   3e-54   
ref|XP_007136021.1|  hypothetical protein PHAVU_009G011400g             191   4e-54   
ref|XP_003616404.1|  Serine/threonine protein kinase                    187   4e-54   
ref|XP_010028844.1|  PREDICTED: probable serine/threonine-protein...    192   6e-54   
gb|AFW66750.1|  putative protein kinase superfamily protein             192   6e-54   
ref|NP_001147123.1|  serine/threonine-protein kinase Cx32               192   7e-54   Zea mays [maize]
gb|KGN55601.1|  hypothetical protein Csa_3G001730                       187   8e-54   
ref|XP_011091519.1|  PREDICTED: probable serine/threonine-protein...    191   8e-54   
ref|XP_008653727.1|  PREDICTED: probable serine/threonine-protein...    191   1e-53   
emb|CDP12378.1|  unnamed protein product                                196   1e-53   
gb|KCW70318.1|  hypothetical protein EUGRSUZ_F03560                     188   2e-53   
ref|XP_004146213.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    189   2e-53   
gb|KDP26841.1|  hypothetical protein JCGZ_17999                         189   3e-53   
emb|CDP12379.1|  unnamed protein product                                194   4e-53   
ref|XP_008448469.1|  PREDICTED: probable serine/threonine-protein...    188   7e-53   
ref|XP_008448468.1|  PREDICTED: probable serine/threonine-protein...    188   7e-53   
gb|KCW70317.1|  hypothetical protein EUGRSUZ_F03558                     186   8e-53   
ref|XP_003548807.2|  PREDICTED: probable serine/threonine-protein...    188   8e-53   
ref|XP_006435539.1|  hypothetical protein CICLE_v10031723mg             188   9e-53   
ref|XP_004490921.1|  PREDICTED: protein kinase APK1A, chloroplast...    181   9e-53   
ref|XP_006486482.1|  PREDICTED: protein kinase APK1B, chloroplast...    188   1e-52   
ref|XP_008465651.1|  PREDICTED: probable serine/threonine-protein...    186   1e-52   
ref|XP_010063130.1|  PREDICTED: protein kinase APK1B, chloroplast...    188   1e-52   
ref|XP_010063129.1|  PREDICTED: probable serine/threonine-protein...    189   1e-52   
ref|XP_002531440.1|  Protein kinase APK1A, chloroplast precursor,...    186   1e-52   
gb|ADN33987.1|  serine/threonine-protein kinase cx32                    187   1e-52   
ref|XP_003548810.2|  PREDICTED: probable serine/threonine-protein...    188   2e-52   
ref|XP_004146212.1|  PREDICTED: probable serine/threonine-protein...    187   2e-52   
ref|XP_003519344.1|  PREDICTED: protein kinase APK1A, chloroplast...    187   2e-52   
gb|KGN55604.1|  hypothetical protein Csa_3G001760                       187   2e-52   
ref|XP_004159758.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    187   2e-52   
ref|XP_004301978.1|  PREDICTED: protein kinase 2A, chloroplastic-...    188   2e-52   
emb|CDP00097.1|  unnamed protein product                                187   2e-52   
ref|NP_001149460.1|  LOC100283086                                       187   2e-52   
ref|XP_004490898.1|  PREDICTED: protein kinase APK1A, chloroplast...    187   3e-52   
gb|KHN09344.1|  Putative serine/threonine-protein kinase Cx32, ch...    186   4e-52   
gb|EYU38034.1|  hypothetical protein MIMGU_mgv1a012038mg                182   4e-52   
ref|XP_009759469.1|  PREDICTED: protein kinase APK1A, chloroplast...    186   4e-52   
ref|XP_004144241.1|  PREDICTED: probable serine/threonine-protein...    185   5e-52   
gb|ACU19261.1|  unknown                                                 186   5e-52   
ref|XP_009626085.1|  PREDICTED: protein kinase APK1A, chloroplastic     186   5e-52   
ref|XP_003544233.1|  PREDICTED: protein kinase APK1A, chloroplast...    186   7e-52   
ref|XP_010047712.1|  PREDICTED: protein kinase APK1B, chloroplast...    186   8e-52   
gb|KCW70316.1|  hypothetical protein EUGRSUZ_F03558                     184   9e-52   
gb|KCW88940.1|  hypothetical protein EUGRSUZ_A01268                     186   9e-52   
ref|XP_010047703.1|  PREDICTED: probable serine/threonine-protein...    186   9e-52   
gb|ACF83789.1|  unknown                                                 185   1e-51   
gb|EYU22645.1|  hypothetical protein MIMGU_mgv1a012231mg                181   1e-51   
ref|XP_004236745.1|  PREDICTED: protein kinase APK1A, chloroplastic     184   2e-51   
ref|XP_008654993.1|  PREDICTED: LOC100283086 isoform X2                 185   2e-51   
ref|XP_006365700.1|  PREDICTED: protein kinase APK1A, chloroplast...    184   2e-51   
ref|XP_003616403.1|  Serine/threonine protein kinase                    185   2e-51   
gb|EPS59398.1|  hypothetical protein M569_15409                         184   3e-51   
ref|XP_010554610.1|  PREDICTED: serine/threonine-protein kinase B...    184   4e-51   
gb|KEH34698.1|  tyrosine kinase family protein                          181   4e-51   
ref|XP_008654992.1|  PREDICTED: LOC100283086 isoform X1                 184   4e-51   
ref|XP_004159759.1|  PREDICTED: probable serine/threonine-protein...    182   5e-51   
gb|KEH34699.1|  tyrosine kinase family protein                          181   5e-51   
ref|XP_010063131.1|  PREDICTED: probable serine/threonine-protein...    185   5e-51   
ref|XP_004294513.1|  PREDICTED: protein kinase APK1A, chloroplast...    184   5e-51   
gb|ABF93808.1|  serine/threonine-protein kinase Cx32, chloroplast...    183   6e-51   
gb|EAZ25468.1|  hypothetical protein OsJ_09291                          183   7e-51   
ref|XP_010256925.1|  PREDICTED: protein kinase APK1A, chloroplastic     183   8e-51   
ref|XP_008238069.1|  PREDICTED: probable serine/threonine-protein...    181   9e-51   
gb|EYU41728.1|  hypothetical protein MIMGU_mgv1a007413mg                182   1e-50   
ref|XP_010041547.1|  PREDICTED: protein kinase APK1B, chloroplast...    179   1e-50   
ref|XP_003618115.1|  Protein kinase 2B                                  178   1e-50   
emb|CCI55428.1|  PH01B031C15.11                                         182   1e-50   
ref|XP_010030960.1|  PREDICTED: protein kinase APK1A, chloroplast...    182   1e-50   
ref|XP_010683239.1|  PREDICTED: protein kinase 2B, chloroplastic-...    182   2e-50   
gb|KEH34697.1|  tyrosine kinase family protein                          182   2e-50   
gb|KEH34700.1|  tyrosine kinase family protein                          182   2e-50   
ref|XP_011077648.1|  PREDICTED: protein kinase APK1A, chloroplast...    182   2e-50   
gb|KDP20446.1|  hypothetical protein JCGZ_05291                         182   2e-50   
ref|XP_006372170.1|  hypothetical protein POPTR_0018s13470g             182   3e-50   
ref|XP_002314178.2|  Protein kinase capable of phosphorylating ty...    181   3e-50   
ref|XP_007141880.1|  hypothetical protein PHAVU_008G233400g             181   3e-50   
ref|XP_009389571.1|  PREDICTED: protein kinase 2A, chloroplastic-...    182   3e-50   
ref|XP_009389572.1|  PREDICTED: protein kinase 2A, chloroplastic-...    182   3e-50   
gb|EAY78419.1|  hypothetical protein OsI_33509                          182   4e-50   
ref|NP_001064557.1|  Os10g0405100                                       182   4e-50   
ref|XP_002266032.1|  PREDICTED: probable serine/threonine-protein...    181   4e-50   
emb|CDP06608.1|  unnamed protein product                                181   5e-50   
ref|XP_008789617.1|  PREDICTED: serine/threonine-protein kinase A...    180   5e-50   
ref|XP_010531641.1|  PREDICTED: serine/threonine-protein kinase B...    180   6e-50   
gb|KDO51148.1|  hypothetical protein CISIN_1g015909mg                   181   6e-50   
ref|XP_006429091.1|  hypothetical protein CICLE_v10011895mg             181   6e-50   
ref|XP_010234717.1|  PREDICTED: protein kinase 2B, chloroplastic-...    181   7e-50   
ref|XP_010245739.1|  PREDICTED: serine/threonine-protein kinase A...    180   8e-50   
ref|XP_006856462.1|  hypothetical protein AMTR_s00046p00017580          176   8e-50   
ref|XP_011094865.1|  PREDICTED: protein kinase APK1A, chloroplastic     180   1e-49   
gb|EYU26593.1|  hypothetical protein MIMGU_mgv1a007265mg                180   1e-49   
gb|KEH39440.1|  kinase 1B                                               180   1e-49   
ref|XP_010534501.1|  PREDICTED: serine/threonine-protein kinase B...    180   1e-49   
ref|XP_009610452.1|  PREDICTED: probable serine/threonine-protein...    180   1e-49   
ref|XP_004158308.1|  PREDICTED: serine/threonine-protein kinase P...    175   1e-49   
emb|CBW30202.1|  Protein kinase APK1B                                   181   1e-49   
ref|XP_009610451.1|  PREDICTED: probable serine/threonine-protein...    180   1e-49   
gb|EYU39277.1|  hypothetical protein MIMGU_mgv1a011202mg                176   2e-49   
ref|XP_002533148.1|  Protein kinase APK1B, chloroplast precursor,...    180   2e-49   
ref|XP_007155041.1|  hypothetical protein PHAVU_003G168000g             180   2e-49   
ref|XP_002468577.1|  hypothetical protein SORBIDRAFT_01g048300          179   2e-49   
ref|NP_001234409.1|  protein kinase 1b                                  179   2e-49   
ref|XP_010264446.1|  PREDICTED: protein kinase APK1A, chloroplastic     180   2e-49   
gb|KCW44282.1|  hypothetical protein EUGRSUZ_L02283                     178   2e-49   
ref|XP_010927375.1|  PREDICTED: probable receptor-like protein ki...    179   2e-49   
ref|XP_011027201.1|  PREDICTED: protein kinase APK1A, chloroplastic     179   2e-49   
ref|XP_007155042.1|  hypothetical protein PHAVU_003G168000g             180   2e-49   
ref|XP_010927374.1|  PREDICTED: probable receptor-like protein ki...    179   2e-49   
ref|XP_006361336.1|  PREDICTED: putative receptor-like protein ki...    179   3e-49   
ref|XP_010685751.1|  PREDICTED: protein kinase APK1B, chloroplast...    179   3e-49   
ref|XP_004503561.1|  PREDICTED: serine/threonine-protein kinase A...    178   3e-49   
ref|XP_004503560.1|  PREDICTED: serine/threonine-protein kinase A...    178   3e-49   
ref|XP_010245738.1|  PREDICTED: serine/threonine-protein kinase A...    180   3e-49   
ref|XP_010245737.1|  PREDICTED: serine/threonine-protein kinase A...    180   3e-49   
gb|KHG10966.1|  Protein kinase APK1B, chloroplastic -like protein       179   3e-49   
ref|XP_009353659.1|  PREDICTED: protein kinase APK1A, chloroplast...    178   3e-49   
ref|XP_004252518.1|  PREDICTED: putative receptor-like protein ki...    179   3e-49   
ref|XP_010685750.1|  PREDICTED: protein kinase APK1B, chloroplast...    179   3e-49   
ref|XP_010417417.1|  PREDICTED: serine/threonine-protein kinase A...    179   3e-49   
ref|XP_008464125.1|  PREDICTED: protein kinase APK1A, chloroplast...    177   3e-49   
gb|KHN33381.1|  Protein kinase APK1A, chloroplastic                     179   3e-49   
ref|XP_008343582.1|  PREDICTED: protein kinase APK1A, chloroplast...    178   3e-49   
ref|XP_008450497.1|  PREDICTED: serine/threonine-protein kinase A...    177   4e-49   
ref|XP_008351966.1|  PREDICTED: probable receptor-like protein ki...    177   4e-49   
gb|AET01074.2|  Serine/Threonine kinase family protein                  178   4e-49   
gb|KDP44953.1|  hypothetical protein JCGZ_01453                         179   4e-49   
ref|XP_008223637.1|  PREDICTED: protein kinase APK1A, chloroplast...    179   4e-49   
ref|XP_007205264.1|  hypothetical protein PRUPE_ppa006390mg             179   4e-49   
ref|XP_010692535.1|  PREDICTED: probable serine/threonine-protein...    178   4e-49   
ref|XP_011035315.1|  PREDICTED: protein kinase APK1B, chloroplast...    177   4e-49   
ref|XP_006573305.1|  PREDICTED: protein kinase APK1B, chloroplast...    179   4e-49   
ref|XP_010250180.1|  PREDICTED: probable receptor-like protein ki...    179   5e-49   
ref|NP_001242670.1|  uncharacterized protein LOC100798404               179   5e-49   
ref|XP_010526844.1|  PREDICTED: probable serine/threonine-protein...    179   5e-49   
ref|XP_003618113.1|  Protein kinase 2B                                  178   6e-49   
ref|XP_008450489.1|  PREDICTED: serine/threonine-protein kinase A...    177   6e-49   
ref|XP_009772470.1|  PREDICTED: probable serine/threonine-protein...    178   6e-49   
ref|XP_003618114.1|  Protein kinase 2B                                  178   6e-49   
ref|XP_004301877.1|  PREDICTED: probable serine/threonine-protein...    177   6e-49   
ref|XP_002265959.2|  PREDICTED: serine/threonine-protein kinase A...    179   6e-49   
ref|XP_007009312.1|  Kinase superfamily protein isoform 1               178   6e-49   
gb|EMT28395.1|  Putative serine/threonine-protein kinase NAK            176   6e-49   
ref|XP_006576543.1|  PREDICTED: protein kinase APK1B, chloroplast...    177   6e-49   
ref|XP_004165824.1|  PREDICTED: LOW QUALITY PROTEIN: protein kina...    178   7e-49   
ref|XP_008354131.1|  PREDICTED: protein kinase APK1A, chloroplast...    178   7e-49   
ref|XP_008811563.1|  PREDICTED: protein kinase 2B, chloroplastic-...    178   7e-49   
ref|XP_003573903.1|  PREDICTED: protein kinase 2B, chloroplastic-...    179   7e-49   
ref|XP_009392754.1|  PREDICTED: serine/threonine-protein kinase A...    179   7e-49   
ref|XP_004145296.1|  PREDICTED: protein kinase APK1A, chloroplast...    178   7e-49   
ref|XP_009376055.1|  PREDICTED: probable receptor-like protein ki...    177   7e-49   
ref|NP_001235430.1|  protein kinase                                     176   7e-49   
ref|XP_008464124.1|  PREDICTED: protein kinase APK1A, chloroplast...    178   7e-49   
ref|XP_003621108.1|  Protein kinase 2B                                  179   7e-49   
ref|XP_009380174.1|  PREDICTED: protein kinase 2B, chloroplastic-...    178   8e-49   
ref|XP_006844578.1|  hypothetical protein AMTR_s00016p00199290          178   8e-49   
gb|AES77326.2|  receptor-like kinase plant                              179   8e-49   
dbj|BAE71262.1|  putative protein kinase APK1A                          178   8e-49   
ref|XP_010928727.1|  PREDICTED: serine/threonine-protein kinase A...    177   8e-49   
ref|XP_009398617.1|  PREDICTED: serine/threonine-protein kinase A...    178   8e-49   
ref|XP_006593328.1|  PREDICTED: protein kinase isoform X2               178   9e-49   
ref|XP_004163061.1|  PREDICTED: serine/threonine-protein kinase A...    176   9e-49   
ref|XP_010540703.1|  PREDICTED: serine/threonine-protein kinase A...    178   9e-49   
ref|XP_002534306.1|  Protein kinase APK1B, chloroplast precursor,...    177   9e-49   
ref|XP_004508467.1|  PREDICTED: probable receptor-like protein ki...    178   1e-48   
ref|XP_010429651.1|  PREDICTED: serine/threonine-protein kinase A...    178   1e-48   
ref|XP_010656462.1|  PREDICTED: receptor-like serine/threonine-pr...    178   1e-48   
emb|CDP10443.1|  unnamed protein product                                178   1e-48   
ref|XP_009339196.1|  PREDICTED: probable receptor-like protein ki...    177   1e-48   
ref|NP_001167795.1|  uncharacterized LOC100381489                       174   1e-48   
ref|XP_007160211.1|  hypothetical protein PHAVU_002G302300g             177   1e-48   
ref|XP_002285390.2|  PREDICTED: receptor-like serine/threonine-pr...    178   1e-48   
gb|KHN47889.1|  Protein kinase APK1B, chloroplastic                     177   1e-48   
ref|XP_010536824.1|  PREDICTED: probable receptor-like protein ki...    177   1e-48   
ref|XP_006593327.1|  PREDICTED: protein kinase isoform X1               178   1e-48   
ref|XP_002311169.2|  hypothetical protein POPTR_0008s05650g             177   1e-48   
ref|XP_009412594.1|  PREDICTED: probable serine/threonine-protein...    177   1e-48   
ref|NP_001235445.1|  protein kinase                                     177   1e-48   
ref|XP_003522100.1|  PREDICTED: protein kinase APK1B, chloroplast...    177   1e-48   
emb|CBI16124.3|  unnamed protein product                                177   1e-48   
ref|XP_010913798.1|  PREDICTED: serine/threonine-protein kinase A...    178   1e-48   
ref|XP_009762091.1|  PREDICTED: probable receptor-like protein ki...    177   1e-48   
ref|XP_006379595.1|  hypothetical protein POPTR_0008s05650g             177   1e-48   
ref|XP_011035309.1|  PREDICTED: protein kinase APK1A, chloroplast...    177   1e-48   
ref|XP_011042707.1|  PREDICTED: protein kinase APK1A, chloroplastic     177   1e-48   
ref|XP_011035314.1|  PREDICTED: protein kinase APK1A, chloroplast...    177   1e-48   
ref|XP_009774717.1|  PREDICTED: protein kinase APK1A, chloroplast...    177   1e-48   
ref|XP_004152853.1|  PREDICTED: serine/threonine-protein kinase A...    176   1e-48   
ref|XP_010112470.1|  Receptor-like serine/threonine-protein kinase      177   2e-48   
ref|XP_010067409.1|  PREDICTED: probable serine/threonine-protein...    177   2e-48   
gb|AAR23739.1|  At2g26290                                               173   2e-48   
gb|KEH21307.1|  Serine/Threonine kinase family protein                  176   2e-48   
emb|CDP18581.1|  unnamed protein product                                176   2e-48   
ref|XP_004239839.1|  PREDICTED: probable serine/threonine-protein...    177   2e-48   
gb|AFK44181.1|  unknown                                                 177   2e-48   
ref|XP_002299870.1|  Protein kinase capable of phosphorylating ty...    177   2e-48   
ref|XP_009590400.1|  PREDICTED: protein kinase APK1A, chloroplastic     177   2e-48   
ref|XP_003609389.1|  Protein kinase 2B                                  177   2e-48   
gb|KDP35639.1|  hypothetical protein JCGZ_09077                         176   2e-48   
ref|XP_009343547.1|  PREDICTED: protein kinase APK1A, chloroplast...    176   2e-48   
ref|XP_008384377.1|  PREDICTED: probable receptor-like protein ki...    176   2e-48   
ref|XP_008357182.1|  PREDICTED: protein kinase APK1A, chloroplastic     177   2e-48   
ref|XP_006601720.1|  PREDICTED: protein kinase isoform X1               176   2e-48   
ref|XP_004143118.1|  PREDICTED: protein kinase APK1A, chloroplast...    176   2e-48   
ref|XP_010530998.1|  PREDICTED: probable serine/threonine-protein...    177   2e-48   
ref|XP_004487006.1|  PREDICTED: protein kinase APK1B, chloroplast...    177   2e-48   
emb|CDP16592.1|  unnamed protein product                                177   2e-48   
ref|XP_003612555.1|  Protein kinase 2B                                  177   3e-48   
gb|EPS69141.1|  hypothetical protein M569_05623                         175   3e-48   
ref|XP_004238776.1|  PREDICTED: protein kinase 2B, chloroplastic-...    177   3e-48   
ref|XP_010530999.1|  PREDICTED: probable serine/threonine-protein...    177   3e-48   
gb|AAT39953.2|  Protein kinase APK1B, chloroplast precursor, puta...    176   3e-48   
gb|KHN17927.1|  Protein kinase APK1B, chloroplastic                     175   3e-48   
ref|XP_004159424.1|  PREDICTED: probable receptor-like protein ki...    176   3e-48   
ref|XP_006363247.1|  PREDICTED: protein kinase 2B, chloroplastic-...    177   3e-48   
ref|XP_007222079.1|  hypothetical protein PRUPE_ppa007540mg             175   3e-48   
ref|XP_011089173.1|  PREDICTED: probable receptor-like protein ki...    176   3e-48   
ref|XP_002283646.2|  PREDICTED: protein kinase APK1A, chloroplastic     177   3e-48   
ref|XP_009762090.1|  PREDICTED: probable receptor-like protein ki...    177   3e-48   
ref|XP_007153823.1|  hypothetical protein PHAVU_003G067900g             176   3e-48   
ref|XP_008784589.1|  PREDICTED: protein kinase APK1A, chloroplast...    176   3e-48   
ref|XP_002316286.1|  hypothetical protein POPTR_0010s21090g             176   3e-48   
emb|CAN69043.1|  hypothetical protein VITISV_022341                     176   3e-48   
ref|XP_008371735.1|  PREDICTED: probable serine/threonine-protein...    176   3e-48   
ref|XP_002466186.1|  hypothetical protein SORBIDRAFT_01g003130          176   3e-48   
gb|AAT40481.1|  putative protein kinase                                 176   3e-48   
gb|KCW44991.1|  hypothetical protein EUGRSUZ_L01420                     174   3e-48   
ref|XP_010920578.1|  PREDICTED: protein kinase APK1B, chloroplast...    176   3e-48   
dbj|BAJ98795.1|  predicted protein                                      172   4e-48   
ref|XP_004491643.1|  PREDICTED: probable serine/threonine-protein...    176   4e-48   
gb|KHN48075.1|  Putative receptor-like protein kinase                   176   4e-48   
ref|XP_007163407.1|  hypothetical protein PHAVU_001G232300g             176   4e-48   
ref|XP_008645103.1|  PREDICTED: probable serine/threonine-protein...    176   4e-48   
gb|KHN31764.1|  Protein kinase 2B, chloroplastic                        176   4e-48   
ref|NP_001238650.1|  protein kinase                                     176   4e-48   
ref|XP_006580500.1|  PREDICTED: serine/threonine-protein kinase A...    175   4e-48   
gb|ACL52762.1|  unknown                                                 172   4e-48   
ref|XP_004487004.1|  PREDICTED: protein kinase APK1B, chloroplast...    176   4e-48   



>ref|XP_009765257.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Nicotiana sylvestris]
Length=427

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAK+GPVNG+SHVTTR++GTYGYAAPEYMATGHLYV+SDVYGFGVVLLEI
Sbjct  229  DYNAKLSDFGLAKMGPVNGDSHVTTRVVGTYGYAAPEYMATGHLYVRSDVYGFGVVLLEI  288

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG +VLDL+R + E NLVEW KP+L +K+K++ I+DPRLEG+YPS+AA +IAE+IL+C 
Sbjct  289  LTGRRVLDLNRPNGETNLVEWAKPMLPDKKKLRKIMDPRLEGQYPSKAAYQIAEIILQCL  348

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADY  554
            + +P  RPSM+E+L+ L++ N +K + R+  + R+   RS ++
Sbjct  349  EPDPKTRPSMEEILECLEQCNAIKMKPREKNATRAHDQRSGNH  391



>ref|XP_009765256.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Nicotiana sylvestris]
Length=428

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAK+GPVNG+SHVTTR++GTYGYAAPEYMATGHLYV+SDVYGFGVVLLEI
Sbjct  230  DYNAKLSDFGLAKMGPVNGDSHVTTRVVGTYGYAAPEYMATGHLYVRSDVYGFGVVLLEI  289

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG +VLDL+R + E NLVEW KP+L +K+K++ I+DPRLEG+YPS+AA +IAE+IL+C 
Sbjct  290  LTGRRVLDLNRPNGETNLVEWAKPMLPDKKKLRKIMDPRLEGQYPSKAAYQIAEIILQCL  349

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADY  554
            + +P  RPSM+E+L+ L++ N +K + R+  + R+   RS ++
Sbjct  350  EPDPKTRPSMEEILECLEQCNAIKMKPREKNATRAHDQRSGNH  392



>ref|XP_009590741.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X2 [Nicotiana tomentosiformis]
Length=222

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAKLGP NGNSHVTT ++GTYGYAAPEYMA+GHLYVKSDVYGFGVVLLEI
Sbjct  59   DYNAKLSDFGLAKLGPANGNSHVTTGVVGTYGYAAPEYMASGHLYVKSDVYGFGVVLLEI  118

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL+VLDL+R + EQNLV+W +P+L +K+K++ ++DPRLEGKYP++AA  IA+L+L+C 
Sbjct  119  LTGLRVLDLNRPNGEQNLVDWAEPLLPDKKKLRKLMDPRLEGKYPTKAAFEIAQLVLQCL  178

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRD  512
            + +P  RPS+++VL+SL++IN +K + R+
Sbjct  179  EPDPKTRPSIEQVLESLEKINTIKKKPRE  207



>ref|XP_009590736.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=223

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAKLGP NGNSHVTT ++GTYGYAAPEYMA+GHLYVKSDVYGFGVVLLEI
Sbjct  60   DYNAKLSDFGLAKLGPANGNSHVTTGVVGTYGYAAPEYMASGHLYVKSDVYGFGVVLLEI  119

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL+VLDL+R + EQNLV+W +P+L +K+K++ ++DPRLEGKYP++AA  IA+L+L+C 
Sbjct  120  LTGLRVLDLNRPNGEQNLVDWAEPLLPDKKKLRKLMDPRLEGKYPTKAAFEIAQLVLQCL  179

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRD  512
            + +P  RPS+++VL+SL++IN +K + R+
Sbjct  180  EPDPKTRPSIEQVLESLEKINTIKKKPRE  208



>emb|CDP07284.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   231 bits (589),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            +FNAKLSDFGLAKLGPVNG SHVTTR++GTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI
Sbjct  250  DFNAKLSDFGLAKLGPVNGYSHVTTRVVGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  309

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            ++G +VLDL+R S E NLV+W+KP+L +KRK++ ++DP+LEG+YPSR A +IA+LILKC 
Sbjct  310  ISGRRVLDLNRPSGEHNLVDWSKPLLPDKRKLRKVMDPQLEGRYPSRGAFQIAQLILKCL  369

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
            + +P KRP M++VL++LQ+I+ VK + +D ++
Sbjct  370  EPDPKKRPPMEQVLETLQQISAVKMKPKDAKA  401



>gb|KCW70322.1| hypothetical protein EUGRSUZ_F03566 [Eucalyptus grandis]
Length=354

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            +FNAKLSDFGLAKLGP  GNSHVTTR++GTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  158  DFNAKLSDFGLAKLGPAGGNSHVTTRVIGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEM  217

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL+ LD +R S +QNLVEW +P L +KRK++ I+D RLEG+YP +AAT+ AELILKC 
Sbjct  218  LTGLQALDNTRPSGQQNLVEWARPSLRDKRKLRKIMDSRLEGRYPLKAATQAAELILKCL  277

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
            + +P  RPSMDEVLK++++I+ ++ +R++ +++ S
Sbjct  278  EGDPKARPSMDEVLKTVEQIDTIREKRKEGKASTS  312



>gb|KCW70323.1| hypothetical protein EUGRSUZ_F03566 [Eucalyptus grandis]
Length=360

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            +FNAKLSDFGLAKLGP  GNSHVTTR++GTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  164  DFNAKLSDFGLAKLGPAGGNSHVTTRVIGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEM  223

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL+ LD +R S +QNLVEW +P L +KRK++ I+D RLEG+YP +AAT+ AELILKC 
Sbjct  224  LTGLQALDNTRPSGQQNLVEWARPSLRDKRKLRKIMDSRLEGRYPLKAATQAAELILKCL  283

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
            + +P  RPSMDEVLK++++I+ ++ +R++ +++ S
Sbjct  284  EGDPKARPSMDEVLKTVEQIDTIREKRKEGKASTS  318



>ref|XP_010064951.1| PREDICTED: probable serine/threonine-protein kinase NAK [Eucalyptus 
grandis]
Length=396

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            +FNAKLSDFGLAKLGP  GNSHVTTR++GTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  200  DFNAKLSDFGLAKLGPAGGNSHVTTRVIGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEM  259

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL+ LD +R S +QNLVEW +P L +KRK++ I+D RLEG+YP +AAT+ AELILKC 
Sbjct  260  LTGLQALDNTRPSGQQNLVEWARPSLRDKRKLRKIMDSRLEGRYPLKAATQAAELILKCL  319

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
            + +P  RPSMDEVLK++++I+ ++ +R++ +++ S
Sbjct  320  EGDPKARPSMDEVLKTVEQIDTIREKRKEGKASTS  354



>ref|XP_009622684.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Nicotiana tomentosiformis]
Length=435

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAK+GPVNG+SHVTTR++GTYGYAAPEYMATGHLYV+SDVYGFGVVLLEI
Sbjct  237  DYNAKLSDFGLAKMGPVNGDSHVTTRVVGTYGYAAPEYMATGHLYVRSDVYGFGVVLLEI  296

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG +VLDL+R + E NLVEW KP+L +K+K++ I+DPRLEG+YPS+AA  IAE+I++C 
Sbjct  297  LTGRRVLDLNRPNGEINLVEWAKPMLPDKKKLRKIMDPRLEGQYPSKAAYEIAEIIVQCL  356

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSA  548
            + +P  RPSM+E+L  L++ N +K + R+  + R+   RS 
Sbjct  357  EPDPKTRPSMEEILDCLEQCNAIKMKPRERNATRAHDQRSG  397



>ref|XP_009622683.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Nicotiana tomentosiformis]
Length=435

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAK+GPVNG+SHVTTR++GTYGYAAPEYMATGHLYV+SDVYGFGVVLLEI
Sbjct  237  DYNAKLSDFGLAKMGPVNGDSHVTTRVVGTYGYAAPEYMATGHLYVRSDVYGFGVVLLEI  296

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG +VLDL+R + E NLVEW KP+L +K+K++ I+DPRLEG+YPS+AA  IAE+I++C 
Sbjct  297  LTGRRVLDLNRPNGEINLVEWAKPMLPDKKKLRKIMDPRLEGQYPSKAAYEIAEIIVQCL  356

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSA  548
            + +P  RPSM+E+L  L++ N +K + R+  + R+   RS 
Sbjct  357  EPDPKTRPSMEEILDCLEQCNAIKMKPRERNATRAHDQRSG  397



>ref|XP_009622682.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Nicotiana tomentosiformis]
Length=436

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAK+GPVNG+SHVTTR++GTYGYAAPEYMATGHLYV+SDVYGFGVVLLEI
Sbjct  238  DYNAKLSDFGLAKMGPVNGDSHVTTRVVGTYGYAAPEYMATGHLYVRSDVYGFGVVLLEI  297

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG +VLDL+R + E NLVEW KP+L +K+K++ I+DPRLEG+YPS+AA  IAE+I++C 
Sbjct  298  LTGRRVLDLNRPNGEINLVEWAKPMLPDKKKLRKIMDPRLEGQYPSKAAYEIAEIIVQCL  357

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSA  548
            + +P  RPSM+E+L  L++ N +K + R+  + R+   RS 
Sbjct  358  EPDPKTRPSMEEILDCLEQCNAIKMKPRERNATRAHDQRSG  398



>ref|XP_006342141.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Solanum tuberosum]
Length=417

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 136/163 (83%), Gaps = 8/163 (5%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAK+GPVNG+SHVTT+I+GTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI
Sbjct  229  DYNAKLSDFGLAKMGPVNGDSHVTTKIVGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  288

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            L+G +VLDL+R + E NLV+W KP+L +K+K++ ++DPRLE +YPS+AA +IAE+ILKC 
Sbjct  289  LSGRRVLDLNRPNGEHNLVDWAKPMLPDKKKLRKLMDPRLEAQYPSKAAFQIAEIILKCL  348

Query  426  QDEPGKRPSMDEVLKSLQEINDVK--------TRRRDHRSNRS  530
            + +P  RPSM+E+L+ L++ N ++        TR  +HR +RS
Sbjct  349  EPDPKNRPSMEEILECLEQCNGIQMKPRAKNTTRNHNHRGHRS  391



>gb|KDP36787.1| hypothetical protein JCGZ_08078 [Jatropha curcas]
Length=424

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP+NGNSHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  237  YNAKLSDFGLAKLGPINGNSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  296

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGLK LD +R + + NLV+W KP L +KRK+K I+DPRLE +YP + A   AELI+KC +
Sbjct  297  TGLKALDTNRPNGKHNLVDWAKPSLSDKRKLKRIMDPRLEQQYPLKGAIHAAELIIKCLE  356

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
             EP  RPSM+EVL++L EIN++K + R+ +S
Sbjct  357  SEPKTRPSMEEVLETLLEINEIKEKPRETKS  387



>ref|XP_009792375.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Nicotiana sylvestris]
Length=423

 Score =   225 bits (574),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAKLGP NGNSHVTT ++GTYGYAAPEYMA+GHLYVKSDVYGFGVVLLEI
Sbjct  233  DYNAKLSDFGLAKLGPANGNSHVTTGVVGTYGYAAPEYMASGHLYVKSDVYGFGVVLLEI  292

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL+VLDL+R + EQNLV+W KP+L +K+K++ ++DPRLEG+YP++AA  IA+L+L+C 
Sbjct  293  LTGLRVLDLNRPNGEQNLVDWAKPLLPDKKKLRKLMDPRLEGEYPTKAAFEIAQLVLQCL  352

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
              +P  RPS+++VL+SL++IN +K   R+  +  S
Sbjct  353  MPDPKTRPSIEQVLESLEKINTIKKEPRECNATHS  387



>ref|XP_009792373.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Nicotiana sylvestris]
Length=432

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAKLGP NGNSHVTT ++GTYGYAAPEYMA+GHLYVKSDVYGFGVVLLEI
Sbjct  242  DYNAKLSDFGLAKLGPANGNSHVTTGVVGTYGYAAPEYMASGHLYVKSDVYGFGVVLLEI  301

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL+VLDL+R + EQNLV+W KP+L +K+K++ ++DPRLEG+YP++AA  IA+L+L+C 
Sbjct  302  LTGLRVLDLNRPNGEQNLVDWAKPLLPDKKKLRKLMDPRLEGEYPTKAAFEIAQLVLQCL  361

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
              +P  RPS+++VL+SL++IN +K   R+  +  S
Sbjct  362  MPDPKTRPSIEQVLESLEKINTIKKEPRECNATHS  396



>ref|XP_009792374.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Nicotiana sylvestris]
Length=431

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAKLGP NGNSHVTT ++GTYGYAAPEYMA+GHLYVKSDVYGFGVVLLEI
Sbjct  241  DYNAKLSDFGLAKLGPANGNSHVTTGVVGTYGYAAPEYMASGHLYVKSDVYGFGVVLLEI  300

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL+VLDL+R + EQNLV+W KP+L +K+K++ ++DPRLEG+YP++AA  IA+L+L+C 
Sbjct  301  LTGLRVLDLNRPNGEQNLVDWAKPLLPDKKKLRKLMDPRLEGEYPTKAAFEIAQLVLQCL  360

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
              +P  RPS+++VL+SL++IN +K   R+  +  S
Sbjct  361  MPDPKTRPSIEQVLESLEKINTIKKEPRECNATHS  395



>ref|XP_004238436.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Solanum lycopersicum]
Length=414

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 135/163 (83%), Gaps = 8/163 (5%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAK+GPVNG+SHVTT+I+GTYGYAAPEYMATGH+YVKSDVYGFGVVLLEI
Sbjct  226  DYNAKLSDFGLAKMGPVNGDSHVTTKIVGTYGYAAPEYMATGHVYVKSDVYGFGVVLLEI  285

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            L+G +VLDL+R + E NLV+W KP+L +K+K++ ++DPRLE +YPS+AA +IAE+IL+C 
Sbjct  286  LSGRRVLDLNRPNGEHNLVDWAKPMLPDKKKLRKLMDPRLEAQYPSKAAFQIAEIILRCL  345

Query  426  QDEPGKRPSMDEVLKSLQEINDVK--------TRRRDHRSNRS  530
            + +P  RPSM+E+L+ L++ N ++        TR  +HR  RS
Sbjct  346  EPDPKNRPSMEEILECLEQCNGIQKKPRAKNTTRNHNHRGPRS  388



>ref|XP_010320466.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Solanum lycopersicum]
Length=413

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 135/163 (83%), Gaps = 8/163 (5%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAK+GPVNG+SHVTT+I+GTYGYAAPEYMATGH+YVKSDVYGFGVVLLEI
Sbjct  225  DYNAKLSDFGLAKMGPVNGDSHVTTKIVGTYGYAAPEYMATGHVYVKSDVYGFGVVLLEI  284

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            L+G +VLDL+R + E NLV+W KP+L +K+K++ ++DPRLE +YPS+AA +IAE+IL+C 
Sbjct  285  LSGRRVLDLNRPNGEHNLVDWAKPMLPDKKKLRKLMDPRLEAQYPSKAAFQIAEIILRCL  344

Query  426  QDEPGKRPSMDEVLKSLQEINDVK--------TRRRDHRSNRS  530
            + +P  RPSM+E+L+ L++ N ++        TR  +HR  RS
Sbjct  345  EPDPKNRPSMEEILECLEQCNGIQKKPRAKNTTRNHNHRGPRS  387



>ref|XP_011041221.1| PREDICTED: probable serine/threonine-protein kinase NAK [Populus 
euphratica]
Length=426

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAKLSDFGLAK GP+NGNSHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  239  FNAKLSDFGLAKFGPLNGNSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLELL  298

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGLK LD +R S +QNLVE+ +P L +KRK+K I+DPRLE +YP +AA + AELIL+C +
Sbjct  299  TGLKALDTNRPSWQQNLVEFARPSLSDKRKLKKIMDPRLEEQYPIKAAVQAAELILQCLE  358

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSN  524
             +P  RPSM+EVL++L++I+D K   ++ + +
Sbjct  359  CDPKSRPSMEEVLETLKKIDDTKDVSKESKGS  390



>ref|XP_007018056.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY15281.1| Kinase superfamily protein [Theobroma cacao]
Length=433

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP+NGNSHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  234  YNAKLSDFGLAKLGPINGNSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  293

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S E NLVEW K  L +K+K+K I+DPRLE +YP +AA +  ELIL+C +
Sbjct  294  TGLRALDTNRPSGEHNLVEWAKYSLTQKKKLKKIMDPRLEERYPLKAALQAGELILRCLE  353

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RPSM+EVL++L++I+ +  + +D +++ S
Sbjct  354  SDPKNRPSMEEVLETLEKISAINEKPKDSKASTS  387



>ref|XP_010040704.1| PREDICTED: probable serine/threonine-protein kinase NAK [Eucalyptus 
grandis]
Length=452

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            +FNAKLSDFGLAKLGP  GNSHVTTR++GTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  285  DFNAKLSDFGLAKLGPAGGNSHVTTRVIGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEM  344

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL+  D +R S +QNLV   +P L +KRK++ I+D RLEG+YP +AAT+ AELILKC 
Sbjct  345  LTGLQAFDNTRPSGQQNLVGLARPSLRDKRKLRKIMDSRLEGRYPLKAATQAAELILKCL  404

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
            + +P  RPSMDEVLK+L++I+ ++ +R++ +++ S
Sbjct  405  EGDPKARPSMDEVLKTLEQIDTIREKRKEAKASTS  439



>ref|XP_010061181.1| PREDICTED: probable serine/threonine-protein kinase NAK [Eucalyptus 
grandis]
 gb|KCW68104.1| hypothetical protein EUGRSUZ_F01781 [Eucalyptus grandis]
Length=451

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 129/165 (78%), Gaps = 6/165 (4%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            EFNAKLSDFGLAKLGP +GN+HV+TRIMGTYGYAAPEY+ATGHLY+ SDVYGFGVVLLE+
Sbjct  249  EFNAKLSDFGLAKLGPTDGNTHVSTRIMGTYGYAAPEYIATGHLYINSDVYGFGVVLLEL  308

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL+ LD  R S++ NL+EW KP L EKRK+K IVDPRL  +YP +AA R AELILKC 
Sbjct  309  LTGLQALDSKRPSSQHNLLEWAKPSLSEKRKLKKIVDPRLNNEYPLKAAARAAELILKCL  368

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADYST  560
            + +  KRP M+ VL +L+ IN +K++ ++ R       RS D +T
Sbjct  369  ESDQRKRPPMEHVLATLEIINTIKSKPKEAR------PRSEDLTT  407



>ref|XP_010663976.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Vitis vinifera]
Length=425

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAKLGP NG+SHVTTRI+GTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  225  DYNAKLSDFGLAKLGPSNGDSHVTTRIVGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEM  284

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG + LDL+R   +QNLVEW KP L  KRK+K I+DPRL  +YP +AA + AELILKC 
Sbjct  285  LTGNQALDLNRPPGQQNLVEWAKPSLTNKRKLKKIMDPRLRDQYPLKAAAQAAELILKCL  344

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTR  503
            + +P  RPSM+EVL++L+ IN++K +
Sbjct  345  ESDPKNRPSMEEVLETLKRINEIKEK  370



>ref|XP_010663975.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Vitis vinifera]
Length=426

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAKLGP NG+SHVTTRI+GTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  226  DYNAKLSDFGLAKLGPSNGDSHVTTRIVGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEM  285

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG + LDL+R   +QNLVEW KP L  KRK+K I+DPRL  +YP +AA + AELILKC 
Sbjct  286  LTGNQALDLNRPPGQQNLVEWAKPSLTNKRKLKKIMDPRLRDQYPLKAAAQAAELILKCL  345

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTR  503
            + +P  RPSM+EVL++L+ IN++K +
Sbjct  346  ESDPKNRPSMEEVLETLKRINEIKEK  371



>gb|EYU36568.1| hypothetical protein MIMGU_mgv1a007211mg [Erythranthe guttata]
Length=415

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            EFNAKLSDFGLAKLGPV+GNSHVTT+++GTYGYAAPEY+ATGHLYVKSDVYGFGVVLLEI
Sbjct  223  EFNAKLSDFGLAKLGPVDGNSHVTTKVVGTYGYAAPEYLATGHLYVKSDVYGFGVVLLEI  282

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            +TGL+VLDL+R   + NLV+W KP L +K+K++ ++DPR  G+YP +AA +IAELIL C 
Sbjct  283  ITGLQVLDLNRPGGQTNLVDWAKPSLPDKKKLRKLIDPRFMGQYPFKAAIKIAELILNCI  342

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTR  503
            + +P +RP M+EVL SL++IN +  +
Sbjct  343  EPDPKRRPDMEEVLDSLEKINTISMK  368



>ref|XP_002510681.1| serine/threonine-protein kinase cx32, putative [Ricinus communis]
 gb|EEF52868.1| serine/threonine-protein kinase cx32, putative [Ricinus communis]
Length=435

 Score =   218 bits (554),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAKLGP+NGNSHVTTR+MGTYGYAAPEY+ATGHLYV+SDVYGFGVVLLE+
Sbjct  234  DYNAKLSDFGLAKLGPINGNSHVTTRVMGTYGYAAPEYVATGHLYVRSDVYGFGVVLLEM  293

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG + LD +R ++EQNL+EW  P L EKRK+  I+DPRLEG+YP + A + AELIL+C 
Sbjct  294  LTGRRALDNNRPNSEQNLIEWATPSLSEKRKLTKIMDPRLEGQYPIKGAMQAAELILQCL  353

Query  426  QDEPGKRPSMDEVLKSLQEIN  488
            + +P  RPSM+E+L +L++IN
Sbjct  354  ESDPKSRPSMEEILDTLEKIN  374



>ref|XP_002307794.2| hypothetical protein POPTR_0005s27330g [Populus trichocarpa]
 gb|EEE94790.2| hypothetical protein POPTR_0005s27330g [Populus trichocarpa]
Length=447

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAKLSDFGLAK GP+NGNSHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  240  FNAKLSDFGLAKFGPLNGNSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLELL  299

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGLK LD +R   +QNLVE+ +P L +KRK+K I+DPRLE +YP +AA + AELIL+C +
Sbjct  300  TGLKALDTNRPIWQQNLVEFARPSLSDKRKLKKIMDPRLEEQYPIKAAVQAAELILQCLE  359

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSN  524
             +P  RPSM++VL++L++I+D K   +D + +
Sbjct  360  SDPKSRPSMEKVLETLKKIDDTKDVSKDSKGS  391



>ref|XP_010663977.1| PREDICTED: protein kinase APK1B, chloroplastic [Vitis vinifera]
Length=418

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAKLGP +G+SHVTT+I+GTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  226  DYNAKLSDFGLAKLGPSDGDSHVTTQIVGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEM  285

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG + LD++R   + NLVEWTKP+L  KRK+K I+DPRL  +YP +AAT++AELILKC 
Sbjct  286  LTGKQTLDINRPPGQLNLVEWTKPLLPNKRKLKKIMDPRLRDQYPLKAATQVAELILKCL  345

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTR  503
            + +P  RPSM+EVL++L+ IN++K +
Sbjct  346  ESDPKNRPSMEEVLETLKRINEIKEK  371



>emb|CBI40719.3| unnamed protein product [Vitis vinifera]
Length=418

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 127/146 (87%), Gaps = 0/146 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAKLGP +G+SHVTT+I+GTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  226  DYNAKLSDFGLAKLGPSDGDSHVTTQIVGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEM  285

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG + LD++R   + NLVEWTKP+L  KRK+K I+DPRL  +YP +AAT++AELILKC 
Sbjct  286  LTGKQTLDINRPPGQLNLVEWTKPLLPNKRKLKKIMDPRLRDQYPLKAATQVAELILKCL  345

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTR  503
            + +P  RPSM+EVL++L+ IN++K +
Sbjct  346  ESDPKNRPSMEEVLETLKRINEIKEK  371



>ref|XP_011074087.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Sesamum indicum]
Length=423

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 127/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            E+NAKLSDFGLAKLGPV+GNSHVTT+++GTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI
Sbjct  223  EYNAKLSDFGLAKLGPVDGNSHVTTKVVGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  282

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            +TGL+VLDL+R   + NLVEW KP L +K+K++ ++DPRL+G YP +AA   AELIL C 
Sbjct  283  ITGLRVLDLNRPGGQTNLVEWAKPSLPDKKKLRKLIDPRLQGNYPPKAAYGAAELILSCL  342

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
            + +P  RP M+EVL+SL++I  ++   ++ R+
Sbjct  343  EPDPKCRPGMEEVLESLEQIRAIQMTPKESRA  374



>emb|CBI40720.3| unnamed protein product [Vitis vinifera]
Length=487

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 124/146 (85%), Gaps = 0/146 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAKLSDFGLAKLGP NG+SHVTTRI+GTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  225  DYNAKLSDFGLAKLGPSNGDSHVTTRIVGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEM  284

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG + LDL+R   +QNLVEW KP L  KRK+K I+DPRL  +YP +AA + AELILKC 
Sbjct  285  LTGNQALDLNRPPGQQNLVEWAKPSLTNKRKLKKIMDPRLRDQYPLKAAAQAAELILKCL  344

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTR  503
            + +P  RPSM+EVL++L+ IN++K +
Sbjct  345  ESDPKNRPSMEEVLETLKRINEIKEK  370



>gb|AAS65788.1| putative protein kinase [Arabidopsis thaliana]
Length=230

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SH+TTR+MGT+GYAAPEY+ATGHLYVKSDVYGFGVVL EIL
Sbjct  55   YNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAEIL  114

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL  LD +R + + NL EW KP L E+RK+++I+DPRLEGKYP ++A R+A+L LKC  
Sbjct  115  TGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLG  174

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PS  539
             EP  RPSM EV++SL+ I     +  + R+ R+ PS
Sbjct  175  PEPKNRPSMKEVVESLELIEAANEKPLERRTTRASPS  211



>ref|XP_007157996.1| hypothetical protein PHAVU_002G115800g [Phaseolus vulgaris]
 gb|ESW29990.1| hypothetical protein PHAVU_002G115800g [Phaseolus vulgaris]
Length=261

 Score =   210 bits (534),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +3

Query  63   QEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  242
            +++NAK+SDFGLAKLGP  G SHVTTRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE
Sbjct  113  EDYNAKISDFGLAKLGPSGGYSHVTTRIMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLE  172

Query  243  ILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKC  422
            ILTGL+ LD +R   +QNL+EW KP L +K+K+K+I+D R+EG+Y ++AA R A L LKC
Sbjct  173  ILTGLRALDRNRPLEQQNLIEWAKPSLSDKKKLKSIMDERIEGQYSTKAAMRAAHLTLKC  232

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRR  509
             Q +  KRP M +VL++L+ I  +K RR+
Sbjct  233  LQRDHRKRPPMKDVLETLERIEAIKNRRQ  261



>ref|XP_002521714.1| serine/threonine-protein kinase cx32, putative [Ricinus communis]
 gb|EEF40701.1| serine/threonine-protein kinase cx32, putative [Ricinus communis]
Length=420

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLEI+
Sbjct  240  YNAKISDFGLAKLGPSGGDSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEIM  299

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R + +QNL+EW KPIL +KRK+K I+D R+EG+Y S+A    A+L LKC +
Sbjct  300  TGLRALDTKRPNGQQNLIEWLKPILSQKRKLKNIMDVRIEGQYSSKAMQLAAQLTLKCLE  359

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADY  554
             +P  RPSM EVL++L++I+ +K + +  ++    P  S  +
Sbjct  360  SDPKSRPSMKEVLEALEQIDAIKEKPKVSKTTSGSPRSSTSH  401



>ref|NP_001234995.1| protein kinase [Glycine max]
 gb|ACM89519.1| protein kinase [Glycine max]
Length=287

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLEIL
Sbjct  123  FNAKISDFGLAKLGPSGGQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEIL  182

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TG++ LD  R + +QNLVEWTKP+L  K+K+KTI+D ++ G+Y  +AA + A+L +KC +
Sbjct  183  TGMRALDTKRPTGQQNLVEWTKPLLSSKKKLKTIMDAKIVGQYSPKAAFQAAQLTVKCLE  242

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P +RPSM EVL+ L+ I  +  + ++ ++  S
Sbjct  243  HDPKQRPSMKEVLEGLEAIEAIHEKSKESKTRNS  276



>ref|XP_004512261.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Cicer arietinum]
Length=406

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 132/170 (78%), Gaps = 3/170 (2%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  G+SHVTTRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  233  YNAKISDFGLAKLGPSEGDSHVTTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEML  292

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKT-IVDPRLEGKYPSRAATRIAELILKCF  425
            TGL  LD  R + +QNLVEW KP L +KRK+K+ IVD RLEG+Y  +AA   A+LILKC 
Sbjct  293  TGLHALDTKRPTGQQNLVEWIKPSLSDKRKLKSNIVDYRLEGQYSPKAAFETAKLILKCL  352

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADYSTIIYIC  575
            + +P KRPSM EV ++L+ I  +K +R+  +++R+    +A Y+    IC
Sbjct  353  ESDPKKRPSMKEVFETLKSIKAIKDKRKISKNHRT--KSAAMYNLQKPIC  400



>ref|XP_007156235.1| hypothetical protein PHAVU_003G269700g [Phaseolus vulgaris]
 gb|ESW28229.1| hypothetical protein PHAVU_003G269700g [Phaseolus vulgaris]
Length=398

 Score =   212 bits (540),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLEIL
Sbjct  230  YNAKISDFGLAKLGPSGGQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEIL  289

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TG++  D  R + +QNLVEWTKP L  K+K+KTI+D R++G+Y S+AA++ AELILKC +
Sbjct  290  TGMRAFDTRRPTGQQNLVEWTKPFLSSKKKLKTIMDIRIKGQYSSKAASQAAELILKCLE  349

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P +R SM EVL+ L+ I  +  + ++ ++  S
Sbjct  350  HDPKQRSSMKEVLEGLEAIETIHEKSKESKTRNS  383



>emb|CDX68102.1| BnaA07g21420D [Brassica napus]
Length=443

 Score =   213 bits (543),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAK GP+NG SHVTTR+MGT GYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  265  FHAKLSDFGLAKNGPINGFSHVTTRVMGTQGYAAPEYMATGHLYVRSDVYGFGVVLLELL  324

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP+L +K+KI+ ++DPRLE KYP  A TR A LIL+C +
Sbjct  325  TGLRALDPTRPSAQQNLVEWAKPVLTQKKKIQKMMDPRLEHKYPILAVTRTAALILRCLE  384

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RP MD+VL+ L+ +  ++   R+ R  RS
Sbjct  385  ADPKNRPPMDDVLRELEIVRTIRDELREERRKRS  418



>gb|EPS70761.1| hypothetical protein M569_03998, partial [Genlisea aurea]
Length=353

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            EFNAKLSDFGLAK GP  G SHVTT + GTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  214  EFNAKLSDFGLAKFGPDEGKSHVTTGVQGTYGYAAPEYLATGHLYVKSDVYGFGVVLLEM  273

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL VLDL R S + +LVEW KP L EK+K+  IVDPRL G+YPSRAA  +A+LILKC 
Sbjct  274  LTGLPVLDLRRPSGQIDLVEWAKPSLKEKKKLHKIVDPRLLGQYPSRAAFSVAQLILKCV  333

Query  426  QDEPGKRPSMDEVLKSLQEI  485
            Q +P  RPSMD VL++LQ +
Sbjct  334  QPDPNNRPSMDRVLETLQSL  353



>ref|XP_006390207.1| hypothetical protein EUTSA_v10018510mg [Eutrema salsugineum]
 gb|ESQ27493.1| hypothetical protein EUTSA_v10018510mg [Eutrema salsugineum]
Length=462

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAKLGP+NG SHVTTR+MGT GYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  285  FHAKLSDFGLAKLGPINGFSHVTTRVMGTQGYAAPEYMATGHLYVRSDVYGFGVVLLELL  344

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP+L +K+KI+ ++DPRLE KYP  A  R A LIL+C +
Sbjct  345  TGLRALDPNRPSAQQNLVEWAKPVLSQKKKIQKMMDPRLEHKYPLLAVVRTAALILRCLE  404

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADYSTI  563
             +P  RP MD+VL+ L+ +  ++   ++ R  R  PS  +D + +
Sbjct  405  ADPKNRPPMDDVLRELEIVRTIRDEPKEERRKR--PSGGSDNNRV  447



>ref|XP_009104679.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=448

 Score =   213 bits (542),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAK GP+NG SHVTTR+MGT GYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  270  FHAKLSDFGLAKNGPINGFSHVTTRVMGTQGYAAPEYMATGHLYVRSDVYGFGVVLLELL  329

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP+L +K+KI+ ++DPRLE KYP  A TR A LIL+C +
Sbjct  330  TGLRALDPTRPSAQQNLVEWAKPVLTQKKKIQKMMDPRLEHKYPILAVTRTAALILRCLE  389

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RP MD+VL+ L+ +  ++   R+ R  RS
Sbjct  390  ADPKNRPPMDDVLRELEIVRTIRDELREERRKRS  423



>dbj|BAC43515.1| putative protein kinase [Arabidopsis thaliana]
Length=335

 Score =   210 bits (534),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAK GP+NG SHVTTR+MGT GYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  159  FHAKLSDFGLAKNGPINGFSHVTTRVMGTQGYAAPEYMATGHLYVRSDVYGFGVVLLELL  218

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP L +K+K++ ++DPRLE KYP  A T+ AELIL+C +
Sbjct  219  TGLRALDPNRPSAQQNLVEWAKPGLNQKKKVQKMMDPRLEQKYPLLAVTKTAELILRCLE  278

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RP MD+VL+ L+ +  ++ + ++ R  RS
Sbjct  279  ADPKNRPPMDDVLRELEVVRTIRDQPQEERRKRS  312



>ref|XP_010536475.1| PREDICTED: probable serine/threonine-protein kinase NAK [Tarenaya 
hassleriana]
 ref|XP_010536476.1| PREDICTED: probable serine/threonine-protein kinase NAK [Tarenaya 
hassleriana]
Length=462

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAKLGP+NG+SHVTTR+MGTYGYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  291  FHAKLSDFGLAKLGPINGHSHVTTRVMGTYGYAAPEYMATGHLYVRSDVYGFGVVLLELL  350

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NLVEW KP L +K+K+K I+DPRL+ KYP  A  + A LIL+C +
Sbjct  351  TGLRALDPTRPSAQHNLVEWAKPCLTDKKKLKKIMDPRLDRKYPVSAVVQTAALILRCIE  410

Query  429  DEPGKRPSMDEVLKSLQEINDVK  497
             +P  RPSMDEVLK L+ I  ++
Sbjct  411  ADPKNRPSMDEVLKELRAIRVIR  433



>ref|XP_008781319.1| PREDICTED: probable serine/threonine-protein kinase NAK [Phoenix 
dactylifera]
Length=424

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +N KLSDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  232  YNPKLSDFGLAKLGPTGGESHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  291

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD +R S + NL++W KP L ++RK+  ++DPRLEG+YPS+ A R A+L LKC  
Sbjct  292  SGQRALDTNRPSEQHNLIDWGKPYLADRRKLARLMDPRLEGRYPSKGAFRAAQLTLKCLA  351

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
             EP  RPSM EVL++L++I   K R R+ +S
Sbjct  352  GEPKNRPSMKEVLETLEQIEATKGRSRESKS  382



>ref|XP_006302239.1| hypothetical protein CARUB_v10020265mg [Capsella rubella]
 gb|EOA35137.1| hypothetical protein CARUB_v10020265mg [Capsella rubella]
Length=459

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAKLGP+NG SHVTTR+MGT GYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  282  FHAKLSDFGLAKLGPINGFSHVTTRVMGTQGYAAPEYMATGHLYVRSDVYGFGVVLLELL  341

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP+L +K+KI+ ++DPRLE KYP  A  + AELIL+C +
Sbjct  342  TGLRALDPNRPSAQQNLVEWAKPVLTQKKKIQKMMDPRLEHKYPLLAVVKTAELILRCLE  401

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNR  527
             +P  RP MD+VL+ L+ +  ++ + ++ R  R
Sbjct  402  ADPKNRPPMDDVLRELEIVRTIRDQPKEERRKR  434



>ref|XP_003533415.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Glycine max]
Length=397

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLEIL
Sbjct  233  FNAKISDFGLAKLGPSGGQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEIL  292

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TG++ LD  R + +QNLVEWTKP+L  K+K+KTI+D ++ G+Y  +AA + A+L LKC +
Sbjct  293  TGMRALDTKRPTGQQNLVEWTKPLLSSKKKLKTIMDAKIVGQYSPKAAFQAAQLTLKCLE  352

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P +RPSM EVL+ L+ I  +  + ++ ++  S
Sbjct  353  HDPKQRPSMKEVLEGLEAIEAIHEKSKESKTCNS  386



>ref|XP_009773233.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Nicotiana sylvestris]
Length=418

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  GNSHVTTR+MGTYGYAAPEY+ TGHLYVKSDVYGFGVVLLE+L
Sbjct  234  YNAKISDFGLAKLGPSGGNSHVTTRVMGTYGYAAPEYVETGHLYVKSDVYGFGVVLLEML  293

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R S +Q LV+W KP+L  KRK+K+I+D RLEG+Y S+ AT  A++ LKC +
Sbjct  294  TGLRALDTKRPSGQQKLVDWVKPMLSNKRKLKSIMDARLEGQYSSKGATLAAQITLKCLE  353

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
             +P  RPSM EV+  L++I  +K + ++ RS
Sbjct  354  GDPKNRPSMKEVMDVLEQIEAIKEKPKESRS  384



>ref|XP_007157997.1| hypothetical protein PHAVU_002G115800g [Phaseolus vulgaris]
 gb|ESW29991.1| hypothetical protein PHAVU_002G115800g [Phaseolus vulgaris]
Length=361

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +3

Query  63   QEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  242
            +++NAK+SDFGLAKLGP  G SHVTTRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE
Sbjct  213  EDYNAKISDFGLAKLGPSGGYSHVTTRIMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLE  272

Query  243  ILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKC  422
            ILTGL+ LD +R   +QNL+EW KP L +K+K+K+I+D R+EG+Y ++AA R A L LKC
Sbjct  273  ILTGLRALDRNRPLEQQNLIEWAKPSLSDKKKLKSIMDERIEGQYSTKAAMRAAHLTLKC  332

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRR  509
             Q +  KRP M +VL++L+ I  +K RR+
Sbjct  333  LQRDHRKRPPMKDVLETLERIEAIKNRRQ  361



>ref|XP_004290061.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=430

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 123/156 (79%), Gaps = 2/156 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAK+SDFGLAKLGP    SHVTTR+MGTYGYAAPEY++TGHLYVKSDVYGFGVVL+EIL
Sbjct  239  FNAKISDFGLAKLGPSESQSHVTTRVMGTYGYAAPEYVSTGHLYVKSDVYGFGVVLVEIL  298

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S   NLVEW KP L +KRK+K I+DPRLE KYP++AA RI++L LKC +
Sbjct  299  TGLRALDTNRPSGRHNLVEWIKPFLSDKRKLKGIMDPRLEAKYPAKAAFRISQLALKCIE  358

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDH--RSNRS  530
             E   RPSM +V+++L+ I  V    R+   RSNRS
Sbjct  359  SEHKNRPSMIDVVETLERIQSVNEVIREPRIRSNRS  394



>gb|AAF16665.1|AC012394_14 putative protein kinase; 59396-62219 [Arabidopsis thaliana]
Length=442

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAK GP+NG SHVTTR+MGT GYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  266  FHAKLSDFGLAKNGPINGFSHVTTRVMGTQGYAAPEYMATGHLYVRSDVYGFGVVLLELL  325

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP L +K+K++ ++DPRLE KYP  A T+ AELIL+C +
Sbjct  326  TGLRALDPNRPSAQQNLVEWAKPGLNQKKKVQKMMDPRLEQKYPLLAVTKTAELILRCLE  385

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RP MD+VL+ L+ +  ++ + ++ R  RS
Sbjct  386  ADPKNRPPMDDVLRELEVVRTIRDQPQEERRKRS  419



>ref|XP_010471786.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
Length=465

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAKLGP+NG SHVTTR++GT GYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  289  FHAKLSDFGLAKLGPINGFSHVTTRVVGTRGYAAPEYMATGHLYVRSDVYGFGVVLLELL  348

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP+L +K+K++ ++DPRLE KYP  A  + AELIL+C +
Sbjct  349  TGLRALDPNRPSAQQNLVEWAKPVLTQKKKLQKMMDPRLEHKYPLLAVVKTAELILRCLE  408

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RP MD+VL+ L+ +  ++ + ++ R  RS
Sbjct  409  ADPKNRPPMDDVLRELEIVRTIRDQPKEERRKRS  442



>ref|XP_010247082.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nelumbo 
nucifera]
Length=422

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 125/157 (80%), Gaps = 1/157 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAK+SDFGLAK GP  GNSHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  229  FNAKISDFGLAKNGPAAGNSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  288

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NLVEW KP L +KRK+KT++D RLEG++P + A ++A+L L C  
Sbjct  289  TGLRALDTNRPSGQHNLVEWLKPSLHDKRKLKTMIDSRLEGQFPMKGAVQLAQLTLSCLG  348

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRR-RDHRSNRS*P  536
             EP  RPSM EV+++L+ I  +K  + ++ R+N + P
Sbjct  349  SEPKSRPSMKEVVETLERIEAIKDNKPKESRTNSAQP  385



>ref|XP_010416550.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
 ref|XP_010416551.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Camelina sativa]
Length=465

 Score =   211 bits (538),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAKLGP+NG SHVTTR++GT GYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  289  FHAKLSDFGLAKLGPINGFSHVTTRVVGTRGYAAPEYMATGHLYVRSDVYGFGVVLLELL  348

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP+L +K+K++ ++DPRLE KYP  A  + AELIL+C +
Sbjct  349  TGLRALDPNRPSAQQNLVEWAKPVLTQKKKLQKMMDPRLEHKYPLLAVVKTAELILRCLE  408

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RP MD+VL+ L+ +  ++ + ++ R  RS
Sbjct  409  ADPKNRPPMDDVLRELEIVRTIRDQPKEERRKRS  442



>ref|XP_002889077.1| hypothetical protein ARALYDRAFT_476789 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65336.1| hypothetical protein ARALYDRAFT_476789 [Arabidopsis lyrata subsp. 
lyrata]
Length=506

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAK GP+NG SHVTTR+MGT GYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  328  FHAKLSDFGLAKNGPINGFSHVTTRVMGTQGYAAPEYMATGHLYVRSDVYGFGVVLLELL  387

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP+L +K+K++ ++DPRLE KYP  A  + AELIL+C +
Sbjct  388  TGLRALDPNRPSAQQNLVEWAKPVLNQKKKVQKMMDPRLEHKYPLLAVVKTAELILRCLE  447

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RP MD+VL+ L+ +  ++ + ++ R  RS
Sbjct  448  ADPKNRPPMDDVLRELEVVRTIRDQPKEERRKRS  481



>gb|AES95298.2| Serine/Threonine-kinase Cx32, related protein [Medicago truncatula]
Length=387

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 125/163 (77%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAK GP  G+SHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE+L
Sbjct  224  YNAKISDFGLAKFGPSGGDSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEML  283

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKT--IVDPRLEGKYPSRAATRIAELILKC  422
            TGL+  D +R   +QNL+EW KP L +KRK+K+  IVD RLEG+Y S+AA   A LILKC
Sbjct  284  TGLQAFDSNRPEGQQNLIEWIKPSLSDKRKLKSNNIVDYRLEGQYTSKAAFETAHLILKC  343

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSAD  551
             Q +P KRPSM +VL  L+ I  +K +R+  + NR   S + D
Sbjct  344  LQPDPKKRPSMKDVLGILEAIKAIKVKRKISK-NRCTKSATMD  385



>ref|XP_007210594.1| hypothetical protein PRUPE_ppa016837mg, partial [Prunus persica]
 gb|EMJ11793.1| hypothetical protein PRUPE_ppa016837mg, partial [Prunus persica]
Length=315

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAK+GP+NGNSHVTTRI+GTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  158  YNAKLSDFGLAKVGPINGNSHVTTRIIGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  217

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S E +LV+W +P L +K+++K I+DP L  +YP +AA + AELILKC +
Sbjct  218  TGLRALDNNRPSREHSLVDWLRPSLHKKKELKKIMDPGLGDQYPLKAACQAAELILKCLE  277

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSN  524
             +P  RPSM+EVL  L++IN +K + +  + N
Sbjct  278  SDPKNRPSMEEVLGILEKINAIKEKPKTAKPN  309



>ref|XP_006598681.1| PREDICTED: protein kinase isoform X1 [Glycine max]
Length=406

 Score =   210 bits (534),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLEIL
Sbjct  242  FNAKISDFGLAKLGPSGGQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEIL  301

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TG++ LD  R + +QNLVEWTKP+L  K+K+KTI+D ++ G+Y  +AA + A+L +KC +
Sbjct  302  TGMRALDTKRPTGQQNLVEWTKPLLSSKKKLKTIMDAKIVGQYSPKAAFQAAQLTVKCLE  361

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P +RPSM EVL+ L+ I  +  + ++ ++  S
Sbjct  362  HDPKQRPSMKEVLEGLEAIEAIHEKSKESKTRNS  395



>emb|CDX88265.1| BnaC06g37090D [Brassica napus]
Length=446

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAKLSDFGLAK GP+NG SHVTTR+MGT GYAAPEY+ATGHLYV SDVYGFGVVLLE+L
Sbjct  278  FNAKLSDFGLAKHGPINGYSHVTTRVMGTQGYAAPEYVATGHLYVLSDVYGFGVVLLELL  337

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP+L +K+KI+ ++DPRLE KYP  A T+ A LIL+C +
Sbjct  338  TGLRALDPNRPSAQQNLVEWAKPVLSQKKKIQKLMDPRLEHKYPLLAVTKTAALILRCLE  397

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RP MD+VL+ L+ +  ++ + ++ + NR+
Sbjct  398  ADPKNRPPMDDVLRELEIVRTIREQPKEEKRNRN  431



>ref|XP_010416552.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Camelina sativa]
Length=500

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAKLGP+NG SHVTTR++GT GYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  324  FHAKLSDFGLAKLGPINGFSHVTTRVVGTRGYAAPEYMATGHLYVRSDVYGFGVVLLELL  383

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP+L +K+K++ ++DPRLE KYP  A  + AELIL+C +
Sbjct  384  TGLRALDPNRPSAQQNLVEWAKPVLTQKKKLQKMMDPRLEHKYPLLAVVKTAELILRCLE  443

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RP MD+VL+ L+ +  ++ + ++ R  RS
Sbjct  444  ADPKNRPPMDDVLRELEIVRTIRDQPKEERRKRS  477



>ref|XP_008663505.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X3 [Zea mays]
Length=581

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = +3

Query  45   IPFGNWQEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGF  224
             P    Q +NAKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGF
Sbjct  389  FPCHPPQNYNAKLSDFGLAKNGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGF  448

Query  225  GVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIA  404
            GVVLLE+LTGL+ LD +R + + NLVEW KP L ++RK+  +VDPRLEG+YPS+AA + A
Sbjct  449  GVVLLEMLTGLRALDTARPAQQHNLVEWAKPYLADRRKLPRLVDPRLEGQYPSKAALQAA  508

Query  405  ELILKCFQDEPGKRPSMDEVLKSLQEINDVKTRRRD  512
            +L L+C + +P  RPSM EV+ +++ +  ++ R RD
Sbjct  509  QLTLRCLEGDPRSRPSMAEVVLAIEAMEQLRVRPRD  544



>ref|XP_010428693.1| PREDICTED: probable serine/threonine-protein kinase NAK [Camelina 
sativa]
Length=464

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAKLGP+NG SHVTTR++GT GYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  289  FHAKLSDFGLAKLGPINGFSHVTTRVVGTRGYAAPEYMATGHLYVRSDVYGFGVVLLELL  348

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP+L +K+K++ ++DPRLE KYP  A  + AELIL+C +
Sbjct  349  TGLRALDPNRPSAQQNLVEWAKPVLTQKKKLQKMMDPRLEHKYPLLAVLKTAELILRCLE  408

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RP MD+VL+ L+ +  ++ + ++ R  RS
Sbjct  409  ADPKNRPPMDDVLRELEIVRTIRDQPKEERRKRS  442



>ref|NP_177762.3| putative protein kinase [Arabidopsis thaliana]
 gb|ABO38790.1| At1g76360 [Arabidopsis thaliana]
 gb|AEE35828.1| putative protein kinase [Arabidopsis thaliana]
Length=484

 Score =   211 bits (538),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAK GP+NG SHVTTR+MGT GYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  308  FHAKLSDFGLAKNGPINGFSHVTTRVMGTQGYAAPEYMATGHLYVRSDVYGFGVVLLELL  367

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP L +K+K++ ++DPRLE KYP  A T+ AELIL+C +
Sbjct  368  TGLRALDPNRPSAQQNLVEWAKPGLNQKKKVQKMMDPRLEQKYPLLAVTKTAELILRCLE  427

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RP MD+VL+ L+ +  ++ + ++ R  RS
Sbjct  428  ADPKNRPPMDDVLRELEVVRTIRDQPQEERRKRS  461



>emb|CDX85943.1| BnaC06g21910D [Brassica napus]
Length=439

 Score =   210 bits (535),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAK GP+NG SHVTTR+MGT GYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  265  FHAKLSDFGLAKNGPINGFSHVTTRVMGTQGYAAPEYMATGHLYVRSDVYGFGVVLLELL  324

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP L +K+KI+ ++DPRLE KYP  A TR A LIL+C +
Sbjct  325  TGLRTLDPTRPSAQQNLVEWAKPALTQKKKIQKMMDPRLEHKYPIMAVTRTAALILRCLE  384

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSN  524
             +P  RP MD+VL+ L+ +  ++   R  RS+
Sbjct  385  ADPKNRPPMDDVLRELEIVRTIRDEERRKRSS  416



>gb|KHN38873.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=454

 Score =   211 bits (536),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLEIL
Sbjct  290  FNAKISDFGLAKLGPSGGQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEIL  349

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TG++ LD  R + +QNLVEWTKP+L  K+K+KTI+D ++ G+Y  +AA + A+L LKC +
Sbjct  350  TGMRALDTKRPTGQQNLVEWTKPLLSSKKKLKTIMDAKIVGQYSPKAAFQAAQLTLKCLE  409

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P +RPSM EVL+ L+ I  +  + ++ ++  S
Sbjct  410  HDPKQRPSMKEVLEGLEAIEAIHEKSKESKTCNS  443



>ref|XP_008663503.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Zea mays]
Length=583

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +3

Query  63   QEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  242
            Q +NAKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE
Sbjct  397  QNYNAKLSDFGLAKNGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLE  456

Query  243  ILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKC  422
            +LTGL+ LD +R + + NLVEW KP L ++RK+  +VDPRLEG+YPS+AA + A+L L+C
Sbjct  457  MLTGLRALDTARPAQQHNLVEWAKPYLADRRKLPRLVDPRLEGQYPSKAALQAAQLTLRC  516

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRRD  512
             + +P  RPSM EV+ +++ +  ++ R RD
Sbjct  517  LEGDPRSRPSMAEVVLAIEAMEQLRVRPRD  546



>ref|XP_008663504.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Zea mays]
Length=582

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +3

Query  63   QEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  242
            Q +NAKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE
Sbjct  396  QNYNAKLSDFGLAKNGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLE  455

Query  243  ILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKC  422
            +LTGL+ LD +R + + NLVEW KP L ++RK+  +VDPRLEG+YPS+AA + A+L L+C
Sbjct  456  MLTGLRALDTARPAQQHNLVEWAKPYLADRRKLPRLVDPRLEGQYPSKAALQAAQLTLRC  515

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRRD  512
             + +P  RPSM EV+ +++ +  ++ R RD
Sbjct  516  LEGDPRSRPSMAEVVLAIEAMEQLRVRPRD  545



>gb|AAM61685.1| putative protein kinase [Arabidopsis thaliana]
Length=414

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SH+TTR+MGT+GYAAPEY+ATGHLYVKSDVYGFGVVL EIL
Sbjct  232  YNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAEIL  291

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL  LD +R + + NL EW KP L EKRK+++I+DPRLEGKYP ++A R+A+L LKC  
Sbjct  292  TGLHALDPTRPTGQHNLTEWIKPHLSEKRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLG  351

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PS  539
             EP  RPSM EV++SL+ I     +  + R+ R+ PS
Sbjct  352  PEPKNRPSMKEVVESLELIEAANEKPLERRTTRASPS  388



>ref|XP_008237981.1| PREDICTED: probable serine/threonine-protein kinase NAK [Prunus 
mume]
Length=429

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAK+GP+NGNSHVTTRI+GTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  247  YNAKLSDFGLAKVGPINGNSHVTTRIIGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  306

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S E +LV+W +P L +K+++K I+DP L  +YP +AA + AELILKC +
Sbjct  307  TGLRALDNNRPSREHSLVDWLRPSLHKKKELKKIMDPGLGDQYPLKAACQAAELILKCLE  366

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSN  524
             +P  RPSM+EVL +L++IN +K + +  + N
Sbjct  367  SDPKNRPSMEEVLVTLEKINAIKEKPKTAKPN  398



>ref|XP_010935290.1| PREDICTED: probable serine/threonine-protein kinase NAK [Elaeis 
guineensis]
Length=428

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +N KLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  234  YNPKLSDFGLAKHGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  293

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD +R S + NLV+W KP L ++RK+  ++DPRLEG+YPS+ A + A+L LKC  
Sbjct  294  SGQRALDTNRPSGQHNLVDWAKPYLADRRKLARLMDPRLEGQYPSKGAFQAAQLTLKCLG  353

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
             EP  RPSM EVL++L++I  +K R R+ +S
Sbjct  354  GEPKSRPSMKEVLETLEQIEAMKGRSRESKS  384



>ref|XP_006656517.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Oryza brachyantha]
Length=413

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAKLSDFGLAK GP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  239  FNAKLSDFGLAKHGPDGGLSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  298

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +GL+ LD SR S + NLV+W KP+L ++RK+  ++D RLEG+Y SR A + A+L LKC  
Sbjct  299  SGLRALDPSRPSGKLNLVDWAKPLLADRRKLSQLMDSRLEGQYHSRGALQAAQLTLKCLS  358

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             EP  RPSM EV+++L++I  +KT+ R+ R++ S
Sbjct  359  GEPKNRPSMKEVVEALEKIESIKTKSREPRNSSS  392



>gb|KHN07820.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=407

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLEIL
Sbjct  243  FNAKISDFGLAKLGPSGGQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEIL  302

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TG++ LD  R + +QNLVEWTKP+L  K+K+KTI+D ++ G+Y  +AA + A+L +KC +
Sbjct  303  TGMRALDTKRPTGQQNLVEWTKPLLSSKKKLKTIMDAKIVGQYSPKAAFQAAQLTVKCLE  362

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P +RPSM EVL+ ++ I  +  + ++ ++  S
Sbjct  363  HDPKQRPSMKEVLEGMEAIEAIHEKSKESKTRNS  396



>gb|KDP42038.1| hypothetical protein JCGZ_03101 [Jatropha curcas]
Length=431

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 122/155 (79%), Gaps = 2/155 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  243  YTAKISDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  302

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S   NLV+W KP L +KRK+K I+D RLEGKYPS+AA RIA+L + C +
Sbjct  303  TGLRALDTNRPSGRHNLVDWIKPFLYDKRKLKNIMDSRLEGKYPSKAAFRIAQLAINCIE  362

Query  429  DEPGKRPSMDEVLKSLQ--EINDVKTRRRDHRSNR  527
             EP  RPSM EV+++L+  E N+ + R    RSNR
Sbjct  363  SEPKNRPSMKEVVETLERIEANNERPREPRVRSNR  397



>ref|XP_002886105.1| hypothetical protein ARALYDRAFT_480605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62364.1| hypothetical protein ARALYDRAFT_480605 [Arabidopsis lyrata subsp. 
lyrata]
Length=414

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SH+TTR+MGT+GYAAPEY+ATGHLYVKSDVYGFGVVL EIL
Sbjct  232  YNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAEIL  291

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL  LD +R + + NL EW KP L E+RK+++I+DPRLEGKYP ++A R+A+L LKC  
Sbjct  292  TGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLG  351

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PS  539
             EP  RPSM EV++SL+ I     +  + R+ R+ PS
Sbjct  352  PEPKNRPSMKEVVESLELIEAANEKPLERRTTRASPS  388



>ref|XP_007202257.1| hypothetical protein PRUPE_ppa007710mg [Prunus persica]
 gb|EMJ03456.1| hypothetical protein PRUPE_ppa007710mg [Prunus persica]
Length=358

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAK+SDFGLAKLGP  G SHV+TRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLEIL
Sbjct  179  FNAKISDFGLAKLGPAGGESHVSTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEIL  238

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD+ R   +Q LVEW KP+L  KRK+K I+D R+EG+Y  +AA + A++  KC  
Sbjct  239  TGLRALDMKRPKEQQQLVEWAKPLLLHKRKLKNILDVRMEGQYAFKAALQAAQITQKCLA  298

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRS  545
             +P  RPSM EV++ L++I  +K +++  R   + P+ S
Sbjct  299  PDPKSRPSMKEVVEELEKIQAIKEKQKQSRLASAQPTFS  337



>ref|NP_973478.1| putative serine/threonine-specific protein kinase kin3 [Arabidopsis 
thaliana]
 gb|AEC06600.1| putative serine/threonine-specific protein kinase kin3 [Arabidopsis 
thaliana]
Length=413

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SH+TTR+MGT+GYAAPEY+ATGHLYVKSDVYGFGVVL EIL
Sbjct  231  YNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAEIL  290

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL  LD +R + + NL EW KP L E+RK+++I+DPRLEGKYP ++A R+A+L LKC  
Sbjct  291  TGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLG  350

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PS  539
             EP  RPSM EV++SL+ I     +  + R+ R+ PS
Sbjct  351  PEPKNRPSMKEVVESLELIEAANEKPLERRTTRASPS  387



>emb|CDX87609.1| BnaA07g32640D [Brassica napus]
Length=449

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAKLSDFGLAK GP+NG SHVTTR+MGT GYAAPEY+ATGHLYV SDVYGFGVVLLE+L
Sbjct  281  FNAKLSDFGLAKHGPINGYSHVTTRVMGTQGYAAPEYVATGHLYVLSDVYGFGVVLLELL  340

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP+L +K+KI+ ++DPRLE KYP  A ++ A LIL+C +
Sbjct  341  TGLRALDPNRPSAQQNLVEWAKPVLTQKKKIQKLMDPRLENKYPLLAVSKTAALILRCLE  400

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RP MD+VL+ L+ +  ++ + ++ + NR+
Sbjct  401  ADPKNRPPMDDVLRELEIVRTIREQPKEEKRNRN  434



>gb|KHG23247.1| hypothetical protein F383_30094 [Gossypium arboreum]
Length=410

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AKLSDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  229  YTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  288

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NL EW KP L ++RK+K+I+D RLEGKYPS+AA RIA+L LKC +
Sbjct  289  TGLRALDPNRPSGQHNLSEWIKPYLSDRRKLKSIMDNRLEGKYPSKAAVRIAQLALKCLE  348

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
              P  RPSM EV+++L++I  +    ++ R NR+
Sbjct  349  PGPKYRPSMKEVVETLEQIESINHNPKEPR-NRT  381



>ref|NP_565408.1| putative serine/threonine-specific protein kinase kin3 [Arabidopsis 
thaliana]
 gb|AAK43904.1|AF370585_1 putative protein kinase [Arabidopsis thaliana]
 gb|AAK83605.1| At2g17220/T23A1.8 [Arabidopsis thaliana]
 gb|AAD25140.2| putative protein kinase [Arabidopsis thaliana]
 gb|AAN31120.1| At2g17220/T23A1.8 [Arabidopsis thaliana]
 gb|AEC06599.1| putative serine/threonine-specific protein kinase kin3 [Arabidopsis 
thaliana]
Length=414

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SH+TTR+MGT+GYAAPEY+ATGHLYVKSDVYGFGVVL EIL
Sbjct  232  YNAKISDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLAEIL  291

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL  LD +R + + NL EW KP L E+RK+++I+DPRLEGKYP ++A R+A+L LKC  
Sbjct  292  TGLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLG  351

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PS  539
             EP  RPSM EV++SL+ I     +  + R+ R+ PS
Sbjct  352  PEPKNRPSMKEVVESLELIEAANEKPLERRTTRASPS  388



>gb|KHG23246.1| hypothetical protein F383_30094 [Gossypium arboreum]
Length=419

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AKLSDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  238  YTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  297

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NL EW KP L ++RK+K+I+D RLEGKYPS+AA RIA+L LKC +
Sbjct  298  TGLRALDPNRPSGQHNLSEWIKPYLSDRRKLKSIMDNRLEGKYPSKAAVRIAQLALKCLE  357

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
              P  RPSM EV+++L++I  +    ++ R NR+
Sbjct  358  PGPKYRPSMKEVVETLEQIESINHNPKEPR-NRT  390



>ref|XP_006467073.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Citrus sinensis]
Length=419

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  238  YNAKISDFGLAKLGPAGGESHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLELL  297

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R + +QNLVEW KP+L +K+K+KTI+D R+EG+Y S AA + A+L L C +
Sbjct  298  TGLRALDTKRPTGQQNLVEWLKPMLSQKKKLKTIMDARIEGQYSSNAALQAAQLTLMCLE  357

Query  429  DEPGKRPSMDEVLKSLQEINDV  494
             +P +RPSM EVL+ L++I  V
Sbjct  358  SDPKRRPSMREVLEVLEQIEAV  379



>ref|XP_006425293.1| hypothetical protein CICLE_v10025699mg [Citrus clementina]
 gb|ESR38533.1| hypothetical protein CICLE_v10025699mg [Citrus clementina]
Length=419

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  238  YNAKISDFGLAKLGPAGGESHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLELL  297

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R + +QNLVEW KP+L +K+K+KTI+D R+EG+Y S AA + A+L L C +
Sbjct  298  TGLRALDTKRPTGQQNLVEWLKPMLSQKKKLKTIMDARIEGQYSSNAALQAAQLTLMCLE  357

Query  429  DEPGKRPSMDEVLKSLQEINDV  494
             +P +RPSM EVL+ L++I  V
Sbjct  358  SDPKRRPSMREVLEVLEQIEAV  379



>ref|XP_009106296.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=450

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAKLSDFGLAK GP+NG SHVTTR+MGT GYAAPEY+ATGHLYV SDVYGFGVVLLE+L
Sbjct  282  FNAKLSDFGLAKHGPINGYSHVTTRVMGTQGYAAPEYVATGHLYVLSDVYGFGVVLLELL  341

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +QNLVEW KP+L +K+KI+ ++DPRLE KYP  A ++ A LIL+C +
Sbjct  342  TGLRALDPNRPSAQQNLVEWAKPVLTQKKKIQKLMDPRLENKYPLLAVSKTAALILRCLE  401

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RP MD+VL+ L+ +  ++ + ++ + NR+
Sbjct  402  ADPKNRPPMDDVLRELEIVRTIREQPKEEKRNRN  435



>ref|XP_003612340.1| Serine/threonine protein kinase [Medicago truncatula]
Length=461

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 125/164 (76%), Gaps = 3/164 (2%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
             +NAK+SDFGLAK GP  G+SHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE+
Sbjct  297  NYNAKISDFGLAKFGPSGGDSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEM  356

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKT--IVDPRLEGKYPSRAATRIAELILK  419
            LTGL+  D +R   +QNL+EW KP L +KRK+K+  IVD RLEG+Y S+AA   A LILK
Sbjct  357  LTGLQAFDSNRPEGQQNLIEWIKPSLSDKRKLKSNNIVDYRLEGQYTSKAAFETAHLILK  416

Query  420  CFQDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSAD  551
            C Q +P KRPSM +VL  L+ I  +K +R+  + NR   S + D
Sbjct  417  CLQPDPKKRPSMKDVLGILEAIKAIKVKRKISK-NRCTKSATMD  459



>ref|XP_006425292.1| hypothetical protein CICLE_v10025699mg [Citrus clementina]
 gb|ESR38532.1| hypothetical protein CICLE_v10025699mg [Citrus clementina]
Length=406

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  225  YNAKISDFGLAKLGPAGGESHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLELL  284

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R + +QNLVEW KP+L +K+K+KTI+D R+EG+Y S AA + A+L L C +
Sbjct  285  TGLRALDTKRPTGQQNLVEWLKPMLSQKKKLKTIMDARIEGQYSSNAALQAAQLTLMCLE  344

Query  429  DEPGKRPSMDEVLKSLQEINDV  494
             +P +RPSM EVL+ L++I  V
Sbjct  345  SDPKRRPSMREVLEVLEQIEAV  366



>ref|XP_008663506.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X4 [Zea mays]
Length=547

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  363  YNAKLSDFGLAKNGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  422

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R + + NLVEW KP L ++RK+  +VDPRLEG+YPS+AA + A+L L+C +
Sbjct  423  TGLRALDTARPAQQHNLVEWAKPYLADRRKLPRLVDPRLEGQYPSKAALQAAQLTLRCLE  482

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRD  512
             +P  RPSM EV+ +++ +  ++ R RD
Sbjct  483  GDPRSRPSMAEVVLAIEAMEQLRVRPRD  510



>emb|CAH66747.1| H0409D10.5 [Oryza sativa Indica Group]
 gb|EAY95176.1| hypothetical protein OsI_16994 [Oryza sativa Indica Group]
Length=476

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
             +NAKLSDFGLAK GP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  282  HYNAKLSDFGLAKNGPTAGESHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEM  341

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG++ LD  R + + +LVEW KP L ++RK+  +VDPRLEG+YPSRAA + A+L L+C 
Sbjct  342  LTGMRALDTGRPAPQHSLVEWAKPYLADRRKLARLVDPRLEGQYPSRAAQQAAQLTLRCL  401

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTR  503
              +P  RPSM EV+++L EI  +++R
Sbjct  402  SGDPRSRPSMAEVVQALVEIERIRSR  427



>gb|ACJ84370.1| unknown [Medicago truncatula]
 gb|AFK33998.1| unknown [Medicago truncatula]
Length=401

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 124/163 (76%), Gaps = 3/163 (2%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAK GP  G+SHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE+L
Sbjct  238  YNAKISDFGLAKFGPSGGDSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEML  297

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKT--IVDPRLEGKYPSRAATRIAELILKC  422
            TGL+  D +R   +QNL+EW KP L +KRK+K+  IVD RLEG+Y S+AA   A LILKC
Sbjct  298  TGLQAFDSNRPEGQQNLIEWIKPSLSDKRKLKSNNIVDYRLEGQYTSKAAFETAHLILKC  357

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSAD  551
             Q +P KRPSM + L  L+ I  +K +R+  + NR   S + D
Sbjct  358  LQPDPKKRPSMKDALGILEAIKAIKVKRKISK-NRCTKSATMD  399



>ref|XP_003581530.2| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Brachypodium distachyon]
Length=558

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 128/171 (75%), Gaps = 8/171 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKH+ + +++         +NAKLSDFGLAK GP  G+SH+TTR+MGTYGYAAPEY+ATG
Sbjct  343  EKHVIYRDFKASNILLDTHYNAKLSDFGLAKDGPTGGDSHITTRVMGTYGYAAPEYVATG  402

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLE+LTGL+ LD +R + + NLV+W KP L ++RK+  +VDPRLEG
Sbjct  403  HLYVKSDVYGFGVVLLEMLTGLRALDTARPAPQLNLVDWAKPYLADRRKLARLVDPRLEG  462

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSN  524
            +YPS+AA R A+L L C   EP  RPSM EV+  L+EI  ++ R    R++
Sbjct  463  QYPSKAALRAAQLTLSCLAGEPRNRPSMAEVVAVLEEIEGMRPRHHRRRAS  513



>emb|CAE03087.2| OSJNBa0017B10.2 [Oryza sativa Japonica Group]
Length=475

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
             +NAKLSDFGLAK GP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  281  HYNAKLSDFGLAKNGPTAGESHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEM  340

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG++ LD  R + + +LVEW KP L ++RK+  +VDPRLEG+YPSRAA + A+L L+C 
Sbjct  341  LTGMRALDTGRPAPQHSLVEWAKPYLADRRKLARLVDPRLEGQYPSRAAQQAAQLTLRCL  400

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTR  503
              +P  RPSM EV+++L EI  +++R
Sbjct  401  SGDPRSRPSMAEVVQALVEIERIRSR  426



>dbj|BAK05598.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 126/166 (76%), Gaps = 8/166 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKH+ + +++         +NAKLSDFGLA+ GP  G+SH+TTR+MGTYGYAAPEY+ATG
Sbjct  241  EKHVIYRDFKASNILLDTNYNAKLSDFGLARNGPTGGDSHITTRVMGTYGYAAPEYVATG  300

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLE+LTGL+ LD +R + + NLV+W KP L ++RK+  +VDPRLEG
Sbjct  301  HLYVKSDVYGFGVVLLEMLTGLRALDTARPAQQLNLVDWAKPYLADRRKLPRLVDPRLEG  360

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDVKTRRR  509
            +YPS+A  R A+L L C   EP  RPSM EV+ +L+EI  ++ R R
Sbjct  361  QYPSKAVLRAAQLTLSCLAGEPKNRPSMAEVVTALEEIEGMRPRHR  406



>ref|XP_010240264.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Brachypodium distachyon]
Length=557

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 128/171 (75%), Gaps = 8/171 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKH+ + +++         +NAKLSDFGLAK GP  G+SH+TTR+MGTYGYAAPEY+ATG
Sbjct  342  EKHVIYRDFKASNILLDTHYNAKLSDFGLAKDGPTGGDSHITTRVMGTYGYAAPEYVATG  401

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLE+LTGL+ LD +R + + NLV+W KP L ++RK+  +VDPRLEG
Sbjct  402  HLYVKSDVYGFGVVLLEMLTGLRALDTARPAPQLNLVDWAKPYLADRRKLARLVDPRLEG  461

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSN  524
            +YPS+AA R A+L L C   EP  RPSM EV+  L+EI  ++ R    R++
Sbjct  462  QYPSKAALRAAQLTLSCLAGEPRNRPSMAEVVAVLEEIEGMRPRHHRRRAS  512



>ref|XP_007157998.1| hypothetical protein PHAVU_002G115900g [Phaseolus vulgaris]
 gb|ESW29992.1| hypothetical protein PHAVU_002G115900g [Phaseolus vulgaris]
Length=393

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 125/150 (83%), Gaps = 1/150 (1%)
 Frame = +3

Query  63   QEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  242
            +EFNAK+SDFGLAKLGP  G+SHVTTRI+GTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE
Sbjct  228  EEFNAKISDFGLAKLGPSVGDSHVTTRIIGTYGYAAPEYIATGHLYVKSDVYGFGVVLLE  287

Query  243  ILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKT-IVDPRLEGKYPSRAATRIAELILK  419
            +L G++ LD++R S ++NLVEW KP L +K K+K+ I+D ++EG+Y ++AA + A+L L+
Sbjct  288  LLKGMRALDVNRPSGQENLVEWMKPYLSDKTKLKSDIMDEKIEGQYSTKAALKAAQLTLE  347

Query  420  CFQDEPGKRPSMDEVLKSLQEINDVKTRRR  509
            C Q++  KRPSM +VL +L+ I  +K RRR
Sbjct  348  CLQNDRNKRPSMKDVLHTLESIQAIKVRRR  377



>gb|KHG09399.1| hypothetical protein F383_14054 [Gossypium arboreum]
 gb|KHG10456.1| hypothetical protein F383_08344 [Gossypium arboreum]
Length=416

 Score =   207 bits (527),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
             +NAK+SDFGLAKLGP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGV+LLEI
Sbjct  234  HYNAKISDFGLAKLGPSGGDSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVLLLEI  293

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            +TGL+ LD  R   +QNLV+W KP L  KRK KT +D R+EG+Y S+AAT+ AEL LKC 
Sbjct  294  MTGLRALDTKRPDGQQNLVDWLKPTLSHKRKFKTFMDARIEGQYSSKAATQTAELTLKCL  353

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRR  506
            + +P  RPSM +V+++L+ I  +   +
Sbjct  354  EHDPKNRPSMKQVVEALERIESLNKEK  380



>ref|XP_009345926.1| PREDICTED: probable serine/threonine-protein kinase NAK [Pyrus 
x bretschneideri]
Length=418

 Score =   207 bits (527),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAK+GP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  228  YTAKISDFGLAKMGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLIEIL  287

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R + + NLV+W KP L +KRK+K+I+DPRLEG+YPS+AA RI+ L L C +
Sbjct  288  TGLRALDTTRPNGKHNLVDWIKPFLSDKRKLKSIMDPRLEGRYPSKAAFRISHLALNCIE  347

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*P  536
             E   RPSM +V++ L+ I  VK   R+ R   + P
Sbjct  348  SEHRNRPSMKDVVEQLERIESVKELTREPRPRSTHP  383



>ref|XP_009128175.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=456

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAKLSDFGLAKLGP+NG SHVTTR+MGT GYAAPEYMATGHLYV+SDVYGFGVVLLEIL
Sbjct  279  FNAKLSDFGLAKLGPINGFSHVTTRVMGTQGYAAPEYMATGHLYVRSDVYGFGVVLLEIL  338

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R   + NLVEW KP L +K+KI+ ++DPRLE KYP  A  R A LIL+C +
Sbjct  339  TGLRALDPNRPPLQLNLVEWAKPGLTQKKKIQKMMDPRLEHKYPISAVIRTAALILRCVE  398

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
            ++P  RP MDEVL+ L+ +  ++   ++ +  RS
Sbjct  399  EDPKNRPPMDEVLRELEIVRTMRDEPKEEKRKRS  432



>ref|XP_007043058.1| Serine/threonine-protein kinase cx32 isoform 2 [Theobroma cacao]
 gb|EOX98889.1| Serine/threonine-protein kinase cx32 isoform 2 [Theobroma cacao]
Length=434

 Score =   207 bits (528),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 121/154 (79%), Gaps = 1/154 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAK GP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  246  YTAKISDFGLAKFGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  305

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S   NLV+W KP L ++RK+K+++D RLEGKYPS+AA RIA L LKC  
Sbjct  306  TGLRALDPNRPSGRHNLVDWVKPYLSDRRKLKSLMDHRLEGKYPSKAAFRIAHLALKCLA  365

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             EP  RPSM EV+++L++I     + ++ R NRS
Sbjct  366  PEPKHRPSMKEVVETLEQIESANEKPKEPR-NRS  398



>ref|XP_009593137.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Nicotiana tomentosiformis]
Length=416

 Score =   207 bits (527),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SHVTTR+MGT+GYAAPEY+ATGHLYVKSDVYGFGVVL+E+L
Sbjct  228  YNAKISDFGLAKLGPSASQSHVTTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLVEML  287

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S++ NLVEW KP L ++RK+K  +D RLEGKYPSRAA +IA+L L C  
Sbjct  288  TGLRALDTNRPSHQHNLVEWIKPHLSDRRKLKDKMDSRLEGKYPSRAAVQIAQLALSCLG  347

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             EP  RPSM EV++ L++I  V  R ++ R
Sbjct  348  PEPKTRPSMKEVVEKLEQIEAVNERPKEPR  377



>ref|XP_004976505.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Setaria italica]
Length=433

 Score =   207 bits (528),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDV+ FGVVLLE+L
Sbjct  249  YNAKLSDFGLAKHGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVWAFGVVLLEML  308

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R + + NLV+W KP L ++RK+  +VDPRLEG+YPS+AA + A+L L+C +
Sbjct  309  TGLRALDTGRPAQQHNLVDWAKPHLADRRKLARLVDPRLEGQYPSKAALQAAQLSLRCLE  368

Query  429  DEPGKRPSMDEVLKSLQEINDVKTR  503
             +P  RPSM EV+ +L+EI  +K R
Sbjct  369  GDPRSRPSMAEVVAALEEIEQIKVR  393



>gb|KHN41825.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=339

 Score =   204 bits (520),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +3

Query  63   QEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  242
            +++NAK+SDFGLAKLGP   +SHV+TRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE
Sbjct  191  EDYNAKISDFGLAKLGPSGEDSHVSTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLE  250

Query  243  ILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKC  422
            +LTGL+ LD +R   +QNL+EW KP L +KRK+K+I+D R+EG+Y ++AA + A LILKC
Sbjct  251  MLTGLRALDKNRPIEQQNLIEWAKPSLSDKRKLKSIMDERIEGQYSTKAALKSAHLILKC  310

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRR  509
             Q +  KRP M +VL +L+ I  +K R +
Sbjct  311  LQCDRKKRPHMKDVLDTLEHIEAIKDRTK  339



>ref|XP_010918257.1| PREDICTED: probable serine/threonine-protein kinase NAK [Elaeis 
guineensis]
Length=428

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAK GP  G SHV+TR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  234  YNAKLSDFGLAKNGPTGGESHVSTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  293

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD SR S + NLV+W KP+L ++RK+  ++DPRLEG+Y S+AA + A+L L+C  
Sbjct  294  SGQRALDTSRPSGKHNLVDWAKPLLSDRRKLARLMDPRLEGQYSSKAALKAAQLTLRCLA  353

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             EP  RPSM EV+++L+ I  +KTR ++ +
Sbjct  354  GEPKNRPSMKEVVETLEHIEALKTRSKESK  383



>ref|XP_006300039.1| hypothetical protein CARUB_v10016265mg [Capsella rubella]
 gb|EOA32937.1| hypothetical protein CARUB_v10016265mg [Capsella rubella]
Length=380

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAK+SDFGLAKLGP    SH+TTR+MGT GYAAPEY+ATGHLYVKSDVYGFGVVL EIL
Sbjct  198  FNAKISDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLAEIL  257

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            T L  LD +R S + NL EW KP L E+RK+++I+DPRLEGKYP ++A R+A+L LKC  
Sbjct  258  TSLHALDPTRPSGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLG  317

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PS  539
             EP  RPSM EV++SL+ I     +  + R+ ++ PS
Sbjct  318  PEPKDRPSMKEVVESLELIEAANEKPLERRTTKTPPS  354



>ref|XP_003519694.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform 1 [Glycine max]
 gb|KHN29881.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=412

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 121/159 (76%), Gaps = 6/159 (4%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  237  YNAKISDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  296

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TG + LD +R S   +L EW KP L ++RK+K I+DPRLEGK+PS+AA RIA+L LKC  
Sbjct  297  TGQRALDTNRPSGLHSLTEWVKPYLHDRRKLKGIMDPRLEGKFPSKAAFRIAQLSLKCLA  356

Query  429  DEPGKRPSMDEVLKSLQEINDVKTR------RRDHRSNR  527
             EP +RPSM EVL++L+ I     +      R  H ++R
Sbjct  357  SEPKQRPSMKEVLENLERIQAANEKPVEPKFRSTHAASR  395



>ref|XP_004509435.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=382

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAK+SDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  214  FNAKISDFGLAKLGPSGEQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEML  273

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G++ LD +R   +QNLVEW KP+L  K+K+K I+D ++EG+Y  +AA + A+L LKC +
Sbjct  274  SGMRALDRTRPPGQQNLVEWGKPLLSNKKKLKNIMDGKIEGQYSQKAAIQAAQLSLKCLE  333

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*P  536
            ++P +RPSM +VL+SL+ I  ++ + ++H S    P
Sbjct  334  NDPKQRPSMKDVLESLEIIEAIQVKSKNHISRHQPP  369



>gb|AET03604.2| Serine/Threonine-kinase Cx32, related protein [Medicago truncatula]
Length=394

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 129/168 (77%), Gaps = 2/168 (1%)
 Frame = +3

Query  75   AKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEILTG  254
            AK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLEILT 
Sbjct  227  AKISDFGLAKLGPSGGQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEILTA  286

Query  255  LKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQDE  434
            ++ LD  R + +QNLVEW KP L  K+K+K I+D R+EG+Y  +AA + A L LKC +++
Sbjct  287  MRALDTKRPTGQQNLVEWVKPFLSNKKKLKGIMDGRIEGQYSPKAAVQAAALSLKCLEND  346

Query  435  PGKRPSMDEVLKSLQEIN--DVKTRRRDHRSNRS*PSRSADYSTIIYI  572
            P +RPSM EVL+SL+ I    VKT+R ++ S++    ++A +  ++ +
Sbjct  347  PKQRPSMKEVLESLEVIEAIQVKTKRSNNNSHQPPVLQAARHQRVVKV  394



>ref|XP_007199945.1| hypothetical protein PRUPE_ppa006347mg [Prunus persica]
 gb|EMJ01144.1| hypothetical protein PRUPE_ppa006347mg [Prunus persica]
Length=416

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAK+GP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  228  YIAKISDFGLAKMGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  287

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NLV+W KP L +KRK+K I+DPRLEGKYP++AA RI++L LKC +
Sbjct  288  TGLRALDTNRPSGKHNLVDWIKPFLSDKRKLKGIMDPRLEGKYPAKAAFRISQLALKCIE  347

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*P  536
             E   RPSM +V+++L+ I       R+ R   + P
Sbjct  348  SEQKNRPSMKDVVETLERIESANEHSREPRPRSTHP  383



>ref|XP_003538908.2| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Glycine max]
Length=366

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +3

Query  63   QEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  242
            +++NAK+SDFGLAKLGP   +SHV+TRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE
Sbjct  218  EDYNAKISDFGLAKLGPSGEDSHVSTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLE  277

Query  243  ILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKC  422
            +LTGL+ LD +R   +QNL+EW KP L +KRK+K+I+D R+EG+Y ++AA + A LILKC
Sbjct  278  MLTGLRALDKNRPIEQQNLIEWAKPSLSDKRKLKSIMDERIEGQYSTKAALKSAHLILKC  337

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRR  509
             Q +  KRP M +VL +L+ I  +K R +
Sbjct  338  LQCDRKKRPHMKDVLDTLEHIEAIKDRTK  366



>ref|XP_007142571.1| hypothetical protein PHAVU_008G292000g [Phaseolus vulgaris]
 gb|ESW14565.1| hypothetical protein PHAVU_008G292000g [Phaseolus vulgaris]
Length=416

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SHVTTR+MGT+GYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  237  YNAKISDFGLAKLGPSASQSHVTTRVMGTFGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  296

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NL +W KP L ++RK+K ++D RLEGK+PS+AA RIA+L LKC  
Sbjct  297  TGLRALDPNRPSGQHNLTDWVKPYLHDRRKLKGVMDSRLEGKFPSKAAFRIAQLALKCLA  356

Query  429  DEPGKRPSMDEVLKSLQEIN  488
             EP +RPSM EVL+S++ I 
Sbjct  357  TEPKQRPSMKEVLESMERIQ  376



>ref|XP_009597877.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Nicotiana tomentosiformis]
Length=409

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  GNSHVTTR+MGTYGYAAPEY+ TGHLYVKSDVYGFGVVLLEIL
Sbjct  236  YNAKISDFGLAKLGPSGGNSHVTTRVMGTYGYAAPEYVETGHLYVKSDVYGFGVVLLEIL  295

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R S +Q LV+W KP+L  KRK+K+I+D RLEG+Y S+ A   A++ LKC +
Sbjct  296  TGLRALDTKRPSGQQKLVDWVKPMLSNKRKLKSIMDARLEGQYSSKGAMLAAQITLKCLE  355

Query  429  DEPGKRPSMDEVLKSLQEINDVKTR  503
             +P  RPSM EV+  L++I  +K +
Sbjct  356  GDPKNRPSMKEVMDVLEQIEAIKEK  380



>ref|XP_008235964.1| PREDICTED: probable serine/threonine-protein kinase NAK [Prunus 
mume]
Length=416

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAK+GP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  228  YIAKISDFGLAKMGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  287

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NLV+W KP L +KRK+K I+DPRLEGKYP++AA RI++L LKC +
Sbjct  288  TGLRALDQNRPSGKHNLVDWIKPFLSDKRKLKGIMDPRLEGKYPAKAAFRISQLALKCIE  347

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*P  536
             E   RPSM +V+++L+ I       R+ R   + P
Sbjct  348  SEQKNRPSMKDVVETLERIESANEHSREPRPRSTHP  383



>ref|XP_010548159.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Tarenaya hassleriana]
Length=411

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 122/163 (75%), Gaps = 0/163 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDV+GFGVVL EIL
Sbjct  228  YTAKISDFGLAKLGPSESQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVFGFGVVLAEIL  287

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ +D SR S + NL EW KP L ++RK+++++DPRLEGKY  +AA R+AEL LKC  
Sbjct  288  TGLRAVDTSRPSGQHNLSEWIKPYLADRRKLRSVMDPRLEGKYSIKAAFRVAELALKCIG  347

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADYS  557
             EP KRP M EV+++L+ +     +  + R  RS P+ S   S
Sbjct  348  PEPKKRPPMKEVVEALERVEAANDKPLERRRARSSPTVSNQQS  390



>ref|XP_007043057.1| Serine/threonine-protein kinase cx32 isoform 1 [Theobroma cacao]
 gb|EOX98888.1| Serine/threonine-protein kinase cx32 isoform 1 [Theobroma cacao]
Length=488

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 121/154 (79%), Gaps = 1/154 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAK GP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  300  YTAKISDFGLAKFGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  359

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S   NLV+W KP L ++RK+K+++D RLEGKYPS+AA RIA L LKC  
Sbjct  360  TGLRALDPNRPSGRHNLVDWVKPYLSDRRKLKSLMDHRLEGKYPSKAAFRIAHLALKCLA  419

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             EP  RPSM EV+++L++I     + ++ R NRS
Sbjct  420  PEPKHRPSMKEVVETLEQIESANEKPKEPR-NRS  452



>ref|XP_003629128.1| Serine/threonine protein kinase BIK1 [Medicago truncatula]
Length=408

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 129/168 (77%), Gaps = 2/168 (1%)
 Frame = +3

Query  75   AKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEILTG  254
            AK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLEILT 
Sbjct  241  AKISDFGLAKLGPSGGQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEILTA  300

Query  255  LKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQDE  434
            ++ LD  R + +QNLVEW KP L  K+K+K I+D R+EG+Y  +AA + A L LKC +++
Sbjct  301  MRALDTKRPTGQQNLVEWVKPFLSNKKKLKGIMDGRIEGQYSPKAAVQAAALSLKCLEND  360

Query  435  PGKRPSMDEVLKSLQEIN--DVKTRRRDHRSNRS*PSRSADYSTIIYI  572
            P +RPSM EVL+SL+ I    VKT+R ++ S++    ++A +  ++ +
Sbjct  361  PKQRPSMKEVLESLEVIEAIQVKTKRSNNNSHQPPVLQAARHQRVVKV  408



>ref|XP_004509434.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=407

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAK+SDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  239  FNAKISDFGLAKLGPSGEQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEML  298

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G++ LD +R   +QNLVEW KP+L  K+K+K I+D ++EG+Y  +AA + A+L LKC +
Sbjct  299  SGMRALDRTRPPGQQNLVEWGKPLLSNKKKLKNIMDGKIEGQYSQKAAIQAAQLSLKCLE  358

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*P  536
            ++P +RPSM +VL+SL+ I  ++ + ++H S    P
Sbjct  359  NDPKQRPSMKDVLESLEIIEAIQVKSKNHISRHQPP  394



>gb|KFK42056.1| hypothetical protein AALP_AA2G205700 [Arabis alpina]
Length=459

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F+AKLSDFGLAK GP+NG SHVTTR+MGT GYAAPEYMATGHLYV+SDVYGFGVVLLE+L
Sbjct  282  FDAKLSDFGLAKHGPINGFSHVTTRVMGTRGYAAPEYMATGHLYVRSDVYGFGVVLLELL  341

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ +D +R S++QNLVEW KP+L +K+KI+ ++DPRLE KYP  A TR A LIL+C +
Sbjct  342  TGLRTIDPNRPSSQQNLVEWAKPVL-QKKKIQKMMDPRLEQKYPLLAVTRTAGLILQCLE  400

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNR  527
             +P  RP MDEVL+ L+ +  ++   ++ R  R
Sbjct  401  ADPKNRPPMDEVLRELEIVRTIRDEPKEERRKR  433



>ref|XP_002279800.2| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Vitis vinifera]
Length=415

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+E+L
Sbjct  227  YTAKISDFGLAKLGPTASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEML  286

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NLV+W KP L ++RK+KTI+D RLEG+YPS+AA +IA+L L+C  
Sbjct  287  TGLRALDTTRPSGQHNLVDWIKPHLSDRRKLKTIMDARLEGRYPSKAANQIAQLSLRCIG  346

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             E   RPSM EVL++L+ I     R R+ R
Sbjct  347  SEHKSRPSMKEVLETLERIEAYNERPREPR  376



>ref|NP_001174044.1| Os04g0563900 [Oryza sativa Japonica Group]
 dbj|BAH92772.1| Os04g0563900 [Oryza sativa Japonica Group]
Length=555

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
             +NAKLSDFGLAK GP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  281  HYNAKLSDFGLAKNGPTAGESHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEM  340

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG++ LD  R + + +LVEW KP L ++RK+  +VDPRLEG+YPSRAA + A+L L+C 
Sbjct  341  LTGMRALDTGRPAPQHSLVEWAKPYLADRRKLARLVDPRLEGQYPSRAAQQAAQLTLRCL  400

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTR  503
              +P  RPSM EV+++L EI  +++R
Sbjct  401  SGDPRSRPSMAEVVQALVEIERIRSR  426



>ref|XP_007142572.1| hypothetical protein PHAVU_008G292000g [Phaseolus vulgaris]
 gb|ESW14566.1| hypothetical protein PHAVU_008G292000g [Phaseolus vulgaris]
Length=426

 Score =   206 bits (523),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 125/160 (78%), Gaps = 1/160 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SHVTTR+MGT+GYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  247  YNAKISDFGLAKLGPSASQSHVTTRVMGTFGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  306

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NL +W KP L ++RK+K ++D RLEGK+PS+AA RIA+L LKC  
Sbjct  307  TGLRALDPNRPSGQHNLTDWVKPYLHDRRKLKGVMDSRLEGKFPSKAAFRIAQLALKCLA  366

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSA  548
             EP +RPSM EVL+S++ I     +  + +S RS  +R A
Sbjct  367  TEPKQRPSMKEVLESMERIQAANEKPVEPKS-RSTNTRQA  405



>ref|XP_011088714.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X2 [Sesamum indicum]
 ref|XP_011088715.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X3 [Sesamum indicum]
Length=437

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            ++AK+SDFGLAK+GP    SHVTT++MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+E+L
Sbjct  247  YHAKISDFGLAKMGPTASRSHVTTQVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEML  306

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NLV+W KP L ++RK+K I+D RLEG+YPS++A +IA+L L C +
Sbjct  307  TGLRALDTNRPSGQHNLVDWIKPHLSDRRKLKNIMDLRLEGRYPSKSALQIAQLALNCLE  366

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
            +EP  RPSM E++++L+ I+    R R+ R + S
Sbjct  367  NEPKNRPSMQEIVETLERIDSANERPRERRVHSS  400



>ref|XP_011088711.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X1 [Sesamum indicum]
 ref|XP_011088712.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X1 [Sesamum indicum]
Length=438

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            ++AK+SDFGLAK+GP    SHVTT++MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+E+L
Sbjct  248  YHAKISDFGLAKMGPTASRSHVTTQVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEML  307

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NLV+W KP L ++RK+K I+D RLEG+YPS++A +IA+L L C +
Sbjct  308  TGLRALDTNRPSGQHNLVDWIKPHLSDRRKLKNIMDLRLEGRYPSKSALQIAQLALNCLE  367

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
            +EP  RPSM E++++L+ I+    R R+ R + S
Sbjct  368  NEPKNRPSMQEIVETLERIDSANERPRERRVHSS  401



>ref|XP_006379372.1| hypothetical protein POPTR_0009s16860g [Populus trichocarpa]
 gb|ERP57169.1| hypothetical protein POPTR_0009s16860g [Populus trichocarpa]
Length=410

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 124/162 (77%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AKLSDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  222  YTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  281

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD++R S   +LV+W KP L +KRK+K+I+D  LEG+YPS+AA +IA+L L C +
Sbjct  282  TGLRALDINRPSGRHSLVDWIKPYLSDKRKLKSIMDSHLEGRYPSKAALQIAQLALNCLE  341

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADY  554
             EP  RP M +V+++L+ I   K R+   R+    P+RS  +
Sbjct  342  SEPKHRPHMKQVVETLERIEASKERQGQTRTR---PNRSKSH  380



>gb|EYU43737.1| hypothetical protein MIMGU_mgv1a007465mg [Erythranthe guttata]
Length=406

 Score =   205 bits (521),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  232  YNAKISDFGLAKLGPSGGDSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEML  291

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R SN  NLVEW KP L +KR++KTI+D R++G+Y ++A+   A+L L+C +
Sbjct  292  TGLRALDTTRPSNRHNLVEWVKPFLSQKRRLKTIMDARIQGQYSTKASLAAAQLSLRCLE  351

Query  429  DEPGKRPSMDEVLKSLQEI  485
            +E  KRPSM EV++ L++I
Sbjct  352  NEQKKRPSMKEVVEVLEQI  370



>ref|NP_001058637.1| Os06g0727400 [Oryza sativa Japonica Group]
 dbj|BAD61815.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF20551.1| Os06g0727400 [Oryza sativa Japonica Group]
 dbj|BAG91489.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66388.1| hypothetical protein OsJ_22723 [Oryza sativa Japonica Group]
Length=414

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAKLSDFGLAK GP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  240  FNAKLSDFGLAKHGPDGGLSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  299

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +GL+ LD SR S + NLV+W KP+L ++RK+  ++D RLEG+Y SR A + A+L LKC  
Sbjct  300  SGLRALDPSRPSGKLNLVDWAKPLLADRRKLSQLMDSRLEGQYHSRGALQAAQLTLKCLS  359

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RPSM EV+++L++I  +K++ R+ R++ S
Sbjct  360  GDPKSRPSMKEVVEALEKIKLIKSKSREPRNSSS  393



>ref|XP_002452769.1| hypothetical protein SORBIDRAFT_04g032190 [Sorghum bicolor]
 gb|EES05745.1| hypothetical protein SORBIDRAFT_04g032190 [Sorghum bicolor]
Length=473

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 122/166 (73%), Gaps = 8/166 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKH+ + +++         FNAKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATG
Sbjct  256  EKHVIYRDFKASNILLDTHFNAKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATG  315

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLEILTGL+ LD  R + + NLV+W KP L ++RK+  +VDPRLEG
Sbjct  316  HLYVKSDVYGFGVVLLEILTGLRALDTDRPAAQHNLVDWAKPYLADRRKLARLVDPRLEG  375

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDVKTRRR  509
            +YPSR A R A+L L+C   +   RPSM EV+  L+EI  +    R
Sbjct  376  QYPSRGAQRAAQLTLRCLAADHKNRPSMREVVAVLEEIESMSLSSR  421



>ref|XP_003629135.1| Protein kinase APK1B [Medicago truncatula]
 gb|AET03611.1| Serine/Threonine-kinase Cx32, related protein [Medicago truncatula]
Length=277

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 122/155 (79%), Gaps = 2/155 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGL KLGP  G SHVT R+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLEIL
Sbjct  114  YNAKISDFGLDKLGPSGGQSHVTPRLMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEIL  173

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            T ++ LD  R + +QNLVEW KP L  K+K+K I+D R+EG+Y  +AA + A L LKC +
Sbjct  174  TVMRALDTKRPTGQQNLVEWVKPFLSNKKKLKGIMDGRIEGQYSPKAAVQAAALSLKCLE  233

Query  429  DEPGKRPSMDEVLKSLQEIN--DVKTRRRDHRSNR  527
            ++P +RPSM EVL+SL+ I    VKT+R ++ S++
Sbjct  234  NDPKQRPSMKEVLESLEVIEAIQVKTKRSNNNSHQ  268



>ref|XP_009344675.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Pyrus x bretschneideri]
Length=411

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAK+SDFGLAKLGPV G SHV+TR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLEIL
Sbjct  232  FNAKISDFGLAKLGPVGGESHVSTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEIL  291

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LDL R   +Q LVEW KP+L  KRK+KTI+D R+EG+Y  +AA + A++  KC  
Sbjct  292  TGLRALDLKRPKEQQQLVEWAKPLLLNKRKLKTILDVRMEGQYAFKAAMQTAQITEKCLA  351

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             +P  RPSM E+++ L++I  +K + +  +
Sbjct  352  PDPKSRPSMIEIVEQLKQIRAIKEQPKQSK  381



>ref|XP_010941423.1| PREDICTED: probable serine/threonine-protein kinase NAK [Elaeis 
guineensis]
Length=426

 Score =   205 bits (522),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  234  YNAKLSDFGLAKHGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  293

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD +R S + NLV+W +P L ++RK+  ++DPRLEG+YPS+ A + A+L L+C  
Sbjct  294  SGQRALDTNRPSGQHNLVDWARPYLADRRKLSRLMDPRLEGQYPSKGALQAAQLTLRCLA  353

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRR  509
             +P  RPSM EV+++L++I  +K R R
Sbjct  354  GDPKSRPSMKEVVETLEQIEAMKGRSR  380



>ref|XP_002312803.2| hypothetical protein POPTR_0009s16860g [Populus trichocarpa]
 gb|EEE86758.2| hypothetical protein POPTR_0009s16860g [Populus trichocarpa]
Length=423

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 124/162 (77%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AKLSDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  235  YTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  294

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD++R S   +LV+W KP L +KRK+K+I+D  LEG+YPS+AA +IA+L L C +
Sbjct  295  TGLRALDINRPSGRHSLVDWIKPYLSDKRKLKSIMDSHLEGRYPSKAALQIAQLALNCLE  354

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADY  554
             EP  RP M +V+++L+ I   K R+   R+    P+RS  +
Sbjct  355  SEPKHRPHMKQVVETLERIEASKERQGQTRTR---PNRSKSH  393



>ref|XP_004231098.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Solanum lycopersicum]
Length=410

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ TGHLYVKSDVYGFGVVL+E+L
Sbjct  222  YNAKISDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVQTGHLYVKSDVYGFGVVLVEML  281

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R SN+ NLVEW KP L ++RK+K  +D RLEG+YPSRAA +IA+L L C  
Sbjct  282  TGLRALDTNRPSNQHNLVEWIKPHLSDRRKLKDKMDSRLEGRYPSRAAVQIAQLALSCLG  341

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             EP  RP M EV++ L++I     R ++ R
Sbjct  342  PEPKTRPGMKEVVEKLEQIEAANERPKEPR  371



>ref|XP_011096982.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Sesamum indicum]
Length=418

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 124/155 (80%), Gaps = 1/155 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  235  YNAKISDFGLAKLGPSGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  294

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R S + NLV+W KP+L ++RK+K+ +D R+EG+Y S+AA + ++L L+C +
Sbjct  295  TGLRALDTRRPSGQHNLVDWLKPLLPQRRKLKSYMDARIEGQYSSKAALQASQLTLRCLE  354

Query  429  DEPGKRPSMDEVLKSLQEINDV-KTRRRDHRSNRS  530
             EP KRPSM EV+  L++I  + K R   +RS  S
Sbjct  355  GEPRKRPSMKEVVDVLEQIAAMEKPRESKNRSTHS  389



>ref|XP_006409336.1| hypothetical protein EUTSA_v10022708mg [Eutrema salsugineum]
 gb|ESQ50789.1| hypothetical protein EUTSA_v10022708mg [Eutrema salsugineum]
Length=408

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP    SH+TTR+MGT GYAAPEY+ATGHLYVKSD +GFGVVL EIL
Sbjct  226  YNAKLSDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDNFGFGVVLAEIL  285

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R + + NL EW KP L E+RK+++I+DPRLEGKYP ++A R+A+L LKC +
Sbjct  286  TGLRALDPTRPTGQHNLTEWVKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLE  345

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             EP  RPSM EV++SL+ I     +  + RS R+
Sbjct  346  PEPKNRPSMKEVVESLELIVAANEKPLERRSTRA  379



>emb|CBI37741.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+E+L
Sbjct  227  YTAKISDFGLAKLGPTASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEML  286

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NLV+W KP L ++RK+KTI+D RLEG+YPS+AA +IA+L L+C  
Sbjct  287  TGLRALDTTRPSGQHNLVDWIKPHLSDRRKLKTIMDARLEGRYPSKAANQIAQLSLRCIG  346

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             E   RPSM EVL++L+ I     R R+ R
Sbjct  347  SEHKSRPSMKEVLETLERIEAYNERPREPR  376



>ref|XP_003572799.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brachypodium 
distachyon]
Length=448

 Score =   205 bits (522),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 122/164 (74%), Gaps = 8/164 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKH+ + +++         F+AKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATG
Sbjct  235  EKHVIYRDFKASNILLDTHFHAKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATG  294

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLE+LTGL+ LD  R S + NLV+W KP L ++RK+  ++DPRLEG
Sbjct  295  HLYVKSDVYGFGVVLLEVLTGLRALDTDRPSGQHNLVDWAKPHLADRRKLARLMDPRLEG  354

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDVKTR  503
            +Y SR A R A+L L+C   E   RPSM EV+  LQEI  + +R
Sbjct  355  QYSSRGAQRAAQLTLRCLAAEHTNRPSMKEVVAVLQEIESMSSR  398



>ref|XP_008813320.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Phoenix 
dactylifera]
Length=392

 Score =   204 bits (518),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAK GP +G+SHVTTR+MGT GYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  235  YNAKLSDFGLAKNGPSDGDSHVTTRVMGTRGYAAPEYIATGHLYVKSDVYGFGVVLLEML  294

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD +R S +QNLV+W KP L ++RK+ +++DPRLEG+Y S+ A + A+L L+C  
Sbjct  295  SGQRALDPNRPSGKQNLVDWAKPFLADRRKLASLMDPRLEGRYRSKGALQAAQLTLRCLA  354

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*P  536
             +P +RPSM+EV+++L+ I  +K R ++ +   S P
Sbjct  355  GDPKRRPSMEEVVQTLEHIEALKNRSKESKDVASQP  390



>emb|CDP14494.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   204 bits (519),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 123/162 (76%), Gaps = 3/162 (2%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAK+GP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+E+L
Sbjct  231  YNAKISDFGLAKMGPTASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEML  290

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R + + NL +W KP L ++RK+K ++D RLEGKYPS+AA +IA+L L C  
Sbjct  291  TGLRALDTNRPNGQHNLTDWIKPHLSDRRKLKIMMDVRLEGKYPSKAAVQIAQLALTCLG  350

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADY  554
             EP  RPSM EVL++L+ I     + ++ R N   P+R   +
Sbjct  351  PEPKTRPSMKEVLETLERIESADEKPKERRVN---PTRQTAH  389



>ref|XP_011092993.1| PREDICTED: probable serine/threonine-protein kinase NAK [Sesamum 
indicum]
Length=414

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            ++AK+SDFGLAK+GP    SHVTT++MGT GYAAPEY+ATGHLYVKSDVYGFGVVL+E+L
Sbjct  231  YHAKISDFGLAKMGPTASKSHVTTQVMGTNGYAAPEYVATGHLYVKSDVYGFGVVLVEML  290

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NLVEW KP L ++RK+K ++D RLEGKYPSR+A +IA+L L C +
Sbjct  291  TGLRALDPNRPSGKHNLVEWIKPHLPDRRKLKNVMDSRLEGKYPSRSALQIAQLALNCLE  350

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
            +EP  RPSM E++++L+ I+    R RD R + S
Sbjct  351  NEPKNRPSMQEIVETLERIHSDNERPRDPRIHSS  384



>emb|CDY31372.1| BnaA07g03070D [Brassica napus]
Length=410

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 123/163 (75%), Gaps = 0/163 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP    SH+TTR+MGT+GYAAPEY+ATGHLYVKSD YGFGVVL EIL
Sbjct  228  YNAKLSDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDNYGFGVVLAEIL  287

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL  LD +R + + NL +W KP L E+RK++ I+DPRLEGKYP ++A R+A+L LKC +
Sbjct  288  TGLHALDPTRPTGQHNLTDWIKPHLSERRKLRRIMDPRLEGKYPFKSAFRVAQLSLKCLE  347

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADYS  557
             EP  RPSM EV++SL+ I     +  + R+ R+ P+ S   S
Sbjct  348  PEPKNRPSMTEVVESLELIVAANEKPLERRTTRASPTVSNQQS  390



>ref|XP_009373402.1| PREDICTED: probable serine/threonine-protein kinase NAK [Pyrus 
x bretschneideri]
 ref|XP_009373403.1| PREDICTED: probable serine/threonine-protein kinase NAK [Pyrus 
x bretschneideri]
Length=429

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAK+GP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  239  YTAKISDFGLAKMGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLIEIL  298

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R S +QNLV+W KP L +KRK+K+I+DP+L+G+YPS+AA RI+ L LKC +
Sbjct  299  TGLRALDTHRPSGKQNLVDWIKPFLSDKRKLKSIMDPQLQGRYPSKAAFRISLLSLKCIE  358

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*P  536
             E   RPSM +V+++L+ I       R+ R   + P
Sbjct  359  SEHRNRPSMKDVVETLERIESANELTREPRPRSTHP  394



>ref|XP_008382436.1| PREDICTED: probable serine/threonine-protein kinase NAK [Malus 
domestica]
Length=418

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAK+GP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  228  YTAKISDFGLAKMGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLIEIL  287

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R   + NLV+W KP L +KRK+K+I+DP L+G+YPS+AA RI++L L C +
Sbjct  288  TGLRALDTTRPXGKHNLVDWIKPFLSDKRKLKSIMDPHLQGRYPSKAAFRISQLALNCIE  347

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*P  536
             E   RPSM +V++ L+ I  VK   R+ R   + P
Sbjct  348  SEHRNRPSMKDVVEKLERIESVKELTREPRPRSTHP  383



>ref|XP_008241951.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Prunus mume]
Length=414

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAK+SDFGLAKLGP  G SHV+TRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLEIL
Sbjct  235  FNAKISDFGLAKLGPAGGESHVSTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEIL  294

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R   +Q LVEW KP+L  KRK+K I+D R+EG+Y  +AA + A++  KC  
Sbjct  295  TGLRALDTKRPKEQQQLVEWAKPLLLHKRKLKNILDVRMEGQYAFKAALQAAQITQKCLA  354

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRS  545
             +P  RPSM EV++ L++I  +K + +  R   + P+ S
Sbjct  355  PDPKSRPSMKEVVEELEKIQAIKEKPKQSRLASAQPTFS  393



>dbj|BAK06515.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=456

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 121/161 (75%), Gaps = 8/161 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKH+ + +++        +F+AKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATG
Sbjct  245  EKHVIYRDFKASNILLDTQFHAKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATG  304

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLE+LTGL+ LD  R S + NLV+W KP L ++RK+  ++DPRLEG
Sbjct  305  HLYVKSDVYGFGVVLLEVLTGLRALDTDRPSGQHNLVDWAKPHLADRRKLARLMDPRLEG  364

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDV  494
            +Y SR A R A+L L+C   E   RPSM EV+  LQEI  +
Sbjct  365  QYSSRGAQRAAQLTLRCLAAEHTNRPSMKEVVAVLQEIESM  405



>ref|XP_002527153.1| serine/threonine-protein kinase cx32, putative [Ricinus communis]
 gb|EEF35235.1| serine/threonine-protein kinase cx32, putative [Ricinus communis]
Length=430

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL EIL
Sbjct  242  YTAKISDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLAEIL  301

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL  LD +R S   NLVEW KP L +KRK+KTI+D RLEG+YPS+ A RIA+L L C +
Sbjct  302  TGLHALDTNRPSGRHNLVEWIKPYLYDKRKLKTIMDSRLEGRYPSKPAFRIAQLALNCIE  361

Query  429  DEPGKRPSMDEVLKSLQEI  485
             EP  RPSM EV+++L+ I
Sbjct  362  SEPKHRPSMKEVVETLERI  380



>ref|XP_009121148.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=410

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 123/163 (75%), Gaps = 0/163 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP    SH+TTR+MGT+GYAAPEY+ATGHLYVKSD YGFGVVL EIL
Sbjct  228  YNAKLSDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDNYGFGVVLAEIL  287

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL  LD +R + + NL +W KP L E+RK++ I+DPRLEGKYP ++A R+A+L LKC +
Sbjct  288  TGLHALDPTRPTGQHNLTDWIKPHLSERRKLRRIMDPRLEGKYPFKSAFRVAQLSLKCLE  347

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADYS  557
             EP  RPSM EV++SL+ I     +  + R+ R+ P+ S   S
Sbjct  348  PEPKNRPSMTEVVESLELIVAANEKPLERRTTRASPTVSNQRS  390



>ref|XP_008364420.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Malus domestica]
Length=374

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAK+GP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  184  YTAKISDFGLAKMGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLIEIL  243

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R S +QNLV+W KP L +KRK+K I+DP+L+G+YPS+AA RI+ L LKC +
Sbjct  244  TGLRALDTHRPSGKQNLVDWIKPFLSDKRKLKGIMDPQLQGRYPSKAAFRISLLALKCIE  303

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*P  536
             E   RPSM +V++ L+ I       R+ R   + P
Sbjct  304  SEHRNRPSMKDVVEELERIESANELTREPRPRSTHP  339



>dbj|BAK03372.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=407

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
             FN KLSDFGLAK GP +G SHVTTR+MGTYGYAAPEY++TGHLYVKSDVYGFGVVLLEI
Sbjct  229  HFNPKLSDFGLAKHGPDDGESHVTTRVMGTYGYAAPEYVSTGHLYVKSDVYGFGVVLLEI  288

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            L GL+ LD SR S + NLV W KP+L ++R++  ++D RLEG+Y +R A R A+L LKC 
Sbjct  289  LCGLRALDPSRPSEKLNLVNWAKPLLSDRRRLTQLMDSRLEGQYHARGAFRAAQLTLKCL  348

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PS  539
              EP  RPSM EV+++L++I  +K++ +   + R  PS
Sbjct  349  AGEPKSRPSMKEVVEALEQIEAMKSKSKSREARRDSPS  386



>emb|CDX71350.1| BnaC07g06290D [Brassica napus]
Length=410

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 122/163 (75%), Gaps = 0/163 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP    SH+TTR+MGT+GYAAPEY+ATGHLYVKSD YGFGVVL EIL
Sbjct  228  YNAKLSDFGLAKLGPSASQSHITTRVMGTHGYAAPEYVATGHLYVKSDNYGFGVVLAEIL  287

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL  LD +R + + NL +W KP L E+RK++ I+DPRLEGKYP ++A R+A+L LKC +
Sbjct  288  TGLHALDPTRPTGQHNLTDWIKPHLSERRKLRRIMDPRLEGKYPFKSAFRVAQLSLKCLE  347

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADYS  557
             EP  RPSM EV++SL+ I     +    R+ R+ P+ S   S
Sbjct  348  PEPKNRPSMTEVVESLELIVAANEKPLQRRTTRASPTVSNQQS  390



>gb|KEH36322.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=409

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 132/172 (77%), Gaps = 11/172 (6%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            +FNAKLSDFGLAKLGPVNG SHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI
Sbjct  225  DFNAKLSDFGLAKLGPVNGRSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  284

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL  LD +R +NE NLV++T+  L +K+K+K I+DP LE +Y S AA  IA+LILKC 
Sbjct  285  LTGLIALDQNRPTNEMNLVDFTRGSLSDKKKLKKIMDPGLEEQYSSTAAFLIAQLILKCL  344

Query  426  QDEPGKRPSMDEVLKSLQEINDV-------KTRRRDHRSNRS*PSRSADYST  560
            + +P  RPSM++VL++L++   +       K+R   H+ N+    R  D+ST
Sbjct  345  ESDPKNRPSMEQVLETLEKAQSIKYKPKVKKSRNSVHQKNK----RPRDHST  392



>ref|XP_009392863.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAK GP +G+SHVTTR+MGT+GYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  220  YNAKLSDFGLAKHGPTDGDSHVTTRVMGTFGYAAPEYVATGHLYVKSDVYGFGVVLLEML  279

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
             G + LD +R SN+ NLV + KP+L ++RK+  ++DPRLEG+YP++ A + A+L LKC  
Sbjct  280  AGQRALDSNRPSNQHNLVAYAKPLLADRRKLGRLMDPRLEGRYPAKGALQAAQLTLKCLA  339

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRR  509
            ++P  RPSM EV+++L++I   K R +
Sbjct  340  NDPRSRPSMKEVVETLEQIEATKGRSK  366



>ref|XP_010690221.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010690222.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=404

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 120/160 (75%), Gaps = 6/160 (4%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVV++E+L
Sbjct  224  YNAKISDFGLAKLGPSESQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVIVELL  283

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +  LV+W KP L +KRK+K I+D RLEGKYP +AA   AEL L C +
Sbjct  284  TGLRALDTTRPSGKHTLVDWIKPFLSDKRKLKGIMDIRLEGKYPLKAAVATAELALTCIE  343

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSA  548
             EP  RPSM EVL+SL     VK +  DH   R  P RS+
Sbjct  344  QEPRARPSMQEVLESL-----VKIQAIDHEKPRV-PRRSS  377



>ref|XP_002300641.2| hypothetical protein POPTR_0002s01040g [Populus trichocarpa]
 gb|EEE79914.2| hypothetical protein POPTR_0002s01040g [Populus trichocarpa]
Length=465

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP+NG+SHVTTRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  277  YNAKLSDFGLAKLGPLNGDSHVTTRIMGTYGYAAPEYLATGHLYVKSDVYGFGVVLLELL  336

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGLK LD +R S + NLVE+ +P L E+RK+K I+DP LE +YP +AA + AELIL+C +
Sbjct  337  TGLKALDTNRPSGQHNLVEYARPFLLERRKLKKIMDPGLEERYPLKAAMQAAELILRCLE  396

Query  429  DEPGKRPSMDEVLKSLQEINDV  494
             +   RPSM+EV   L +I DV
Sbjct  397  SDLRIRPSMEEVSGILIKIKDV  418



>ref|XP_009392862.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=421

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAK GP +G+SHVTTR+MGT+GYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  234  YNAKLSDFGLAKHGPTDGDSHVTTRVMGTFGYAAPEYVATGHLYVKSDVYGFGVVLLEML  293

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
             G + LD +R SN+ NLV + KP+L ++RK+  ++DPRLEG+YP++ A + A+L LKC  
Sbjct  294  AGQRALDSNRPSNQHNLVAYAKPLLADRRKLGRLMDPRLEGRYPAKGALQAAQLTLKCLA  353

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRR  509
            ++P  RPSM EV+++L++I   K R +
Sbjct  354  NDPRSRPSMKEVVETLEQIEATKGRSK  380



>ref|XP_010515408.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
 ref|XP_010515419.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
 ref|XP_010515427.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
Length=416

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SH+TTR+MGT GYAAPEY+ATGHLYVKSDVYGFGVVL EIL
Sbjct  233  YNAKISDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLAEIL  292

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            T L  LD +R + + NL EW KP L E+RK+++I+DPRLEGKYP ++A R+A+L LKC  
Sbjct  293  TSLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLG  352

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             EP  RPSM EV++SL+ I     +  + R+ R+
Sbjct  353  PEPKDRPSMKEVVESLELIEAANEKPLERRTTRA  386



>ref|XP_009788445.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X1 [Nicotiana sylvestris]
Length=416

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SHVTTR++GT+GYAAPEY+ATGHLYVKSDVYGFGVVL+E+L
Sbjct  228  YNAKISDFGLAKLGPSASQSHVTTRVVGTHGYAAPEYVATGHLYVKSDVYGFGVVLVEML  287

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S++ NLVEW KP L ++RK+K  +D RLEGKYPSRAA +IA+L L C  
Sbjct  288  TGLRALDTNRPSHQHNLVEWIKPHLSDRRKLKDKMDSRLEGKYPSRAAVQIAQLALSCLG  347

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             EP  RPSM EV++ L+ I     R ++ R
Sbjct  348  PEPKTRPSMKEVVEKLEHIEAANERPKEPR  377



>ref|XP_010515435.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Camelina sativa]
Length=415

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SH+TTR+MGT GYAAPEY+ATGHLYVKSDVYGFGVVL EIL
Sbjct  232  YNAKISDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLAEIL  291

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            T L  LD +R + + NL EW KP L E+RK+++I+DPRLEGKYP ++A R+A+L LKC  
Sbjct  292  TSLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGKYPFKSAFRVAQLALKCLG  351

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             EP  RPSM EV++SL+ I     +  + R+ R+
Sbjct  352  PEPKDRPSMKEVVESLELIEAANEKPLERRTTRA  385



>ref|XP_004287732.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=409

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 123/164 (75%), Gaps = 8/164 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKHI + +++         +NAK+SDFGLAKLGP  G+SHV+TRIMGTYGYAAPEY+ATG
Sbjct  208  EKHIIYRDFKASNILLDGNYNAKISDFGLAKLGPTGGDSHVSTRIMGTYGYAAPEYIATG  267

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLEILTGL+ LD  R   + NLV+W KP+L  KRK+KTI+D R+EG
Sbjct  268  HLYVKSDVYGFGVVLLEILTGLRALDTKRPKEQLNLVDWAKPLLPHKRKLKTIMDARMEG  327

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDVKTR  503
            +Y  +AA + A + LKC   +P  RPSM EVL+ L+++  +  +
Sbjct  328  QYSFKAALQTANITLKCLAPDPKSRPSMKEVLEELEQVQAISEK  371



>ref|XP_006473798.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85106.1| hypothetical protein CISIN_1g013519mg [Citrus sinensis]
Length=441

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP++GNSHVTTRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  247  YNAKLSDFGLAKLGPIDGNSHVTTRIMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  306

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S E  LV++ +P L +KR++K I+DPRLE +YP + A    ++I+KC +
Sbjct  307  TGLRALDTNRPSGEHVLVDFARPSLTDKRRLKKIMDPRLEEQYPIKGALLAGQIIIKCLE  366

Query  429  DEPGKRPSMDEVLKSLQEIN  488
             EP  RPSM+EVL++LQ I+
Sbjct  367  AEPKNRPSMEEVLETLQNIS  386



>ref|XP_006435368.1| hypothetical protein CICLE_v10001177mg [Citrus clementina]
 gb|ESR48608.1| hypothetical protein CICLE_v10001177mg [Citrus clementina]
Length=441

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP++GNSHVTTRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  247  YNAKLSDFGLAKLGPIDGNSHVTTRIMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  306

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S E  LV++ +P L +KR++K I+DPRLE +YP + A    ++I+KC +
Sbjct  307  TGLRALDTNRPSGEHVLVDFARPSLTDKRRLKKIMDPRLEEQYPIKGALLAGQIIIKCLE  366

Query  429  DEPGKRPSMDEVLKSLQEIN  488
             EP  RPSM+EVL++LQ I+
Sbjct  367  AEPKNRPSMEEVLETLQNIS  386



>ref|XP_010029583.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Eucalyptus grandis]
 gb|KCW56505.1| hypothetical protein EUGRSUZ_I02227 [Eucalyptus grandis]
Length=385

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 121/155 (78%), Gaps = 1/155 (1%)
 Frame = +3

Query  57   NWQEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVL  236
            +W + NAK++DFGLAKLGP +G SHVTTRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVL
Sbjct  223  DWHD-NAKIADFGLAKLGPSSGESHVTTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVL  281

Query  237  LEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELIL  416
            LE+LTGL+ LD  R S +QNLV+WTKPIL ++ K+K I+D R+E +Y  +A  + A+L L
Sbjct  282  LELLTGLRALDTKRPSGQQNLVDWTKPILSQRGKLKNIIDHRMEDQYSFKAVLQTAQLTL  341

Query  417  KCFQDEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
            KC   EP  RP M EV+++L+ I  +K + +  R+
Sbjct  342  KCLAAEPRHRPCMAEVVETLERIESIKDKPKQPRT  376



>ref|XP_009788446.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X2 [Nicotiana sylvestris]
Length=415

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SHVTTR++GT+GYAAPEY+ATGHLYVKSDVYGFGVVL+E+L
Sbjct  227  YNAKISDFGLAKLGPSASQSHVTTRVVGTHGYAAPEYVATGHLYVKSDVYGFGVVLVEML  286

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S++ NLVEW KP L ++RK+K  +D RLEGKYPSRAA +IA+L L C  
Sbjct  287  TGLRALDTNRPSHQHNLVEWIKPHLSDRRKLKDKMDSRLEGKYPSRAAVQIAQLALSCLG  346

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             EP  RPSM EV++ L+ I     R ++ R
Sbjct  347  PEPKTRPSMKEVVEKLEHIEAANERPKEPR  376



>ref|XP_010530963.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Tarenaya hassleriana]
Length=409

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 120/151 (79%), Gaps = 3/151 (2%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            ++AK+SDFGLAKLGP +  SHVTTR+MGTYGYAAPEY+ATGHLYVKSDV+GFGVVL EIL
Sbjct  229  YSAKISDFGLAKLGPSDSQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVFGFGVVLAEIL  288

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL  LD +R S + NL +W KP L ++RK+++I+DPRLEGKYP +AA R+A+L LKC  
Sbjct  289  TGLHALDTNRPSGQHNLSDWIKPYLADRRKLRSIMDPRLEGKYPLKAAFRVAQLALKCIG  348

Query  429  DEPGKRPSMDEVLKSLQEI---NDVKTRRRD  512
             EP +RP M EV+++L+ I   N+    RR+
Sbjct  349  PEPKQRPPMKEVVEALERIEAANEKPLERRN  379



>ref|XP_008393454.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Malus domestica]
Length=411

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAK+SDFGLAKLGPV G SHV+TRIMGTYGYAAPEY+ATGHLYV SDVYGFGVVLLEIL
Sbjct  232  FNAKISDFGLAKLGPVGGESHVSTRIMGTYGYAAPEYIATGHLYVNSDVYGFGVVLLEIL  291

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LDL R   +Q LVEW KP+L  KRK+KTI+D R+E +Y  +AA + A++  KC  
Sbjct  292  TGLRALDLKRPKEQQQLVEWAKPLLLNKRKLKTILDVRMESQYAFKAAMQTAQITEKCLA  351

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             +P  RPSM EV++ L++I  +K + +  +
Sbjct  352  PDPKSRPSMIEVVEQLEQIQAIKEQPKQSK  381



>ref|NP_001235086.1| protein kinase [Glycine max]
 gb|ACM89536.1| protein kinase [Glycine max]
 gb|KHN46866.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=412

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 120/159 (75%), Gaps = 6/159 (4%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SHVTTR+MGT+GYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  237  YNAKISDFGLAKLGPSASQSHVTTRVMGTHGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  296

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S +  L EW KP L ++RK+K I+D RLEGK+PS+AA RIA+L +KC  
Sbjct  297  TGLRALDSNRPSGQHKLTEWVKPYLHDRRKLKGIMDSRLEGKFPSKAAFRIAQLSMKCLA  356

Query  429  DEPGKRPSMDEVLKSLQEINDVKTR------RRDHRSNR  527
             EP  RPSM +VL++L+ I     +      R  H ++R
Sbjct  357  SEPKHRPSMKDVLENLERIQAANEKPVEPKFRSTHAASR  395



>ref|XP_008372852.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase NAK [Malus domestica]
Length=429

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAK+GP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  239  YTAKISDFGLAKMGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLIEIL  298

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R S +QNLV+W KP L +KRK+K I+DP+L+G+YPS+AA RI+ L LKC +
Sbjct  299  TGLRALDTHRPSGKQNLVDWIKPFLSDKRKLKGIMDPQLQGRYPSKAAFRISLLALKCIE  358

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*P  536
             E   RPSM +V++ L+ I       R+ R   + P
Sbjct  359  SEHRNRPSMKDVVEELERIESANELTREPRPRSTHP  394



>emb|CDP16537.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 118/149 (79%), Gaps = 1/149 (1%)
 Frame = +3

Query  63   QEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  242
            ++FNAKLSDFGLAK GPVNG SHVTT + GTYGYAAPEY+A+GHLYVKSDVYGFGVVLLE
Sbjct  222  EDFNAKLSDFGLAKFGPVNGKSHVTTEVAGTYGYAAPEYVASGHLYVKSDVYGFGVVLLE  281

Query  243  ILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKC  422
            I+TGL+V+D+ R +   NL++W KP LG K+ +  I+DPRLEG+YPS  A+++A L+ +C
Sbjct  282  IITGLRVVDVKRPAEMYNLIKWAKPFLG-KKDVSQIMDPRLEGQYPSWGASQMAALVAEC  340

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRR  509
               +P  RPSM+EVL  L+EI   + R R
Sbjct  341  LPPDPKSRPSMEEVLDKLEEIRTGEDRER  369



>ref|XP_004955142.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Setaria 
italica]
Length=462

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 120/161 (75%), Gaps = 8/161 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKH+ + +++         FNAKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEYMATG
Sbjct  248  EKHVIYRDFKASNILLDTHFNAKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYMATG  307

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLEILTG++ LD  R + + NLV+W KP L +++K+  +VDPRLEG
Sbjct  308  HLYVKSDVYGFGVVLLEILTGMRALDTDRPAAQHNLVDWAKPFLADRKKLARLVDPRLEG  367

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDV  494
            +Y SR A R A+L L+C   +   RPSM EV+  L+EI  +
Sbjct  368  QYSSRGAQRAAQLTLRCLAADHKNRPSMREVVAVLEEIESM  408



>ref|XP_011000883.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X2 [Populus euphratica]
Length=422

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 121/156 (78%), Gaps = 2/156 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AKLSDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  234  YTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  293

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD++R S  Q LV+W KP L +KRK+K+I+D  LEG+YPS+AA +IA+L L C +
Sbjct  294  TGLRALDINRPSGRQTLVDWIKPYLSDKRKLKSIMDSHLEGRYPSKAALQIAQLALNCLE  353

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRS--NRS  530
             E   RP M +V+++L+ I   K R+   R+  NRS
Sbjct  354  SEHKHRPHMKQVVETLERIEASKERQGQTRTRPNRS  389



>ref|XP_011000882.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
isoform X1 [Populus euphratica]
Length=423

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 121/156 (78%), Gaps = 2/156 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AKLSDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  235  YTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  294

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD++R S  Q LV+W KP L +KRK+K+I+D  LEG+YPS+AA +IA+L L C +
Sbjct  295  TGLRALDINRPSGRQTLVDWIKPYLSDKRKLKSIMDSHLEGRYPSKAALQIAQLALNCLE  354

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRS--NRS  530
             E   RP M +V+++L+ I   K R+   R+  NRS
Sbjct  355  SEHKHRPHMKQVVETLERIEASKERQGQTRTRPNRS  390



>gb|EMT24247.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Aegilops tauschii]
Length=412

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP   NSH+TTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVV+LE+L
Sbjct  218  YNAKLSDFGLAKLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEML  277

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD +R + +Q+LV+W KP L ++RK+  ++DP+ EG+Y S+ + + A+L L C  
Sbjct  278  SGKRALDPNRPNGQQSLVDWAKPYLADRRKLARLMDPQFEGQYNSKQSHQAAQLTLNCLA  337

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSR  542
             EP  RPSM EVL++L++I  +K+R R+ R      SR
Sbjct  338  GEPRSRPSMKEVLETLEQIEALKSRTREARGGSGTSSR  375



>ref|XP_006364355.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Solanum tuberosum]
Length=418

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ TGHLYVKSDVYGFGVVL+E+L
Sbjct  230  YNAKISDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVQTGHLYVKSDVYGFGVVLVEML  289

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            T L+ LD +R SN+ NLVEW KP L ++RK+K  +D RLEG+YPSRAA +IA+L L C  
Sbjct  290  TALRALDTNRPSNQHNLVEWIKPHLSDRRKLKDKMDSRLEGRYPSRAAVQIAQLALSCLG  349

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             EP  RP M EV++ L++I     R ++ R
Sbjct  350  PEPKTRPGMKEVVEKLEQIEAANERPKEPR  379



>ref|NP_001045693.1| Os02g0118200 [Oryza sativa Japonica Group]
 dbj|BAD07615.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF07607.1| Os02g0118200 [Oryza sativa Japonica Group]
 gb|EAY84215.1| hypothetical protein OsI_05597 [Oryza sativa Indica Group]
 gb|EAZ21510.1| hypothetical protein OsJ_05134 [Oryza sativa Japonica Group]
Length=427

 Score =   202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP   NSH+TTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVV+LE++
Sbjct  239  YNAKLSDFGLAKLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEMM  298

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD +R + + +LV+W KP L ++RK+  ++DPR EG+Y S+ A + A+L L C  
Sbjct  299  SGQRALDPNRPNGQLSLVDWAKPYLADRRKLARLMDPRFEGQYNSKQAVQAAQLTLNCLA  358

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             EP  RPSM EVL++L+ I  +K+R RD R + S
Sbjct  359  GEPRSRPSMKEVLETLERIESMKSRARDARGSGS  392



>ref|XP_006422428.1| hypothetical protein CICLE_v10028539mg [Citrus clementina]
 gb|ESR35668.1| hypothetical protein CICLE_v10028539mg [Citrus clementina]
Length=400

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  212  YTAKISDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  271

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NLV+W KP L EKRK + I+D RL+G+YP +AA +IA+L LKC +
Sbjct  272  TGLRALDTNRPSGQHNLVDWIKPYLSEKRKFRHIIDARLQGQYPYKAAYQIAQLSLKCLE  331

Query  429  DEPGKRPSMDEVLKSLQEIN  488
             EP  RPSM EV+++L+ + 
Sbjct  332  AEPKHRPSMREVVETLERLQ  351



>gb|AFW59201.1| putative protein kinase superfamily protein [Zea mays]
Length=564

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  271  YNAKLSDFGLAKNGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  330

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R + + NLVEW KP L ++RK+  +VDPRLEG+YPS+AA + A+L L+C +
Sbjct  331  TGLRALDTARPAQQHNLVEWAKPYLADRRKLPRLVDPRLEGQYPSKAALQAAQLTLRCLE  390

Query  429  DEPGKRPSMDEVLKSLQEINDVK  497
             +P  RPSM EV+ +++ +  ++
Sbjct  391  GDPRSRPSMAEVVLAIEAMEQLR  413



>gb|EMS52039.1| putative serine/threonine-protein kinase Cx32, chloroplastic 
[Triticum urartu]
Length=416

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
             FN KLSDFGLAK GP +G SHVTTR+MGTYGYAAPEY++TGHLYVKSDVYGFGVVLLE+
Sbjct  238  HFNPKLSDFGLAKHGPDDGESHVTTRVMGTYGYAAPEYVSTGHLYVKSDVYGFGVVLLEM  297

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            L GL+ LD SR S + NLV W KP+L ++R++  ++D RLEG+Y +R A R A+L LKC 
Sbjct  298  LCGLRALDPSRPSEKLNLVNWAKPLLSDRRRLTQLMDSRLEGQYHARGAFRAAQLTLKCL  357

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PS  539
              EP  RPSM EV+++L++I  +K++ +   + R  PS
Sbjct  358  AGEPKSRPSMKEVVEALEQIEAMKSKSKSREARRDSPS  395



>ref|XP_002451394.1| hypothetical protein SORBIDRAFT_04g001360 [Sorghum bicolor]
 gb|EES04370.1| hypothetical protein SORBIDRAFT_04g001360 [Sorghum bicolor]
Length=436

 Score =   202 bits (514),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP   NSH+TTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVV+LE+L
Sbjct  240  YNAKLSDFGLAKLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEML  299

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD +R S + +L +W KP L ++RK+  ++DPR EG+Y S+ A + A+L L C  
Sbjct  300  SGQRALDPNRPSGQLSLADWAKPYLADRRKLARLMDPRFEGQYNSKQAFQAAQLTLNCLA  359

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSR  542
             EP  RPSM EV+++L+ I  +K+R RD R   S  +R
Sbjct  360  GEPRSRPSMKEVVETLEHIESMKSRARDARGGGSGSTR  397



>ref|XP_010066335.1| PREDICTED: probable serine/threonine-protein kinase NAK [Eucalyptus 
grandis]
 gb|KCW64210.1| hypothetical protein EUGRSUZ_G01860 [Eucalyptus grandis]
Length=414

 Score =   201 bits (512),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL E+L
Sbjct  226  YNAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLAEML  285

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TG + LDL+R S + NLV+W KP L ++RK+KT++D  LEGKYPS+   ++A+L L+C  
Sbjct  286  TGQRALDLNRPSGKHNLVDWVKPYLADRRKLKTLMDSNLEGKYPSKTVFQVAQLALRCLA  345

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*P  536
             EP  RPSM EV+++L+ +     R  + R+  S P
Sbjct  346  PEPKCRPSMKEVVETLERLEASSERANEPRARSSHP  381



>gb|AFW63337.1| putative protein kinase superfamily protein [Zea mays]
Length=462

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 122/164 (74%), Gaps = 8/164 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKH+ + +++         FNAKLSD GLAK GP  G+SHVTTR+MGTYGYAAPEY+ATG
Sbjct  253  EKHVIYRDFKASNILLDTHFNAKLSDLGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATG  312

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLE+LTGL+ LD  R + + +LV+W KP L ++RK+  ++DPRLEG
Sbjct  313  HLYVKSDVYGFGVVLLEVLTGLRALDTDRPTAQHSLVDWAKPYLADRRKLARLMDPRLEG  372

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDVKTR  503
            +YPSR A R A+L L+C   +   RPSM EV+  L+EI  + +R
Sbjct  373  QYPSRGAQRAAQLTLRCLAADHKNRPSMREVVAVLEEIESMSSR  416



>ref|NP_001148215.1| protein kinase APK1B [Zea mays]
 gb|ACG30206.1| protein kinase APK1B [Zea mays]
Length=466

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 122/164 (74%), Gaps = 8/164 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKH+ + +++         FNAKLSD GLAK GP  G+SHVTTR+MGTYGYAAPEY+ATG
Sbjct  251  EKHVIYRDFKASNILLDTHFNAKLSDLGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATG  310

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLE+LTGL+ LD  R + + +LV+W KP L ++RK+  ++DPRLEG
Sbjct  311  HLYVKSDVYGFGVVLLEVLTGLRALDTDRPTAQHSLVDWAKPYLADRRKLARLMDPRLEG  370

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDVKTR  503
            +YPSR A R A+L L+C   +   RPSM EV+  L+EI  + +R
Sbjct  371  QYPSRGAQRAAQLTLRCLAADHKNRPSMREVVAVLEEIESMSSR  414



>ref|XP_006422427.1| hypothetical protein CICLE_v10028539mg [Citrus clementina]
 ref|XP_006486596.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Citrus sinensis]
 gb|ESR35667.1| hypothetical protein CICLE_v10028539mg [Citrus clementina]
 gb|KDO68338.1| hypothetical protein CISIN_1g015094mg [Citrus sinensis]
Length=413

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  225  YTAKISDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  284

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + NLV+W KP L EKRK + I+D RL+G+YP +AA +IA+L LKC +
Sbjct  285  TGLRALDTNRPSGQHNLVDWIKPYLSEKRKFRHIIDARLQGQYPYKAAYQIAQLSLKCLE  344

Query  429  DEPGKRPSMDEVLKSLQEIN  488
             EP  RPSM EV+++L+ + 
Sbjct  345  AEPKHRPSMREVVETLERLQ  364



>gb|KFK40106.1| hypothetical protein AALP_AA3G331300 [Arabis alpina]
Length=412

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 117/154 (76%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SH+TTR+MGT GYAAPEY+ATGHLYVKSDVYGFGVVL EIL
Sbjct  230  YNAKISDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLAEIL  289

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL  LD +R S + NL EW KP L E+RK+++I+DPRLEGKYP ++  R+A L LKC  
Sbjct  290  TGLHALDPNRPSGQHNLTEWIKPHLFERRKLRSIIDPRLEGKYPFKSVFRVAHLALKCLG  349

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             EP  RPSM EV+++L+ I     +  + R+ R+
Sbjct  350  PEPKDRPSMKEVVEALELIEAANEKPLERRTTRT  383



>gb|KFK40107.1| hypothetical protein AALP_AA3G331300 [Arabis alpina]
Length=411

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 117/154 (76%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SH+TTR+MGT GYAAPEY+ATGHLYVKSDVYGFGVVL EIL
Sbjct  229  YNAKISDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLAEIL  288

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL  LD +R S + NL EW KP L E+RK+++I+DPRLEGKYP ++  R+A L LKC  
Sbjct  289  TGLHALDPNRPSGQHNLTEWIKPHLFERRKLRSIIDPRLEGKYPFKSVFRVAHLALKCLG  348

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             EP  RPSM EV+++L+ I     +  + R+ R+
Sbjct  349  PEPKDRPSMKEVVEALELIEAANEKPLERRTTRT  382



>gb|KCW70320.1| hypothetical protein EUGRSUZ_F035642, partial [Eucalyptus grandis]
Length=381

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  84   SDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEILTGLKV  263
            +D GLAKLG   GNSHVTTR++GTYGYAAPEY+ATGHLYVKSD+YGFGVVLLE+LTGL+ 
Sbjct  215  TDIGLAKLGLAGGNSHVTTRVIGTYGYAAPEYIATGHLYVKSDLYGFGVVLLEMLTGLQA  274

Query  264  LDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQDEPGK  443
            LD +R S +QNLVEW +P L +KRK++ I+D RLE +YP +AAT+ AELILKC + +P  
Sbjct  275  LDNTRPSGQQNLVEWARPSLRDKRKLRKIMDSRLERRYPLKAATQAAELILKCLEGDPNV  334

Query  444  RPSMDEVLKSLQEINDVKTRRRDHRSNRS*PS  539
            RPS DEVLK+L++IN ++ +++  +     P+
Sbjct  335  RPSTDEVLKTLEQINTIRVKKKGDQGEHIEPA  366



>ref|XP_006376784.1| hypothetical protein POPTR_0012s06370g [Populus trichocarpa]
 gb|ERP54581.1| hypothetical protein POPTR_0012s06370g [Populus trichocarpa]
Length=431

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  241  YNAKISDFGLAKLGPSGGESHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEML  300

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIK-TIVDPRLEGKYPSRAATRIAELILKCF  425
            +G + LD  R + +QNL+EW KP+L +K+K+K TI+D R+EG+Y S+A  + A+L LKC 
Sbjct  301  SGRRALDTKRPTGQQNLIEWLKPLLSQKKKLKTTIMDARIEGQYSSKAMVQAAQLTLKCL  360

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
            + +P  RPSM EVL+ L++I  +K + +  +S
Sbjct  361  EADPKNRPSMKEVLEVLEQIEAMKEKPKATKS  392



>ref|XP_006590748.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X3 [Glycine max]
 gb|KHN41824.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=382

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  63   QEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  242
            +++NAK+SDFGLAKLGP  G+SHV+TRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE
Sbjct  218  EDYNAKISDFGLAKLGPSGGDSHVSTRIMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLE  277

Query  243  ILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKC  422
            +LTG++ +D +R   +QNLVEW KP L +K K K+I+D R+EG+Y ++AA +  +L LKC
Sbjct  278  MLTGMRAIDRNRPIEQQNLVEWAKPSLSDKSKFKSIMDERIEGQYSTKAALKATQLTLKC  337

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             + +  KRP M +VL++L+ I  +K  R++ +
Sbjct  338  LERDLKKRPHMKDVLETLECIKAIKVTRKEGK  369



>ref|XP_003523529.1| PREDICTED: protein kinase APK1B, chloroplastic-like isoform X1 
[Glycine max]
 gb|KHN33798.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=370

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            +FNAKLSDFGLAK GPVNG SHVTTRIMGTYGYAAPEYMATGHLY+KSDVYGFGVVLLE+
Sbjct  215  DFNAKLSDFGLAKFGPVNGKSHVTTRIMGTYGYAAPEYMATGHLYIKSDVYGFGVVLLEM  274

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG   LD ++ +  QNLVE T   L  K+++K ++DP +E +Y  RAA +IA+LILKC 
Sbjct  275  LTGRAALDTNQPTGMQNLVECTMSSLHAKKRLKEVMDPNMEEQYSLRAAFQIAQLILKCL  334

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTR  503
            + +P KRPSM+EVL++L+++  +K +
Sbjct  335  ESKPKKRPSMEEVLETLEKVEAIKYK  360



>ref|XP_006590747.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X2 [Glycine max]
Length=392

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  63   QEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  242
            +++NAK+SDFGLAKLGP  G+SHV+TRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE
Sbjct  228  EDYNAKISDFGLAKLGPSGGDSHVSTRIMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLE  287

Query  243  ILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKC  422
            +LTG++ +D +R   +QNLVEW KP L +K K K+I+D R+EG+Y ++AA +  +L LKC
Sbjct  288  MLTGMRAIDRNRPIEQQNLVEWAKPSLSDKSKFKSIMDERIEGQYSTKAALKATQLTLKC  347

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             + +  KRP M +VL++L+ I  +K  R++ +
Sbjct  348  LERDLKKRPHMKDVLETLECIKAIKVTRKEGK  379



>gb|EYU38037.1| hypothetical protein MIMGU_mgv1a007214mg [Erythranthe guttata]
Length=415

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            ++AK+SDFGLAK+GP    SHVTT+++GTYGYAAPEY+ATGHLYVKSDVYGFGVVL+E+L
Sbjct  227  YHAKISDFGLAKMGPTASRSHVTTQVIGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEML  286

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S + +LV+W KP L E+RK+K I+D RLEG+YPS++A  IA+L L C +
Sbjct  287  TGLRALDTNRPSGQHSLVDWIKPHLCERRKLKNIMDSRLEGRYPSKSALHIAQLALTCLE  346

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRR  509
             EP  RPSM E++++L+ I  V  R R
Sbjct  347  SEPKNRPSMQEIVEALERIESVSERPR  373



>ref|XP_010266182.1| PREDICTED: probable serine/threonine-protein kinase NAK [Nelumbo 
nucifera]
Length=425

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 121/155 (78%), Gaps = 1/155 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  226  YNAKISDFGLAKNGPSAGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  285

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TG + LD SR S + NLV+W KP L ++RK+K I+DPRLEG+Y  +A  + A+L LKC  
Sbjct  286  TGQRALDTSRPSGQTNLVDWLKPSLPDRRKVKNIMDPRLEGQYSMKAVQQAAQLTLKCLG  345

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRR-RDHRSNRS  530
             +P  RPSM EV+++L+ I  +K  + +  + NRS
Sbjct  346  SDPKSRPSMKEVVEALERIEAIKDNKPKQSKINRS  380



>ref|XP_006340004.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Solanum tuberosum]
Length=415

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 124/169 (73%), Gaps = 12/169 (7%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            ++AKLSDFGLAK+GP  GNSHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  232  YHAKLSDFGLAKVGPSAGNSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLELL  291

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R   + NLV+W KP+L  KRK+K+I+D R+EG+Y S+AAT  A+L +KC +
Sbjct  292  TGLRALDTKRPGGQHNLVDWMKPMLSNKRKLKSIMDARMEGQYSSKAATLTAQLTMKCLE  351

Query  429  DEPGKRPSMDEV---------LKSLQEINDVKTRRRDHR---SNRS*PS  539
             EP KRPSM EV         +K   + +  KT    HR   S RS PS
Sbjct  352  GEPKKRPSMKEVVEVLEQVESIKEKPKASKSKTESSSHRYKQSPRSYPS  400



>ref|XP_011040800.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Populus euphratica]
Length=424

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 121/165 (73%), Gaps = 3/165 (2%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AKLSDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  235  YTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  294

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S    LV+W KP L +KRK+K+I+D RLEG+YP++AA RIA+L L C +
Sbjct  295  TGLRALDTNRPSGRHTLVDWIKPYLSDKRKLKSIMDSRLEGRYPAKAALRIAQLALNCLE  354

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADYSTI  563
             E   RP M EV+ +L+ I   K +  + R+    P RS  +  +
Sbjct  355  SEHRHRPHMKEVVATLERIEAAKDKPVEPRAR---PKRSMPHQNV  396



>ref|XP_006384848.1| kinase family protein [Populus trichocarpa]
 gb|ERP62645.1| kinase family protein [Populus trichocarpa]
Length=424

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 121/165 (73%), Gaps = 3/165 (2%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AKLSDFGLAKLGP    SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVL+EIL
Sbjct  235  YTAKLSDFGLAKLGPSASQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLVEIL  294

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R S    LV+W KP L +KRK+K+I+D RLEG+YP++AA RIA+L L C +
Sbjct  295  TGLRALDANRPSGRHTLVDWIKPFLSDKRKLKSIMDIRLEGRYPAKAALRIAQLALNCLE  354

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADYSTI  563
             E   RP M EV+ +L+ I   K +  + R+    P RS  +  +
Sbjct  355  QEHRHRPHMREVVATLERIEAAKDKPVEPRAR---PKRSVPHQNV  396



>ref|XP_003538909.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X1 [Glycine max]
Length=391

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  63   QEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  242
            +++NAK+SDFGLAKLGP  G+SHV+TRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE
Sbjct  227  EDYNAKISDFGLAKLGPSGGDSHVSTRIMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLE  286

Query  243  ILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKC  422
            +LTG++ +D +R   +QNLVEW KP L +K K K+I+D R+EG+Y ++AA +  +L LKC
Sbjct  287  MLTGMRAIDRNRPIEQQNLVEWAKPSLSDKSKFKSIMDERIEGQYSTKAALKATQLTLKC  346

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             + +  KRP M +VL++L+ I  +K  R++ +
Sbjct  347  LERDLKKRPHMKDVLETLECIKAIKVTRKEGK  378



>ref|XP_002280326.3| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Vitis vinifera]
Length=426

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            E+NAK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGF VVLLE+
Sbjct  243  EYNAKISDFGLAKLGPSGGESHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFRVVLLEM  302

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL+ LD  R + +Q+LV+WT+P L  KRK+K I+D R+EG+Y  +AA   A+L LKC 
Sbjct  303  LTGLRALDTKRPNGQQSLVDWTRPSLSSKRKLKNIMDARVEGQYSPKAAFEAAQLTLKCL  362

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
              +P  RPSM EV++ L++I  +  + ++ R+  S
Sbjct  363  GSDPKSRPSMKEVVEVLEKIEAMSGKPKESRTKHS  397



>ref|XP_008367929.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Malus domestica]
Length=401

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 118/154 (77%), Gaps = 1/154 (1%)
 Frame = +3

Query  57   NWQEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVL  236
            +W  FN+K+SDFGLAKLGP    SHVTTRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVL
Sbjct  230  DW-SFNSKISDFGLAKLGPAGAESHVTTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVL  288

Query  237  LEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELIL  416
            LEILTGL+ LD+ R   +Q L EW KP+L  KRK+K I+D R+EG+Y  +AA ++A +  
Sbjct  289  LEILTGLRALDMQRPREQQQLAEWAKPLLLHKRKLKNILDVRMEGQYAFKAAMQVALIAH  348

Query  417  KCFQDEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
            KC + +P  RPSM EV++ L++I  +K + +  +
Sbjct  349  KCLEPDPKSRPSMKEVVEQLEQIQAIKEQPKQSK  382



>gb|EPS65362.1| hypothetical protein M569_09414, partial [Genlisea aurea]
Length=238

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AK+SDFGLAK+GP  G+SHVTTR+MGTYGYAAPEY++TGHLYVKSDVYGFGVVLLE+L
Sbjct  97   YTAKISDFGLAKMGPAGGDSHVTTRVMGTYGYAAPEYVSTGHLYVKSDVYGFGVVLLELL  156

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R S +QNLVE++KP+L  +RK+++IVD R+EG+Y SRA +    L+ +C +
Sbjct  157  TGLRALDPKRPSGKQNLVEYSKPLLARRRKLRSIVDARIEGQYSSRALSEAGRLVWRCLE  216

Query  429  DEPGKRPSMDEVLKSLQEI  485
            ++P +RP M EV++ L+ I
Sbjct  217  EDPRRRPPMKEVVECLERI  235



>ref|XP_010103259.1| putative serine/threonine-protein kinase Cx32 [Morus notabilis]
 gb|EXB95130.1| putative serine/threonine-protein kinase Cx32 [Morus notabilis]
Length=348

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  G+SHVTTRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVV+LE+L
Sbjct  186  YNAKISDFGLAKLGPSGGDSHVTTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVMLEML  245

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R S +QNLV+W KP L  KRK+ TI+D R+EG+Y  +AA + A+L  KC +
Sbjct  246  TGLRALDTKRPSGQQNLVDWAKPCLSSKRKLSTIMDVRMEGQYSPKAALQAAQLAFKCLE  305

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSN  524
             EP  RPSM +V+ +L+ I  +K + + ++++
Sbjct  306  QEPKNRPSMKDVVDALERIEAIKEKPKHYKTS  337



>dbj|BAJ91759.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=403

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP   NSH+TTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVV+LE+L
Sbjct  209  YNAKLSDFGLAKLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEML  268

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD +R + +Q+L +W KP L ++RK+  ++DP+ EG+Y S+ + + A+L L C  
Sbjct  269  SGKRALDPNRPNGQQSLADWAKPYLADRRKLARLMDPQFEGQYNSKQSYQAAQLTLNCLA  328

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSR  542
             EP  RPSM EVL++L++I  +K+R R+ R      SR
Sbjct  329  GEPRSRPSMKEVLETLEQIEALKSRTREARGGSGTSSR  366



>ref|XP_009764652.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Nicotiana sylvestris]
Length=391

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 125/150 (83%), Gaps = 3/150 (2%)
 Frame = +3

Query  63   QEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  242
            +++NAKLSDFGLAKLGP+NGNSHV+TR++GTYGYAAPEY+A+GHLYV SDVYGFGVVLLE
Sbjct  226  EDYNAKLSDFGLAKLGPINGNSHVSTRVVGTYGYAAPEYVASGHLYVNSDVYGFGVVLLE  285

Query  243  ILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKC  422
            I+TGL+VLDL+R + + +LV+W KP+L +KRK + ++D +++G+YP  AA +IA+LIL+C
Sbjct  286  IITGLRVLDLTRPTGQLDLVDWAKPLLPDKRKPRKMMDSKIQGRYPINAAFQIAQLILQC  345

Query  423  FQDEPGKRPSMDEVL---KSLQEINDVKTR  503
               +P  RPSM +VL   +++Q   D ++R
Sbjct  346  LDSDPKNRPSMGQVLECFRTMQCHQDEQSR  375



>ref|XP_011016043.1| PREDICTED: probable serine/threonine-protein kinase NAK [Populus 
euphratica]
Length=477

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 124/162 (77%), Gaps = 8/162 (5%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGPVNG+SHVTTRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  281  YNAKLSDFGLAKLGPVNGDSHVTTRIMGTYGYAAPEYLATGHLYVKSDVYGFGVVLLELL  340

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLE--------GKYPSRAATRIA  404
            TGL+ LD +R S + NLVE+ KP L E+RK+K I+DP LE         +YP +AA + A
Sbjct  341  TGLRALDTNRPSAQHNLVEYAKPFLSERRKLKKIMDPGLEERNXXXXXERYPLKAAMQAA  400

Query  405  ELILKCFQDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
            ELIL+C + +   RPSM EV + L +I DVK +    +S+ S
Sbjct  401  ELILRCLESDLKIRPSMAEVSEILIKIKDVKEKPNKSKSSCS  442



>ref|XP_004234513.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Solanum lycopersicum]
Length=418

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP   NSHVTTR+MGTYGYAAPEY+ TGHLYVKSDVYGFGVV+LE+L
Sbjct  234  YNAKISDFGLAKLGPSGSNSHVTTRVMGTYGYAAPEYVETGHLYVKSDVYGFGVVVLELL  293

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R + ++ LV+W KP+L  KRK+K+I+D R+EG+Y S+AAT  A++ LKC +
Sbjct  294  TGLRALDTKRPNRQEKLVDWVKPMLSNKRKLKSIMDARMEGQYSSKAATLAAQITLKCLE  353

Query  429  DEPGKRPSMDEVLKSLQEINDVK  497
             +P  RPSM EV+  L++I  +K
Sbjct  354  VDPKNRPSMKEVMNVLEQIEAMK  376



>ref|XP_004154762.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Cucumis sativus]
Length=339

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AKLSDFGLAKLGP    SH+TTR+MGT+GYAAPEY+ TGHLYVKSDVYGFGVVL+E+L
Sbjct  151  YTAKLSDFGLAKLGPSESKSHLTTRVMGTHGYAAPEYVTTGHLYVKSDVYGFGVVLIEML  210

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R + +++L EW KP L E+RK+K ++D RLEGKYPSR+A ++A+L L+C +
Sbjct  211  TGLRALDENRPTGQEHLTEWIKPFLSERRKLKNVMDFRLEGKYPSRSAFQVAQLALQCIE  270

Query  429  DEPGKRPSMDEVLKSLQEINDVKTR  503
             E   RPSM EV+++L++I  V  +
Sbjct  271  QEQKNRPSMKEVVETLEQIETVNEK  295



>ref|XP_007046513.1| Kinase superfamily protein, 32 [Theobroma cacao]
 gb|EOX90670.1| Kinase superfamily protein, 32 [Theobroma cacao]
Length=478

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE++
Sbjct  296  YNAKISDFGLAKLGPAGGESHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLELM  355

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R S +QNLV+W +P L  K+K+KTI+D R+EG+Y S+AA   A+L LKC +
Sbjct  356  TGLRALDTKRLSGQQNLVDWLRPTLSLKKKVKTIMDVRIEGQYSSKAAILSADLTLKCLE  415

Query  429  DEPGKRPSMDEVLKSLQEINDV  494
             +P  RPSM EV ++L+ I  +
Sbjct  416  HDPKNRPSMKEVGEALERIESL  437



>gb|EMT33274.1| Protein kinase APK1A, chloroplastic [Aegilops tauschii]
Length=396

 Score =   199 bits (505),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 119/159 (75%), Gaps = 8/159 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKH+ + +++         +NAKLSDFGLA+ GP  G+SH+TTR+MGTYGYAAPEY+ATG
Sbjct  238  EKHVIYRDFKASNILLDTNYNAKLSDFGLARNGPTGGDSHITTRVMGTYGYAAPEYVATG  297

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLE+LTGL+ LD +R + + NLV+W KP L ++RK+  +VDPRLEG
Sbjct  298  HLYVKSDVYGFGVVLLEMLTGLRALDTARPAQQLNLVDWAKPYLADRRKLPRLVDPRLEG  357

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEIN  488
            +YPS+AA R A+L L C   EP  RPSM E++      N
Sbjct  358  QYPSKAALRAAQLTLSCLAGEPRNRPSMAELILDFDVYN  396



>dbj|BAD28317.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD28151.1| putative protein kinase [Oryza sativa Japonica Group]
Length=454

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 8/161 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKH+ + +++        +F+AKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATG
Sbjct  241  EKHVIYRDFKASNILLDTQFHAKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATG  300

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLE+LTGL+ LD  R S + +LV+W KP L ++RK+  ++DPRLEG
Sbjct  301  HLYVKSDVYGFGVVLLELLTGLRALDAGRPSGQHHLVDWAKPFLSDRRKLARLMDPRLEG  360

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDV  494
            +Y SR A R A+L L+C   +   RPSM EV+  L+EI  +
Sbjct  361  QYSSRGAQRAAQLTLRCLAADHKNRPSMREVVAVLEEIESM  401



>ref|XP_011013448.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Populus euphratica]
Length=435

 Score =   199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  241  YNAKISDFGLAKLGPSGGESHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEML  300

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIK-TIVDPRLEGKYPSRAATRIAELILKCF  425
            +G + LD  R + +QNL+EW KP+L +K+K+K T++D R+EG+Y S+A  + A+L LKC 
Sbjct  301  SGQRALDTKRPAGQQNLIEWLKPLLSQKKKLKNTVMDARIEGQYSSKAMLQAAQLTLKCL  360

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
            + +P  RPSM EV++ L++I  +K + +  +S
Sbjct  361  EADPKNRPSMKEVVEVLEQIEAMKEKPKATKS  392



>ref|XP_008781318.1| PREDICTED: probable serine/threonine-protein kinase NAK [Phoenix 
dactylifera]
Length=384

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +N K++DFGLAK GP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  234  YNPKIADFGLAKHGPSCGESHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEML  293

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G +  D SR S + NLV+W  P L ++R++  ++DPRLEG+YPS+ A + A+L LKC  
Sbjct  294  SGQRAYDRSRPSKQHNLVDWGTPYLADRRRLARLMDPRLEGRYPSKGAFQAAQLTLKCLA  353

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRD  512
             +P  RPSM EVL++L++I  +K R R+
Sbjct  354  GDPKSRPSMKEVLETLEQIEAMKGRSRE  381



>ref|NP_001047694.1| Os02g0670100 [Oryza sativa Japonica Group]
 dbj|BAF09608.1| Os02g0670100 [Oryza sativa Japonica Group]
Length=458

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 8/161 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKH+ + +++        +F+AKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATG
Sbjct  245  EKHVIYRDFKASNILLDTQFHAKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATG  304

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLE+LTGL+ LD  R S + +LV+W KP L ++RK+  ++DPRLEG
Sbjct  305  HLYVKSDVYGFGVVLLELLTGLRALDAGRPSGQHHLVDWAKPFLSDRRKLARLMDPRLEG  364

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDV  494
            +Y SR A R A+L L+C   +   RPSM EV+  L+EI  +
Sbjct  365  QYSSRGAQRAAQLTLRCLAADHKNRPSMREVVAVLEEIESM  405



>gb|KDP43763.1| hypothetical protein JCGZ_22390 [Jatropha curcas]
Length=412

 Score =   199 bits (506),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  G+SHVTTRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  235  YNAKISDFGLAKLGPSGGDSHVTTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLELL  294

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TG + LD  R + +QNLVEW KPIL  K+K+K  +D R+EG+Y S+A  + A+L L C +
Sbjct  295  TGSRALDTRRPNGQQNLVEWLKPILPYKKKLKAKMDVRIEGQYSSKAMLQAAQLTLNCLE  354

Query  429  DEPGKRPSMDEVLKSLQEINDVKTR  503
             +P  RPSM EV+ +L++I+ +K +
Sbjct  355  PDPKSRPSMREVVDALEQIDAIKEK  379



>gb|EAY87019.1| hypothetical protein OsI_08416 [Oryza sativa Indica Group]
Length=460

 Score =   200 bits (509),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 8/161 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKH+ + +++        +F+AKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATG
Sbjct  245  EKHVIYRDFKASNILLDTQFHAKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATG  304

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLE+LTGL+ LD  R S + +LV+W KP L ++RK+  ++DPRLEG
Sbjct  305  HLYVKSDVYGFGVVLLELLTGLRALDAGRPSGQHHLVDWAKPFLSDRRKLARLMDPRLEG  364

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDV  494
            +Y SR A R A+L L+C   +   RPSM EV+  L+EI  +
Sbjct  365  QYSSRGAQRAAQLTLRCLAADHKNRPSMREVVAVLEEIESM  405



>ref|XP_006646791.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Oryza brachyantha]
Length=428

 Score =   199 bits (506),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 123/164 (75%), Gaps = 0/164 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLA+LGP   NSH+TTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVV+LE+L
Sbjct  240  YNAKLSDFGLARLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEML  299

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD +R + + +LV+W KP L ++RK+  ++D R EG+Y S+ A + A+L L C  
Sbjct  300  SGQRALDPNRPNGQLSLVDWAKPYLADRRKLARLMDARFEGQYNSKQALQAAQLTLNCLA  359

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADYST  560
             EP  RPSM EVL+ L++I  +K+R RD R + S   RS   +T
Sbjct  360  GEPRSRPSMKEVLEKLEQIESMKSRARDTRGSGSSRDRSHGRTT  403



>ref|XP_010040702.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Eucalyptus grandis]
Length=495

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 126/157 (80%), Gaps = 2/157 (1%)
 Frame = +3

Query  84   SDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEILTGLKV  263
            SD GLAKLGP + NSHVTTR+MGT+GYAAPEY+ATG LYVKSDVYG GVVLLE+LTG +V
Sbjct  334  SDLGLAKLGPADRNSHVTTRVMGTFGYAAPEYIATGRLYVKSDVYGVGVVLLEMLTGSRV  393

Query  264  LDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQDEPGK  443
            +D SR S +QNLV+W +P+L +KRK++ I+DPRL+G+YP +AAT+ A+LILKC + +P  
Sbjct  394  IDCSRPSGQQNLVDWARPLLHDKRKLRKIMDPRLKGQYPLKAATQAAKLILKCLEVDPKV  453

Query  444  RPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADY  554
            RPSM+EVL +L+ IN +  + ++ R + S  SR + Y
Sbjct  454  RPSMEEVLATLENINTIWEKNQETREDAS--SRPSSY  488


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 4/53 (8%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGF  224
            ++NAKLSDFGLAK GP +GNS+VTTR++   GYAA EY A      K+++  F
Sbjct  256  DYNAKLSDFGLAKQGPASGNSYVTTRVIEMDGYAASEYSAVS----KTEILSF  304



>ref|XP_010489344.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
 ref|XP_010489345.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Camelina sativa]
Length=417

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SH+TTR+MGT GYAAPEY+ATGHLYVKSDVYGFGVVL EIL
Sbjct  233  YNAKISDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLAEIL  292

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            T L  LD +R + + NL EW KP L E+RK+++I+DPRLEG+YP ++A R+A+L LKC  
Sbjct  293  TSLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGRYPFKSAFRVAQLALKCLG  352

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
             EP  RPSM EV++SL+ I     +  + R+
Sbjct  353  PEPKDRPSMKEVVESLELIEAANEKPLERRT  383



>ref|XP_010489347.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Camelina sativa]
Length=416

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP    SH+TTR+MGT GYAAPEY+ATGHLYVKSDVYGFGVVL EIL
Sbjct  232  YNAKISDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLAEIL  291

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            T L  LD +R + + NL EW KP L E+RK+++I+DPRLEG+YP ++A R+A+L LKC  
Sbjct  292  TSLHALDPTRPTGQHNLTEWIKPHLSERRKLRSIMDPRLEGRYPFKSAFRVAQLALKCLG  351

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
             EP  RPSM EV++SL+ I     +  + R+
Sbjct  352  PEPKDRPSMKEVVESLELIEAANEKPLERRT  382



>ref|XP_008812270.1| PREDICTED: probable serine/threonine-protein kinase NAK [Phoenix 
dactylifera]
Length=424

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +  KLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  232  YTPKLSDFGLAKHGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  291

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD +R + + NLV+W KP L ++RK+  ++DPRLEG+Y S+ A + A+L LKC  
Sbjct  292  SGQRALDNNRPTGQHNLVDWGKPYLADRRKLSRLIDPRLEGQYHSKGALQAAQLTLKCLA  351

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             +P  RPSM EV+++L++I  +K+R R+ +
Sbjct  352  GDPKSRPSMKEVVETLEQIEAMKSRSRESK  381



>ref|XP_008447840.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Cucumis melo]
 ref|XP_008447841.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Cucumis melo]
 ref|XP_008447842.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Cucumis melo]
 ref|XP_008447843.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Cucumis melo]
Length=414

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AKLSDFGLAKLGP    SH+TTR+MGT+GYAAPEY+ TGHLYVKSDVYGFGVVL+E+L
Sbjct  225  YTAKLSDFGLAKLGPSESKSHLTTRVMGTHGYAAPEYVTTGHLYVKSDVYGFGVVLIEML  284

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R + ++NL++W KP L E+RK+K ++D RLEGKYPSR+A ++A+L L+C +
Sbjct  285  TGLRALDENRPTGQENLMDWIKPFLSERRKLKNVMDFRLEGKYPSRSAFQVAQLALQCIE  344

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             E   RPSM EV+++L++I  V  +  +   NR+
Sbjct  345  QEQKNRPSMKEVVETLEQIETVNEKLIETGRNRA  378



>ref|XP_009395361.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGV+LLE+L
Sbjct  233  YNAKLSDFGLAKHGPSGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVMLLEML  292

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD +R S + NL+++ +P+L ++RK+  ++D RLEG+Y S+ A ++A+L LKC  
Sbjct  293  SGQRALDTNRPSGQHNLIDFARPMLADRRKLARLIDNRLEGQYSSKGAYQVAQLTLKCLA  352

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
             +P  RPSM EV+++L++I  +K+R R+ ++
Sbjct  353  GDPRSRPSMKEVVQTLEKIEALKSRSREAKN  383



>ref|XP_009382066.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=445

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            F  KLSDFGLAK GP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  287  FVPKLSDFGLAKNGPTGGQSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  346

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +GL+ LD +R S   NLV++ KP L ++RK+  ++DPRLEG+YPS+AA + A+L ++C  
Sbjct  347  SGLRALDTTRPSGHHNLVDFAKPFLSDRRKLARLMDPRLEGRYPSKAAQQAAQLTVRCLA  406

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*P  536
             +P  RPSM EV+++L+ I  + +R R+ +S    P
Sbjct  407  GDPKSRPSMKEVVETLEHIEVMTSRPRESKSGSPRP  442



>ref|XP_010040701.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Eucalyptus grandis]
Length=525

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 126/157 (80%), Gaps = 2/157 (1%)
 Frame = +3

Query  84   SDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEILTGLKV  263
            SD GLAKLGP + NSHVTTR+MGT+GYAAPEY+ATG LYVKSDVYG GVVLLE+LTG +V
Sbjct  364  SDLGLAKLGPADRNSHVTTRVMGTFGYAAPEYIATGRLYVKSDVYGVGVVLLEMLTGSRV  423

Query  264  LDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQDEPGK  443
            +D SR S +QNLV+W +P+L +KRK++ I+DPRL+G+YP +AAT+ A+LILKC + +P  
Sbjct  424  IDCSRPSGQQNLVDWARPLLHDKRKLRKIMDPRLKGQYPLKAATQAAKLILKCLEVDPKV  483

Query  444  RPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRSADY  554
            RPSM+EVL +L+ IN +  + ++ R + S  SR + Y
Sbjct  484  RPSMEEVLATLENINTIWEKNQETREDAS--SRPSSY  518


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 4/53 (8%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGF  224
            ++NAKLSDFGLAK GP +GNS+VTTR++   GYAA EY A      K+++  F
Sbjct  286  DYNAKLSDFGLAKQGPASGNSYVTTRVIEMDGYAASEYSAVS----KTEILSF  334



>ref|XP_009392329.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=421

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 121/159 (76%), Gaps = 3/159 (2%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAK GP   +SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE L
Sbjct  235  YNAKLSDFGLAKHGPTGSDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLETL  294

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD +R S + NLV+W +P+L ++RK+  ++DPRLEG+Y S+ A + A+L L+C  
Sbjct  295  SGQRTLDPNRPSGQHNLVDWARPMLADRRKLARLMDPRLEGQYSSKGALQAAQLTLRCLA  354

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRS  545
             +P  RPSM EV+++L+ +  +K   R  R  R+ P RS
Sbjct  355  GDPKSRPSMKEVVETLEHVEAIK---RGSREPRNTPQRS  390



>ref|XP_010679959.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=403

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            ++AK+SDFGLAKLGP  GNSHVTTRIMGT+GYAAPEY+ATGHLY+ SDVYGFGVVLLE+L
Sbjct  231  YDAKISDFGLAKLGPSGGNSHVTTRIMGTFGYAAPEYVATGHLYMNSDVYGFGVVLLEML  290

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TG + +DL+R   +QNLVEWT P L  K+K++ I+DPRL G+Y  +AA  +A++ LKC +
Sbjct  291  TGSRAVDLNRPKGQQNLVEWTSPYLSNKKKLRGIIDPRLVGQYSLKAAFELAQVTLKCLR  350

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDH  515
             +P  RP M EVL+ +Q++  +K ++ ++
Sbjct  351  PDPRTRPGMKEVLEVIQKVESIKVKKENN  379



>gb|EYU40476.1| hypothetical protein MIMGU_mgv1a006634mg [Erythranthe guttata]
Length=437

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAK+GP    SH+TT++MGT GYAAPEY+ATGHLYVKSDVYGFGVVL+E+L
Sbjct  243  YNAKISDFGLAKMGPTASKSHITTQVMGTQGYAAPEYVATGHLYVKSDVYGFGVVLVEML  302

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL  +D +R S +QNLV+W KP L ++RK+KT++D RLEG+YPSR+A +IA+L L C +
Sbjct  303  TGLGAMDTNRPSGQQNLVDWIKPYLSDRRKLKTVMDSRLEGRYPSRSAFQIAQLTLTCLE  362

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRR  506
            +E   RPSM E++ +L+ I+     R
Sbjct  363  NEQKNRPSMQELVDTLERIDSAAKDR  388



>gb|KHN09350.1| Putative serine/threonine-protein kinase Cx32, chloroplastic 
[Glycine soja]
Length=415

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  54   GNWQEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVV  233
            G    +N ++SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVV
Sbjct  267  GQSHNYNPEISDFGLAKLGPSGGQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVV  326

Query  234  LLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELI  413
            LLEILTG++ LD +R + +QNLVEWTKP+L  K+K+KTI+D ++ G+Y  +AA + A+L 
Sbjct  327  LLEILTGMRALDTNRPTGQQNLVEWTKPLLSSKKKLKTIMDAKIVGQYSLQAAWQAAQLT  386

Query  414  LKCFQDEPGKRPSMDEVLKSLQEINDVK  497
            +KC Q  P +RPSM +V+++L+ I  ++
Sbjct  387  MKCLQSIPEERPSMKDVVEALEAIEAIQ  414



>emb|CDY26797.1| BnaC09g09240D [Brassica napus]
Length=416

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 119/157 (76%), Gaps = 0/157 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP    SH+TTR+MGT GYAAPEY+ATGHLYVKSD YGFGVVL EIL
Sbjct  234  YNAKLSDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDNYGFGVVLAEIL  293

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ +D  R + +QNL +W KP L E+RK++ I+DPRLEGKYP ++A R+A+L LKC +
Sbjct  294  TGLRAVDPLRPTGQQNLTDWIKPHLSERRKLRRIMDPRLEGKYPFKSAFRVAQLALKCLE  353

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PS  539
             E   RPSM EV++SL+ +     +  + R+ R  PS
Sbjct  354  PEQKNRPSMKEVVESLELVVAANEKPLERRTARDSPS  390



>ref|XP_010040700.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X2 [Eucalyptus grandis]
Length=457

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  84   SDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEILTGLKV  263
            SDFG AKLGP  GNSHV+TR++GTYGY APEY+ATGHLYVKSDVYGFGVVLLE+LTGL+V
Sbjct  320  SDFGPAKLGPAGGNSHVSTRVIGTYGYVAPEYIATGHLYVKSDVYGFGVVLLEMLTGLRV  379

Query  264  LDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQDEPGK  443
            +D  R   +Q LV+W KP+L +KRK++ I+DPRLEG+YP +AATR A+LILKC   +P  
Sbjct  380  VDNKRPKGQQMLVDWMKPLLHDKRKLRKIMDPRLEGQYPLKAATRAAKLILKCLNCDPKA  439

Query  444  RPSMDEVLKSLQEIN  488
            RPSM+EVL +L+ IN
Sbjct  440  RPSMEEVLVTLENIN  454


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 73/155 (47%), Gaps = 10/155 (6%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGV-----  230
            ++NAKLSDFGLA  GP  G+S+V+TR++   GYAAPEY AT    + S      V     
Sbjct  233  DYNAKLSDFGLAIQGPAGGDSYVSTRVIEMDGYAAPEYSATSKTEIPSSFSAGNVGSVTT  292

Query  231  ----VLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATR  398
                 L + L G+   D +  S  QN  ++    LG      + V  R+ G Y   A   
Sbjct  293  TLFRRLRDYLAGVLRNDFTAVSAHQNRSDFGPAKLGPAGG-NSHVSTRVIGTYGYVAPEY  351

Query  399  IAELILKCFQDEPGKRPSMDEVLKSLQEINDVKTR  503
            IA   L    D  G    + E+L  L+ +++ + +
Sbjct  352  IATGHLYVKSDVYGFGVVLLEMLTGLRVVDNKRPK  386



>ref|XP_002307210.1| hypothetical protein POPTR_0005s10390g [Populus trichocarpa]
 gb|EEE94206.1| hypothetical protein POPTR_0005s10390g [Populus trichocarpa]
Length=437

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAK+SDFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  239  KYNAKISDFGLAKLGPSGGESHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEM  298

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIK-TIVDPRLEGKYPSRAATRIAELILKC  422
            L+G + LD  R + +QNLVEW KP+L  K+K+K TI+D R+EG+Y ++A  + A+L LKC
Sbjct  299  LSGQRALDRKRPTGQQNLVEWLKPLLSHKKKLKTTIMDSRIEGQYSAKAMVQAAQLTLKC  358

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
             + +P  RPSM EV++ L++I  +K + +  +S
Sbjct  359  LKADPKNRPSMKEVVEVLEQIEAMKEKPKATKS  391



>emb|CDY47489.1| BnaA09g08980D [Brassica napus]
Length=412

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 119/157 (76%), Gaps = 0/157 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP    SH+TTR+MGT GYAAPEY+ATGHLYVKSD YGFGVVL EIL
Sbjct  230  YNAKLSDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDNYGFGVVLAEIL  289

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ +D  R + +QNL +W KP L E+RK++ I+DPRLEGKYP ++A R+A+L LKC +
Sbjct  290  TGLRAVDPLRPTGQQNLTDWIKPHLSERRKLRRIMDPRLEGKYPFKSAFRVAQLALKCLE  349

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PS  539
             E   RPSM EV++SL+ +     +  + R+ R  PS
Sbjct  350  PEQKNRPSMKEVVESLELVLAANEKPLERRTARDSPS  386



>gb|EPS71474.1| hypothetical protein M569_03280 [Genlisea aurea]
Length=396

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 121/157 (77%), Gaps = 4/157 (3%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAK+GP    SHVTT++MGT GYAAPEY+ATGHLYVKSDVYGFGVVL+E+L
Sbjct  226  YNAKLSDFGLAKMGPTASKSHVTTQVMGTNGYAAPEYVATGHLYVKSDVYGFGVVLVEML  285

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R + +QN+ EW KP L ++RK+K I+DP LEGKY SR+A R+A+L L C +
Sbjct  286  TGLRALDTNRPAEKQNVAEWAKPRLYDRRKLKGIMDPLLEGKYSSRSALRVAQLALNCLE  345

Query  429  DEPGKRPSMDEVLKSLQEIN----DVKTRRRDHRSNR  527
            +EP  RPSM EV+++L  I     D    +R H +N+
Sbjct  346  NEPKNRPSMQEVVETLDRIASAAIDGNGGQRVHSTNQ  382



>gb|EEC81341.1| hypothetical protein OsI_24527 [Oryza sativa Indica Group]
Length=943

 Score =   204 bits (520),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAKLSDFGLAK GP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  240  FNAKLSDFGLAKHGPDGGLSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  299

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +GL+ LD SR S + NLV+W KP+L ++RK+  ++D RLEG+Y SR A + A+L LKC  
Sbjct  300  SGLRALDPSRPSGKLNLVDWAKPLLADRRKLSQLMDSRLEGQYHSRGALQAAQLTLKCLS  359

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RPSM EV+++L++I  +K++ R+ R++ S
Sbjct  360  GDPKSRPSMKEVVEALEKIELIKSKSREPRNSSS  393



>gb|AFK43900.1| unknown [Lotus japonicus]
Length=394

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +3

Query  63   QEFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  242
            ++FNAKLSDFGLAKLGP+NG SH+TTR+MGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE
Sbjct  218  RDFNAKLSDFGLAKLGPINGRSHITTRVMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE  277

Query  243  ILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKC  422
            ILTGL  LD +R +  QNLV +  P L +K+ +K I+DP+++ +Y  +AA  IA+LIL C
Sbjct  278  ILTGLIALDKNRPTYGQNLVGYAMPSLSDKKSLKKIMDPKMDQQYSIKAALLIAQLILTC  337

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRR  509
             + +P  RPSM++VL +L++   +K + +
Sbjct  338  LESDPKNRPSMEDVLSTLEKAQSIKHKPK  366



>ref|XP_010064950.1| PREDICTED: probable serine/threonine-protein kinase NAK [Eucalyptus 
grandis]
Length=567

 Score =   201 bits (510),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +3

Query  84   SDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEILTGLKV  263
            +D GLAKLG   GNSHVTTR++GTYGYAAPEY+ATGHLYVKSD+YGFGVVLLE+LTGL+ 
Sbjct  401  TDIGLAKLGLAGGNSHVTTRVIGTYGYAAPEYIATGHLYVKSDLYGFGVVLLEMLTGLQA  460

Query  264  LDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQDEPGK  443
            LD +R S +QNLVEW +P L +KRK++ I+D RLE +YP +AAT+ AELILKC + +P  
Sbjct  461  LDNTRPSGQQNLVEWARPSLRDKRKLRKIMDSRLERRYPLKAATQAAELILKCLEGDPNV  520

Query  444  RPSMDEVLKSLQEINDVKTRRR  509
            RPS DEVLK+L++IN ++ +++
Sbjct  521  RPSTDEVLKTLEQINTIRVKKK  542



>ref|XP_004144887.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004154222.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Cucumis sativus]
Length=413

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AKLSDFGLAKLGP    SH+TTR+MGT+GYAAPEY+ TGHLYVKSDVYGFGVVL+E+L
Sbjct  225  YTAKLSDFGLAKLGPSESKSHLTTRVMGTHGYAAPEYVTTGHLYVKSDVYGFGVVLIEML  284

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R + +++L EW KP L E+RK+K ++D RLEGKYPSR+A ++A+L L+C +
Sbjct  285  TGLRALDENRPTGQEHLTEWIKPFLSERRKLKNVMDFRLEGKYPSRSAFQVAQLALQCIE  344

Query  429  DEPGKRPSMDEVLKSLQEINDVKTR  503
             E   RPSM EV+++L++I  V  +
Sbjct  345  QEQKNRPSMKEVVETLEQIETVNEK  369



>ref|XP_009112418.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brassica 
rapa]
Length=412

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 119/157 (76%), Gaps = 0/157 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP    SH+TTR+MGT GYAAPEY+ATGHLYVKSD YGFGVVL EIL
Sbjct  230  YNAKLSDFGLAKLGPSASQSHITTRVMGTQGYAAPEYVATGHLYVKSDNYGFGVVLAEIL  289

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ +D  R + +QNL +W KP L E+RK++ I+DPRLEGKYP ++A R+A+L LKC +
Sbjct  290  TGLRAVDPLRPTGQQNLTDWIKPHLSERRKLRRIMDPRLEGKYPFKSAFRVAQLALKCLE  349

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PS  539
             E   RPSM EV++SL+ +     +  + R+ R  PS
Sbjct  350  PEQKNRPSMKEVVESLELVLAANEKPLERRTARDSPS  386



>ref|NP_001147720.1| serine/threonine-protein kinase Cx32 [Zea mays]
 gb|ACG28486.1| serine/threonine-protein kinase Cx32 [Zea mays]
 gb|AFW69825.1| putative protein kinase superfamily protein [Zea mays]
Length=438

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP    SH+TTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVV+LE+L
Sbjct  243  YNAKLSDFGLAKLGPTGSKSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEML  302

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD +R + + +L +W KP L ++R++  ++DPR EG+Y S+ A + A+L L C  
Sbjct  303  SGQRALDPNRPNGQLSLADWAKPFLADRRRLARLMDPRFEGQYNSKQAFQAAQLTLNCLA  362

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             EP  RPSM EV+++L++I  VK+R R+ R   S
Sbjct  363  GEPRSRPSMKEVVETLEQIESVKSRAREARGGSS  396



>ref|XP_009397897.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
 ref|XP_009397904.1| PREDICTED: probable serine/threonine-protein kinase NAK [Musa 
acuminata subsp. malaccensis]
Length=426

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  232  YIAKLSDFGLAKHGPTGGDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLEML  291

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            +G + LD +R S + NLV+W +P+L ++RK+  ++DPRLEG+Y S+ A + A+L L C  
Sbjct  292  SGQRALDANRPSGQHNLVDWARPMLADRRKLARLMDPRLEGQYSSKGALQAAQLTLSCLA  351

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS  530
             +P  RPSM  V+++L+ I  +K R R+ R   S
Sbjct  352  GDPKSRPSMKVVVETLERIEAIKGRSREARDAAS  385



>ref|XP_010233714.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brachypodium 
distachyon]
Length=431

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGLAKLGP   NSH+TTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVV+LE+L
Sbjct  239  YNAKLSDFGLAKLGPTGSNSHITTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVMLEML  298

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TG + LD +R + + +LV+W KP L ++RK+  I+D R EG+Y S+ A + A+L + C  
Sbjct  299  TGQRALDPNRPNGQLSLVDWAKPYLNDRRKLARIMDTRFEGQYNSKQALQSAQLTMICLA  358

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHR  518
             EP  RPSM EVL++L++I  +K+R R+ R
Sbjct  359  AEPRSRPSMKEVLETLEQIEAMKSRAREAR  388



>gb|KHN20110.1| Putative serine/threonine-protein kinase NAK, partial [Glycine 
soja]
Length=343

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            +FNAKLSDFGLAK GPVNG SHVTTR+MGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE+
Sbjct  165  DFNAKLSDFGLAKFGPVNGISHVTTRVMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEM  224

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG   LD ++ +  QNLVE T   L +K+++K I+DPR+  +Y  RAA +IA+L+LKC 
Sbjct  225  LTGRAALDTNQPAGMQNLVECTMSCLHDKKRLKEIIDPRMNEQYSLRAAFQIAQLVLKCL  284

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTR  503
            + +P KRPS  EVL +L++   +K +
Sbjct  285  ETDPKKRPSTKEVLGTLEKARAIKYK  310



>gb|EAZ24138.1| hypothetical protein OsJ_07878 [Oryza sativa Japonica Group]
Length=460

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 120/161 (75%), Gaps = 8/161 (5%)
 Frame = +3

Query  36   EKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATG  191
            EKH+ + +++        +F+AKLSDFGLAK GP  G+SHVTTR+MGTYGYAAPEY+ATG
Sbjct  245  EKHVIYRDFKASNILLDTQFHAKLSDFGLAKDGPAGGSSHVTTRVMGTYGYAAPEYVATG  304

Query  192  HLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEG  371
            HLYVKSDVYGFGVVLLE+LTGL+ LD  R   + +LV+W KP L ++RK+  ++DPRLEG
Sbjct  305  HLYVKSDVYGFGVVLLELLTGLRALDAGRPQRQHHLVDWAKPFLSDRRKLARLMDPRLEG  364

Query  372  KYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDV  494
            +Y SR A R A+L L+C   +   RPSM EV+  L+EI  +
Sbjct  365  QYSSRGAQRAAQLTLRCLAADHKNRPSMREVVAVLEEIESM  405



>ref|XP_004253237.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Solanum lycopersicum]
Length=415

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            ++AKLSDFGLAK+GP  GNSHVTTRIMGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  232  YHAKLSDFGLAKVGPSAGNSHVTTRIMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLELL  291

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R   + NLV+W KP+L  KRK+K+I+D R+EG+Y S+AA   A+L +KC +
Sbjct  292  TGLRALDTKRPGGQHNLVDWMKPMLSNKRKLKSIMDARMEGQYSSKAAILTAQLTIKCLE  351

Query  429  DEPGKRPSM  455
             EP KRPSM
Sbjct  352  GEPKKRPSM  360



>ref|XP_010040699.1| PREDICTED: probable serine/threonine-protein kinase NAK isoform 
X1 [Eucalyptus grandis]
Length=506

 Score =   199 bits (506),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  84   SDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEILTGLKV  263
            SDFG AKLGP  GNSHV+TR++GTYGY APEY+ATGHLYVKSDVYGFGVVLLE+LTGL+V
Sbjct  369  SDFGPAKLGPAGGNSHVSTRVIGTYGYVAPEYIATGHLYVKSDVYGFGVVLLEMLTGLRV  428

Query  264  LDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQDEPGK  443
            +D  R   +Q LV+W KP+L +KRK++ I+DPRLEG+YP +AATR A+LILKC   +P  
Sbjct  429  VDNKRPKGQQMLVDWMKPLLHDKRKLRKIMDPRLEGQYPLKAATRAAKLILKCLNCDPKA  488

Query  444  RPSMDEVLKSLQEIN  488
            RPSM+EVL +L+ IN
Sbjct  489  RPSMEEVLVTLENIN  503


 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 73/155 (47%), Gaps = 10/155 (6%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGV-----  230
            ++NAKLSDFGLA  GP  G+S+V+TR++   GYAAPEY AT    + S      V     
Sbjct  282  DYNAKLSDFGLAIQGPAGGDSYVSTRVIEMDGYAAPEYSATSKTEIPSSFSAGNVGSVTT  341

Query  231  ----VLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATR  398
                 L + L G+   D +  S  QN  ++    LG      + V  R+ G Y   A   
Sbjct  342  TLFRRLRDYLAGVLRNDFTAVSAHQNRSDFGPAKLGPAGG-NSHVSTRVIGTYGYVAPEY  400

Query  399  IAELILKCFQDEPGKRPSMDEVLKSLQEINDVKTR  503
            IA   L    D  G    + E+L  L+ +++ + +
Sbjct  401  IATGHLYVKSDVYGFGVVLLEMLTGLRVVDNKRPK  435



>gb|KDP43762.1| hypothetical protein JCGZ_22389 [Jatropha curcas]
Length=398

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP  G+SHVTTR+MG+YGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  221  YNAKISDFGLAKLGPSGGDSHVTTRVMGSYGYAAPEYIATGHLYVKSDVYGFGVVLLELL  280

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R + +QNLV+W KPIL  K+K+K  +D R+EG+  S+A  + A+L L+C +
Sbjct  281  TGLRALDRRRPNGQQNLVDWLKPILPYKKKLKATMDVRIEGQNSSKAMLQAAQLTLQCLE  340

Query  429  DEPGKRPSMDEVLKSLQEINDVKTR  503
             +P  RPSM EV+ +L++I+ +K +
Sbjct  341  PDPQSRPSMREVVDALEQIDAIKEK  365



>ref|XP_006855749.1| hypothetical protein AMTR_s00044p00168360 [Amborella trichopoda]
 gb|ERN17216.1| hypothetical protein AMTR_s00044p00168360 [Amborella trichopoda]
Length=879

 Score =   203 bits (516),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 136/183 (74%), Gaps = 10/183 (5%)
 Frame = +3

Query  30   NVEKHIPFGNWQ--------EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMA  185
            N+EKHI + +++         +NAK+SDFGLAK GP+  +SHVTTR+MGT+GYAAPEY+A
Sbjct  234  NLEKHIIYRDFKAANILLDSNYNAKISDFGLAKFGPLGDDSHVTTRVMGTHGYAAPEYVA  293

Query  186  TGHLYVKSDVYGFGVVLLEILTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRL  365
            TGHLYVKSDVY FGVVLLEILTGL+ LDL+R +++ NLV+W KP+LG++RK++ ++D RL
Sbjct  294  TGHLYVKSDVYTFGVVLLEILTGLRALDLNRPTSQINLVDWAKPLLGDRRKLEVLMDIRL  353

Query  366  EGKYPSRAATRIAELILKCFQDEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNRS*PSRS  545
            + +YP + A    +L LKC   EP KRP M EVL+ LQ I  +K + ++  S R+  +RS
Sbjct  354  DNQYPIKGALETCKLSLKCLTPEPRKRPHMKEVLEELQRIAAIKEKPKE--SKRADKARS  411

Query  546  ADY  554
            A +
Sbjct  412  AAH  414



>emb|CDP01798.1| unnamed protein product [Coffea canephora]
Length=423

 Score =   196 bits (499),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKL+DFGLAKLGP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  234  YNAKLADFGLAKLGPSGGMSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEML  293

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R   +QNLV++ KP++  KRK+KTI+D R+EG+Y S+AA + A+L L+C +
Sbjct  294  TGLRALDTRRPGGQQNLVDYAKPLISHKRKLKTIMDARIEGQYSSKAALQAAQLALRCLE  353

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
             EP KRPSM EV++ L++I  +K + ++ +S
Sbjct  354  AEPKKRPSMKEVIEILEQIEAIKEKPKESKS  384



>ref|XP_003527639.1| PREDICTED: probable serine/threonine-protein kinase NAK-like 
[Glycine max]
Length=369

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            +FNAKLSDFGLAK GPVNG SHVTTR+MGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE+
Sbjct  191  DFNAKLSDFGLAKFGPVNGISHVTTRVMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEM  250

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTG   LD ++ +  QNLVE T   L +K+++K I+DPR+  +Y  RAA +IA+L+LKC 
Sbjct  251  LTGRAALDTNQPAGMQNLVECTMSCLHDKKRLKEIIDPRMNEQYSLRAAFQIAQLVLKCL  310

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTR  503
            + +P KRPS  EVL +L++   +K +
Sbjct  311  ETDPKKRPSTKEVLGTLEKARAIKYK  336



>ref|XP_006343333.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
[Solanum tuberosum]
Length=414

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAK+SDFGLAKLGP   +SHVTTR+MGTYGYAAPEY+ TGHLYVKSDVYGFGVV+LE+L
Sbjct  234  YNAKISDFGLAKLGPSGSDSHVTTRVMGTYGYAAPEYVETGHLYVKSDVYGFGVVVLELL  293

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R + ++ LV+W KP+L  KRK+K+I+D R+EG+Y S+AAT  A++ L+C +
Sbjct  294  TGLRALDTKRPNGQEKLVDWVKPMLSNKRKLKSIMDARMEGQYSSKAATLAAQITLECLE  353

Query  429  DEPGKRPSMDEVLKSLQEINDVK  497
             +P  RPSM EV   L++I  +K
Sbjct  354  GDPKNRPSMKEVTNVLEQIEAIK  376



>ref|XP_009601926.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009601927.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Nicotiana tomentosiformis]
Length=409

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            ++AKLSDFGLAK+GP +GNSHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  231  YHAKLSDFGLAKVGPSDGNSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLELL  290

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD  R S + NLV+W KP+L  KRK+++I+D R+EG+Y S+AA   A+L LKC +
Sbjct  291  TGLRALDTKRPSGQNNLVDWVKPMLCNKRKLRSIMDARMEGQYSSKAALVAAQLSLKCLE  350

Query  429  DEPGKRPSM  455
             EP  RPSM
Sbjct  351  GEPKNRPSM  359



>ref|XP_009365764.1| PREDICTED: protein kinase 2A, chloroplastic-like [Pyrus x bretschneideri]
Length=284

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            +NAKLSDFGL K GP+NGNSHVTTRI+GT+GYAAPEY+ATGHLYVKSDVYGFGVVLLE+L
Sbjct  94   YNAKLSDFGLVKTGPMNGNSHVTTRIIGTHGYAAPEYVATGHLYVKSDVYGFGVVLLEML  153

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL  +D +R S E +LV+  +P L +K+ +K I+DP L  +Y  + A + AELILKC +
Sbjct  154  TGLPAVDSNRPSCEYSLVDLARPSLHKKKWLKKIMDPGLGEEYSLKGAFQAAELILKCLE  213

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSN  524
             +P  RPSM+EVL  L++IND+K + +  +SN
Sbjct  214  PDPKSRPSMEEVLTVLEKINDIKKKPKCTKSN  245



>ref|XP_011022164.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic 
[Populus euphratica]
Length=438

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            ++NAK+SDFGLAK GP  G SHVTTR+MGTYGYAAPEY+ATGHLYVKSDVYGFGVVLLE+
Sbjct  239  KYNAKISDFGLAKSGPSGGESHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEM  298

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIK-TIVDPRLEGKYPSRAATRIAELILKC  422
            L+G + LD  R + +QNLVEW KP+L  K+K+K TI+D R+EG+Y S+A  + A+L LKC
Sbjct  299  LSGQRALDRKRPTGQQNLVEWLKPLLSHKKKLKTTIMDSRIEGQYSSKAMVQAAQLTLKC  358

Query  423  FQDEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
             + +P  RPSM EV++ L++I  +K + +  +S
Sbjct  359  LKADPRNRPSMKEVVEVLEQIEAMKEKPKATKS  391



>gb|KGN43339.1| hypothetical protein Csa_7G024130 [Cucumis sativus]
Length=487

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            + AKLSDFGLAKLGP    SH+TTR+MGT+GYAAPEY+ TGHLYVKSDVYGFGVVL+E+L
Sbjct  299  YTAKLSDFGLAKLGPSESKSHLTTRVMGTHGYAAPEYVTTGHLYVKSDVYGFGVVLIEML  358

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
            TGL+ LD +R + +++L EW KP L E+RK+K ++D RLEGKYPSR+A ++A+L L+C +
Sbjct  359  TGLRALDENRPTGQEHLTEWIKPFLSERRKLKNVMDFRLEGKYPSRSAFQVAQLALQCIE  418

Query  429  DEPGKRPSMDEVLKSLQEINDVKTR  503
             E   RPSM EV+++L++I  V  +
Sbjct  419  QEQKNRPSMKEVVETLEQIETVNEK  443



>ref|XP_003563244.1| PREDICTED: probable serine/threonine-protein kinase NAK [Brachypodium 
distachyon]
Length=414

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = +3

Query  69   FNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEIL  248
            FNAKLSDFGLAK GP +G SHVTTR+MGTYGYAAPEY++TGHLYVKSDVYGFGVVLLE+L
Sbjct  237  FNAKLSDFGLAKHGPDDGESHVTTRVMGTYGYAAPEYVSTGHLYVKSDVYGFGVVLLEML  296

Query  249  TGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCFQ  428
             GL+ LD SR + + NLV W KP+L ++R++  ++D RLEG+Y +R A   A+L LKC  
Sbjct  297  CGLRALDPSRPTEKLNLVNWAKPLLADRRRLSQLMDSRLEGQYHARGAFHAAQLTLKCLS  356

Query  429  DEPGKRPSMDEVLKSLQEINDVKTRRRDHRSNR  527
             +P  RPSM EV++ L+ I  ++++ R     R
Sbjct  357  GDPKSRPSMKEVVEELERIELMRSKSRSREVRR  389



>ref|XP_004500872.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X4 [Cicer arietinum]
Length=362

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            +FNAKLSDFGLAK GPV+G SHVTTR+MGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE+
Sbjct  182  DFNAKLSDFGLAKFGPVSGKSHVTTRVMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEM  241

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL  LD +R +N+ NLV++T   L +++K+KTI+D R+  +Y   AA +++ L+LKC 
Sbjct  242  LTGLIALDKNRPTNKLNLVDFTIGCLSDRKKLKTIMDHRMNEQYSLTAALQVSHLVLKCL  301

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
            + +P  RPSM++VL++L++   +K + +  +S
Sbjct  302  ESDPKNRPSMEQVLETLEKAQTIKYKPKLKKS  333



>ref|XP_004500871.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X3 [Cicer arietinum]
Length=374

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            +FNAKLSDFGLAK GPV+G SHVTTR+MGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE+
Sbjct  194  DFNAKLSDFGLAKFGPVSGKSHVTTRVMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEM  253

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL  LD +R +N+ NLV++T   L +++K+KTI+D R+  +Y   AA +++ L+LKC 
Sbjct  254  LTGLIALDKNRPTNKLNLVDFTIGCLSDRKKLKTIMDHRMNEQYSLTAALQVSHLVLKCL  313

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
            + +P  RPSM++VL++L++   +K + +  +S
Sbjct  314  ESDPKNRPSMEQVLETLEKAQTIKYKPKLKKS  345



>ref|XP_004500870.1| PREDICTED: probable serine/threonine-protein kinase Cx32, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=381

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  66   EFNAKLSDFGLAKLGPVNGNSHVTTRIMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEI  245
            +FNAKLSDFGLAK GPV+G SHVTTR+MGTYGYAAPEYMATGHLYVKSDVYGFGVVLLE+
Sbjct  201  DFNAKLSDFGLAKFGPVSGKSHVTTRVMGTYGYAAPEYMATGHLYVKSDVYGFGVVLLEM  260

Query  246  LTGLKVLDLSRASNEQNLVEWTKPILGEKRKIKTIVDPRLEGKYPSRAATRIAELILKCF  425
            LTGL  LD +R +N+ NLV++T   L +++K+KTI+D R+  +Y   AA +++ L+LKC 
Sbjct  261  LTGLIALDKNRPTNKLNLVDFTIGCLSDRKKLKTIMDHRMNEQYSLTAALQVSHLVLKCL  320

Query  426  QDEPGKRPSMDEVLKSLQEINDVKTRRRDHRS  521
            + +P  RPSM++VL++L++   +K + +  +S
Sbjct  321  ESDPKNRPSMEQVLETLEKAQTIKYKPKLKKS  352



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1664082826224