BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23674_g1_i2 len=1759 path=[1701:0-377 2079:378-510 4960:511-642
2311:643-669 4294:670-718 2387:719-742 4366:743-980 2646:981-1018
4241:1019-1022 2688:1023-1758]

Length=1759
                                                                      Score     E

ref|XP_006354913.1|  PREDICTED: patatin-3-Kuras 1-like                  522   4e-178   
ref|XP_009617797.1|  PREDICTED: patatin-like protein 2 isoform X1       519   8e-177   
ref|XP_006354911.1|  PREDICTED: patatin-3-Kuras 1-like                  517   2e-176   
gb|AAF98368.1|AF158027_1  patatin-like protein 1                        516   8e-176   Nicotiana tabacum [American tobacco]
ref|XP_004238176.1|  PREDICTED: patatin-like protein 2                  516   1e-175   
ref|XP_009801077.1|  PREDICTED: patatin-like protein 2                  515   2e-175   
emb|CBI19549.3|  unnamed protein product                                513   1e-174   
ref|XP_006354914.1|  PREDICTED: patatin-3-Kuras 1-like                  512   2e-174   
ref|XP_004238177.1|  PREDICTED: patatin-like protein 2                  511   5e-174   
ref|XP_006354912.1|  PREDICTED: patatin-3-Kuras 1-like                  508   7e-173   
ref|XP_002282366.2|  PREDICTED: patatin-like protein 2                  508   2e-172   Vitis vinifera
ref|XP_002282432.1|  PREDICTED: patatin-like protein 2                  506   7e-172   Vitis vinifera
emb|CDP01332.1|  unnamed protein product                                506   1e-171   
ref|XP_002282415.2|  PREDICTED: patatin-like protein 2                  504   2e-171   Vitis vinifera
ref|XP_010664933.1|  PREDICTED: patatin-like protein 2                  502   2e-170   
emb|CAN68798.1|  hypothetical protein VITISV_008805                     502   2e-170   Vitis vinifera
ref|XP_002282440.1|  PREDICTED: patatin-like protein 2                  501   5e-170   Vitis vinifera
emb|CBI19558.3|  unnamed protein product                                501   8e-170   
emb|CBI19560.3|  unnamed protein product                                502   5e-169   
ref|XP_003589236.1|  Patatin-like protein                               498   9e-169   
ref|XP_003589238.1|  Patatin-like protein                               492   3e-166   
ref|XP_007136666.1|  hypothetical protein PHAVU_009G063500g             491   5e-166   
ref|XP_006354910.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    490   1e-165   
emb|CBI19557.3|  unnamed protein product                                504   3e-165   
ref|XP_003544452.1|  PREDICTED: patatin-3-Kuras 1-like                  489   3e-165   
ref|XP_010664934.1|  PREDICTED: patatin-like protein 2                  489   4e-165   
gb|AFK35290.1|  unknown                                                 488   8e-165   
ref|XP_004499075.1|  PREDICTED: patatin-2-Kuras 3-like isoform X1       488   2e-164   
ref|XP_003549405.1|  PREDICTED: patatin-3-Kuras 1                       486   4e-164   
gb|KHN12765.1|  Patatin group A-3                                       486   7e-164   
ref|XP_009769117.1|  PREDICTED: patatin-like protein 2 isoform X1       485   1e-163   
ref|XP_002277305.1|  PREDICTED: patatin-like protein 1                  484   2e-163   Vitis vinifera
ref|XP_010041051.1|  PREDICTED: patatin-like protein 2                  483   6e-163   
ref|XP_009769118.1|  PREDICTED: patatin-like protein 2 isoform X2       483   6e-163   
emb|CBI21444.3|  unnamed protein product                                484   8e-163   
ref|XP_004499076.1|  PREDICTED: patatin-2-Kuras 3-like isoform X2       481   1e-162   
ref|XP_002510258.1|  Patatin T5 precursor, putative                     482   2e-162   Ricinus communis
emb|CAN71271.1|  hypothetical protein VITISV_001907                     482   6e-162   Vitis vinifera
ref|XP_008228777.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    478   5e-161   
ref|XP_010068174.1|  PREDICTED: patatin-like protein 2                  478   1e-160   
ref|XP_009797490.1|  PREDICTED: patatin-like protein 2                  478   1e-160   
ref|XP_002282391.3|  PREDICTED: uncharacterized protein LOC100264244    501   1e-160   Vitis vinifera
ref|XP_003527713.1|  PREDICTED: patatin-like                            477   2e-160   
gb|KHN04516.1|  Patatin group A-3                                       476   4e-160   
ref|XP_010068219.1|  PREDICTED: patatin-like protein 2                  476   5e-160   
gb|KCW88897.1|  hypothetical protein EUGRSUZ_A01223                     475   7e-160   
emb|CBI19553.3|  unnamed protein product                                475   2e-159   
ref|XP_010059972.1|  PREDICTED: patatin-like protein 2                  474   2e-159   
gb|KCW66458.1|  hypothetical protein EUGRSUZ_F00254                     474   4e-159   
ref|XP_010059967.1|  PREDICTED: patatin-like protein 2                  473   5e-159   
ref|XP_006354907.1|  PREDICTED: patatin-2-Kuras 4-like                  472   5e-159   
ref|XP_007160832.1|  hypothetical protein PHAVU_001G020300g             473   5e-159   
ref|XP_010064139.1|  PREDICTED: patatin-like protein 2                  473   6e-159   
ref|XP_006488153.1|  PREDICTED: patatin-3-Kuras 1-like                  473   6e-159   
ref|XP_006424637.1|  hypothetical protein CICLE_v10030027mg             473   6e-159   
ref|XP_010064187.1|  PREDICTED: patatin-like protein 2                  473   7e-159   
ref|XP_010268994.1|  PREDICTED: patatin-like protein 2 isoform X1       473   9e-159   
ref|XP_010064186.1|  PREDICTED: patatin-like protein 2                  473   1e-158   
ref|XP_010054916.1|  PREDICTED: patatin-like protein 2                  472   2e-158   
ref|XP_006434815.1|  hypothetical protein CICLE_v10001337mg             472   2e-158   
gb|KCW78409.1|  hypothetical protein EUGRSUZ_D02575                     471   2e-158   
ref|XP_010320346.1|  PREDICTED: patatin-like protein 2 isoform X1       471   3e-158   
ref|XP_010059969.1|  PREDICTED: patatin-like protein 2 isoform X2       471   3e-158   
ref|XP_009367377.1|  PREDICTED: patatin-like protein 2                  471   3e-158   
ref|XP_010064132.1|  PREDICTED: patatin-like protein 2                  471   5e-158   
ref|XP_010664585.1|  PREDICTED: patatin-like protein 2 isoform X3       471   5e-158   
ref|XP_010268982.1|  PREDICTED: patatin-like protein 2                  471   6e-158   
ref|XP_009797488.1|  PREDICTED: patatin-like protein 2 isoform X1       470   6e-158   
ref|XP_011099181.1|  PREDICTED: patatin-like protein 1                  470   7e-158   
ref|XP_002282481.1|  PREDICTED: patatin-like protein 2                  470   8e-158   Vitis vinifera
emb|CBI19552.3|  unnamed protein product                                472   1e-157   
ref|XP_008361010.1|  PREDICTED: patatin-like protein 2                  469   1e-157   
gb|KCW66178.1|  hypothetical protein EUGRSUZ_F00014                     469   2e-157   
ref|XP_009370195.1|  PREDICTED: patatin-like protein 2                  475   2e-157   
gb|KCW66171.1|  hypothetical protein EUGRSUZ_F00007                     469   2e-157   
ref|XP_010664584.1|  PREDICTED: patatin-like protein 2 isoform X2       469   2e-157   
ref|XP_009612649.1|  PREDICTED: patatin-like protein 2                  469   2e-157   
ref|XP_002310732.1|  patatin family protein                             469   3e-157   Populus trichocarpa [western balsam poplar]
ref|XP_009409669.1|  PREDICTED: patatin-like protein 1                  469   3e-157   
ref|XP_011008336.1|  PREDICTED: patatin-like protein 3                  468   5e-157   
ref|XP_010064188.1|  PREDICTED: patatin-like protein 2                  468   5e-157   
ref|XP_003603015.1|  Patatin-like protein                               468   6e-157   
ref|XP_007226655.1|  hypothetical protein PRUPE_ppa021897mg             468   7e-157   
emb|CAN76066.1|  hypothetical protein VITISV_001725                     468   8e-157   Vitis vinifera
ref|XP_010059968.1|  PREDICTED: patatin-like protein 2 isoform X1       467   1e-156   
ref|XP_006434813.1|  hypothetical protein CICLE_v10001337mg             466   2e-156   
ref|XP_010059970.1|  PREDICTED: patatin-like protein 2 isoform X1       466   2e-156   
ref|XP_010064191.1|  PREDICTED: patatin-like protein 2                  466   3e-156   
gb|EYU30123.1|  hypothetical protein MIMGU_mgv1a005982mg                468   3e-156   
ref|XP_008776828.1|  PREDICTED: patatin-like protein 2                  465   4e-156   
ref|XP_010320347.1|  PREDICTED: patatin-like protein 2 isoform X2       465   4e-156   
ref|XP_010061770.1|  PREDICTED: patatin-like protein 2 isoform X1       465   6e-156   
ref|XP_008808514.1|  PREDICTED: patatin-like protein 2                  468   8e-156   
ref|XP_009794733.1|  PREDICTED: patatin-like protein 2                  465   9e-156   
ref|XP_010269056.1|  PREDICTED: patatin-like protein 2 isoform X1       464   1e-155   
ref|XP_010064137.1|  PREDICTED: patatin-like protein 2                  464   3e-155   
gb|KCW66471.1|  hypothetical protein EUGRSUZ_F00268                     463   3e-155   
ref|XP_010064136.1|  PREDICTED: patatin-like protein 2                  464   4e-155   
ref|XP_002281798.1|  PREDICTED: patatin-like protein 1                  462   7e-155   Vitis vinifera
ref|XP_010061771.1|  PREDICTED: patatin-like protein 2 isoform X2       461   8e-155   
ref|XP_002284571.1|  PREDICTED: patatin-like protein 2                  463   1e-154   Vitis vinifera
ref|XP_011017230.1|  PREDICTED: patatin-like protein 2                  462   1e-154   
ref|XP_009370176.1|  PREDICTED: patatin-like protein 2                  462   1e-154   
ref|XP_009419098.1|  PREDICTED: patatin-like protein 2                  462   1e-154   
emb|CBI19544.3|  unnamed protein product                                464   1e-154   
ref|XP_011007290.1|  PREDICTED: patatin-like protein 3                  462   1e-154   
ref|XP_007017303.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            463   2e-154   
ref|XP_010942708.1|  PREDICTED: patatin-like protein 2                  462   2e-154   
emb|CDP02483.1|  unnamed protein product                                461   2e-154   
ref|XP_004501586.1|  PREDICTED: patatin-3-Kuras 1-like isoform X1       461   2e-154   
ref|XP_010065725.1|  PREDICTED: patatin-like protein 2                  461   3e-154   
ref|XP_009380972.1|  PREDICTED: patatin-like protein 2                  460   4e-154   
ref|XP_008228776.1|  PREDICTED: patatin-like protein 2                  461   4e-154   
ref|XP_003603014.1|  Patatin-like protein                               460   6e-154   
ref|XP_010028264.1|  PREDICTED: patatin-like protein 1                  460   7e-154   
ref|XP_007222710.1|  hypothetical protein PRUPE_ppa006466mg             460   9e-154   
ref|XP_008393828.1|  PREDICTED: patatin-like protein 2 isoform X2       459   2e-153   
ref|XP_007227183.1|  hypothetical protein PRUPE_ppa019615mg             458   2e-153   
gb|AAX99411.1|  patatin-like protein                                    460   2e-153   Gossypium hirsutum [American cotton]
ref|XP_008393827.1|  PREDICTED: patatin-like protein 2 isoform X1       459   2e-153   
ref|XP_009367378.1|  PREDICTED: patatin-like protein 2                  458   3e-153   
ref|XP_011030334.1|  PREDICTED: patatin-like protein 2 isoform X2       458   4e-153   
ref|XP_007017304.1|  Phospholipase A 2A, IIA,PLA2A isoform 2            459   4e-153   
ref|XP_004957049.1|  PREDICTED: patatin-05-like                         457   5e-153   
ref|XP_008801772.1|  PREDICTED: patatin-like protein 2                  457   5e-153   
emb|CDP04311.1|  unnamed protein product                                457   5e-153   
ref|XP_011030324.1|  PREDICTED: patatin-like protein 2 isoform X1       457   1e-152   
ref|XP_006374982.1|  hypothetical protein POPTR_0014s03330g             457   1e-152   
ref|XP_008813724.1|  PREDICTED: patatin-like protein 2 isoform X1       456   2e-152   
ref|XP_008779158.1|  PREDICTED: patatin-like protein 2                  456   2e-152   
ref|XP_009390266.1|  PREDICTED: patatin-like protein 2 isoform X2       456   2e-152   
ref|XP_009403085.1|  PREDICTED: patatin-like protein 2                  456   3e-152   
ref|XP_007227189.1|  hypothetical protein PRUPE_ppa019532mg             456   3e-152   
ref|XP_006829694.1|  hypothetical protein AMTR_s00126p00050070          456   3e-152   
ref|XP_007047215.1|  Uncharacterized protein TCM_000589                 456   3e-152   
ref|XP_008220192.1|  PREDICTED: patatin-like protein 2                  455   7e-152   
ref|XP_006829702.1|  hypothetical protein AMTR_s00126p00063230          455   7e-152   
ref|XP_009390265.1|  PREDICTED: patatin-like protein 2 isoform X1       455   1e-151   
ref|XP_006374976.1|  hypothetical protein POPTR_0014s03280g             454   1e-151   
ref|XP_008220177.1|  PREDICTED: patatin-like protein 2                  453   3e-151   
ref|XP_010926367.1|  PREDICTED: patatin-like protein 2                  453   3e-151   
ref|XP_009383171.1|  PREDICTED: patatin-like protein 2                  453   3e-151   
ref|XP_003576611.1|  PREDICTED: patatin-like protein 2 isoform X1       453   4e-151   
ref|XP_004501587.1|  PREDICTED: patatin-3-Kuras 1-like isoform X2       452   6e-151   
ref|XP_006374981.1|  hypothetical protein POPTR_0014s03320g             453   7e-151   
ref|XP_002301195.2|  hypothetical protein POPTR_0002s12980g             452   9e-151   Populus trichocarpa [western balsam poplar]
ref|XP_006374977.1|  hypothetical protein POPTR_0014s03280g             452   1e-150   
ref|XP_002449853.1|  hypothetical protein SORBIDRAFT_05g024430          452   1e-150   Sorghum bicolor [broomcorn]
ref|XP_006374978.1|  hypothetical protein POPTR_0014s03290g             452   2e-150   
ref|XP_010101004.1|  Patatin group A-3                                  451   2e-150   
emb|CAN81920.1|  hypothetical protein VITISV_021802                     451   3e-150   Vitis vinifera
ref|XP_007226924.1|  hypothetical protein PRUPE_ppa015844mg             451   3e-150   
ref|XP_011017228.1|  PREDICTED: patatin-like protein 2                  451   3e-150   
gb|KCW66463.1|  hypothetical protein EUGRSUZ_F00261                     449   5e-150   
ref|XP_010238242.1|  PREDICTED: patatin-like protein 2 isoform X2       450   5e-150   
ref|XP_006374974.1|  hypothetical protein POPTR_0014s03260g             449   7e-150   
ref|XP_006354909.1|  PREDICTED: patatin-3-Kuras 1-like                  450   7e-150   
ref|XP_006339912.1|  PREDICTED: patatin-05-like                         449   8e-150   
gb|KHG27256.1|  Patatin group M-3                                       450   9e-150   
ref|XP_008797306.1|  PREDICTED: patatin-like protein 2                  449   1e-149   
ref|XP_010269035.1|  PREDICTED: patatin-like protein 2 isoform X1       449   1e-149   
ref|XP_002880810.1|  hypothetical protein ARALYDRAFT_481516             449   2e-149   
ref|XP_008337062.1|  PREDICTED: patatin-like protein 2                  448   2e-149   
ref|XP_002277318.1|  PREDICTED: patatin-like protein 1                  448   3e-149   Vitis vinifera
ref|XP_004288052.1|  PREDICTED: patatin group A-3-like                  448   3e-149   
ref|XP_006374973.1|  hypothetical protein POPTR_0014s03250g             448   4e-149   
ref|XP_009370175.1|  PREDICTED: patatin-like protein 2                  447   4e-149   
ref|XP_002301194.1|  patatin-like family protein                        447   5e-149   Populus trichocarpa [western balsam poplar]
gb|KCW54973.1|  hypothetical protein EUGRSUZ_I00941                     447   6e-149   
ref|XP_008220193.1|  PREDICTED: patatin-like protein 2 isoform X1       447   7e-149   
ref|XP_010098699.1|  Patatin group A-3                                  448   1e-148   
ref|XP_011081971.1|  PREDICTED: patatin-like protein 1                  447   1e-148   
ref|XP_010089434.1|  Patatin group A-3                                  446   1e-148   
ref|XP_011071103.1|  PREDICTED: patatin-like protein 2                  447   1e-148   
ref|NP_180224.1|  phospholipase A 2A                                    446   2e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008220195.1|  PREDICTED: patatin-like protein 2 isoform X2       446   3e-148   
ref|XP_010269043.1|  PREDICTED: patatin-like protein 2 isoform X2       445   3e-148   
ref|XP_006339914.1|  PREDICTED: patatin-05-like                         445   4e-148   
ref|XP_006387188.1|  hypothetical protein POPTR_1581s00200g             444   6e-148   
ref|XP_004979715.1|  PREDICTED: patatin-2-Kuras 1-like                  444   9e-148   
ref|XP_007017307.1|  Phospholipase A 2A, IIA,PLA2A isoform 1            444   1e-147   
ref|XP_010429587.1|  PREDICTED: patatin-like protein 2                  444   1e-147   
ref|XP_006419185.1|  hypothetical protein CICLE_v10030450mg             443   1e-147   
ref|XP_004310193.1|  PREDICTED: patatin group A-3-like                  444   1e-147   
ref|XP_002460354.1|  hypothetical protein SORBIDRAFT_02g026818          442   1e-147   Sorghum bicolor [broomcorn]
ref|XP_008777430.1|  PREDICTED: patatin-like protein 2                  444   1e-147   
ref|XP_002451118.1|  hypothetical protein SORBIDRAFT_05g024380          444   2e-147   Sorghum bicolor [broomcorn]
ref|XP_006354908.1|  PREDICTED: patatin-3-Kuras 1-like                  444   2e-147   
gb|AAM63157.1|  similar to latex allergen from Hevea brasiliensis       444   2e-147   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006488152.1|  PREDICTED: patatin-05-like                         443   2e-147   
ref|XP_006285520.1|  hypothetical protein CARUB_v10006962mg             443   3e-147   
ref|XP_006408594.1|  hypothetical protein EUTSA_v10002000mg             443   3e-147   
ref|XP_002282597.1|  PREDICTED: patatin-like protein 2 isoform X1       443   3e-147   Vitis vinifera
ref|XP_006663045.1|  PREDICTED: patatin-2-Kuras 1-like                  443   4e-147   
ref|XP_009410116.1|  PREDICTED: patatin-like protein 2                  443   4e-147   
ref|XP_006473887.1|  PREDICTED: patatin-05-like                         443   4e-147   
ref|XP_010101003.1|  Patatin group A-3                                  443   4e-147   
ref|XP_010417357.1|  PREDICTED: patatin-like protein 2                  442   4e-147   
ref|XP_010101001.1|  Patatin group A-3                                  442   5e-147   
ref|XP_006434817.1|  hypothetical protein CICLE_v10003658mg             442   5e-147   
ref|XP_009367381.1|  PREDICTED: patatin-like protein 2                  442   6e-147   
emb|CDP01337.1|  unnamed protein product                                442   8e-147   
ref|XP_004291128.1|  PREDICTED: patatin group A-3-like                  443   9e-147   
ref|XP_008384958.1|  PREDICTED: patatin-like protein 2                  441   1e-146   
ref|XP_009393655.1|  PREDICTED: patatin-like protein 2                  442   1e-146   
ref|XP_011038246.1|  PREDICTED: patatin-like protein 2 isoform X2       441   1e-146   
ref|XP_004979713.1|  PREDICTED: patatin-3-Kuras 1-like                  441   1e-146   
gb|KFK30333.1|  hypothetical protein AALP_AA7G248300                    442   1e-146   
ref|XP_006829697.1|  hypothetical protein AMTR_s00126p00052700          441   1e-146   
ref|XP_009792908.1|  PREDICTED: patatin-like protein 1                  441   1e-146   
ref|XP_010680418.1|  PREDICTED: patatin-like protein 1                  441   2e-146   
ref|XP_004291130.1|  PREDICTED: patatin group A-3-like                  441   3e-146   
ref|XP_010472600.1|  PREDICTED: patatin-like protein 2                  440   3e-146   
ref|XP_002510255.1|  Patatin precursor, putative                        440   4e-146   Ricinus communis
ref|XP_011070718.1|  PREDICTED: patatin-like protein 2                  441   5e-146   
emb|CDP07844.1|  unnamed protein product                                439   6e-146   
ref|XP_009367379.1|  PREDICTED: patatin-like protein 2                  439   8e-146   
ref|XP_004499077.1|  PREDICTED: patatin-2-Kuras 3-like isoform X3       438   1e-145   
emb|CDM80597.1|  unnamed protein product                                440   1e-145   
ref|XP_002262942.1|  PREDICTED: patatin-like protein 2                  439   1e-145   Vitis vinifera
gb|EMS66123.1|  Patatin group A-3                                       439   1e-145   
ref|XP_002510259.1|  Patatin T5 precursor, putative                     439   1e-145   Ricinus communis
emb|CBI25858.3|  unnamed protein product                                438   1e-145   
gb|EMS45954.1|  Patatin group A-3                                       438   2e-145   
ref|XP_010269013.1|  PREDICTED: patatin-like protein 2 isoform X1       438   2e-145   
ref|XP_010548401.1|  PREDICTED: patatin-like protein 1                  437   3e-145   
gb|KFK32501.1|  hypothetical protein AALP_AA6G250900                    437   3e-145   
ref|XP_008393826.1|  PREDICTED: patatin-like protein 2                  438   3e-145   
ref|XP_009367484.1|  PREDICTED: patatin-like protein 2                  437   5e-145   
gb|EMT13605.1|  Patatin group A-3                                       437   5e-145   
gb|ACG31156.1|  patatin T5 precursor                                    437   5e-145   Zea mays [maize]
ref|XP_009603683.1|  PREDICTED: patatin-like protein 1                  437   5e-145   
ref|XP_011038245.1|  PREDICTED: patatin-like protein 2 isoform X1       437   6e-145   
gb|KDP38383.1|  hypothetical protein JCGZ_04308                         437   6e-145   
gb|KDO79282.1|  hypothetical protein CISIN_1g015720mg                   437   8e-145   
ref|XP_004152794.1|  PREDICTED: patatin group A-3-like                  437   9e-145   
ref|XP_002869007.1|  PLA IVA/PLP1                                       436   1e-144   
ref|XP_011038242.1|  PREDICTED: patatin-like protein 2                  436   1e-144   
emb|CAN62059.1|  hypothetical protein VITISV_024099                     436   1e-144   Vitis vinifera
ref|XP_008241509.1|  PREDICTED: patatin-like protein 3                  436   1e-144   
ref|XP_008444643.1|  PREDICTED: patatin-like protein 2                  436   2e-144   
ref|NP_001151190.1|  LOC100284823                                       436   2e-144   Zea mays [maize]
ref|XP_006411935.1|  hypothetical protein EUTSA_v10025343mg             436   2e-144   
gb|ACN25198.1|  unknown                                                 436   3e-144   Zea mays [maize]
ref|XP_004291132.1|  PREDICTED: patatin group A-3-like                  435   3e-144   
ref|XP_010432097.1|  PREDICTED: patatin-like protein 1                  436   3e-144   
ref|XP_011038244.1|  PREDICTED: patatin-like protein 2 isoform X2       435   3e-144   
ref|XP_009370177.1|  PREDICTED: patatin-like protein 2                  436   4e-144   
ref|XP_006660213.1|  PREDICTED: patatin-3-Kuras 1-like                  435   4e-144   
tpg|DAA42306.1|  TPA: patatin T5                                        435   6e-144   
gb|EMT30617.1|  Patatin group A-3                                       435   6e-144   
ref|XP_008339923.1|  PREDICTED: patatin-like protein 1 isoform X1       434   6e-144   
ref|XP_010269022.1|  PREDICTED: patatin-like protein 2 isoform X2       434   6e-144   
ref|XP_010525997.1|  PREDICTED: patatin-like protein 2                  434   7e-144   
ref|XP_008670247.1|  PREDICTED: patatin-like protein 2 isoform X2       434   8e-144   
ref|XP_010437269.1|  PREDICTED: patatin-like protein 1 isoform X1       434   1e-143   
ref|XP_007017306.1|  Phospholipase A 2A, IIA,PLA2A                      434   1e-143   
ref|XP_006659497.1|  PREDICTED: patatin-3-Kuras 1-like                  434   2e-143   
tpg|DAA40258.1|  TPA: hypothetical protein ZEAMMB73_846494              433   2e-143   
ref|XP_009617802.1|  PREDICTED: patatin-like protein 2 isoform X2       431   2e-143   
ref|XP_006660710.1|  PREDICTED: patatin-2-Kuras 2-like isoform X2       432   3e-143   
ref|XP_010926529.1|  PREDICTED: patatin-like protein 2                  437   3e-143   
ref|XP_010270650.1|  PREDICTED: patatin-like protein 2                  432   5e-143   
ref|XP_010942710.1|  PREDICTED: patatin-like protein 2                  436   8e-143   
ref|NP_849511.1|  patatin-related phospholipase A                       432   9e-143   Arabidopsis thaliana [mouse-ear cress]
emb|CAA05628.1|  patatin-like protein                                   432   9e-143   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69269.1|  BnaC01g01840D                                          432   9e-143   
ref|XP_008670246.1|  PREDICTED: patatin-like protein 2 isoform X1       431   1e-142   
gb|EEC84713.1|  hypothetical protein OsI_31673                          431   1e-142   Oryza sativa Indica Group [Indian rice]
ref|XP_010437270.1|  PREDICTED: patatin-like protein 1 isoform X2       430   2e-142   
ref|XP_011038243.1|  PREDICTED: patatin-like protein 2 isoform X1       431   2e-142   
ref|XP_007202991.1|  hypothetical protein PRUPE_ppa019010mg             431   2e-142   
ref|XP_008354710.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    433   2e-142   
ref|NP_001068268.1|  Os11g0614400                                       431   2e-142   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003572284.1|  PREDICTED: patatin-like protein 2                  431   2e-142   
ref|XP_002445638.1|  hypothetical protein SORBIDRAFT_07g023200          432   2e-142   Sorghum bicolor [broomcorn]
gb|EAY88437.1|  hypothetical protein OsI_09902                          431   2e-142   Oryza sativa Indica Group [Indian rice]
ref|XP_010446709.1|  PREDICTED: patatin-like protein 1 isoform X2       431   3e-142   
ref|XP_009366942.1|  PREDICTED: patatin-like protein 1 isoform X1       429   3e-142   
gb|EAZ07347.1|  hypothetical protein OsI_29596                          431   3e-142   
ref|XP_002510260.1|  Patatin T5 precursor, putative                     430   5e-142   
ref|XP_002449852.1|  hypothetical protein SORBIDRAFT_05g024390          429   5e-142   
ref|XP_004233636.1|  PREDICTED: patatin-like protein 1                  443   6e-142   
ref|NP_001063402.2|  Os09g0462400                                       429   7e-142   
ref|XP_009139351.1|  PREDICTED: patatin-like protein 1 isoform X1       429   8e-142   
tpg|DAA42305.1|  TPA: hypothetical protein ZEAMMB73_127435              434   8e-142   
gb|KFK30335.1|  hypothetical protein AALP_AA7G248500                    429   9e-142   
ref|NP_568015.1|  patatin-related phospholipase A                       428   9e-142   
gb|AAM64566.1|  patatin-like protein                                    428   1e-141   
emb|CDX75619.1|  BnaA01g00830D                                          429   1e-141   
ref|XP_010547841.1|  PREDICTED: patatin-like protein 2                  429   1e-141   
ref|NP_001151996.1|  patatin T5                                         428   2e-141   
ref|XP_009133998.1|  PREDICTED: patatin-like protein 2                  428   2e-141   
emb|CDY21469.1|  BnaC03g27280D                                          428   2e-141   
gb|EMS54202.1|  Patatin group A-3                                       434   3e-141   
ref|XP_004973688.1|  PREDICTED: patatin-2-Kuras 1-like isoform X2       429   3e-141   
ref|XP_008656522.1|  PREDICTED: patatin-like protein 1                  429   3e-141   
ref|XP_010939456.1|  PREDICTED: patatin-like protein 2 isoform X1       427   3e-141   
ref|XP_008777590.1|  PREDICTED: patatin-like protein 2                  427   3e-141   
ref|XP_010503027.1|  PREDICTED: patatin-like protein 2                  427   4e-141   
emb|CDX75621.1|  BnaA01g00810D                                          427   5e-141   
ref|XP_010446710.1|  PREDICTED: patatin-like protein 1 isoform X3       426   5e-141   
ref|XP_009139093.1|  PREDICTED: patatin-like protein 3                  427   6e-141   
ref|XP_003561574.1|  PREDICTED: patatin-like protein 1                  427   6e-141   
gb|AAD22149.1|AF061282_2  patatin-like protein                          428   6e-141   
ref|XP_010059758.1|  PREDICTED: patatin-like protein 2                  424   6e-141   
ref|XP_007017305.1|  Phospholipase A 2A, IIA,PLA2A                      427   8e-141   
gb|EAZ07350.1|  hypothetical protein OsI_29600                          427   9e-141   
ref|XP_010509131.1|  PREDICTED: patatin-like protein 2                  426   1e-140   
emb|CAN80453.1|  hypothetical protein VITISV_028107                     425   2e-140   
emb|CDX83197.1|  BnaA03g23090D                                          426   2e-140   
dbj|BAK02816.1|  predicted protein                                      427   2e-140   
ref|NP_001062043.1|  Os08g0477100                                       426   2e-140   
gb|AAD22169.1|AF061282_23  patatin-like protein                         426   2e-140   
ref|XP_002523555.1|  Patatin precursor, putative                        426   2e-140   
ref|XP_008241530.1|  PREDICTED: patatin-like protein 2                  425   2e-140   
dbj|BAK06341.1|  predicted protein                                      426   2e-140   
ref|XP_008668146.1|  PREDICTED: patatin T5 isoform X1                   425   3e-140   
ref|XP_009139287.1|  PREDICTED: patatin-like protein 1                  425   3e-140   
gb|AFJ92643.2|  phospholipase A2                                        425   3e-140   
ref|XP_002510257.1|  Patatin T5 precursor, putative                     425   3e-140   
ref|XP_009139399.1|  PREDICTED: patatin-like protein 1 isoform X2       424   4e-140   
emb|CDX69270.1|  BnaC01g01830D                                          424   4e-140   
ref|XP_010446708.1|  PREDICTED: patatin-like protein 1 isoform X1       425   5e-140   
emb|CDP01331.1|  unnamed protein product                                424   6e-140   
emb|CDX72619.1|  BnaC07g46410D                                          424   6e-140   
ref|XP_010268755.1|  PREDICTED: patatin-like protein 2                  423   8e-140   
ref|XP_006372536.1|  hypothetical protein POPTR_0017s02540g             422   9e-140   
ref|XP_002467750.1|  hypothetical protein SORBIDRAFT_01g033380          425   9e-140   
ref|XP_010939457.1|  PREDICTED: patatin-like protein 2 isoform X2       423   1e-139   
ref|XP_007156814.1|  hypothetical protein PHAVU_002G019800g             423   1e-139   
ref|XP_004160046.1|  PREDICTED: patatin group A-3-like                  422   3e-139   
ref|XP_004973689.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-2-Ku...    424   3e-139   
ref|XP_007156813.1|  hypothetical protein PHAVU_002G019700g             422   3e-139   
sp|Q6ZJD3.1|PLP2_ORYSJ  RecName: Full=Patatin-like protein 2; Sho...    422   3e-139   
gb|EMT18762.1|  Patatin group A-3                                       422   3e-139   
ref|XP_003611772.1|  Patatin-like protein                               422   4e-139   
ref|XP_006291236.1|  hypothetical protein CARUB_v10017367mg             422   4e-139   
ref|XP_004973692.1|  PREDICTED: patatin-3-Kuras 1-like                  422   5e-139   
gb|EAZ07346.1|  hypothetical protein OsI_29595                          422   8e-139   
ref|XP_006651467.1|  PREDICTED: patatin-3-Kuras 1-like                  422   8e-139   
ref|XP_009366776.1|  PREDICTED: patatin-like protein 2                  421   8e-139   
ref|XP_002445639.1|  hypothetical protein SORBIDRAFT_07g023210          422   9e-139   
ref|XP_002305891.2|  hypothetical protein POPTR_0004s08270g             421   1e-138   
ref|XP_008664528.1|  PREDICTED: patatin-like protein 2                  421   1e-138   
ref|XP_008664527.1|  PREDICTED: patatin-like protein 2                  422   2e-138   
gb|KDP38381.1|  hypothetical protein JCGZ_04306                         419   2e-138   
ref|NP_195423.1|  PATATIN-like protein 5                                421   2e-138   
ref|XP_010028281.1|  PREDICTED: patatin-like protein 2                  420   2e-138   
emb|CAN71554.1|  hypothetical protein VITISV_034739                     425   3e-138   
gb|KFK30330.1|  hypothetical protein AALP_AA7G247800                    419   4e-138   
ref|XP_010028265.1|  PREDICTED: patatin-like protein 3                  418   4e-138   
ref|XP_010680489.1|  PREDICTED: patatin-like protein 1                  419   5e-138   
ref|XP_004152795.1|  PREDICTED: patatin group A-3-like                  419   5e-138   
ref|XP_006466737.1|  PREDICTED: patatin-14-like                         419   5e-138   
ref|XP_008241846.1|  PREDICTED: patatin-like protein 1                  419   6e-138   
ref|XP_010235203.1|  PREDICTED: patatin-like protein 2                  420   6e-138   
ref|XP_008444641.1|  PREDICTED: patatin-like protein 2 isoform X1       419   8e-138   
ref|XP_009138466.1|  PREDICTED: patatin-like protein 1 isoform X1       419   1e-137   
ref|XP_010907851.1|  PREDICTED: patatin-like protein 2                  418   1e-137   
ref|XP_003577355.1|  PREDICTED: patatin-like protein 1                  418   2e-137   
ref|XP_006659498.1|  PREDICTED: patatin-T5-like                         418   2e-137   
ref|XP_006338216.1|  PREDICTED: patatin-3-Kuras 1-like                  418   2e-137   
ref|XP_010548404.1|  PREDICTED: patatin-like protein 1 isoform X1       417   2e-137   
dbj|BAJ98020.1|  predicted protein                                      418   3e-137   
ref|NP_001062042.1|  Os08g0476900                                       418   3e-137   
ref|NP_001140826.1|  uncharacterized protein LOC100272901               417   6e-137   
ref|XP_010064133.1|  PREDICTED: patatin-like protein 2                  414   9e-137   
ref|XP_006425860.1|  hypothetical protein CICLE_v10027314mg             415   1e-136   
ref|XP_007227369.1|  hypothetical protein PRUPE_ppa026872mg             416   1e-136   
ref|XP_006388385.1|  hypothetical protein POPTR_0202s00220g             415   1e-136   
ref|XP_008444642.1|  PREDICTED: patatin-like protein 2 isoform X2       416   2e-136   
ref|XP_003611771.1|  Patatin-like protein                               415   2e-136   
ref|XP_007047189.1|  Phospholipase A 2A, IIA,PLA2A                      415   2e-136   
ref|XP_004973687.1|  PREDICTED: patatin-2-Kuras 1-like isoform X1       416   2e-136   
ref|XP_003574632.1|  PREDICTED: patatin-like protein 2                  415   2e-136   
ref|XP_009392030.1|  PREDICTED: patatin-like protein 2                  415   2e-136   
ref|XP_006601293.1|  PREDICTED: patatin-11-like                         415   2e-136   
ref|XP_010514711.1|  PREDICTED: patatin-like protein 2                  415   2e-136   
emb|CDP01333.1|  unnamed protein product                                415   3e-136   
sp|B8AQW7.1|PLP1_ORYSI  RecName: Full=Patatin-like protein 1            415   4e-136   
ref|XP_002880809.1|  hypothetical protein ARALYDRAFT_344337             415   4e-136   
ref|XP_009138467.1|  PREDICTED: patatin-like protein 1 isoform X2       413   6e-136   
ref|NP_001050287.1|  Os03g0393900                                       415   7e-136   
ref|XP_010548405.1|  PREDICTED: patatin-like protein 1 isoform X2       413   8e-136   
ref|XP_008220196.1|  PREDICTED: patatin-like protein 2 isoform X1       413   2e-135   
emb|CDP01335.1|  unnamed protein product                                414   2e-135   
gb|EMT28251.1|  Patatin group A-3                                       413   2e-135   
ref|XP_008339929.1|  PREDICTED: patatin-like protein 1 isoform X2       411   3e-135   
emb|CDY42719.1|  BnaA03g53720D                                          422   3e-135   
ref|XP_007017310.1|  Phospholipase A 2A, IIA,PLA2A                      412   5e-135   
ref|XP_010320535.1|  PREDICTED: patatin-like protein 2                  410   5e-135   
ref|XP_010269002.1|  PREDICTED: patatin-like protein 2 isoform X2       409   7e-135   
emb|CDX69271.1|  BnaC01g01820D                                          411   9e-135   
ref|XP_008220198.1|  PREDICTED: patatin-like protein 2                  410   3e-134   
ref|XP_010030595.1|  PREDICTED: patatin-like protein 2                  409   3e-134   
ref|XP_004958340.1|  PREDICTED: patatin-3-Kuras 1-like                  409   4e-134   
ref|XP_006466736.1|  PREDICTED: patatin-11-like                         409   5e-134   
emb|CDP11077.1|  unnamed protein product                                408   6e-134   
ref|XP_003538815.1|  PREDICTED: patatin group D-2-like                  408   1e-133   
ref|XP_003574631.1|  PREDICTED: patatin-like protein 2                  409   1e-133   
ref|XP_009797489.1|  PREDICTED: patatin-like protein 2 isoform X2       405   1e-133   
gb|EMT32376.1|  Patatin group A-3                                       408   1e-133   
ref|XP_009366946.1|  PREDICTED: patatin-like protein 1 isoform X2       406   2e-133   
ref|XP_008378197.1|  PREDICTED: patatin-like protein 2                  408   2e-133   
ref|NP_195422.3|  PATATIN-like protein 4                                408   2e-133   
ref|XP_007224534.1|  hypothetical protein PRUPE_ppa024261mg             407   2e-133   
ref|XP_002869006.1|  hypothetical protein ARALYDRAFT_490916             407   5e-133   
ref|XP_004511941.1|  PREDICTED: patatin-05-like                         406   8e-133   
gb|ABK24853.1|  unknown                                                 405   8e-133   
ref|XP_010061769.1|  PREDICTED: patatin-like protein 2                  405   1e-132   
ref|XP_003544453.1|  PREDICTED: patatin-05                              406   1e-132   
ref|XP_004289234.1|  PREDICTED: patatin group A-3-like                  405   1e-132   
emb|CDP02475.1|  unnamed protein product                                405   1e-132   
ref|XP_004288059.1|  PREDICTED: patatin group A-3-like                  404   2e-132   
gb|AAK18751.1|  patatin-like protein                                    405   2e-132   
ref|XP_010269072.1|  PREDICTED: patatin-like protein 2 isoform X2       402   3e-132   
ref|XP_009370196.1|  PREDICTED: patatin-like protein 2                  405   3e-132   
emb|CDP07842.1|  unnamed protein product                                405   3e-132   
ref|XP_008393824.1|  PREDICTED: patatin-like protein 2                  401   3e-132   
gb|EPS59074.1|  hypothetical protein M569_15736                         402   3e-132   
ref|XP_003544451.1|  PREDICTED: patatin-05-like                         404   5e-132   
ref|NP_001190942.1|  PATATIN-like protein 5                             405   6e-132   
ref|XP_007160830.1|  hypothetical protein PHAVU_001G020100g             404   6e-132   
gb|KHN42072.1|  Patatin group A-3                                       404   7e-132   
tpg|DAA48470.1|  TPA: hypothetical protein ZEAMMB73_976536              405   8e-132   
ref|XP_009349524.1|  PREDICTED: patatin-like protein 2                  404   9e-132   
ref|NP_001078506.1|  patatin-related phospholipase A                    402   1e-131   
gb|EMS48649.1|  Patatin group A-3                                       407   1e-131   
emb|CDP11080.1|  unnamed protein product                                402   1e-131   
emb|CDY42720.1|  BnaA03g53730D                                          403   1e-131   
ref|XP_009370192.1|  PREDICTED: patatin-like protein 2                  401   1e-131   
emb|CDX72620.1|  BnaC07g46420D                                          403   1e-131   
ref|XP_009138468.1|  PREDICTED: patatin-like protein 3                  403   1e-131   
ref|XP_006425859.1|  hypothetical protein CICLE_v10027498mg             402   1e-131   
ref|XP_010269079.1|  PREDICTED: patatin-like protein 2 isoform X3       399   2e-131   
tpg|DAA42302.1|  TPA: hypothetical protein ZEAMMB73_996038              404   2e-131   
gb|EMS46263.1|  Patatin group A-3                                       402   3e-131   
ref|XP_008241523.1|  PREDICTED: patatin-like protein 3 isoform X1       401   4e-131   
ref|XP_008357460.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    408   5e-131   
ref|XP_009366768.1|  PREDICTED: patatin-like protein 2                  400   5e-131   
ref|XP_004979723.1|  PREDICTED: uncharacterized protein LOC101762...    412   5e-131   
ref|XP_008378189.1|  PREDICTED: patatin-like protein 2                  400   9e-131   
ref|XP_010446707.1|  PREDICTED: patatin-like protein 3                  402   1e-130   
ref|XP_008671929.1|  PREDICTED: patatin-like protein 1                  400   1e-130   
ref|XP_010028278.1|  PREDICTED: patatin-like protein 2 isoform X1       399   2e-130   
ref|XP_010432095.1|  PREDICTED: patatin-like protein 3                  401   2e-130   
ref|XP_010548410.1|  PREDICTED: patatin-like protein 3 isoform X1       399   4e-130   
ref|XP_008457873.1|  PREDICTED: patatin-like protein 2                  398   5e-130   
ref|XP_009781952.1|  PREDICTED: patatin-like protein 3                  399   5e-130   
ref|XP_007202145.1|  hypothetical protein PRUPE_ppa007009mg             398   6e-130   
ref|XP_004167584.1|  PREDICTED: LOW QUALITY PROTEIN: patatin grou...    398   7e-130   
ref|XP_009366807.1|  PREDICTED: patatin-like protein 2                  398   7e-130   
ref|XP_008241529.1|  PREDICTED: patatin-like protein 3                  397   1e-129   
gb|KFK30329.1|  hypothetical protein AALP_AA7G247700                    398   1e-129   
ref|XP_007203278.1|  hypothetical protein PRUPE_ppa025529mg             396   2e-129   
ref|XP_008367973.1|  PREDICTED: patatin-like protein 2                  395   1e-128   
ref|XP_004962815.1|  PREDICTED: patatin-T5-like                         397   1e-128   
ref|XP_010437267.1|  PREDICTED: patatin-like protein 3                  396   1e-128   
gb|EMT31709.1|  Patatin group A-3                                       394   1e-128   
ref|XP_010652820.1|  PREDICTED: patatin-like protein 1                  394   1e-128   
ref|XP_011099197.1|  PREDICTED: patatin-like protein 2                  396   2e-128   
ref|XP_006411934.1|  hypothetical protein EUTSA_v10025319mg             395   2e-128   
ref|XP_010446706.1|  PREDICTED: patatin-like protein 3                  395   2e-128   
gb|AAF98369.1|AF158253_1  patatin-like protein 3                        395   3e-128   
ref|XP_006448680.1|  hypothetical protein CICLE_v10015510mg             394   3e-128   
ref|XP_009799856.1|  PREDICTED: patatin-like protein 2                  394   4e-128   
ref|XP_004167585.1|  PREDICTED: patatin group A-3-like                  393   6e-128   
ref|XP_010094388.1|  Patatin group A-3                                  393   7e-128   
ref|XP_007203506.1|  hypothetical protein PRUPE_ppa024781mg             393   8e-128   
ref|XP_008457869.1|  PREDICTED: patatin-like protein 2 isoform X1       393   8e-128   
ref|XP_009589625.1|  PREDICTED: patatin-like protein 3                  392   2e-127   
ref|XP_010102583.1|  Patatin group A-3                                  392   2e-127   
ref|XP_006285080.1|  hypothetical protein CARUB_v10006413mg             393   2e-127   
ref|XP_004148052.1|  PREDICTED: patatin group A-3-like                  392   2e-127   
ref|XP_002523557.1|  Patatin class 1 precursor, putative                391   3e-127   
ref|XP_003577353.1|  PREDICTED: patatin-like protein 1                  391   4e-127   
ref|XP_004148073.1|  PREDICTED: patatin group A-3-like                  391   4e-127   
gb|AEF30538.1|  patatin-like phospholipase 1                            391   6e-127   
ref|XP_006468499.1|  PREDICTED: patatin group M-2-like                  390   7e-127   
ref|XP_011099198.1|  PREDICTED: patatin-like protein 2                  391   8e-127   
gb|KDP31895.1|  hypothetical protein JCGZ_12356                         390   1e-126   
ref|XP_009613240.1|  PREDICTED: patatin-like protein 2                  390   1e-126   
ref|XP_008457871.1|  PREDICTED: patatin-like protein 3                  390   1e-126   
dbj|BAJ94292.1|  predicted protein                                      390   1e-126   
gb|EMS52853.1|  Patatin group M-3                                       390   2e-126   
ref|XP_004288058.1|  PREDICTED: patatin group A-3-like                  389   3e-126   
tpg|DAA48471.1|  TPA: patatin class 1                                   389   4e-126   
gb|EAZ06806.1|  hypothetical protein OsI_29050                          390   6e-126   
gb|EMT06740.1|  Patatin group A-3                                       389   6e-126   
ref|XP_008457877.1|  PREDICTED: LOW QUALITY PROTEIN: patatin-like...    387   8e-126   
ref|NP_001149326.1|  patatin class 1                                    389   9e-126   
emb|CBI21441.3|  unnamed protein product                                402   9e-126   
ref|XP_006425839.1|  hypothetical protein CICLE_v10025791mg             387   2e-125   
ref|XP_010109903.1|  Patatin group A-3                                  386   2e-125   
gb|ACN33435.1|  unknown                                                 387   3e-125   
gb|EMT12539.1|  Patatin group A-3                                       386   5e-125   
gb|KCW66180.1|  hypothetical protein EUGRSUZ_F00017                     383   6e-125   
gb|EEE68866.1|  hypothetical protein OsJ_27669                          387   7e-125   
ref|NP_001061678.1|  Os08g0376500                                       387   8e-125   



>ref|XP_006354913.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   522 bits (1344),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 269/403 (67%), Positives = 323/403 (80%), Gaps = 20/403 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ERK SQ Q  T G+++TVLSIDGGGIRGIIPA IL++LE+QLQELDG DARLADYFDV+
Sbjct  1     MERKTSQIQPPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVM  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             +GTSTGGLVTAMLTAPDEN RPLYAAKDI PFYL + PKIFPQK G F  I   ++++ G
Sbjct  61    AGTSTGGLVTAMLTAPDENNRPLYAAKDITPFYLEHCPKIFPQKSGLFAPIRNIVQTLIG  120

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
              KYDGKYL  ++K++LKD RL++T+TNVVIPTFDIK LQP IFSTY+ KR    +A LSD
Sbjct  121   SKYDGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLSD  180

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CIGTSAAPTYLPAHYFK+++G        +  +E+++IDGGV ANNP L+AIS+V+K+I
Sbjct  181   ICIGTSAAPTYLPAHYFKVEDG-------KNNVREHHLIDGGVVANNPGLIAISEVSKEI  233

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
             F NNPD +PIKPM+  RFLVIS+GTG A  E KYNS  AAKWGI+ WLLHK S PLIEVF
Sbjct  234   FKNNPDFYPIKPMEYGRFLVISLGTGAAKYEQKYNSSMAAKWGIVEWLLHKGSNPLIEVF  293

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              ++S+DMVD HNS VFQAL   E+SYLRIQ            +  L+GT++S+DVAT+EN
Sbjct  294   TQSSADMVDYHNSVVFQAL-RSEDSYLRIQ------------EDELSGTEASVDVATKEN  340

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             LE+LVEIGE LLKKP+SRVNLETG+SEPIP  GTNE+ALKR A
Sbjct  341   LERLVEIGENLLKKPLSRVNLETGLSEPIPKGGTNEEALKRFA  383



>ref|XP_009617797.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana tomentosiformis]
Length=420

 Score =   519 bits (1337),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 283/436 (65%), Positives = 347/436 (80%), Gaps = 24/436 (6%)
 Frame = -3

Query  1586  KIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             ++ERK SQ Q  T G+++TVLSIDGGGIRGIIPA IL++LE+QLQELDG DARLADYFDV
Sbjct  6     QMERKASQIQPPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGNDARLADYFDV  65

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSV  1230
             I+GTSTGGLVTAMLTAPDEN RPLYAAKDI PFYL + PKIFPQ K G F  I   ++++
Sbjct  66    IAGTSTGGLVTAMLTAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAI  125

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  ++K++LKD RL++T+TNVVIPTFDIK LQP IFSTY+ KR    +A L
Sbjct  126   IGPKYDGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKL  185

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+CI TSAAPTYLPAHYFK+++       T    KE+++IDGGVAANNP L+AIS+V+K
Sbjct  186   SDICISTSAAPTYLPAHYFKVED-------TKGNVKEHHLIDGGVAANNPALIAISEVSK  238

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I  +NPD FPIKPMD  RFLVISIGTG+A  E+KYN+  AAKWGI++WL HK STPLIE
Sbjct  239   EILKDNPDFFPIKPMDYGRFLVISIGTGSAKWEHKYNASMAAKWGIVNWLFHKGSTPLIE  298

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
             VF ++S+D+VD HNS VFQAL   +N+YLRIQ            +  L+GT++S+D+AT+
Sbjct  299   VFFQSSADLVDYHNSVVFQAL-HSDNNYLRIQ------------EDELSGTEASVDIATK  345

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSP  330
             ENLE+LVEIG+ LLKKP+SRVNLETG++EPIP  GTNE+AL R A+ L NERRLRESRSP
Sbjct  346   ENLERLVEIGQNLLKKPLSRVNLETGLTEPIPKGGTNEEALIRFARLLVNERRLRESRSP  405

Query  329   VTKRT*WFRQSYKVSR  282
             +TK+     + Y +SR
Sbjct  406   LTKKV---SKKYSLSR  418



>ref|XP_006354911.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   517 bits (1332),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 267/403 (66%), Positives = 321/403 (80%), Gaps = 20/403 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ERK SQ Q  T G+++TVLSIDGGGIRGIIPA IL++LE+QLQELDG DARLADYFDV+
Sbjct  1     MERKTSQIQPPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVM  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             +GTSTGGLVTAMLTAPDEN RPLYAAKDI PFYL N PKIFPQK G F  I   ++++ G
Sbjct  61    AGTSTGGLVTAMLTAPDENNRPLYAAKDITPFYLENCPKIFPQKSGLFTPIRNIVQTLIG  120

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
              K DGKYL  ++K++LKD RL++T+TNVVIPTFDIK LQP IFSTY+ KR    +A LSD
Sbjct  121   SKCDGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLSD  180

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CIGTSAAPTYLPAHYFK+++G           +E+++IDGGVAANNP L+AIS+V+K+I
Sbjct  181   ICIGTSAAPTYLPAHYFKVEDGKDN-------VREHHLIDGGVAANNPGLIAISEVSKEI  233

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
             F NNPD +PIKPM+  RFLVIS+GTG A  E KYNS  AAKWGI+ WLLHK S PLIEVF
Sbjct  234   FKNNPDFYPIKPMEYGRFLVISLGTGAAKYEQKYNSSMAAKWGIVEWLLHKGSNPLIEVF  293

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              ++S+DMVD HNS VFQAL   E+SYLRIQ            +  L+GT++S+DVAT+EN
Sbjct  294   TQSSADMVDYHNSVVFQAL-RSEDSYLRIQ------------EDELSGTEASVDVATKEN  340

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             LE+LVEIGE LLKKP+SR+NLETG++EPIP  GTNE+AL R A
Sbjct  341   LERLVEIGENLLKKPLSRINLETGLTEPIPKGGTNEEALTRFA  383



>gb|AAF98368.1|AF158027_1 patatin-like protein 1 [Nicotiana tabacum]
Length=420

 Score =   516 bits (1330),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 282/436 (65%), Positives = 346/436 (79%), Gaps = 24/436 (6%)
 Frame = -3

Query  1586  KIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             ++ERK SQ Q  T G+++TVLSIDGGGIRGIIPA IL++LE+QLQELDG DARLADYFDV
Sbjct  6     QMERKASQIQPPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGNDARLADYFDV  65

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSV  1230
             I+GTSTGGLVTAMLTAPDEN RPLYAAKDI PFYL + PKIFPQ K G F  I   ++++
Sbjct  66    IAGTSTGGLVTAMLTAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAI  125

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  ++K++LKD RL++T+TNVVIPTFDIK LQP IFSTY+ KR    +A L
Sbjct  126   IGPKYDGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKL  185

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+CI TSAAPTYLPAHYFK+++       T    KE+++IDGGVAANNP L+AIS+V+K
Sbjct  186   SDICISTSAAPTYLPAHYFKVED-------TKGNVKEHHLIDGGVAANNPALIAISEVSK  238

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I  +N D FPIKPMD  RFLVISIGTG+A  E+KYN+  AAKWGI++WL HK STPLIE
Sbjct  239   EILKDNSDFFPIKPMDYGRFLVISIGTGSAKWEHKYNASMAAKWGIVNWLFHKGSTPLIE  298

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
             VF ++S+D+VD HNS VFQAL   +N+YLRIQ            +  L+GT++S+D+AT+
Sbjct  299   VFFQSSADLVDYHNSVVFQAL-HSDNNYLRIQ------------EDELSGTEASVDIATK  345

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSP  330
             ENLE+LVEIG+ LLKKP+SRVNLETG++EPIP  GTNE+AL R A+ L NERRLRESRSP
Sbjct  346   ENLERLVEIGQNLLKKPLSRVNLETGLTEPIPKGGTNEEALIRFARLLVNERRLRESRSP  405

Query  329   VTKRT*WFRQSYKVSR  282
             +TK+     + Y +SR
Sbjct  406   LTKKV---SKKYSLSR  418



>ref|XP_004238176.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=405

 Score =   516 bits (1328),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 271/404 (67%), Positives = 324/404 (80%), Gaps = 21/404 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ERK SQ Q  T G+++TVLSIDGGGIRGIIPA IL++LE+QLQELDG++ARLADYFDVI
Sbjct  1     MERKTSQIQPPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGKEARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVF  1227
             +GTSTGGLVTAMLTAPDEN RPLYAAKDI PFYL + PKIFPQK  G F  I   ++++ 
Sbjct  61    AGTSTGGLVTAMLTAPDENNRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNIVQTLI  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKYDGKYL  ++K++LKD RL++T+TNVVIPTFDIK LQP IFSTY+ KR    +A LS
Sbjct  121   GPKYDGKYLHQVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLS  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CI TSAAPTYLPAHYFK+++       T    KE+++IDGGVAANNP L+AIS+V+K+
Sbjct  181   DICISTSAAPTYLPAHYFKVED-------TKGNFKEHHLIDGGVAANNPGLIAISEVSKE  233

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             IF NNPD +PIKPM+  RFLVIS+GTG A  E KYNS  AAKWGIL WLL+K S PLIEV
Sbjct  234   IFKNNPDFYPIKPMEYGRFLVISLGTGAAKYEQKYNSSMAAKWGILEWLLNKGSNPLIEV  293

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F ++S+DMVD HNS VFQAL   E+SYLRIQ            +  L+GT++S+DVAT+E
Sbjct  294   FTQSSADMVDYHNSVVFQAL-RSEDSYLRIQ------------EDELSGTEASVDVATKE  340

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             NLE+LVEIGE LLKKP+SRVNLETG+SEPIP  GTNE+ALKR A
Sbjct  341   NLERLVEIGENLLKKPLSRVNLETGLSEPIPKGGTNEEALKRFA  384



>ref|XP_009801077.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=403

 Score =   515 bits (1326),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 265/406 (65%), Positives = 323/406 (80%), Gaps = 21/406 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ERK SQ Q  T G+++TVLSIDGGGIRGIIPA IL++LE QLQELDG DARLADYFDVI
Sbjct  1     MERKTSQIQPPTYGDLITVLSIDGGGIRGIIPATILSFLEAQLQELDGNDARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVF  1227
             +GTSTGGLVTAMLTAPDEN RPLYAAKDI PFYL + PKIFPQ K G F  I   ++++ 
Sbjct  61    AGTSTGGLVTAMLTAPDENDRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNMVQAII  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKYDGKYL  ++K++LKD RL++T+TNVVIPTFDIK LQP IFSTY+ KR    +A LS
Sbjct  121   GPKYDGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRSACYDAKLS  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CI TSAAPTYLPAHYFK+++G           KE+++IDGGVAANNP L+A+S+V+K+
Sbjct  181   DICISTSAAPTYLPAHYFKVEDGKGN-------VKEHHLIDGGVAANNPALIAVSEVSKE  233

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             I  +NPD FPIKPMD  RFLVISIGTG+A  E+KYN+   AKWGI+ WL HK STPLIEV
Sbjct  234   ILKDNPDFFPIKPMDYGRFLVISIGTGSAKWEHKYNASMTAKWGIVDWLFHKGSTPLIEV  293

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F ++S+D+VD HNS VFQAL  C+++YLRIQ            +  L GT++S+D+AT+E
Sbjct  294   FTQSSADLVDYHNSVVFQAL-RCDDNYLRIQ------------EDELNGTEASVDIATKE  340

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             NLE+LVEIG+ LLKKP+SRVNLETG++EPIP  GTNE+ALKR A+ 
Sbjct  341   NLERLVEIGQNLLKKPLSRVNLETGLAEPIPKGGTNEEALKRFARL  386



>emb|CBI19549.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   513 bits (1321),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 259/399 (65%), Positives = 312/399 (78%), Gaps = 20/399 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+LSIDG GIRGIIPA ILA LE+QLQELDG+DAR+ADYFDVI+GTSTG
Sbjct  8     QIQPPTYGNLVTILSIDGRGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTG  67

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             GLVTAMLTAP++  RPL+AAKDIKPFYL +GPKIFP + G FG I    RS+ GP YDGK
Sbjct  68    GLVTAMLTAPNDEKRPLFAAKDIKPFYLEHGPKIFPHRRGIFGWIMNIFRSIVGPNYDGK  127

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL +L+K++L   RL  TLT+VVIPTFDIK+LQP IFS+Y+ KR P ++A L+D+CIG+S
Sbjct  128   YLHNLIKEKLGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADICIGSS  187

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTY PA++FK Q+   +EG      +E N+IDGGVAANNP LVAISQVTKQ+FD NPD
Sbjct  188   AAPTYFPAYFFKNQD---KEG----KARELNLIDGGVAANNPALVAISQVTKQVFDKNPD  240

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
               PIKPMD  RFLVISIGTG+  +E KYN+K AAKWG+L WLLH  STPL++VF +AS+D
Sbjct  241   FLPIKPMDYGRFLVISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQASAD  300

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD H S VFQAL   E++YLRIQ              +L GT +++DV T+ENL  LV+
Sbjct  301   MVDFHISVVFQAL-HSEDNYLRIQ------------DDTLHGTNATVDVTTKENLGNLVK  347

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             IGE+LLKKPVSRVNLETG+S P+ + GTNE+ALKR AK 
Sbjct  348   IGERLLKKPVSRVNLETGLSVPVENCGTNEEALKRFAKL  386



>ref|XP_006354914.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=406

 Score =   512 bits (1319),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 281/423 (66%), Positives = 334/423 (79%), Gaps = 21/423 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ERK SQ Q  T G+ +T+LSIDGGGIRGIIPA IL++LE QLQELDG+DA LADYFDVI
Sbjct  1     MERKTSQIQPPTYGDFITILSIDGGGIRGIIPATILSFLELQLQELDGKDATLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVF  1227
             +GTSTGGLVTAMLT+PDEN RPLYAAKDI PFYL + PKIFPQ K G F  I   ++++ 
Sbjct  61    AGTSTGGLVTAMLTSPDENHRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGKMVQALI  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKYDGKYL  ++K++LKD  +++T+TNVVIPTFDIK LQP IFSTY+ KR    +A LS
Sbjct  121   GPKYDGKYLHKVVKEKLKDTCISNTITNVVIPTFDIKKLQPTIFSTYETKRSTCCDAKLS  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CI TSAAPTYLPAHYFK+++G           KE+N+IDGGVAANNP L+AIS+V+K+
Sbjct  181   DICISTSAAPTYLPAHYFKVEDGKGN-------VKEHNLIDGGVAANNPGLIAISEVSKE  233

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             IF NNPD FPIKPMD  RFLVIS+GTG A  E KYNS   AKWGI+ WL HK STPL+EV
Sbjct  234   IFKNNPDFFPIKPMDYGRFLVISLGTGAAKCEQKYNSLMGAKWGIVDWLFHKGSTPLVEV  293

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F ++S+DMVD HNS VFQAL   ENSYLRIQ            +  L GT++S+DVAT++
Sbjct  294   FTQSSADMVDYHNSVVFQALRS-ENSYLRIQ------------EDELIGTEASVDVATKK  340

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPV  327
             NLE+LVEIGEKLLKKP+SRVNLETG++EPIP  GTNE+ALKR A  L NERRLRESRSP+
Sbjct  341   NLERLVEIGEKLLKKPLSRVNLETGLTEPIPKGGTNEEALKRFATLLVNERRLRESRSPL  400

Query  326   TKR  318
              K+
Sbjct  401   IKK  403



>ref|XP_004238177.1| PREDICTED: patatin-like protein 2 [Solanum lycopersicum]
Length=406

 Score =   511 bits (1317),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 278/423 (66%), Positives = 335/423 (79%), Gaps = 21/423 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ERK SQ Q  T G+ +T+LSIDGGGIRGIIPA IL +LE+QLQELDG++AR+ADYFDVI
Sbjct  1     MERKTSQIQPPTYGDFITILSIDGGGIRGIIPATILTFLESQLQELDGKNARIADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVF  1227
             +GTSTGGLV AMLTAPDEN RPLYAAKDI PFYL + PKIFPQ K G F  I   ++++ 
Sbjct  61    AGTSTGGLVAAMLTAPDENHRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGKMVQALI  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKYDGKYL  ++K++LKDI +++T+TNVVIPTFDIK LQP IFSTY+ KR    +A LS
Sbjct  121   GPKYDGKYLHEVVKEKLKDICISNTITNVVIPTFDIKKLQPTIFSTYETKRSTCCDAKLS  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CI TSAAPTYLPAHYFK+++G           KE+++IDGGVAANNP L+AIS+V+K+
Sbjct  181   DICISTSAAPTYLPAHYFKVEDGKGN-------VKEHHLIDGGVAANNPGLIAISEVSKE  233

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             IF NNPD FPIKPMD  RFLVIS+GTG A  E KYNS   AKWGI+ WL+HK STPL+EV
Sbjct  234   IFKNNPDFFPIKPMDYGRFLVISLGTGAAKCEQKYNSLMGAKWGIVDWLIHKGSTPLVEV  293

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F ++S+DMVD HNS VFQAL   ENSYLRIQ            +  L GT++S+DVAT++
Sbjct  294   FTQSSADMVDYHNSIVFQALRS-ENSYLRIQ------------EDELIGTEASVDVATKK  340

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPV  327
             NLE+LVEIGE+LLKKP+SRVNLETG+SEP P  GTNE+ALKR A+ L NERRLRE RSP+
Sbjct  341   NLERLVEIGEQLLKKPLSRVNLETGLSEPTPKGGTNEEALKRFARLLVNERRLRELRSPL  400

Query  326   TKR  318
              K+
Sbjct  401   IKK  403



>ref|XP_006354912.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=404

 Score =   508 bits (1309),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 265/404 (66%), Positives = 320/404 (79%), Gaps = 21/404 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ERK SQ Q  T G+++TVLSIDGGGIRGIIPA IL++LE+QLQELDG DARLADYFDV+
Sbjct  1     MERKTSQIQPPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGSDARLADYFDVM  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVF  1227
             +GTSTG LVTAMLTAPDEN RPLYAAKDI PFYL + PKIFPQ K G F  I   ++++ 
Sbjct  61    AGTSTGSLVTAMLTAPDENNRPLYAAKDITPFYLEHCPKIFPQKKCGLFAPIGNIVQTLI  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             G KYDGKYL  ++K++LKD RL++T+TNVVIPTFDIK LQP IFSTY+ KR    +A LS
Sbjct  121   GSKYDGKYLHEVVKEKLKDTRLSNTITNVVIPTFDIKKLQPTIFSTYETKRAACYDAKLS  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CI TSAAPTYLPAHYFK+++            +E+++IDGGVAANNP L+AIS+V+K+
Sbjct  181   DICISTSAAPTYLPAHYFKVEDSKGN-------VREHHLIDGGVAANNPGLIAISEVSKE  233

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             IF NNPD +PIKPM+  RFLVIS+GTG A  E KYNS   AKWGI+ WL HK STPL+EV
Sbjct  234   IFKNNPDFYPIKPMEYGRFLVISLGTGAAKCEQKYNSLMGAKWGIVDWLFHKGSTPLVEV  293

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F ++S+DMVD HNS VFQAL   E+SYLRIQ            +  L+GT++S+DVAT+E
Sbjct  294   FTQSSADMVDYHNSVVFQAL-RSEDSYLRIQ------------EDELSGTEASVDVATKE  340

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             NLE+LVEIGEKLLKKP+SRVNLETG++EPIP  GTNE+ALKR A
Sbjct  341   NLERLVEIGEKLLKKPLSRVNLETGLTEPIPKGGTNEEALKRFA  384



>ref|XP_002282366.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=411

 Score =   508 bits (1308),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 266/399 (67%), Positives = 319/399 (80%), Gaps = 20/399 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T G++VT+LSIDGGGIRGIIPA ILA LE+QLQELDG+DAR+ADYFDVI+GTSTG
Sbjct  13    QIQPPTYGSLVTILSIDGGGIRGIIPATILALLESQLQELDGDDARIADYFDVIAGTSTG  72

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             GLVTAMLTAPD+  RPL+AAK+I PFYL +GPKIFPQ  G FG I   +RS+ GPKYDGK
Sbjct  73    GLVTAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPQTRGIFGWIMSIVRSLIGPKYDGK  132

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL+ + K++L   RL +TLT+VVIPTFDIK+LQP IFSTY+ KR P ++A L+D+CIG+S
Sbjct  133   YLKRITKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSS  192

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTY P HYFK Q+   +EG T    +E+N+IDGGVAANNP LVAISQVTKQ+FD NPD
Sbjct  193   AAPTYFPGHYFKNQD---KEGKT----QEFNLIDGGVAANNPALVAISQVTKQVFDKNPD  245

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
              FPIKPMD  RFLVISIGTG+  +E KYN+K A+KWG+L WLLH  STPL++VFM+AS+D
Sbjct  246   FFPIKPMDFGRFLVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASAD  305

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD H S VFQAL   E++YLRIQ              +L G  +S+DVATEENL+ LV+
Sbjct  306   MVDFHISMVFQAL-HSEDNYLRIQ------------DDTLRGKDASVDVATEENLDNLVK  352

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             IGE+LLKKPVSRVNLETG+SEP+ + GTNE+ALKR AK 
Sbjct  353   IGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFAKL  391



>ref|XP_002282432.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19556.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   506 bits (1303),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 264/397 (66%), Positives = 320/397 (81%), Gaps = 20/397 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+LSIDGGGIRGIIPA ILA LET+LQELDG+DAR+ADYFDVI+GTSTG
Sbjct  8     QIQPPTYGNLVTILSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTG  67

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             G+VTAMLTAPD+  RPL+AAKDIKPFYL +GPKIFPQ  G FG I   +RS+ GPKYDGK
Sbjct  68    GIVTAMLTAPDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGK  127

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL+ L+K++L   RL +TLT+VVIPTFDIK+LQP IFSTY+ KR P ++A L+D+CIG+S
Sbjct  128   YLKRLIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSS  187

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTY PA++FK Q+   +EG T    +E+++IDGGVAANNP LVAI+QVTKQ+FD NPD
Sbjct  188   AAPTYFPAYFFKNQD---KEGKT----QEFDLIDGGVAANNPALVAITQVTKQVFDRNPD  240

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
              FPIKPMD  RFLVISIGTG+  +E KYN+K A+KWG+L WLLH  STPL++VFM+AS+D
Sbjct  241   FFPIKPMDFGRFLVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASAD  300

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD H S VFQAL   E++YLRIQ              +L G  +S+DV TEENL+ LV+
Sbjct  301   MVDFHISMVFQAL-HSEDNYLRIQ------------DDTLRGKDASVDVTTEENLDNLVK  347

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             IGE+LLKKPVSRVNLETG+SEP+ + GTNE+ALKR A
Sbjct  348   IGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFA  384



>emb|CDP01332.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   506 bits (1302),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 263/418 (63%), Positives = 320/418 (77%), Gaps = 28/418 (7%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             QA T GN++T+LSIDGGGIRG+IP VIL YLE+QLQELDGEDARLADYFDVI+GTSTGGL
Sbjct  12    QAPTYGNLITILSIDGGGIRGLIPGVILEYLESQLQELDGEDARLADYFDVIAGTSTGGL  71

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             +T+ML APDEN RPL+AAKDIKPFYL NGPKIFPQK G    +  ++++VFGPKYDG+YL
Sbjct  72    ITSMLAAPDENKRPLFAAKDIKPFYLENGPKIFPQKWGRLASVRSALKAVFGPKYDGRYL  131

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
               +++++L +IRL +TLTN+V+PTFDIKNL P IFSTY+AK    M+A LSD+CI TSAA
Sbjct  132   HQVVREKLGEIRLHETLTNIVVPTFDIKNLHPTIFSTYEAKEKKSMDARLSDLCISTSAA  191

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPP----KEYNVIDGGVAANNPTLVAISQVTKQIFDNN  852
             PTYLPA+YF+           NH      +E+N+IDGGVAANNP LVAI QVTKQIF  N
Sbjct  192   PTYLPAYYFQ-----------NHDELGNVQEFNLIDGGVAANNPALVAIGQVTKQIFRGN  240

Query  851   PDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEAS  672
             PD FPIKP D  RFLVISIGTG+A  E +YN+ +AAKWG+  WL+   STPL++VF +AS
Sbjct  241   PDFFPIKPTDYGRFLVISIGTGSAKVEERYNAAKAAKWGVFGWLISGHSTPLVDVFTQAS  300

Query  671   SDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKL  492
             +DMVDLH S VFQAL   E++YLRIQ              +L GT SS+D+AT++NL+ L
Sbjct  301   ADMVDLHLSEVFQAL-HSEDNYLRIQ------------DDTLIGTVSSVDIATKKNLDNL  347

Query  491   VEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTKR  318
             V  G +LLKKPVSRVN + G  E I + GTNE+ALKR A+ LS ERRLRE RSP+T +
Sbjct  348   VITGTQLLKKPVSRVNQQNGAVETIANGGTNEEALKRFARLLSEERRLRELRSPLTSK  405



>ref|XP_002282415.2| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=406

 Score =   504 bits (1299),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 263/397 (66%), Positives = 319/397 (80%), Gaps = 20/397 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+ SIDGGGIRGIIPA ILA LET+LQELDG+DAR+ADYFDVI+GTSTG
Sbjct  8     QIQPPTYGNLVTIFSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTG  67

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             G+VTAMLTAPD+  RPL+AAKDIKPFYL +GPKIFPQ  G FG I   +RS+ GPKYDGK
Sbjct  68    GIVTAMLTAPDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGK  127

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL+ L+K++L   RL +TLT+VVIPTFDIK+LQP IFSTY+ KR P ++A L+D+CIG+S
Sbjct  128   YLKRLIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSS  187

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTY PA++FK Q+   +EG T    +E+++IDGGVAANNP LVAI+QVTKQ+FD NPD
Sbjct  188   AAPTYFPAYFFKNQD---KEGKT----QEFDLIDGGVAANNPALVAITQVTKQVFDRNPD  240

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
              FPIKPMD  RFLVISIGTG+  +E KYN+K A+KWG+L WLLH  STPL++VFM+AS+D
Sbjct  241   FFPIKPMDFGRFLVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASAD  300

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD H S VFQAL   E++YLRIQ              +L G  +S+DV TEENL+ LV+
Sbjct  301   MVDFHISMVFQAL-HSEDNYLRIQ------------DDTLRGKDASVDVTTEENLDNLVK  347

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             IGE+LLKKPVSRVNLETG+SEP+ + GTNE+ALKR A
Sbjct  348   IGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFA  384



>ref|XP_010664933.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score =   502 bits (1293),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 253/401 (63%), Positives = 312/401 (78%), Gaps = 21/401 (5%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T GN++T+LSIDGGGIRG+IP  +L +LE++LQ+LDGEDAR++DYFDVI+GTST
Sbjct  7     SPLQPPTYGNLITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTST  66

Query  1388  GGLVTAMLTAPDEN-GRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYD  1212
             GGLVTAMLT P+EN GRPL++AKDIK FYL++ PKIFPQ  G FG I    RS+ GP YD
Sbjct  67    GGLVTAMLTTPNENTGRPLFSAKDIKDFYLDHCPKIFPQHRGIFGWIMNIFRSIVGPNYD  126

Query  1211  GKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIG  1032
             GKYL +L+K++L   RL  TLT+VVIPTFDIK+LQP IFS+Y+ KR P ++A L+D+CIG
Sbjct  127   GKYLHNLIKEKLGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADICIG  186

Query  1031  TSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNN  852
             +SAAPTY PA++FK Q+   +EG      +E N+IDGGVAANNP LVAISQVTKQ+FD N
Sbjct  187   SSAAPTYFPAYFFKNQD---KEG----KARELNLIDGGVAANNPALVAISQVTKQVFDKN  239

Query  851   PDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEAS  672
             PD  PIKPMD  RFLVISIGTG+  +E KYN+K AAKWG+L WLLH  STPL++VF +AS
Sbjct  240   PDFLPIKPMDYGRFLVISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQAS  299

Query  671   SDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKL  492
             +DMVD H S VFQAL   E++YLRIQ              +L GT +++DV T+ENL  L
Sbjct  300   ADMVDFHISVVFQAL-HSEDNYLRIQ------------DDTLHGTNATVDVTTKENLGNL  346

Query  491   VEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             V+IGE+LLKKPVSRVNLETG+S P+ + GTNE+ALKR AK 
Sbjct  347   VKIGERLLKKPVSRVNLETGLSVPVENCGTNEEALKRFAKL  387



>emb|CAN68798.1| hypothetical protein VITISV_008805 [Vitis vinifera]
Length=400

 Score =   502 bits (1292),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 262/394 (66%), Positives = 316/394 (80%), Gaps = 20/394 (5%)
 Frame = -3

Query  1550  TGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTA  1371
             T G++VT+LSIDGGGIRGIIPA ILA LE+QLQ LDG+DAR+ADYFDVI+GTSTGGLVTA
Sbjct  7     TYGSLVTILSIDGGGIRGIIPATILALLESQLQXLDGDDARIADYFDVIAGTSTGGLVTA  66

Query  1370  MLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSL  1191
             MLTAPD+  RPL+AAK+I PFYL +GPKIFP+  G FG I   +RS+ GPKYDGKYL+ +
Sbjct  67    MLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPZTRGIFGWIMSIVRSLIGPKYDGKYLKRI  126

Query  1190  LKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTY  1011
              K++L   RL +TLT+VVIPTFDIK+LQP IFSTY+ KR P ++A L+D+CIG+SAAPTY
Sbjct  127   TKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAPTY  186

Query  1010  LPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIK  831
              P HYFK Q+   +EG T    +E+N+IDGGVAANNP LVAISQVTKQ+FD NPD FPIK
Sbjct  187   FPGHYFKNQD---KEGKT----QEFNLIDGGVAANNPALVAISQVTKQVFDKNPDFFPIK  239

Query  830   PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLH  651
             PMD  RFLVISIGTG+  +E KYN+K A+KWG+L WLLH  STPL++VFM+AS+DMVD H
Sbjct  240   PMDFGRFLVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFH  299

Query  650   NSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKL  471
              S VFQAL   E++YLRIQ              +L G  +S+DVATEENL+ LV+IGE+L
Sbjct  300   ISMVFQAL-HSEDNYLRIQ------------DDTLRGKDASVDVATEENLDNLVKIGERL  346

Query  470   LKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LKKPVSRVNLETG+SEP+ + GTNE+ALKR AK 
Sbjct  347   LKKPVSRVNLETGLSEPVENGGTNEEALKRFAKL  380



>ref|XP_002282440.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
 emb|CBI19555.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   501 bits (1290),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 264/399 (66%), Positives = 318/399 (80%), Gaps = 20/399 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+LSIDGGGIRGIIPA ILA LE+ LQELDG+DAR+ADYFDVI+GTSTG
Sbjct  8     QVQPPTYGNLVTILSIDGGGIRGIIPATILACLESHLQELDGDDARIADYFDVIAGTSTG  67

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             GLV AMLTAPD+  RPL+AAKDI+PFYL +GPKIFPQ  G FG I   +RS+ GPKYDGK
Sbjct  68    GLVAAMLTAPDDQKRPLFAAKDIRPFYLEHGPKIFPQIRGIFGWIMSILRSIVGPKYDGK  127

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL+SL+K++L    L +TLT+VVIPTFDIK+LQP IFSTY+ KR P ++A L+D+CIG+S
Sbjct  128   YLKSLIKEKLGGTWLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPSLDAPLADICIGSS  187

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTY PA+YFK Q+   +EG T    +E+++IDGGVAANNP LVAI+QVTKQ+FD NPD
Sbjct  188   AAPTYFPAYYFKNQD---KEGKT----QEFDLIDGGVAANNPALVAITQVTKQVFDRNPD  240

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
              FPIK MD  RFLVISIGTG+  +E KYN+K AAKWG+L WLLH  STPL++VFM+AS+D
Sbjct  241   FFPIKYMDFGRFLVISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFMQASAD  300

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD H S VFQAL   E++YLRIQ              +L G  +S+DV TEENL+ LV+
Sbjct  301   MVDFHISMVFQAL-HSEDNYLRIQ------------DDTLRGKDASVDVTTEENLDNLVK  347

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             IGE+LLKKPVSRVNLETG+SEP+ + GTNE+ALKR AK 
Sbjct  348   IGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFAKL  386



>emb|CBI19558.3| unnamed protein product [Vitis vinifera]
Length=423

 Score =   501 bits (1291),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 261/399 (65%), Positives = 318/399 (80%), Gaps = 20/399 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T G++VT+LSIDGGGIRGIIPA ILA LE+QLQ +DG+DAR+ADYFDVI+GTSTG
Sbjct  8     QIQPPTYGSLVTILSIDGGGIRGIIPATILALLESQLQAVDGDDARIADYFDVIAGTSTG  67

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             GLVTAMLTAPD+  RPL+AAK+I PFYL +GPKIFP+  G FG I   +RS+ GPKYDGK
Sbjct  68    GLVTAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPETRGIFGWIMSIVRSLIGPKYDGK  127

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL+ ++K++L   RL +TLT+VVIPTFDIK+LQP IFSTY+ KR P ++A L+D+CIG+S
Sbjct  128   YLKRIIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSS  187

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTY P HYFK Q+   +EG T    +E+N+IDGGVAANNP LVAI+QVTKQ+FD NPD
Sbjct  188   AAPTYFPGHYFKNQD---KEGKT----QEFNLIDGGVAANNPALVAITQVTKQVFDKNPD  240

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
              FPIKPMD  RFLVISIGTG+  +E KYN+K A+KWG+L WLLH  STPL++VFM+AS+D
Sbjct  241   FFPIKPMDFGRFLVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASAD  300

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD H S VFQAL   E++YLRIQ              +L G  +S+DV TEENL+ LV+
Sbjct  301   MVDFHISMVFQAL-HSEDNYLRIQ------------DDTLRGKDASVDVTTEENLDNLVK  347

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             IGE+LLKKPVSRVNLETG+SEP+ + GTNE+ALKR AK 
Sbjct  348   IGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFAKL  386



>emb|CBI19560.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   502 bits (1292),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 262/390 (67%), Positives = 314/390 (81%), Gaps = 20/390 (5%)
 Frame = -3

Query  1538  IVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAMLTA  1359
             +VT+LSIDGGGIRGIIPA ILA LE+QLQELDG+DAR+ADYFDVI+GTSTGGLVTAMLTA
Sbjct  48    LVTILSIDGGGIRGIIPATILALLESQLQELDGDDARIADYFDVIAGTSTGGLVTAMLTA  107

Query  1358  PDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLKKE  1179
             PD+  RPL+AAK+I PFYL +GPKIFPQ  G FG I   +RS+ GPKYDGKYL+ + K++
Sbjct  108   PDDQKRPLFAAKEIMPFYLEHGPKIFPQTRGIFGWIMSIVRSLIGPKYDGKYLKRITKEK  167

Query  1178  LKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLPAH  999
             L   RL +TLT+VVIPTFDIK+LQP IFSTY+ KR P ++A L+D+CIG+SAAPTY P H
Sbjct  168   LGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSSAAPTYFPGH  227

Query  998   YFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPMDL  819
             YFK Q+   +EG T    +E+N+IDGGVAANNP LVAISQVTKQ+FD NPD FPIKPMD 
Sbjct  228   YFKNQD---KEGKT----QEFNLIDGGVAANNPALVAISQVTKQVFDKNPDFFPIKPMDF  280

Query  818   SRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNSAV  639
              RFLVISIGTG+  +E KYN+K A+KWG+L WLLH  STPL++VFM+AS+DMVD H S V
Sbjct  281   GRFLVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMV  340

Query  638   FQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLKKP  459
             FQAL   E++YLRIQ              +L G  +S+DVATEENL+ LV+IGE+LLKKP
Sbjct  341   FQAL-HSEDNYLRIQ------------DDTLRGKDASVDVATEENLDNLVKIGERLLKKP  387

Query  458   VSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             VSRVNLETG+SEP+ + GTNE+ALKR AK 
Sbjct  388   VSRVNLETGLSEPVENGGTNEEALKRFAKL  417



>ref|XP_003589236.1| Patatin-like protein [Medicago truncatula]
 gb|AES59487.1| patatin-like phospholipase [Medicago truncatula]
Length=417

 Score =   498 bits (1283),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 265/419 (63%), Positives = 317/419 (76%), Gaps = 24/419 (6%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+LSIDGGGIRG+IPA I+ +LE+ LQELDGEDARLADYFDVISGTSTG
Sbjct  11    QIQPPTYGNLVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTG  70

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSI-RSVFGPKYDG  1209
             GLVTAML APD+N RPL+AAKDIKPFYL + PKIFPQ  G    +   + RS+ GPKYDG
Sbjct  71    GLVTAMLAAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGATLLAKVMRSLGGPKYDG  130

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGT  1029
             KYL  +++++L DIRL +TLTN+V+PTFDIK LQP+IFS+YQ KR P ++A LSD+CI T
Sbjct  131   KYLHQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQLKRSPCLDAKLSDICIST  190

Query  1028  SAAPTYLPAHYF--KIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDN  855
             SAAPTYLPAH F  K  E  K+E        E+N+IDGGV ANNP LVA+++VTKQI + 
Sbjct  191   SAAPTYLPAHNFTNKDDEAGKEE--------EFNLIDGGVCANNPALVAMNEVTKQIINQ  242

Query  854   NPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEA  675
             +PD FPIKP++  RFL+ISIGTGTA NE K+ ++ AAKWG+L WL    S PLI+VF ++
Sbjct  243   SPDFFPIKPLEYGRFLIISIGTGTAKNEEKFTAQMAAKWGLLDWLTQSGSNPLIDVFTQS  302

Query  674   SSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEK  495
             S DMVD H SAV QAL   +N YLRIQ              +LTG  SS+D+ATEENL+K
Sbjct  303   SGDMVDFHLSAVTQALHSADN-YLRIQ------------DDTLTGIDSSVDIATEENLKK  349

Query  494   LVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTKR  318
             L +IGE LLKKPVSRVNLE G  EP+ +  TNE+ALKRLAK LS ERRLRE RSP T R
Sbjct  350   LCQIGENLLKKPVSRVNLENGHFEPLTNGETNEEALKRLAKILSQERRLREMRSPHTSR  408



>ref|XP_003589238.1| Patatin-like protein [Medicago truncatula]
 gb|AES59489.1| patatin-like phospholipase [Medicago truncatula]
Length=415

 Score =   492 bits (1267),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 264/419 (63%), Positives = 316/419 (75%), Gaps = 26/419 (6%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+LSIDGGGIRG+IPA I+ +LE+ LQELDGEDARLADYFDVISGTSTG
Sbjct  11    QIQPPTYGNLVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTG  70

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSI-RSVFGPKYDG  1209
             GLVTAML APD+N RPL+AAKDIKPFYL + PKIFPQ  G    +   + RS+ GPKYDG
Sbjct  71    GLVTAMLAAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGATLLAKVMRSLGGPKYDG  130

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGT  1029
             KYL  +++++L DIRL +TLTN+V+PTFDIK LQP+IFS+YQ  R P ++A LSD+CI T
Sbjct  131   KYLHQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQ--RSPCLDAKLSDICIST  188

Query  1028  SAAPTYLPAHYF--KIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDN  855
             SAAPTYLPAH F  K  E  K+E        E+N+IDGGV ANNP LVA+++VTKQI + 
Sbjct  189   SAAPTYLPAHNFTNKDDEAGKEE--------EFNLIDGGVCANNPALVAMNEVTKQIINQ  240

Query  854   NPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEA  675
             +PD FPIKP++  RFL+ISIGTGTA NE K+ ++ AAKWG+L WL    S PLI+VF ++
Sbjct  241   SPDFFPIKPLEYGRFLIISIGTGTAKNEEKFTAQMAAKWGLLDWLTQSGSNPLIDVFTQS  300

Query  674   SSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEK  495
             S DMVD H SAV QAL   +N YLRIQ              +LTG  SS+D+ATEENL+K
Sbjct  301   SGDMVDFHLSAVTQALHSADN-YLRIQ------------DDTLTGIDSSVDIATEENLKK  347

Query  494   LVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTKR  318
             L +IGE LLKKPVSRVNLE G  EP+ +  TNE+ALKRLAK LS ERRLRE RSP T R
Sbjct  348   LCQIGENLLKKPVSRVNLENGHFEPLTNGETNEEALKRLAKILSQERRLREMRSPHTSR  406



>ref|XP_007136666.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
 gb|ESW08660.1| hypothetical protein PHAVU_009G063500g [Phaseolus vulgaris]
Length=408

 Score =   491 bits (1264),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 257/426 (60%), Positives = 328/426 (77%), Gaps = 23/426 (5%)
 Frame = -3

Query  1583  IERKPS---QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYF  1413
             +ER  S   Q Q  T GN+VT+LSIDGGGIR IIPA ILA+LE QLQELDGEDARLADYF
Sbjct  1     MERSKSSLLQIQPPTYGNLVTILSIDGGGIRAIIPATILAFLEAQLQELDGEDARLADYF  60

Query  1412  DVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRS  1233
             DVI+GTSTGGLVTAML+AP+++ RPL+AAKDI+PFYL++ PKIFPQ+   +G I   +RS
Sbjct  61    DVIAGTSTGGLVTAMLSAPNDHQRPLFAAKDIRPFYLDHSPKIFPQRSSIWGWIQKLLRS  120

Query  1232  VFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAY  1053
             + GPKYD KYL+ +++++L + RL +TLTN+VIPTFDIK LQP+IFS+YQ KR P ++A 
Sbjct  121   LGGPKYDAKYLQGVVREKLGETRLHETLTNIVIPTFDIKTLQPIIFSSYQIKRSPYLDAP  180

Query  1052  LSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVT  873
             LSD+CI TSAAPTYLP ++FK  +    EG T H   E+N+IDGGV ANNP+LVAI+QVT
Sbjct  181   LSDICISTSAAPTYLPPYHFKNSDS---EG-TMH---EFNLIDGGVCANNPSLVAINQVT  233

Query  872   KQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             KQI ++NPD F IKPM+  RFLVIS+GTGT  NE+K+N+K AAKWG+  WL +  STPLI
Sbjct  234   KQIINDNPDFFSIKPMEYGRFLVISLGTGTPKNEHKFNAKMAAKWGLFDWLTNSGSTPLI  293

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             +V   +S+DMVD H + V QAL   +N+YLRIQ              +LTG  +S+D+AT
Sbjct  294   DVLTHSSADMVDFHLATVTQAL-HSKNNYLRIQ------------DDTLTGVDASLDIAT  340

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrS  333
             +EN+EKL +IG++LLKKPVS++NLETG+ EP+    TNEDAL+R AK LS+ER  RE +S
Sbjct  341   KENMEKLSQIGDRLLKKPVSQINLETGLFEPMGDGETNEDALRRFAKMLSDERSFRELKS  400

Query  332   PVTKRT  315
             P T ++
Sbjct  401   PHTNKS  406



>ref|XP_006354910.1| PREDICTED: LOW QUALITY PROTEIN: patatin group M-3-like [Solanum 
tuberosum]
Length=405

 Score =   490 bits (1262),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 272/422 (64%), Positives = 324/422 (77%), Gaps = 22/422 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ERK SQ Q  T G+ +TVLSIDGGGIRGIIPA IL++LE+QLQE DG+DARLA+YFDVI
Sbjct  1     MERKTSQIQPPTYGDFITVLSIDGGGIRGIIPATILSFLESQLQEFDGKDARLAEYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVF  1227
             +GTSTGGLVTAMLTAPDEN RP YAAKDI PFYL + PKIFPQ K G F  +   ++++ 
Sbjct  61    AGTSTGGLVTAMLTAPDENNRPFYAAKDITPFYLEHCPKIFPQNKCGLFASMRKMVQALI  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKYDGKYL  ++K++LKD  L++T+TNVVIPTFDIK LQP IFSTY+ KR  + +A LS
Sbjct  121   GPKYDGKYLHEVIKEKLKDSLLSNTITNVVIPTFDIKKLQPTIFSTYETKRSARYDAKLS  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CI TSAAPTYLPAHYFK+++   +  I  H     N+IDGGVAANNP L+AIS+V+K+
Sbjct  181   DICISTSAAPTYLPAHYFKVED--DKGNIIEH-----NLIDGGVAANNPCLIAISEVSKE  233

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             I   NPD FPIKPMD  RFLVISIGTG    E +YNS  AAKWGI+ WL HK  TPL EV
Sbjct  234   ILKENPDFFPIKPMDYGRFLVISIGTGAPKLEQEYNSSMAAKWGIVDWLFHKGCTPLFEV  293

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F ++S+DM+D HNS VFQAL   E+SYLRIQ            +  L+GT++      +E
Sbjct  294   FTQSSADMIDYHNSVVFQAL-HSEDSYLRIQ------------EDGLSGTEAQXGCGYKE  340

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPV  327
             NLE+LVEIGEKLL KP+SRVNLETG+ EPIP  GTNE+ALKR AK L +ERRLRESRSPV
Sbjct  341   NLERLVEIGEKLLXKPLSRVNLETGL-EPIPKGGTNEEALKRFAKLLVDERRLRESRSPV  399

Query  326   TK  321
             TK
Sbjct  400   TK  401



>emb|CBI19557.3| unnamed protein product [Vitis vinifera]
Length=849

 Score =   504 bits (1299),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 263/397 (66%), Positives = 319/397 (80%), Gaps = 20/397 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+ SIDGGGIRGIIPA ILA LET+LQELDG+DAR+ADYFDVI+GTSTG
Sbjct  8     QIQPPTYGNLVTIFSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTG  67

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             G+VTAMLTAPD+  RPL+AAKDIKPFYL +GPKIFPQ  G FG I   +RS+ GPKYDGK
Sbjct  68    GIVTAMLTAPDDQKRPLFAAKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGK  127

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL+ L+K++L   RL +TLT+VVIPTFDIK+LQP IFSTY+ KR P ++A L+D+CIG+S
Sbjct  128   YLKRLIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSS  187

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTY PA++FK Q+   +EG T    +E+++IDGGVAANNP LVAI+QVTKQ+FD NPD
Sbjct  188   AAPTYFPAYFFKNQD---KEGKT----QEFDLIDGGVAANNPALVAITQVTKQVFDRNPD  240

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
              FPIKPMD  RFLVISIGTG+  +E KYN+K A+KWG+L WLLH  STPL++VFM+AS+D
Sbjct  241   FFPIKPMDFGRFLVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASAD  300

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD H S VFQAL   E++YLRIQ              +L G  +S+DV TEENL+ LV+
Sbjct  301   MVDFHISMVFQALHS-EDNYLRIQ------------DDTLRGKDASVDVTTEENLDNLVK  347

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             IGE+LLKKPVSRVNLETG+SEP+ + GTNE+ALKR A
Sbjct  348   IGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFA  384



>ref|XP_003544452.1| PREDICTED: patatin-3-Kuras 1-like [Glycine max]
 gb|KHN46308.1| Patatin group A-3 [Glycine soja]
Length=408

 Score =   489 bits (1259),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 274/427 (64%), Positives = 325/427 (76%), Gaps = 21/427 (5%)
 Frame = -3

Query  1592  MVKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYF  1413
             M + E    Q Q  T GN+VT+LSIDGGGIRGIIPA I+ +LE+QLQELDG +ARLADYF
Sbjct  1     MERAESSIEQIQPPTYGNLVTILSIDGGGIRGIIPATIIGFLESQLQELDGPEARLADYF  60

Query  1412  DVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVS-IR  1236
             DVISGTSTGGLVTAM+TAPD N RPL+AAKDIKPFY+++ PKIFPQ  G  G I    IR
Sbjct  61    DVISGTSTGGLVTAMITAPDNNNRPLFAAKDIKPFYMDHCPKIFPQHSGLGGTILAKMIR  120

Query  1235  SVFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNA  1056
             S+ GPKYDGKYL  ++K++L DIRL +TLTNVVIPTFDIK+LQP+IFS+Y+ K  P M+A
Sbjct  121   SLGGPKYDGKYLHEVVKEKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYKLKISPCMDA  180

Query  1055  YLSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQV  876
              LSD+CI TSAAPTYLPAH F  Q+             E+N+IDGGV ANNPTLVA+++V
Sbjct  181   KLSDICISTSAAPTYLPAHNFNNQDSKGN-------VHEFNLIDGGVCANNPTLVAMNEV  233

Query  875   TKQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPL  696
             TKQI   NPD FPIKPM+  RFL+ISIGTGTA NE K+N++ AAKWG+L WL    S PL
Sbjct  234   TKQIIMQNPDFFPIKPMEYGRFLIISIGTGTAKNEEKFNAQMAAKWGLLDWLTQSGSNPL  293

Query  695   IEVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVA  516
             I+VF ++SSDMVD H SAV QAL   E++YLRIQ              +LTGT SS+D+A
Sbjct  294   IDVFSQSSSDMVDFHLSAVTQAL-HSEDNYLRIQ------------DDTLTGTDSSVDIA  340

Query  515   TEENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresr  336
             T+ENLEKL  +GEKLLKKPVSR+NLE G+ EP+ +  TNEDALKR AK LS ERRLRE R
Sbjct  341   TKENLEKLCHVGEKLLKKPVSRINLENGLFEPLKNRETNEDALKRFAKILSQERRLREMR  400

Query  335   SPVTKRT  315
             SP TK+T
Sbjct  401   SPHTKKT  407



>ref|XP_010664934.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=407

 Score =   489 bits (1258),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 262/400 (66%), Positives = 314/400 (79%), Gaps = 21/400 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+LSIDGGGIRGIIPA ILA LE+QLQELDG+DAR+ADYFDVI+GTSTG
Sbjct  8     QIQPPTYGNLVTILSIDGGGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTG  67

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVFGPKYDG  1209
             GLVTAMLTAP++  RPL+AAKDIKPFYL +GPKIFPQ+  G FG I    RS+ GP YDG
Sbjct  68    GLVTAMLTAPNDEKRPLFAAKDIKPFYLKHGPKIFPQRRWGIFGWIMNIFRSIVGPNYDG  127

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGT  1029
             KYL +L+K++L   RL  TLT+VVIPTFDIK+LQP IFS+Y+ KR P ++A L+D+CIG+
Sbjct  128   KYLHNLIKEKLGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADICIGS  187

Query  1028  SAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNP  849
             SAAPTY PA++FK Q+   +EG      +E N+IDGGVAANNP LVAISQVTKQ+FD NP
Sbjct  188   SAAPTYFPAYFFKNQD---KEGKA----RELNLIDGGVAANNPALVAISQVTKQVFDKNP  240

Query  848   DLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASS  669
             D  PIKPMD  RFLVISIGTG+  +E KYN+K AAKWG+L WLLH  STPL++VF +AS+
Sbjct  241   DFLPIKPMDYGRFLVISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQASA  300

Query  668   DMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLV  489
             DMVD H S VFQAL   E++YLRIQ              +L GT +S+DV T+ENL  LV
Sbjct  301   DMVDFHISVVFQAL-HSEDNYLRIQ------------DDTLHGTDASVDVTTKENLGNLV  347

Query  488   EIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +IGE+LLKKPVSRVNLETG+S P+ + GTNE+ALKR AK 
Sbjct  348   KIGERLLKKPVSRVNLETGLSVPVENCGTNEEALKRFAKL  387



>gb|AFK35290.1| unknown [Medicago truncatula]
Length=417

 Score =   488 bits (1257),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 262/419 (63%), Positives = 314/419 (75%), Gaps = 24/419 (6%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+LSIDGGGIRG+IPA I+ +LE+ LQELDGEDARLADYFDVISGTSTG
Sbjct  11    QIQPPTYGNLVTILSIDGGGIRGLIPAAIIEFLESHLQELDGEDARLADYFDVISGTSTG  70

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSI-RSVFGPKYDG  1209
             GLVTAML APD+N RPL+AAKDIKPF L + PKIFPQ  G    +   + RS+ GPKYDG
Sbjct  71    GLVTAMLAAPDKNNRPLFAAKDIKPFCLEHCPKIFPQHRGLSATLLAKVMRSLGGPKYDG  130

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGT  1029
             KYL  +++++L DIRL +TLTN+V+PTFDIK LQP+IFS+YQ KR P ++A LSD+ I T
Sbjct  131   KYLHQVVREKLGDIRLHETLTNIVVPTFDIKTLQPIIFSSYQLKRSPCLDAKLSDIRIST  190

Query  1028  SAAPTYLPAHYF--KIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDN  855
             SAAPTYLPAH F  K  E  K+E        E+N+IDGGV ANNP LVA+++VTKQI + 
Sbjct  191   SAAPTYLPAHNFTNKDDEAGKEE--------EFNLIDGGVCANNPALVAMNEVTKQIINQ  242

Query  854   NPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEA  675
             +PD FPIKP++  RFL+ISIGTG A NE K+ ++ AAKWG+L WL    S PLI+VF ++
Sbjct  243   SPDFFPIKPLEYGRFLIISIGTGAAKNEEKFTAQMAAKWGLLDWLTQSGSNPLIDVFTQS  302

Query  674   SSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEK  495
             S DMVD H SAV QAL   +N YLRIQ              +LTG  SS+D+ATEENL+K
Sbjct  303   SGDMVDFHLSAVTQALHSADN-YLRIQ------------DDTLTGIDSSVDIATEENLKK  349

Query  494   LVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTKR  318
             L +IGE LLKKPVSRVNLE G  EP+ +  TNE+ALKRLAK LS ERRLRE RSP T R
Sbjct  350   LYQIGENLLKKPVSRVNLENGHFEPLTNGETNEEALKRLAKILSQERRLREMRSPHTSR  408



>ref|XP_004499075.1| PREDICTED: patatin-2-Kuras 3-like isoform X1 [Cicer arietinum]
Length=418

 Score =   488 bits (1255),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 247/399 (62%), Positives = 306/399 (77%), Gaps = 21/399 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+LSIDGGGIRG+IPA I+ +LE+QLQELDGEDARLADYFDVISGTSTG
Sbjct  11    QIQPPTYGNLVTILSIDGGGIRGLIPATIIEFLESQLQELDGEDARLADYFDVISGTSTG  70

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVS-IRSVFGPKYDG  1209
             GLVTAM+ APD+N RPL+AAKDIKPFYL + PKIFPQ  G  G +    +RS+ GPKYDG
Sbjct  71    GLVTAMIAAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGGIMLAKVVRSLGGPKYDG  130

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGT  1029
             KYL  +++++L DIRL +T+TN+VIPTFDIK+LQP+IFS+YQ ++ P ++A LSD+CI T
Sbjct  131   KYLHDVIREKLGDIRLHETITNIVIPTFDIKSLQPIIFSSYQLEKSPCLDAKLSDICIST  190

Query  1028  SAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNP  849
             SAAPTYLPA+ F  ++        N+  +E+N+IDGGV ANNP LVA+++VTKQI + +P
Sbjct  191   SAAPTYLPAYNFTNKD-------PNNHEEEFNLIDGGVCANNPALVAMNEVTKQIINQSP  243

Query  848   DLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASS  669
             D FPIKP++  RFL+IS+GTGTA NE K+++  AAKWG+L WL +  S PLI+VF ++S 
Sbjct  244   DFFPIKPLEYGRFLIISLGTGTAKNEEKFSADIAAKWGLLGWLTNSGSNPLIDVFTQSSG  303

Query  668   DMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLV  489
             DMVD H S V QAL   +N YLRIQ              +LTG  SS+D+ATEENLEKL 
Sbjct  304   DMVDFHLSCVTQALHSQDN-YLRIQ------------DDTLTGDVSSVDIATEENLEKLC  350

Query  488   EIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             EIG+KLLKKPVSRVNLE G  EP+    TNE ALKRLAK
Sbjct  351   EIGDKLLKKPVSRVNLENGHFEPVIDGETNEQALKRLAK  389



>ref|XP_003549405.1| PREDICTED: patatin-3-Kuras 1 [Glycine max]
Length=409

 Score =   486 bits (1251),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 273/428 (64%), Positives = 329/428 (77%), Gaps = 25/428 (6%)
 Frame = -3

Query  1583  IERKPS---QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYF  1413
             +ER  S   Q Q  T GN+VT+LSIDGGGIRGIIPA I+ +LE+QLQELDG DARLADYF
Sbjct  1     MERAKSSIEQIQPPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPDARLADYF  60

Query  1412  DVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVS-IR  1236
             DVISGTSTGGLVTAM+TAPD N RPL+AAKDIKPFY+++ PKIFPQ  G  G I    ++
Sbjct  61    DVISGTSTGGLVTAMITAPDNNNRPLFAAKDIKPFYMDHSPKIFPQHSGLGGTILAKVVK  120

Query  1235  SVF-GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMN  1059
             S+  GPKYDGKYL  +++++L DIRL +TLTNVVIPTFDIK+LQP+IFS+YQ K  P ++
Sbjct  121   SLLGGPKYDGKYLHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYQIKNSPSLD  180

Query  1058  AYLSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQ  879
             A LSD+CI TSAAPTYLPAH F  Q+       +N    E+N+IDGGV ANNPTLVA+++
Sbjct  181   AKLSDICISTSAAPTYLPAHNFNNQD-------SNGKVHEFNLIDGGVCANNPTLVAMNE  233

Query  878   VTKQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTP  699
             VTKQI   N DLFPIKP++  RFL+ISIGTGTA NE K+N++ AAKWG+L WL    STP
Sbjct  234   VTKQIIKQNSDLFPIKPLEYGRFLIISIGTGTAKNEEKFNAQMAAKWGLLDWLTQSGSTP  293

Query  698   LIEVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDV  519
             LI+VF ++S+DMVD H SAV QAL   +N YLRIQ              +LTGT SS+D+
Sbjct  294   LIDVFTQSSADMVDFHLSAVTQALHSQDN-YLRIQ------------DDTLTGTDSSVDI  340

Query  518   ATEENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlres  339
             AT+ENLEKL +IGEKLLKKPVSRVNLE G+ EP+ +  TNEDALKR AK LS ERRLRE 
Sbjct  341   ATKENLEKLSQIGEKLLKKPVSRVNLENGLFEPLKNRETNEDALKRFAKILSQERRLREM  400

Query  338   rSPVTKRT  315
             +SP TK++
Sbjct  401   KSPHTKKS  408



>gb|KHN12765.1| Patatin group A-3 [Glycine soja]
Length=409

 Score =   486 bits (1250),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 272/428 (64%), Positives = 328/428 (77%), Gaps = 22/428 (5%)
 Frame = -3

Query  1592  MVKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYF  1413
             M K +    Q Q  T GN+VT+LSIDGGGIRGIIPA I+ +LE+QLQELDG DARLADYF
Sbjct  1     MEKAKSSIEQIQPPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPDARLADYF  60

Query  1412  DVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVS-IR  1236
             DVISGTSTGGLVTAM+TAPD N RPL+AAKDIKPFY+++ PKIFPQ  G  G I    ++
Sbjct  61    DVISGTSTGGLVTAMITAPDNNNRPLFAAKDIKPFYMDHCPKIFPQHSGLGGTILAKVVK  120

Query  1235  SVF-GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMN  1059
             S+  GPKYDGKYL  +++++L DIRL +TLTNVVIPTFDIK+LQP+IFS+YQ K  P ++
Sbjct  121   SLLGGPKYDGKYLHGVVREKLGDIRLHETLTNVVIPTFDIKSLQPIIFSSYQIKNSPSLD  180

Query  1058  AYLSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQ  879
             A LSD+CI TSAAPTYLPAH F  Q+       +N    E+N+IDGGV ANNPTLVA+++
Sbjct  181   AKLSDICISTSAAPTYLPAHNFNNQD-------SNGKVHEFNLIDGGVCANNPTLVAMNE  233

Query  878   VTKQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTP  699
             VTKQI   N DLFPIKP++  RFL+ISIGTGTA NE K+N++ AAKWG+L WL    STP
Sbjct  234   VTKQIIKQNSDLFPIKPLEYGRFLIISIGTGTAKNEEKFNAQMAAKWGLLDWLTQSGSTP  293

Query  698   LIEVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDV  519
             LI+VF ++S+DMVD H SAV QAL   +N YLRIQ              +LTGT SS+D+
Sbjct  294   LIDVFTQSSADMVDFHLSAVTQALHSQDN-YLRIQ------------DDTLTGTDSSVDI  340

Query  518   ATEENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlres  339
             AT+ENLEKL +IGEKLLKKPVSRVNLE G+ EP+ +  TNEDALKR AK LS ERRLRE 
Sbjct  341   ATKENLEKLSQIGEKLLKKPVSRVNLENGLFEPLKNRETNEDALKRFAKILSQERRLREM  400

Query  338   rSPVTKRT  315
             +SP TK++
Sbjct  401   KSPHTKKS  408



>ref|XP_009769117.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=410

 Score =   485 bits (1249),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 266/415 (64%), Positives = 328/415 (79%), Gaps = 20/415 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T G ++T+LSIDGGGIRGIIPA IL YLE+QLQELDGEDARLADYFD+I+GTSTGGL
Sbjct  14    QPPTYGKLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGL  73

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLTAPD++ RPL+AAKDIKPFYL +GPKIFPQK   FG I  +++S+ GPKY+GKYL
Sbjct  74    VTAMLTAPDKDKRPLFAAKDIKPFYLEHGPKIFPQKKMVFGSIVKTLKSLIGPKYNGKYL  133

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
               +++++L +  L +TLTNVVIPTFDIKNLQP IFST++A+  P M+A LSD+CI TSAA
Sbjct  134   HQVIEEKLGETLLHETLTNVVIPTFDIKNLQPTIFSTFEARVKPLMDAKLSDICISTSAA  193

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAHYF+ Q+   ++G  +    E+N++DGGVAANNP LVA SQVT+QI   NPD F
Sbjct  194   PTYLPAHYFRTQD---KDGNFH----EFNLVDGGVAANNPALVATSQVTRQIMTGNPDFF  246

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PIKP+D  RFLVISIGTG+A  E KYN+K A+KWGIL WLL+  STP+++VF +AS DMV
Sbjct  247   PIKPIDYGRFLVISIGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMV  306

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             DLH S VFQAL   EN YLRIQ              +LTGT SS+D++T+EN++KLVEIG
Sbjct  307   DLHISVVFQALHSEEN-YLRIQ------------DDTLTGTDSSVDISTKENMDKLVEIG  353

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTKRT  315
             + LLKKPVSRVNL+TG+SE   + GTNE+ LKR A  LS E+RLR+S+SP T ++
Sbjct  354   KTLLKKPVSRVNLQTGLSEQSKNDGTNEETLKRFAMLLSEEKRLRDSKSPHTNKS  408



>ref|XP_002277305.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
Length=407

 Score =   484 bits (1247),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 244/392 (62%), Positives = 297/392 (76%), Gaps = 21/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             GN++T+LSIDGGG+RGIIP +ILA+LE++LQ+LDGEDARLADYFDVI+GTSTGGL+TAML
Sbjct  18    GNLITILSIDGGGVRGIIPGIILAFLESELQKLDGEDARLADYFDVIAGTSTGGLITAML  77

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             TAP++  RPLYAA  IKPFYL N PKIFP + G FG I    + + GPKYDGKYL +LLK
Sbjct  78    TAPNQENRPLYAASGIKPFYLENCPKIFPPRSGIFGTIVNLFKVLTGPKYDGKYLHNLLK  137

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
               L D RL  TLTNVVIPTFDIK LQP IFS+YQ    P ++A LSD+CIGTSAAPTYLP
Sbjct  138   NVLGDKRLHQTLTNVVIPTFDIKKLQPTIFSSYQVAINPALDAKLSDICIGTSAAPTYLP  197

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AHYF+ Q+  +         +E+N+IDGG+AANNP LVAIS+VTKQ+F+ NPD FPIKPM
Sbjct  198   AHYFENQDDQENN-------EEFNLIDGGLAANNPCLVAISEVTKQVFNKNPDFFPIKPM  250

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  RFLVIS+GTG+A  EYKY +K AAKWG+L WL    ST L+   + AS+DMVD HN 
Sbjct  251   DYGRFLVISVGTGSAKEEYKYTAKMAAKWGVLGWLYDNGST-LLSPRVSASADMVDFHNC  309

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              VF+AL   EN YLRI               +L GT +S+++AT++NL+ LV++GE+LLK
Sbjct  310   VVFEALHSEEN-YLRID------------DDTLKGTVASVNIATKKNLDSLVKLGEELLK  356

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             KPVSRVNL+TG  EPI + GTNE+AL R AK 
Sbjct  357   KPVSRVNLDTGKYEPIKNGGTNEEALIRFAKL  388



>ref|XP_010041051.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW44683.1| hypothetical protein EUGRSUZ_L01783 [Eucalyptus grandis]
Length=405

 Score =   483 bits (1243),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 246/398 (62%), Positives = 298/398 (75%), Gaps = 20/398 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             + Q  T GNI+T+LSIDGGG+RGII A ILA LE++L+ELDGEDARLADYFDVI GTSTG
Sbjct  6     KVQPPTDGNIITILSIDGGGVRGIIAATILASLESELEELDGEDARLADYFDVIGGTSTG  65

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             GLVTAMLTAP+E  RPL+AAKDI+ FYL + PKIFPQK G +G +   ++S+ GPKYDGK
Sbjct  66    GLVTAMLTAPNEKNRPLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYDGK  125

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL  L+K +L + RL DTLT+V+IPTFDI+ LQP IFS+Y+  R P ++A LSD+CIGTS
Sbjct  126   YLHGLIKDKLGEARLHDTLTHVIIPTFDIERLQPTIFSSYEVVRSPCLDARLSDICIGTS  185

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTYLP H FK Q+     G T    +E+++IDG VAANNP LVAI+QV+K+I + NPD
Sbjct  186   AAPTYLPPHCFKNQD---DRGCT----REFHLIDGSVAANNPVLVAIAQVSKEIANANPD  238

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
              FPI   +  RFLVISIGTG+   E KYN+  AAKWG L WLLH  S PL++VF +AS+D
Sbjct  239   FFPIGATNYGRFLVISIGTGSPKRERKYNATMAAKWGTLDWLLHGGSVPLVDVFTKASAD  298

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD + SA FQAL   E++YLRI               +LTG  SS+D+AT+ENLE LV 
Sbjct  299   MVDFYISAAFQAL-HFEDNYLRIH------------DDTLTGKDSSVDIATKENLENLVR  345

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             IGE+LLKKPVSRVNLE G+SEPI    TN DALKR AK
Sbjct  346   IGERLLKKPVSRVNLEMGLSEPIAKGITNADALKRFAK  383



>ref|XP_009769118.1| PREDICTED: patatin-like protein 2 isoform X2 [Nicotiana sylvestris]
Length=386

 Score =   483 bits (1242),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 255/393 (65%), Positives = 312/393 (79%), Gaps = 20/393 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T G ++T+LSIDGGGIRGIIPA IL YLE+QLQELDGEDARLADYFD+I+GTSTGGL
Sbjct  14    QPPTYGKLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGL  73

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLTAPD++ RPL+AAKDIKPFYL +GPKIFPQK   FG I  +++S+ GPKY+GKYL
Sbjct  74    VTAMLTAPDKDKRPLFAAKDIKPFYLEHGPKIFPQKKMVFGSIVKTLKSLIGPKYNGKYL  133

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
               +++++L +  L +TLTNVVIPTFDIKNLQP IFST++A+  P M+A LSD+CI TSAA
Sbjct  134   HQVIEEKLGETLLHETLTNVVIPTFDIKNLQPTIFSTFEARVKPLMDAKLSDICISTSAA  193

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAHYF+ Q+   ++G  +    E+N++DGGVAANNP LVA SQVT+QI   NPD F
Sbjct  194   PTYLPAHYFRTQD---KDGNFH----EFNLVDGGVAANNPALVATSQVTRQIMTGNPDFF  246

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PIKP+D  RFLVISIGTG+A  E KYN+K A+KWGIL WLL+  STP+++VF +AS DMV
Sbjct  247   PIKPIDYGRFLVISIGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDMV  306

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             DLH S VFQAL   EN YLRIQ              +LTGT SS+D++T+EN++KLVEIG
Sbjct  307   DLHISVVFQALHSEEN-YLRIQ------------DDTLTGTDSSVDISTKENMDKLVEIG  353

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKR  381
             + LLKKPVSRVNL+TG+SE   + GTNE+ LKR
Sbjct  354   KTLLKKPVSRVNLQTGLSEQSKNDGTNEETLKR  386



>emb|CBI21444.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   484 bits (1245),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 244/392 (62%), Positives = 295/392 (75%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             GN++T+LSIDGGG+RGIIP +ILA+LE++LQ+LDGEDARLADYFDVI+GTSTGGL+TAML
Sbjct  18    GNLITILSIDGGGVRGIIPGIILAFLESELQKLDGEDARLADYFDVIAGTSTGGLITAML  77

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             TAP++  RPLYAA  IKPFYL N PKIFP + G FG I    + + GPKYDGKYL +LLK
Sbjct  78    TAPNQENRPLYAASGIKPFYLENCPKIFPPRSGIFGTIVNLFKVLTGPKYDGKYLHNLLK  137

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
               L D RL  TLTNVVIPTFDIK LQP IFS+YQ    P ++A LSD+CIGTSAAPTYLP
Sbjct  138   NVLGDKRLHQTLTNVVIPTFDIKKLQPTIFSSYQVAINPALDAKLSDICIGTSAAPTYLP  197

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AHYF+ Q+  +         +E+N+IDGG+AANNP LVAIS+VTKQ+F+ NPD FPIKPM
Sbjct  198   AHYFENQDDQENN-------EEFNLIDGGLAANNPCLVAISEVTKQVFNKNPDFFPIKPM  250

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  RFLVIS+GTG+A  EYKY +K AAKWG+L WL    ST L      AS+DMVD HN 
Sbjct  251   DYGRFLVISVGTGSAKEEYKYTAKMAAKWGVLGWLYDNGSTLLSPRVSGASADMVDFHNC  310

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              VF+AL   EN YLRI               +L GT +S+++AT++NL+ LV++GE+LLK
Sbjct  311   VVFEALHSEEN-YLRID------------DDTLKGTVASVNIATKKNLDSLVKLGEELLK  357

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             KPVSRVNL+TG  EPI + GTNE+AL R AK 
Sbjct  358   KPVSRVNLDTGKYEPIKNGGTNEEALIRFAKL  389



>ref|XP_004499076.1| PREDICTED: patatin-2-Kuras 3-like isoform X2 [Cicer arietinum]
Length=386

 Score =   481 bits (1239),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 244/396 (62%), Positives = 303/396 (77%), Gaps = 21/396 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+LSIDGGGIRG+IPA I+ +LE+QLQELDGEDARLADYFDVISGTSTG
Sbjct  11    QIQPPTYGNLVTILSIDGGGIRGLIPATIIEFLESQLQELDGEDARLADYFDVISGTSTG  70

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVS-IRSVFGPKYDG  1209
             GLVTAM+ APD+N RPL+AAKDIKPFYL + PKIFPQ  G  G +    +RS+ GPKYDG
Sbjct  71    GLVTAMIAAPDKNNRPLFAAKDIKPFYLEHCPKIFPQHRGLGGIMLAKVVRSLGGPKYDG  130

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGT  1029
             KYL  +++++L DIRL +T+TN+VIPTFDIK+LQP+IFS+YQ ++ P ++A LSD+CI T
Sbjct  131   KYLHDVIREKLGDIRLHETITNIVIPTFDIKSLQPIIFSSYQLEKSPCLDAKLSDICIST  190

Query  1028  SAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNP  849
             SAAPTYLPA+ F  ++        N+  +E+N+IDGGV ANNP LVA+++VTKQI + +P
Sbjct  191   SAAPTYLPAYNFTNKD-------PNNHEEEFNLIDGGVCANNPALVAMNEVTKQIINQSP  243

Query  848   DLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASS  669
             D FPIKP++  RFL+IS+GTGTA NE K+++  AAKWG+L WL +  S PLI+VF ++S 
Sbjct  244   DFFPIKPLEYGRFLIISLGTGTAKNEEKFSADIAAKWGLLGWLTNSGSNPLIDVFTQSSG  303

Query  668   DMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLV  489
             DMVD H S V QAL   +N YLRIQ              +LTG  SS+D+ATEENLEKL 
Sbjct  304   DMVDFHLSCVTQALHSQDN-YLRIQ------------DDTLTGDVSSVDIATEENLEKLC  350

Query  488   EIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKR  381
             EIG+KLLKKPVSRVNLE G  EP+    TNE ALKR
Sbjct  351   EIGDKLLKKPVSRVNLENGHFEPVIDGETNEQALKR  386



>ref|XP_002510258.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF52445.1| Patatin T5 precursor, putative [Ricinus communis]
Length=411

 Score =   482 bits (1241),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 247/397 (62%), Positives = 304/397 (77%), Gaps = 21/397 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN+VT+LSIDGGGIRG+IP  IL++LE++LQ+LDGE+AR+ADYFDVI+GTSTGGL
Sbjct  12    QPPTYGNVVTILSIDGGGIRGLIPTTILSFLESELQKLDGEEARIADYFDVIAGTSTGGL  71

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVFGPKYDGKY  1203
             VTAMLTAPDEN RPL+AAKDIK FYLN+ PKIFPQ K   F ++   ++ + GPKY+GKY
Sbjct  72    VTAMLTAPDENNRPLFAAKDIKDFYLNHCPKIFPQPKWPLFSQVKKVVKGISGPKYNGKY  131

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  L++++L   RL +TLTN+VIPTFDIK LQP IFS+Y+ K+ P ++A LSD+CI TSA
Sbjct  132   LHGLVREKLGKRRLHETLTNIVIPTFDIKQLQPTIFSSYEVKKQPSLDALLSDICISTSA  191

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYF+ +E  KQ G      +E+N+IDGGVAANNP LVAI +VTK+I   N D 
Sbjct  192   APTYLPAHYFETKE--KQTGKV----REFNLIDGGVAANNPALVAIGEVTKEILGGNSDF  245

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKPMD  RFLVISIGTG+     KYN+ +A+KWG+L WL    STPL++VF +ASSDM
Sbjct  246   FPIKPMDYGRFLVISIGTGSPKAARKYNAIKASKWGVLGWLNSGGSTPLVDVFTQASSDM  305

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD H SAVFQAL   E  YLRIQ              +L G +SS+D+AT+ NL+ LV+I
Sbjct  306   VDYHLSAVFQAL-HSEQHYLRIQ------------DDTLNGKESSVDIATKSNLKNLVKI  352

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             GE+LLKKPVSRVNLETG  EPI   GTNE+AL+R A+
Sbjct  353   GERLLKKPVSRVNLETGRFEPI-DQGTNEEALERFAR  388



>emb|CAN71271.1| hypothetical protein VITISV_001907 [Vitis vinifera]
Length=446

 Score =   482 bits (1241),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 264/439 (60%), Positives = 318/439 (72%), Gaps = 60/439 (14%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+LSIDGGGIRGIIPA ILA LE+ LQELDG+DAR+ADYFDVI+GTSTG
Sbjct  8     QVQXPTYGNLVTILSIDGGGIRGIIPATILACLESHLQELDGDDARIADYFDVIAGTSTG  67

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             GLV AMLTAPD+  RPL+AAKDI+PFYL +GPKIFPQ  G FG I   +RS+ GPKYDGK
Sbjct  68    GLVAAMLTAPDDQKRPLFAAKDIRPFYLEHGPKIFPQIRGIFGWIMSILRSIVGPKYDGK  127

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQA------------------  1080
             YL+SL+K++L    L +TLT+VVIPTFDIK+LQP IFSTY+                   
Sbjct  128   YLKSLIKEKLGGTWLHETLTSVVIPTFDIKSLQPTIFSTYEVALALSLWLYPFGPRFNRV  187

Query  1079  ----------------------KRCPKMNAYLSDVCIGTSAAPTYLPAHYFKIQEGPKQE  966
                                   KR P ++A L+D+CIG+SAAPTY PA+YFK Q+   +E
Sbjct  188   WVVAAQLMGKGCSSRLILTAMVKRSPSLDAPLADICIGSSAAPTYFPAYYFKNQD---KE  244

Query  965   GITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPMDLSRFLVISIGTG  786
             G T    +E+++IDGGVAANNP LVAI+QVTKQ+FD NPD FPIK MD  RFLVISIGTG
Sbjct  245   GKT----QEFDLIDGGVAANNPALVAITQVTKQVFDRNPDFFPIKYMDFGRFLVISIGTG  300

Query  785   TAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNSAVFQALGDCENSY  606
             +  +E KYN+K AAKWG+L WLLH  STPL++VFM+AS+DMVD H S VFQAL   E++Y
Sbjct  301   SPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFMQASADMVDFHISMVFQAL-HSEDNY  359

Query  605   LRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLKKPVSRVNLETGVS  426
             LRIQ              +L G  +S+DV TEENL+ LV+IGE+LLKKPVSRVNLETG+S
Sbjct  360   LRIQ------------DDTLRGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLS  407

Query  425   EPIPHSGTNEDALKRLAKF  369
             EP+ + GTNE+ALKR AK 
Sbjct  408   EPVENGGTNEEALKRFAKL  426



>ref|XP_008228777.1| PREDICTED: LOW QUALITY PROTEIN: patatin-like protein 2 [Prunus 
mume]
Length=406

 Score =   478 bits (1231),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 247/397 (62%), Positives = 299/397 (75%), Gaps = 21/397 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++TVLSIDGGGIRG+IP  ILA+LE++LQ+LDGEDARLADYFDVI+GTSTGGL
Sbjct  10    QPPTYGNLITVLSIDGGGIRGLIPGTILAFLESELQKLDGEDARLADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLTAPDEN RPL+AA DIK FYLN  PKIFPQ   WF  +   I+++ GPKY+GKYL
Sbjct  70    VTAMLTAPDENNRPLFAANDIKEFYLNECPKIFPQNTXWFPYVTKIIKALAGPKYNGKYL  129

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
              SL++++L D +L  TLTNVVIPTFDI+NLQP IFS+++    P  +A LSD+CIGTSAA
Sbjct  130   HSLVRQKLGDKKLHQTLTNVVIPTFDIRNLQPTIFSSFEVNHKPCFDALLSDICIGTSAA  189

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAHYFK ++G   EG      KE+N+IDGGVAANNPTL+AI +VTK I   + D F
Sbjct  190   PTYLPAHYFKTKDG---EGNV----KEFNLIDGGVAANNPTLLAIGEVTKAIIKGSSDFF  242

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PIKPMD  RFLVIS+GTG+  +E KYN+ +AAKWG+L+WL    STP+I VF  +S+DMV
Sbjct  243   PIKPMDYGRFLVISLGTGSPKDEVKYNAHDAAKWGMLNWLTSGGSTPIINVFSYSSADMV  302

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             DL+ S VFQAL   E +YLRIQ               L G  +S+DVATE+NL+ LV++G
Sbjct  303   DLNLSVVFQAL-HSEKNYLRIQ------------DDKLQGDVASVDVATEKNLDSLVQVG  349

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             E LLK+PVSRVNLETG  E   H  TNE+AL R AK 
Sbjct  350   EGLLKQPVSRVNLETGKFEACNHE-TNEEALTRFAKL  385



>ref|XP_010068174.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW88861.1| hypothetical protein EUGRSUZ_A01188 [Eucalyptus grandis]
Length=412

 Score =   478 bits (1229),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 238/392 (61%), Positives = 298/392 (76%), Gaps = 21/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             GN +T+LSIDGGGIRGI+PA IL++LE++LQ+LDG+DARLADYFDVI+GTST GL+TAML
Sbjct  14    GNFITILSIDGGGIRGIVPATILSFLESELQKLDGKDARLADYFDVIAGTSTAGLLTAML  73

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             T+P+E  RP++AAKDIK FYL +GPKIFPQ       I   ++++ GPKYDG YL SL++
Sbjct  74    TSPNEKNRPMFAAKDIKDFYLQDGPKIFPQDSCPLAPIAKMMKTLTGPKYDGNYLHSLVR  133

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             ++L DIRL  TLT+VVIPTFDIK LQP IFST+Q K  P ++A LSD+CI TSAAPTY P
Sbjct  134   EKLGDIRLHQTLTHVVIPTFDIKRLQPTIFSTFQVKNKPSIDALLSDICIATSAAPTYFP  193

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AHYFK ++     G      +E+N+IDGGVAANNPTLVAIS+VT++I    PD FPIKPM
Sbjct  194   AHYFKTED---HSGAV----REFNLIDGGVAANNPTLVAISEVTQEIIKGRPDFFPIKPM  246

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  RFLVIS+GTG+A +E +Y++ EAAKWGI+ WL    STPL+ V  +A++DMVDLH S
Sbjct  247   DYERFLVISLGTGSAKSEERYDAHEAAKWGIIGWLTSGGSTPLVNVVFQATADMVDLHLS  306

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              VFQAL   + SYLRIQ               L+G  SSMDVAT++N+  LV++GE LLK
Sbjct  307   VVFQALHSGK-SYLRIQ------------DDKLSGLTSSMDVATKKNMNDLVKVGEGLLK  353

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             KPVSRVNL+TG+ EP+ +  TNE+ALKR AK 
Sbjct  354   KPVSRVNLDTGIFEPL-NQETNEEALKRFAKL  384



>ref|XP_009797490.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=412

 Score =   478 bits (1229),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 253/399 (63%), Positives = 311/399 (78%), Gaps = 22/399 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T G ++T+LSIDGGGIRGIIPA IL YLE+QLQELDGEDARLADYFD+I+GTSTGGL
Sbjct  14    QPPTYGKLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGL  73

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGW--FGEIWVSIRSVFGPKYDGK  1206
             VTAMLTAP ++ RPL+AAKDIKPFYL +GPKIFPQK     FG +  +++S+ GPKY+GK
Sbjct  74    VTAMLTAPHKDKRPLFAAKDIKPFYLEHGPKIFPQKKSMILFGSVMKTLKSLMGPKYNGK  133

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL  +++++L + +L +TLTNVVIPTFDIKNLQP +FST++A+  P M+A LSD+C  TS
Sbjct  134   YLHQVIEEKLGETQLHETLTNVVIPTFDIKNLQPKVFSTFEAREKPLMDAKLSDICASTS  193

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTYLPAHYF+ Q+   ++G  +    E+N++DGGVAANNP LVA SQVT+QI   NPD
Sbjct  194   AAPTYLPAHYFQTQD---KDGNFH----EFNLVDGGVAANNPALVATSQVTQQIMTGNPD  246

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
              FPIKP+D  RFLVISIGTG+A  E KYN+K A+KWGIL WLL+  STP+++VF +AS D
Sbjct  247   FFPIKPIDYGRFLVISIGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGD  306

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVDLH S VFQAL   EN YLRIQ              +LTGT SS+D+AT+EN+ KLVE
Sbjct  307   MVDLHISVVFQALHSEEN-YLRIQ------------DDTLTGTNSSVDIATKENMNKLVE  353

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             IG+ LLKKPVSRVNL+TG+SE   + GTNE+ LKR  K 
Sbjct  354   IGKTLLKKPVSRVNLQTGLSEQCKNGGTNEETLKRFVKL  392



>ref|XP_002282391.3| PREDICTED: uncharacterized protein LOC100264244 [Vitis vinifera]
Length=1152

 Score =   501 bits (1291),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 261/399 (65%), Positives = 318/399 (80%), Gaps = 20/399 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T G++VT+LSIDGGGIRGIIPA ILA LE+QLQ +DG+DAR+ADYFDVI+GTSTG
Sbjct  8     QIQPPTYGSLVTILSIDGGGIRGIIPATILALLESQLQAVDGDDARIADYFDVIAGTSTG  67

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             GLVTAMLTAPD+  RPL+AAK+I PFYL +GPKIFP+  G FG I   +RS+ GPKYDGK
Sbjct  68    GLVTAMLTAPDDQKRPLFAAKEIMPFYLEHGPKIFPETRGIFGWIMSIVRSLIGPKYDGK  127

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL+ ++K++L   RL +TLT+VVIPTFDIK+LQP IFSTY+ KR P ++A L+D+CIG+S
Sbjct  128   YLKRIIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVKRSPCLDAPLADICIGSS  187

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTY P HYFK Q+   +EG T    +E+N+IDGGVAANNP LVAI+QVTKQ+FD NPD
Sbjct  188   AAPTYFPGHYFKNQD---KEGKT----QEFNLIDGGVAANNPALVAITQVTKQVFDKNPD  240

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
              FPIKPMD  RFLVISIGTG+  +E KYN+K A+KWG+L WLLH  STPL++VFM+AS+D
Sbjct  241   FFPIKPMDFGRFLVISIGTGSPKSEQKYNAKMASKWGVLGWLLHGGSTPLVDVFMQASAD  300

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD H S VFQAL   E++YLRIQ              +L G  +S+DV TEENL+ LV+
Sbjct  301   MVDFHISMVFQAL-HSEDNYLRIQ------------DDTLRGKDASVDVTTEENLDNLVK  347

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             IGE+LLKKPVSRVNLETG+SEP+ + GTNE+ALKR AK 
Sbjct  348   IGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFAKL  386



>ref|XP_003527713.1| PREDICTED: patatin-like [Glycine max]
 gb|KHN22305.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   477 bits (1228),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 263/416 (63%), Positives = 328/416 (79%), Gaps = 20/416 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+LSIDGGGIRGIIPA ILA+LE QLQELDGEDARLADYFDVI+GTSTG
Sbjct  10    QIQPPTYGNLVTILSIDGGGIRGIIPATILAFLEAQLQELDGEDARLADYFDVIAGTSTG  69

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             G+VTAML+AP++N RPL+AAKDIKPFYL + PKIFPQ  G +G +   + S+ GPKYDGK
Sbjct  70    GIVTAMLSAPNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSVGKLLGSLGGPKYDGK  129

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL+ +++++L   RL +TLTN+VIPTFDIK LQP+IFS+YQ KR P ++A LSD+CI TS
Sbjct  130   YLKEVVREKLGQTRLHETLTNIVIPTFDIKTLQPIIFSSYQIKRSPCLDARLSDICISTS  189

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTYLPA++FK Q+    +G T+    E+N+IDGGV ANNPTLVA++QVTKQI + NPD
Sbjct  190   AAPTYLPAYHFKNQDS---QGNTH----EFNLIDGGVCANNPTLVAMNQVTKQIINENPD  242

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
              F IKPM+  RFL+IS+GTGT  NE K+N++ AAKWG+L WL +  STPLI+VF ++S+D
Sbjct  243   FFSIKPMEYGRFLIISLGTGTPKNEQKFNAQMAAKWGLLDWLTNSGSTPLIDVFTQSSAD  302

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD H + V QAL   EN+YLRIQ              +LTGT SS+D+AT+ENLEKL +
Sbjct  303   MVDFHLATVTQAL-HSENNYLRIQ------------DDTLTGTDSSVDIATKENLEKLSQ  349

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTKR  318
             IGE+LLKKPVS++NLE G+ E + +  TNE+ALKR AK LS ERRLRES+SP TK+
Sbjct  350   IGERLLKKPVSQINLEDGLFESVGNGETNENALKRFAKILSQERRLRESKSPHTKK  405



>gb|KHN04516.1| Patatin group A-3 [Glycine soja]
Length=414

 Score =   476 bits (1226),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 259/416 (62%), Positives = 327/416 (79%), Gaps = 20/416 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+LSIDGGGIRGIIPA ILA+LE QLQELDGEDARLADYFDVI+GTSTG
Sbjct  10    QIQPPTYGNLVTILSIDGGGIRGIIPATILAFLEAQLQELDGEDARLADYFDVIAGTSTG  69

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             G+VTAMLTAP++N RPL+AAKDIKPFYL + PKIFPQ  G +G +   +RS+ GPKY+GK
Sbjct  70    GIVTAMLTAPNDNQRPLFAAKDIKPFYLEHCPKIFPQHSGLWGSVGKLLRSLGGPKYNGK  129

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL+ ++++++ + RL +TLTN+VIPTFDIK LQP+IFS+YQ KR P ++A LSD+CI TS
Sbjct  130   YLQEVVREKVGETRLHETLTNIVIPTFDIKTLQPIIFSSYQIKRSPCLDARLSDICISTS  189

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTYLPA++F  ++    EG  +    ++N+IDGGV ANNPTLVA++QVTKQI ++NPD
Sbjct  190   AAPTYLPAYHFNNKDS---EGNMH----QFNLIDGGVCANNPTLVAMNQVTKQILNDNPD  242

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
              F IKPM+  RFL+IS+GTGT  NE K+N++ AAKWG+L WL +  STPLI+VF ++S+D
Sbjct  243   FFSIKPMEYGRFLIISLGTGTPKNEQKFNAQMAAKWGLLDWLTNSGSTPLIDVFTQSSAD  302

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD H + V QAL   EN+YLRIQ              +LTGT  S+D+AT+ENLEKL +
Sbjct  303   MVDFHLATVTQAL-HSENNYLRIQ------------DDTLTGTDYSVDIATKENLEKLSQ  349

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTKR  318
             IGE+LLKKPVS++NLE G+ EP+ +  TNEDALKR AK L  ERRLRE +SP TK+
Sbjct  350   IGERLLKKPVSQINLEDGLFEPVGNGETNEDALKRFAKILLKERRLRELKSPHTKK  405



>ref|XP_010068219.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=412

 Score =   476 bits (1225),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 240/405 (59%), Positives = 303/405 (75%), Gaps = 21/405 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +E    Q Q    GN +T+LSIDGGGIRGI+PA IL++LE++LQ+LDG+DARLADYFDVI
Sbjct  1     MEETSVQLQPPAYGNFITILSIDGGGIRGIVPATILSFLESELQKLDGKDARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             +GTSTGGL+TAMLT+P+E  RP++AA+DIK FYL NGPKIFPQ       +   ++++ G
Sbjct  61    AGTSTGGLLTAMLTSPNEKNRPMFAAEDIKDFYLQNGPKIFPQDSCPLAPVAKMMKTLTG  120

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             PKYDG YL SL++++L DIRL  TLT+VVIPTFDIK LQP IFSTY+ K  P ++A LSD
Sbjct  121   PKYDGNYLHSLVREKLGDIRLHQTLTHVVIPTFDIKRLQPTIFSTYRVKNKPSIDALLSD  180

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CI TSAAPTY PAHYFK ++     G      +E+N+IDGGVAANNPTLVAIS+VTK+I
Sbjct  181   ICIATSAAPTYFPAHYFKTED---HSGAV----REFNLIDGGVAANNPTLVAISEVTKEI  233

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                +PD FPIKPMD  RFLVIS+GTG+A +E +Y++ EAAKWGI+ WL    STPL+ V 
Sbjct  234   IKGSPDFFPIKPMDYGRFLVISLGTGSAKSEERYDAHEAAKWGIIGWLTSGGSTPLVNVV  293

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              +A++DMVDLH S VFQAL   + SYLRIQ               L+G  SS+DVAT++N
Sbjct  294   NQATADMVDLHLSVVFQALHSGK-SYLRIQ------------DDKLSGLTSSVDVATKKN  340

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +  LV++GE LLKK VSRVNL+TG+ EP+ +  TNE+ALKR AK 
Sbjct  341   MNDLVKVGEGLLKKLVSRVNLDTGIFEPL-NQETNEEALKRFAKL  384



>gb|KCW88897.1| hypothetical protein EUGRSUZ_A01223, partial [Eucalyptus grandis]
Length=404

 Score =   475 bits (1223),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 240/405 (59%), Positives = 303/405 (75%), Gaps = 21/405 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +E    Q Q    GN +T+LSIDGGGIRGI+PA IL++LE++LQ+LDG+DARLADYFDVI
Sbjct  1     MEETSVQLQPPAYGNFITILSIDGGGIRGIVPATILSFLESELQKLDGKDARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             +GTSTGGL+TAMLT+P+E  RP++AA+DIK FYL NGPKIFPQ       +   ++++ G
Sbjct  61    AGTSTGGLLTAMLTSPNEKNRPMFAAEDIKDFYLQNGPKIFPQDSCPLAPVAKMMKTLTG  120

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             PKYDG YL SL++++L DIRL  TLT+VVIPTFDIK LQP IFSTY+ K  P ++A LSD
Sbjct  121   PKYDGNYLHSLVREKLGDIRLHQTLTHVVIPTFDIKRLQPTIFSTYRVKNKPSIDALLSD  180

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CI TSAAPTY PAHYFK ++     G      +E+N+IDGGVAANNPTLVAIS+VTK+I
Sbjct  181   ICIATSAAPTYFPAHYFKTED---HSGAV----REFNLIDGGVAANNPTLVAISEVTKEI  233

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                +PD FPIKPMD  RFLVIS+GTG+A +E +Y++ EAAKWGI+ WL    STPL+ V 
Sbjct  234   IKGSPDFFPIKPMDYGRFLVISLGTGSAKSEERYDAHEAAKWGIIGWLTSGGSTPLVNVV  293

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              +A++DMVDLH S VFQAL   + SYLRIQ               L+G  SS+DVAT++N
Sbjct  294   NQATADMVDLHLSVVFQALHSGK-SYLRIQ------------DDKLSGLTSSVDVATKKN  340

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +  LV++GE LLKK VSRVNL+TG+ EP+ +  TNE+ALKR AK 
Sbjct  341   MNDLVKVGEGLLKKLVSRVNLDTGIFEPL-NQETNEEALKRFAKL  384



>emb|CBI19553.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   475 bits (1223),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 255/399 (64%), Positives = 303/399 (76%), Gaps = 36/399 (9%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+LSIDGGGIRGIIPA ILA LE+QLQELDG+DAR+ADYFDVI+GTSTG
Sbjct  54    QIQPPTYGNLVTILSIDGGGIRGIIPATILACLESQLQELDGDDARIADYFDVIAGTSTG  113

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             GLVTAMLTAP++  RPL+AAKDIKPFYL +GPKIFPQ+ G FG I    RS+ GP YDGK
Sbjct  114   GLVTAMLTAPNDEKRPLFAAKDIKPFYLKHGPKIFPQRRGIFGWIMNIFRSIVGPNYDGK  173

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL +L+K++L   RL  TLT+VVIPTFDIK+LQP IFS+Y+ KR P ++A L+D+CIG+S
Sbjct  174   YLHNLIKEKLGRTRLHQTLTSVVIPTFDIKSLQPSIFSSYEVKRSPSLDAPLADICIGSS  233

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTY PA++FK Q+   +EG      +E N+IDGGVAANNP LVAISQVTKQ+FD NPD
Sbjct  234   AAPTYFPAYFFKNQD---KEG----KARELNLIDGGVAANNPALVAISQVTKQVFDKNPD  286

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
               PIKPMD  RFLVISIGTG+  +E KYN+K AAKWG+L WLLH  STPL++VF +AS+D
Sbjct  287   FLPIKPMDYGRFLVISIGTGSPKSEQKYNAKMAAKWGVLGWLLHGGSTPLVDVFTQASAD  346

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD H S VFQAL   E++YLRIQ                            ENL  LV+
Sbjct  347   MVDFHISVVFQAL-HSEDNYLRIQ----------------------------ENLGNLVK  377

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             IGE+LLKKPVSRVNLETG+S P+ + GTNE+ALKR AK 
Sbjct  378   IGERLLKKPVSRVNLETGLSVPVENCGTNEEALKRFAKL  416



>ref|XP_010059972.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66467.1| hypothetical protein EUGRSUZ_F00264 [Eucalyptus grandis]
Length=409

 Score =   474 bits (1220),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 239/397 (60%), Positives = 300/397 (76%), Gaps = 21/397 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGGIRG+IP  ILA+LE++LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  10    QPPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLT+PDEN RPL+AAKDIK FYL+N PKIFPQ    F      I++V GPKYDGKYL
Sbjct  70    VTAMLTSPDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYL  129

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
               L++++L + RL  TLTNVVIPTFDIK+LQP IFS+Y+ KR P +NA LSD+CI TSAA
Sbjct  130   HKLVQEKLGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDICISTSAA  189

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAHYF+ Q+   +        +E+N+IDGGVAANNPT VA+ +VTK+I   + D F
Sbjct  190   PTYLPAHYFETQDSTGK-------IREFNLIDGGVAANNPTFVAMGEVTKEIMGGSSDFF  242

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PIKPMD  RFLVIS+GTG+   E KY+++EAAKWG+L WL     +PL++VFM+AS+DMV
Sbjct  243   PIKPMDYRRFLVISLGTGSQKVEGKYDAREAAKWGVLGWLSSNGGSPLVDVFMQASADMV  302

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D H SAVFQAL   E +YLRIQ              +L+G+ +S+D+AT++NL  LV+ G
Sbjct  303   DFHLSAVFQAL-HLEANYLRIQ------------DDTLSGSVASVDIATKKNLNDLVKTG  349

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             E LLKKPVS+V+LETG  +      TNE+AL+R AK 
Sbjct  350   EALLKKPVSKVDLETGQYDACKLE-TNEEALRRFAKL  385



>gb|KCW66458.1| hypothetical protein EUGRSUZ_F00254 [Eucalyptus grandis]
Length=423

 Score =   474 bits (1220),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 238/397 (60%), Positives = 299/397 (75%), Gaps = 21/397 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGGIRG+IP  IL +LE++LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  10    QPPTYGNLITILSIDGGGIRGLIPGTILDFLESELQKLDGEDARIADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLT PD+N RPL+AAKDIK FYL+N PKIFPQ    F      I++V GPKYDGKYL
Sbjct  70    VTAMLTTPDDNNRPLFAAKDIKNFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYL  129

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
              +L+K++L + RL  TLTNVVIPTFDIK LQP IFS+Y+ K+ P ++A LSD+CI TSAA
Sbjct  130   HNLVKEKLGNARLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKTPTLDALLSDICISTSAA  189

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAHYF+ Q+  ++        +E+N+IDGGVAANNPTLVA+ +VTK+I   + D F
Sbjct  190   PTYLPAHYFETQDSKRKL-------REFNLIDGGVAANNPTLVAMGEVTKEIMGGSSDFF  242

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PIKPMD  RFLVIS+GTG+  +E KY++ EAAKWG+L+WL     +PLI+VFM+AS+DMV
Sbjct  243   PIKPMDYRRFLVISLGTGSRNSEGKYDASEAAKWGVLNWLTCNGGSPLIDVFMQASADMV  302

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D H SAVFQAL   E +YLRIQ              +L+G  +S+D+AT++NL  LV  G
Sbjct  303   DFHLSAVFQAL-HLEANYLRIQ------------DDNLSGAVASVDIATKKNLNDLVRTG  349

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             E LLKKPVS+V+LE G  E   +  TNE+AL+R AK 
Sbjct  350   EALLKKPVSKVDLEKGGCEAC-NPETNEEALRRFAKM  385



>ref|XP_010059967.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66459.1| hypothetical protein EUGRSUZ_F00255 [Eucalyptus grandis]
Length=409

 Score =   473 bits (1218),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 239/397 (60%), Positives = 298/397 (75%), Gaps = 21/397 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGGIRG+IP  ILA+LE++LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  10    QPPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLT+PDEN RPL+AAKDIK FYL+N PKIFPQ    F      I++V GPKYDGKYL
Sbjct  70    VTAMLTSPDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYL  129

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
               L+K++L + RL  TLTNVVIPTFDIK+LQP IFS+Y+ KR P +NA LSD+CI TSAA
Sbjct  130   HELVKEKLGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDICISTSAA  189

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAHYF+ Q+   +        +E+N+IDGGVAANNPT VA+ +VTK+I   + D F
Sbjct  190   PTYLPAHYFETQDSTGK-------IREFNLIDGGVAANNPTFVAMGEVTKEIMGGSSDFF  242

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PIKPMD  RFLVIS+GTG+   E  Y+++EAAKWG+L WL     +PL++VFM+AS+DMV
Sbjct  243   PIKPMDYRRFLVISLGTGSQKVEGNYDAREAAKWGVLGWLSSNGGSPLVDVFMQASADMV  302

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D H SAVFQAL   E +YLRIQ              +L+G+ +S+D+AT++NL  LV+ G
Sbjct  303   DFHLSAVFQAL-HLEANYLRIQ------------DDTLSGSVASVDIATKKNLNDLVKTG  349

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             E LLKKPVS+V+LETG         TNE+AL+R AK 
Sbjct  350   EALLKKPVSKVDLETGQHNACKLE-TNEEALRRFAKL  385



>ref|XP_006354907.1| PREDICTED: patatin-2-Kuras 4-like [Solanum tuberosum]
Length=384

 Score =   472 bits (1215),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 251/394 (64%), Positives = 306/394 (78%), Gaps = 21/394 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T G ++T+LSIDGGGIRGIIPA IL YLE+QLQELDGEDARLADYFD+I+GTSTGGL
Sbjct  11    QPPTYGKLITILSIDGGGIRGIIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGL  70

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVFGPKYDGKY  1203
             VTAMLTAP+++ RP++AAKDIKPFYL +GPKIFPQKG  +FG I  +++S+ GPKY+GKY
Sbjct  71    VTAMLTAPNKDKRPMFAAKDIKPFYLEHGPKIFPQKGMLFFGSIVKTLKSLIGPKYNGKY  130

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  ++K++L +  + +TLTNVVIPTFDIKNLQP IFST++A+  P M+A LSD+CI TSA
Sbjct  131   LHQVIKEKLGETYIHETLTNVVIPTFDIKNLQPTIFSTFEAREKPLMDAKLSDICISTSA  190

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYFK Q+  K +        E+N++DGGVAANNP LVA SQVTKQI   NPD 
Sbjct  191   APTYLPAHYFKTQD--KDDNF-----HEFNLVDGGVAANNPALVATSQVTKQIMAGNPDF  243

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKP+D  RFLVIS+GTG+A  E KYN+K A+KWGIL WLL+  STP+++VF +AS DM
Sbjct  244   FPIKPIDYGRFLVISVGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDM  303

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD H S VFQAL   EN YLRIQ              +L+GT SS+D++T+EN+ KLVEI
Sbjct  304   VDFHISVVFQALHSEEN-YLRIQ------------DDTLSGTDSSVDISTKENMNKLVEI  350

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKR  381
             G  LLKKPVSRVNL+TG+ E      TNE+ LKR
Sbjct  351   GTNLLKKPVSRVNLQTGLFEQSKKDDTNEETLKR  384



>ref|XP_007160832.1| hypothetical protein PHAVU_001G020300g [Phaseolus vulgaris]
 gb|ESW32826.1| hypothetical protein PHAVU_001G020300g [Phaseolus vulgaris]
Length=413

 Score =   473 bits (1218),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 266/426 (62%), Positives = 326/426 (77%), Gaps = 24/426 (6%)
 Frame = -3

Query  1583  IERKPS---QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYF  1413
             +ER  S   Q Q  T GN+VT+LSIDGGGIRGIIPA I+ +LE+QLQELDG +ARLADYF
Sbjct  1     MERSKSSVEQIQPPTYGNLVTILSIDGGGIRGIIPATIIDFLESQLQELDGPEARLADYF  60

Query  1412  DVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVS-IR  1236
             DVISGTSTGGLVTAMLTAPD N RPL+AAKDIKPFYL +GPKIFP   G  G I  + +R
Sbjct  61    DVISGTSTGGLVTAMLTAPDNNHRPLFAAKDIKPFYLEHGPKIFPHHSGLGGTIIANLVR  120

Query  1235  SVFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNA  1056
             S+ GPKYDGKYL  +++++L +IRL DTLTNVVIPTFDIK++QP++FS+YQ K+C  M+A
Sbjct  121   SLGGPKYDGKYLHEVVREKLGEIRLHDTLTNVVIPTFDIKSMQPILFSSYQMKKCSYMDA  180

Query  1055  YLSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQV  876
              LSD+CIGTSAAPTYLPAH F  Q+   Q  +      ++N+IDGGV ANNPTLVA+++V
Sbjct  181   KLSDICIGTSAAPTYLPAHTFTNQDS--QGNL-----HQFNLIDGGVCANNPTLVAMNEV  233

Query  875   TKQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPL  696
             TKQI   N D FPIKP++ SRFL+ISIGTGTA NE K+N + AAKWG+L WL +  STPL
Sbjct  234   TKQIIKQNSDFFPIKPLEYSRFLIISIGTGTARNEEKFNGETAAKWGLLDWLTYNGSTPL  293

Query  695   IEVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVA  516
              +VF ++S+DMVD H SAV QAL   E++YLRIQ              +L+GT+SS+D+A
Sbjct  294   TDVFTQSSADMVDFHLSAVTQAL-HSEDNYLRIQ------------DDTLSGTESSVDIA  340

Query  515   TEENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresr  336
             T+ENL+KL EIG+ LLKK VSRVNLE G+ EP+ +  TN+ AL R AK LS ERRLRE R
Sbjct  341   TKENLQKLSEIGQNLLKKSVSRVNLENGLFEPLANGETNQHALTRFAKILSQERRLREMR  400

Query  335   SPVTKR  318
             SP T +
Sbjct  401   SPHTTK  406



>ref|XP_010064139.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=420

 Score =   473 bits (1218),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 243/389 (62%), Positives = 291/389 (75%), Gaps = 21/389 (5%)
 Frame = -3

Query  1535  VTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAMLTAP  1356
             + +LSIDGGGIRG+IP  IL +LE++LQ+LDGEDARLADYFDVISGTSTGGLVTAMLT P
Sbjct  32    IFILSIDGGGIRGLIPGTILHFLESELQKLDGEDARLADYFDVISGTSTGGLVTAMLTTP  91

Query  1355  DENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLKKEL  1176
             +EN RP++AAKDIK FYLN+ PKIFPQ    F  +   I+++ GPKYDGKYL S+++ +L
Sbjct  92    NENNRPVFAAKDIKDFYLNHCPKIFPQDSCSFKLVTKMIKAMAGPKYDGKYLHSVVRDKL  151

Query  1175  KDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLPAHY  996
              D RL  TLTNVVIPTFDIK+LQP IFS+YQ K+ P M+A LSD+CI TSAAPTYLPAH 
Sbjct  152   GDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDICISTSAAPTYLPAHK  211

Query  995   FKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPMDLS  816
             F+ ++   Q        +E+N+IDGGVAANNPTLVA+ +VTK I   N D FPIKPMD  
Sbjct  212   FETKDPTDQ-------VREFNLIDGGVAANNPTLVAMGEVTKAIIGGNSDFFPIKPMDYR  264

Query  815   RFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNSAVF  636
             RFLVIS+GTGT   E KY + EAAKWG+L WL    S PLI+VF +AS+DMVD H SAVF
Sbjct  265   RFLVISLGTGTRKAEGKYTAHEAAKWGVLGWLTSGGS-PLIDVFSQASADMVDFHISAVF  323

Query  635   QALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLKKPV  456
             QAL    ++YLRIQ              +LTG  SS+DVAT++NL  LV+ GE LLKKPV
Sbjct  324   QAL-HLHDNYLRIQ------------DDTLTGDLSSVDVATKKNLNDLVKTGEALLKKPV  370

Query  455   SRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             SRVNLETG  EP P+  TNE+AL+R AK 
Sbjct  371   SRVNLETGACEPTPNQETNEEALRRFAKL  399



>ref|XP_006488153.1| PREDICTED: patatin-3-Kuras 1-like [Citrus sinensis]
Length=408

 Score =   473 bits (1217),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 239/406 (59%), Positives = 307/406 (76%), Gaps = 21/406 (5%)
 Frame = -3

Query  1589  VKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             ++I+   S  Q  T GN++T+LSIDGGGIRG+IPA ILA+LE++LQ+LDGE+AR+ADYFD
Sbjct  1     MEIQSPRSPIQPPTFGNLITILSIDGGGIRGVIPATILAFLESELQKLDGEEARIADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             VISGTSTGGLVTAMLTAP+E  RPL+AAKDIK FYLN+ PKIFPQ    FG     I+S+
Sbjct  61    VISGTSTGGLVTAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSCPFGSATKLIKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  L+K++L D +L +TLTNVVIPTFDIKNLQP IFS+Y+ K+ P ++A L
Sbjct  121   TGPKYDGKYLHRLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+C+ TSAAPTYLPAH F+ ++       +    + +++IDGGVAANNPTLVA+++VTK
Sbjct  181   SDICVATSAAPTYLPAHTFETKD-------STGKVRSFDLIDGGVAANNPTLVALNEVTK  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D + I  MD +RFLVIS+GTG    E KY++ +AAKWG+L WL  +SSTPL++
Sbjct  234   EINRGSSDYYAINAMDYTRFLVISLGTGAPKTEAKYDALKAAKWGVLGWLSSESSTPLVD  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
             VFM++SSDM D H S  F+AL   EN YLRIQ              +LTG ++S+DVAT+
Sbjct  294   VFMQSSSDMTDFHISTAFKAL-HSENGYLRIQ------------DDTLTGDEASVDVATK  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             +NLE LV IGE+LLKKPV++VN ETG+ EP    GTN++AL RLAK
Sbjct  341   KNLESLVGIGERLLKKPVTKVNFETGLCEPCGQ-GTNDEALIRLAK  385



>ref|XP_006424637.1| hypothetical protein CICLE_v10030027mg [Citrus clementina]
 gb|ESR37877.1| hypothetical protein CICLE_v10030027mg [Citrus clementina]
Length=408

 Score =   473 bits (1217),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 239/406 (59%), Positives = 308/406 (76%), Gaps = 21/406 (5%)
 Frame = -3

Query  1589  VKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             ++I+   S  Q  T GN++T+LSIDGGGIRG+IPA ILA+LE++LQ+LDGE+AR+ADYFD
Sbjct  1     MEIQSPRSPIQPPTFGNLITILSIDGGGIRGVIPATILAFLESELQKLDGEEARIADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             VISGTSTGGLVTAMLTAP+E  RPL+AAKDIK FYLN+ PKIFPQ  G FG     I+S+
Sbjct  61    VISGTSTGGLVTAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  L+K++L D +L +TLTNVVIPTFDIKNLQP IFS+Y+ K+ P ++A L
Sbjct  121   TGPKYDGKYLHRLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+C+ TSAAPTYLPAH F+ ++       +    + +++IDGGVAANNPTLVA+++VTK
Sbjct  181   SDICVATSAAPTYLPAHSFETKD-------STGKVRSFDLIDGGVAANNPTLVALNEVTK  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D + I  MD +RFLVIS+GTG    E KY++ +AAKWG+L WL  +SSTPL++
Sbjct  234   EINRGSSDYYAINAMDYTRFLVISLGTGAPKTEAKYDALKAAKWGVLGWLSSESSTPLVD  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
             VFM++SSDM D H S  F+AL   EN YLRIQ              +LTG ++S+DVAT+
Sbjct  294   VFMQSSSDMTDFHISTAFKAL-HSENGYLRIQ------------DDTLTGDEASVDVATK  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             +NLE LV IGE+LLKKPV++VN ETG+ EP    GTN++AL RLA+
Sbjct  341   KNLESLVGIGERLLKKPVTKVNFETGLCEPCGQ-GTNDEALIRLAE  385



>ref|XP_010064187.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66460.1| hypothetical protein EUGRSUZ_F00256 [Eucalyptus grandis]
Length=421

 Score =   473 bits (1218),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 239/397 (60%), Positives = 297/397 (75%), Gaps = 21/397 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGGIRG+IP  ILA+LE++LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  10    QPPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLT PD+N RPL+AAKDIK FYL+N PKIFPQ    F      I++V GPKYDGKYL
Sbjct  70    VTAMLTTPDDNNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYL  129

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
               L+K++L + RL  TLTNVVIPTFDIK LQP IFS+Y+ K+ P ++A LSD+CI TSAA
Sbjct  130   HKLVKEKLGNARLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKTPTLDALLSDICISTSAA  189

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAHYF+ Q+   +        +E+N+IDGGVAANNPTLVA+ +VTK+I   + D F
Sbjct  190   PTYLPAHYFETQDSTGKL-------REFNLIDGGVAANNPTLVAMGEVTKEIIGGSSDFF  242

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PIKPMD  RFLVIS+GTG+  +E KY++ EAAKWG+L+WL     +PLI+VFM+AS+DMV
Sbjct  243   PIKPMDYRRFLVISLGTGSRNSEGKYDASEAAKWGVLNWLTCNGGSPLIDVFMQASADMV  302

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D H SAVFQAL   E +YLRIQ              +L+G  +S+D+AT++NL  LV  G
Sbjct  303   DFHLSAVFQAL-HLEANYLRIQ------------DDNLSGAVASVDIATKKNLNDLVRTG  349

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             E LLKKPVS+V+LE G  E   +  TNE AL+R AK 
Sbjct  350   EALLKKPVSKVDLEKGGCEAC-NLETNEQALRRFAKM  385



>ref|XP_010268994.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=409

 Score =   473 bits (1216),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 255/396 (64%), Positives = 302/396 (76%), Gaps = 20/396 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN+VT+LSIDGGGIRGIIP  ILA+LE+QLQ+LDGEDARLADYFDVI+GTSTGGL
Sbjct  11    QPPTYGNLVTILSIDGGGIRGIIPGTILAFLESQLQKLDGEDARLADYFDVIAGTSTGGL  70

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLTAP+EN RPL+AAKDI PFYL + PKIFPQ  G FG     I+ + GPKYDGKYL
Sbjct  71    VTAMLTAPNENNRPLFAAKDIVPFYLEDCPKIFPQTSGIFGSALNLIKLMNGPKYDGKYL  130

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
              SL++K+L + RL  TLTN+VIPTFDIK LQP IFS+Y+ K+   M+A LSD+CI TSAA
Sbjct  131   HSLVEKKLGETRLHQTLTNIVIPTFDIKRLQPTIFSSYEVKKSSTMDARLSDICISTSAA  190

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPA+YFK Q+    E       +E+N+IDGGV ANNP LVAIS+VTKQI   NPD F
Sbjct  191   PTYLPAYYFKTQDQDGNE-------REFNLIDGGVTANNPALVAISEVTKQITKENPDFF  243

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PIKPMD  RFLVISIGTGTA  E KYN+  A KWGI+ WL++  STPL++VF +AS DMV
Sbjct  244   PIKPMDYGRFLVISIGTGTAKMEQKYNANMATKWGIIQWLVNGGSTPLVDVFTQASGDMV  303

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D HN+ VFQAL    +SYLRIQ              +L G  SS+D+AT+ENL+ LV+ G
Sbjct  304   DYHNAVVFQAL-KSGSSYLRIQ------------DDTLVGEISSVDIATKENLDNLVKAG  350

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             E LLKKPVS VNL+TG+ EPI + GTNE+ALK+ AK
Sbjct  351   EALLKKPVSGVNLQTGIFEPITNGGTNEEALKKFAK  386



>ref|XP_010064186.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=431

 Score =   473 bits (1217),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 238/397 (60%), Positives = 299/397 (75%), Gaps = 21/397 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGGIRG+IP  IL +LE++LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  10    QPPTYGNLITILSIDGGGIRGLIPGTILDFLESELQKLDGEDARIADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLT PD+N RPL+AAKDIK FYL+N PKIFPQ    F      I++V GPKYDGKYL
Sbjct  70    VTAMLTTPDDNNRPLFAAKDIKNFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYL  129

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
              +L+K++L + RL  TLTNVVIPTFDIK LQP IFS+Y+ K+ P ++A LSD+CI TSAA
Sbjct  130   HNLVKEKLGNARLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKTPTLDALLSDICISTSAA  189

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAHYF+ Q+  ++        +E+N+IDGGVAANNPTLVA+ +VTK+I   + D F
Sbjct  190   PTYLPAHYFETQDSKRKL-------REFNLIDGGVAANNPTLVAMGEVTKEIMGGSSDFF  242

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PIKPMD  RFLVIS+GTG+  +E KY++ EAAKWG+L+WL     +PLI+VFM+AS+DMV
Sbjct  243   PIKPMDYRRFLVISLGTGSRNSEGKYDASEAAKWGVLNWLTCNGGSPLIDVFMQASADMV  302

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D H SAVFQAL   E +YLRIQ              +L+G  +S+D+AT++NL  LV  G
Sbjct  303   DFHLSAVFQAL-HLEANYLRIQ------------DDNLSGAVASVDIATKKNLNDLVRTG  349

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             E LLKKPVS+V+LE G  E   +  TNE+AL+R AK 
Sbjct  350   EALLKKPVSKVDLEKGGCEAC-NPETNEEALRRFAKM  385



>ref|XP_010054916.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=412

 Score =   472 bits (1214),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 235/394 (60%), Positives = 296/394 (75%), Gaps = 21/394 (5%)
 Frame = -3

Query  1550  TGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTA  1371
             T GN+VT+LSIDGGGIRGI+PA IL++LE++LQ+LDG+DARLADYFDVI+GTSTGGL+TA
Sbjct  12    TNGNLVTILSIDGGGIRGIVPATILSFLESELQKLDGKDARLADYFDVIAGTSTGGLLTA  71

Query  1370  MLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSL  1191
             MLT+P+E  RP++AAKDI+ FYL NGPKIFPQ           ++++  P+YDGKYL SL
Sbjct  72    MLTSPNEKNRPMFAAKDIEDFYLENGPKIFPQDSCPLAPFTKMMKTLTRPRYDGKYLHSL  131

Query  1190  LKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTY  1011
             ++++L+D RL  TLT+VVIPTFDIK LQP IFSTYQ K  P ++A LSD+CI TSAAPTY
Sbjct  132   VREKLRDTRLHQTLTHVVIPTFDIKRLQPTIFSTYQVKNKPSIDALLSDICIATSAAPTY  191

Query  1010  LPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIK  831
             LP HYFK  +     G      +E+N+IDGGVAANNPTLVA+S+VT+ I   +PD FPIK
Sbjct  192   LPPHYFKTID---HSGAV----REFNLIDGGVAANNPTLVAVSEVTEDISRRSPDFFPIK  244

Query  830   PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLH  651
             PMD  RFLVIS+GTG+  +E  Y + EAA WGI+ WL+   STPL+ VF +AS+DMVDLH
Sbjct  245   PMDYGRFLVISLGTGSPKSEEGYTAHEAANWGIIGWLMSGGSTPLVNVFTQASADMVDLH  304

Query  650   NSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKL  471
              S VFQAL    NSYLRIQ               L+G  SS+D+AT++N+  L+++GE+L
Sbjct  305   LSVVFQAL-HSRNSYLRIQ------------DDRLSGLVSSVDIATKKNMNDLIKVGERL  351

Query  470   LKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LKKPVS VNL+TG  EP+ +  TNE+ALKR AK 
Sbjct  352   LKKPVSSVNLDTGTLEPL-NRDTNEEALKRFAKL  384



>ref|XP_006434815.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
 gb|ESR48055.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
Length=408

 Score =   472 bits (1214),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 239/406 (59%), Positives = 307/406 (76%), Gaps = 21/406 (5%)
 Frame = -3

Query  1589  VKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             ++I+   S  Q  T GN++T+LSIDGGGIRG+IPA ILA+LE++LQ+LDGE+AR+ADYFD
Sbjct  1     MEIQTPRSPIQPPTFGNLITILSIDGGGIRGVIPATILAFLESELQKLDGEEARIADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             VISGTSTGGLVTAMLTAP+E  RPL+AAKDIK FYLN+ PKIFPQ    FG     I+S+
Sbjct  61    VISGTSTGGLVTAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSCPFGSATKLIKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  L+K++L D +L +TLTNVVIPTFDIKNLQP IFS+Y+ K+ P ++A L
Sbjct  121   TGPKYDGKYLHRLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+C+ TSAAPTYLPAH F+ ++   +        + +++IDGGVAANNPTLVA+++VTK
Sbjct  181   SDICVATSAAPTYLPAHSFETKDCTGK-------VRSFDLIDGGVAANNPTLVALNEVTK  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D + I  MD +RFLVIS+GTG    E KY++ +AAKWG+L WL  +SSTPL++
Sbjct  234   EINRGSSDYYAINAMDYTRFLVISLGTGAPKTEVKYDAIKAAKWGVLGWLSSESSTPLVD  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
             VFM++SSDM D H S  F+AL   EN YLRIQ              +LTG ++S+DVAT+
Sbjct  294   VFMQSSSDMTDFHISTAFKAL-HSENGYLRIQ------------DDTLTGDEASVDVATK  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             +NLE LV IGE+LLKKPV++VN ETG+ EP    GTN++AL RLAK
Sbjct  341   KNLESLVGIGERLLKKPVTKVNFETGLCEPCGQ-GTNDEALIRLAK  385



>gb|KCW78409.1| hypothetical protein EUGRSUZ_D02575, partial [Eucalyptus grandis]
Length=399

 Score =   471 bits (1212),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 235/394 (60%), Positives = 296/394 (75%), Gaps = 21/394 (5%)
 Frame = -3

Query  1550  TGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTA  1371
             T GN+VT+LSIDGGGIRGI+PA IL++LE++LQ+LDG+DARLADYFDVI+GTSTGGL+TA
Sbjct  12    TNGNLVTILSIDGGGIRGIVPATILSFLESELQKLDGKDARLADYFDVIAGTSTGGLLTA  71

Query  1370  MLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSL  1191
             MLT+P+E  RP++AAKDI+ FYL NGPKIFPQ           ++++  P+YDGKYL SL
Sbjct  72    MLTSPNEKNRPMFAAKDIEDFYLENGPKIFPQDSCPLAPFTKMMKTLTRPRYDGKYLHSL  131

Query  1190  LKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTY  1011
             ++++L+D RL  TLT+VVIPTFDIK LQP IFSTYQ K  P ++A LSD+CI TSAAPTY
Sbjct  132   VREKLRDTRLHQTLTHVVIPTFDIKRLQPTIFSTYQVKNKPSIDALLSDICIATSAAPTY  191

Query  1010  LPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIK  831
             LP HYFK  +     G      +E+N+IDGGVAANNPTLVA+S+VT+ I   +PD FPIK
Sbjct  192   LPPHYFKTID---HSGAV----REFNLIDGGVAANNPTLVAVSEVTEDISRRSPDFFPIK  244

Query  830   PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLH  651
             PMD  RFLVIS+GTG+  +E  Y + EAA WGI+ WL+   STPL+ VF +AS+DMVDLH
Sbjct  245   PMDYGRFLVISLGTGSPKSEEGYTAHEAANWGIIGWLMSGGSTPLVNVFTQASADMVDLH  304

Query  650   NSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKL  471
              S VFQAL    NSYLRIQ               L+G  SS+D+AT++N+  L+++GE+L
Sbjct  305   LSVVFQAL-HSRNSYLRIQ------------DDRLSGLVSSVDIATKKNMNDLIKVGERL  351

Query  470   LKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LKKPVS VNL+TG  EP+ +  TNE+ALKR AK 
Sbjct  352   LKKPVSSVNLDTGTLEPL-NRDTNEEALKRFAKL  384



>ref|XP_010320346.1| PREDICTED: patatin-like protein 2 isoform X1 [Solanum lycopersicum]
Length=412

 Score =   471 bits (1213),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 263/416 (63%), Positives = 322/416 (77%), Gaps = 21/416 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T G ++T+LSIDGGGIRGIIPA+IL YLE+QLQELDGEDARLADYFD+I+GTSTGGL
Sbjct  15    QPPTYGKLITILSIDGGGIRGIIPAIILEYLESQLQELDGEDARLADYFDIIAGTSTGGL  74

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVFGPKYDGKY  1203
             VTAMLTAP+++ RP++AAKDIKPFYL +GPKIFPQKG  +FG I  +++S+ GPKY+GKY
Sbjct  75    VTAMLTAPNKDKRPIFAAKDIKPFYLEHGPKIFPQKGMLFFGSIIKTLKSLIGPKYNGKY  134

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  ++K++L +  L +TLTNVVIPTFDIKNLQP IFST++AK  P M+A LSD+CI TS 
Sbjct  135   LHQVIKEKLGETHLHETLTNVVIPTFDIKNLQPTIFSTFEAKEKPLMDAKLSDICISTSG  194

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYFK Q+        +    E+N++DGGVAANNP LVA SQVTKQI   NPD 
Sbjct  195   APTYLPAHYFKTQD-------RDDNFHEFNLVDGGVAANNPALVATSQVTKQIMAGNPDF  247

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKP+D  RFLVIS+GTG+A  E KYN+K A+KWGIL WLL+  STP+++VF +AS DM
Sbjct  248   FPIKPIDYGRFLVISVGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDM  307

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD H S VFQAL   EN YLR+Q              +L+GT SS+D++T+EN+ KLVEI
Sbjct  308   VDFHISVVFQALHSEEN-YLRVQ------------DDTLSGTDSSVDISTKENMNKLVEI  354

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTKRT  315
             G  LLKKPVSRVNL+TG+ E      TNE+ LKR AK LS E+RLR+S+SP T +T
Sbjct  355   GTNLLKKPVSRVNLQTGLFEECKKDDTNEETLKRFAKLLSEEKRLRDSKSPHTSKT  410



>ref|XP_010059969.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
Length=407

 Score =   471 bits (1212),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 237/397 (60%), Positives = 295/397 (74%), Gaps = 20/397 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGG+RG++P  ILA+LE++LQ+LDGEDARLADYFDVI+GTSTGGL
Sbjct  10    QPPTYGNLITILSIDGGGMRGLVPGAILAFLESELQKLDGEDARLADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLT+PD++ RPL+ AKDIK F+LNN PKIFPQ    F      I++V GPKYDGKYL
Sbjct  70    VTAMLTSPDKHNRPLFTAKDIKDFFLNNCPKIFPQDSCPFAPATNMIKAVTGPKYDGKYL  129

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
               L+K++L + RL  TLTNVVIPTFD K LQP IFS+Y+ K+ P ++A LSDVCI TSAA
Sbjct  130   HKLIKEKLGNTRLNQTLTNVVIPTFDAKQLQPTIFSSYEVKKKPSIDALLSDVCISTSAA  189

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAHYF+ Q+   +        +E+N+I GGVAANNPTLVA+ +V K+I   + D F
Sbjct  190   PTYLPAHYFETQDPTGKV-------REFNLIVGGVAANNPTLVAMGEVRKEIIGGSSDFF  242

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PI PMD  RFLVIS+GTG+A  E KYN+ EAAKWG+LSWL     +PLI+V M+AS+DMV
Sbjct  243   PINPMDYRRFLVISLGTGSAKVEGKYNASEAAKWGVLSWLSSNGGSPLIDVLMQASADMV  302

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D H S VFQAL   E +YLRIQ              +L+G  +S+D+A ++N+  LV+ G
Sbjct  303   DFHLSVVFQALL-IEANYLRIQ------------DDTLSGAVASVDIAMKKNMNDLVKTG  349

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             E LLKKPVSRVNLETG  EP P+  TNE+AL+R AK 
Sbjct  350   EALLKKPVSRVNLETGRYEPTPNQETNEEALRRFAKL  386



>ref|XP_009367377.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=401

 Score =   471 bits (1212),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 244/398 (61%), Positives = 299/398 (75%), Gaps = 22/398 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++TVLSIDGGGIRG+IP  ILA+LE++LQ+LDGEDARLADYFDVISGTSTGGL
Sbjct  10    QPPTYGNLITVLSIDGGGIRGLIPGTILAFLESELQKLDGEDARLADYFDVISGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVFGPKYDGKY  1203
             VTAMLT PDEN RPL+AAKDIK FYL   PKIFPQK    F +I   I+ + GPKY+GKY
Sbjct  70    VTAMLTTPDENNRPLFAAKDIKDFYLTESPKIFPQKTRSLFPQIAKIIKRLTGPKYNGKY  129

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L SL++++L + +L  TLTNVVIPTFDIKNLQP IFS+++AK  P  +A +SD+CI TSA
Sbjct  130   LHSLVRQKLGEKKLHQTLTNVVIPTFDIKNLQPTIFSSFEAKHKPPFDALVSDICIATSA  189

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYF+ ++        N   +E+N+IDGGVAANNPTLVAI +VTKQI   +PD 
Sbjct  190   APTYLPAHYFETKD-------HNGNVREFNLIDGGVAANNPTLVAIGEVTKQIIKGSPDF  242

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKPMD  R+LVIS+GTG++  E KY++  AAKWG+L+WL    STP+I+VF + S+DM
Sbjct  243   FPIKPMDYGRYLVISLGTGSSKVELKYSAHNAAKWGLLNWLTSGGSTPIIDVFSQGSADM  302

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VDL+ S VFQAL   E +YLRIQ               L G  SS+D+ATE+NL+ LV++
Sbjct  303   VDLNLSVVFQAL-HSEKNYLRIQ------------DDKLRGDVSSVDIATEKNLDNLVKV  349

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             GE LLK+PVSRVNL+TG  E   H  TNE+AL R AK 
Sbjct  350   GEGLLKQPVSRVNLDTGKFEACNHE-TNEEALIRFAKL  386



>ref|XP_010064132.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=406

 Score =   471 bits (1211),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 246/406 (61%), Positives = 296/406 (73%), Gaps = 22/406 (5%)
 Frame = -3

Query  1583  IERKPS-QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             +ER PS      T GN +T+LSIDGGGIRG+IP  IL  LE++LQ+LDGEDAR+ DYFDV
Sbjct  1     MERSPSLPLHPPTYGNSITILSIDGGGIRGLIPGTILHLLESELQKLDGEDARIVDYFDV  60

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVF  1227
             ISGTSTGGLVTAML  PDEN RP+ AAKDIK FYLN+ PKIFPQ    F  +   I+++ 
Sbjct  61    ISGTSTGGLVTAMLATPDENNRPVVAAKDIKDFYLNHCPKIFPQDSCPFKPVTKRIKAMA  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKY+GKYL S++++EL D RL  TLTNVVIPTFDIK+LQP IFS+YQ K+ P M+A LS
Sbjct  121   GPKYNGKYLHSVVREELGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLS  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CI TSAAPTYLPAH F+ ++   +        +E+N+IDGGVAANNPTLVA+ +VTK 
Sbjct  181   DICISTSAAPTYLPAHQFETEDSTGKV-------REFNLIDGGVAANNPTLVAMGEVTKA  233

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             I   + D FPIKPMD  RFL+IS+GTGT   E KY + EAAKWG+L WL    S PLI+V
Sbjct  234   IVGGSSDFFPIKPMDYRRFLMISLGTGTTKAEGKYTAPEAAKWGVLRWLTSGGS-PLIDV  292

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F  AS+DMVD H SAVFQAL    ++YLRIQ              +L+G  SS+DVAT++
Sbjct  293   FSHASADMVDYHLSAVFQAL-QLHDNYLRIQ------------DDTLSGVLSSVDVATKK  339

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             NL  LV+IGE LLKKPVSRVNLET VSEP     TNE+AL+R AK 
Sbjct  340   NLNDLVKIGEALLKKPVSRVNLETSVSEPTSSQETNEEALRRFAKL  385



>ref|XP_010664585.1| PREDICTED: patatin-like protein 2 isoform X3 [Vitis vinifera]
Length=413

 Score =   471 bits (1211),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 242/402 (60%), Positives = 301/402 (75%), Gaps = 23/402 (6%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T GN++T+LSIDGGGIRG+IP  +L +LE++LQ+LDGEDAR++DYFDVI+GTST
Sbjct  7     SPLQPPTYGNLITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTST  66

Query  1388  GGLVTAMLTAPDEN-GRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVFGPKY  1215
             GGLVTAMLT P+EN GRPL++AKDIK FYL +GPKIFPQ        +   + ++ GPKY
Sbjct  67    GGLVTAMLTTPNENTGRPLFSAKDIKDFYLEHGPKIFPQHSHDPIPRVTKVVTALSGPKY  126

Query  1214  DGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCI  1035
             DGKYL +L+K++L + RL  TLTNVVIPTFDIK LQP IFSTYQ K  P ++A LSD+CI
Sbjct  127   DGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPCLDALLSDICI  186

Query  1034  GTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDN  855
             GTSAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNPTLVAI +VTK+I   
Sbjct  187   GTSAAPTYLPAHYFETKDPAGRV-------REFNLIDGGVAANNPTLVAIGEVTKEIIRG  239

Query  854   NPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEA  675
             +PD FPIKPMD  RFLVIS+GTG++  E KYN+ EAAKWG+L WL    STPL++VF +A
Sbjct  240   SPDFFPIKPMDYGRFLVISLGTGSSKAEEKYNADEAAKWGLLGWLTSGGSTPLVQVFTQA  299

Query  674   SSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEK  495
             S+DMVDLH S  FQAL   E SYLRIQ              +L+G  SS+D+AT+ENL+ 
Sbjct  300   SADMVDLHLSEAFQAL-HSEKSYLRIQ------------DDTLSGITSSVDIATKENLDD  346

Query  494   LVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LV+IGE+LLKK VSRVNL+TG+ EP  H  TNE+AL    + 
Sbjct  347   LVKIGEELLKKRVSRVNLDTGIFEPSNHE-TNEEALTSFTRL  387



>ref|XP_010268982.1| PREDICTED: patatin-like protein 2 [Nelumbo nucifera]
Length=407

 Score =   471 bits (1211),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 247/407 (61%), Positives = 315/407 (77%), Gaps = 27/407 (7%)
 Frame = -3

Query  1586  KIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             +I+R P      T GN++TVLSIDGGGIRGIIP  ILA+LE+QLQELDGEDAR+ADYFDV
Sbjct  10    QIQRPP------TYGNLITVLSIDGGGIRGIIPGTILAFLESQLQELDGEDARIADYFDV  63

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVF  1227
             I GTSTGGLVTAMLTAP+EN RPL+AA+D+  FYL+N PKIFPQ  G FG +  ++RS+F
Sbjct  64    IGGTSTGGLVTAMLTAPNENNRPLFAAQDVTAFYLDNCPKIFPQMCGIFGSVAKTLRSIF  123

Query  1226  -GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKY+GKYL  +L+++L + RL   LTNVVIPTFD+K LQP+IFS+++AK    M+A L
Sbjct  124   VGPKYNGKYLHGILREKLGETRLHQALTNVVIPTFDVKQLQPIIFSSFEAKTTSAMDARL  183

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+CI TSAAPTYLPA+YFK  EG   +       +E+N+IDGGVAANNP L+AI ++TK
Sbjct  184   SDICIATSAAPTYLPAYYFK-NEGEDGD------VREFNLIDGGVAANNPALIAIRELTK  236

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             ++F  NPD FPIKPMD  RFLVIS+GTG+   E KY++K AAKWG++ WLL+ SSTPL++
Sbjct  237   RVFGENPDFFPIKPMDYCRFLVISLGTGSPKKEMKYSAKMAAKWGVMGWLLNGSSTPLVD  296

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
             VF +A +DMVD H + VFQAL   E++YLRIQ              +LTG  +S+D+AT+
Sbjct  297   VFTQAGADMVDFHIAVVFQAL-KSESNYLRIQ------------DDTLTGAVASVDIATK  343

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +NLE LV++GE+LLKKPVSR+NLETG+SEP+ + G NE+ALK+ AK 
Sbjct  344   KNLENLVKVGEELLKKPVSRINLETGLSEPVANGGINEEALKKFAKL  390



>ref|XP_009797488.1| PREDICTED: patatin-like protein 2 isoform X1 [Nicotiana sylvestris]
Length=409

 Score =   470 bits (1210),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 240/396 (61%), Positives = 293/396 (74%), Gaps = 22/396 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN +T+LSIDGGGIRG+IP  IL Y E+QLQ LDGEDARLADYFDVI+GTSTGGL
Sbjct  14    QPPTCGNFITILSIDGGGIRGLIPGTILEYFESQLQALDGEDARLADYFDVIAGTSTGGL  73

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVFGPKYDGKY  1203
             VTAMLTAP+++ RPL+AAKDIKPFYL +GP+IFPQ    WFG I    +SV GPKY GKY
Sbjct  74    VTAMLTAPNKDKRPLFAAKDIKPFYLEHGPRIFPQNTFNWFG-IGTMWKSVTGPKYGGKY  132

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  ++K++L +  L +TLTNVVIP FDIKN+QP IFSTY+A   P M+A LSD+CI TSA
Sbjct  133   LHKVIKEKLGETHLHETLTNVVIPAFDIKNMQPTIFSTYEAMENPLMDAKLSDICISTSA  192

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAH F+ Q+   ++G      +E+N+IDG +AANNPTL+A S+VTKQI+  N D 
Sbjct  193   APTYLPAHQFQTQD---KDGKV----QEFNLIDGAIAANNPTLIATSEVTKQIYAENKDF  245

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKP D  RFLVISIGTG+A  E K+N+K AAKWG+L WL    S P+I+VF +   DM
Sbjct  246   FPIKPSDHGRFLVISIGTGSAKLEQKFNAKMAAKWGLLGWLTKGGSNPIIDVFTQGGDDM  305

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD +NS  FQAL   ++ YLRIQ              +L+G  SS+D+AT+EN+ KLVEI
Sbjct  306   VDYYNSVAFQAL-RSQDHYLRIQ------------DDTLSGIDSSVDIATKENMAKLVEI  352

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             GE LLKKPVSR+NL+ G+ EP    GTNE+ LKR A
Sbjct  353   GENLLKKPVSRINLKKGIFEPHETGGTNEETLKRFA  388



>ref|XP_011099181.1| PREDICTED: patatin-like protein 1 [Sesamum indicum]
Length=399

 Score =   470 bits (1209),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 235/392 (60%), Positives = 292/392 (74%), Gaps = 26/392 (7%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             GN++T+LSIDGGG+RGIIPAV+LAYLE+QLQELDGED R+ADYFDVI+GTSTGGLVT ML
Sbjct  18    GNLITILSIDGGGVRGIIPAVLLAYLESQLQELDGEDVRIADYFDVIAGTSTGGLVTTML  77

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             TAPD N RPLYAAKDI PFYL + PKIFPQ  G F  +   +R   GPKYDGKYL SL +
Sbjct  78    TAPDTNNRPLYAAKDIVPFYLEHSPKIFPQPRGPFAGLISMMRGFHGPKYDGKYLHSLTR  137

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             + L + RL  TLTNVV+ TFDIK LQP IFS+Y A     M+A LSD+CI TSAAPT+LP
Sbjct  138   EMLGNTRLHQTLTNVVLTTFDIKKLQPAIFSSYTAPEDSTMDALLSDICISTSAAPTFLP  197

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
              HYF+ Q G K           +N+IDGG+ ANNPTLVAIS+VT+++ + NPDLFPIKPM
Sbjct  198   PHYFENQ-GAK-----------FNLIDGGIVANNPTLVAISEVTREVSNENPDLFPIKPM  245

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  RFLVIS+GTG   NE  Y+++ AA WG++ W L+ + +PL++ + +A++DMVD HN+
Sbjct  246   DFGRFLVISLGTGARKNEETYDARRAAHWGVVRW-LYVNPSPLLKAYNQANADMVDFHNA  304

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              VFQAL   +++YLRIQ              +LTG  SSMD+AT+ENLE LV++GE+LLK
Sbjct  305   VVFQAL-HSQHNYLRIQ------------DETLTGDLSSMDIATKENLENLVKVGEELLK  351

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             KPV+R+N +TG  EPI + GTN DALK  AK 
Sbjct  352   KPVARMNCQTGAYEPIENGGTNMDALKEFAKL  383



>ref|XP_002282481.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=413

 Score =   470 bits (1210),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 241/402 (60%), Positives = 302/402 (75%), Gaps = 23/402 (6%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T GN++T+LSIDGGGIRG+IP  +L +LE++LQ+LDGEDAR++DYFDVI+GTST
Sbjct  7     SPLQPPTYGNLITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTST  66

Query  1388  GGLVTAMLTAPDEN-GRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVFGPKY  1215
             GGLVTAMLT P+EN GRPL++AKDIK FYL++ PKIFPQ        +   + ++ GPKY
Sbjct  67    GGLVTAMLTTPNENTGRPLFSAKDIKDFYLDHCPKIFPQHSHDPIPHVTKVVTALSGPKY  126

Query  1214  DGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCI  1035
             DGKYL +L+K++L + RL  TLTNVVIPTFDIK LQP IFSTYQ K  P ++A LSD+CI
Sbjct  127   DGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDICI  186

Query  1034  GTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDN  855
             GTSAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNPTLVAI +VTK+I   
Sbjct  187   GTSAAPTYLPAHYFETKDPAGRV-------REFNLIDGGVAANNPTLVAIGEVTKEITRG  239

Query  854   NPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEA  675
             +PD FPIKPMD  RFLVIS+GTG++  E KYN+ EAAKWG+L WL    STPL++VF +A
Sbjct  240   SPDFFPIKPMDYGRFLVISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQA  299

Query  674   SSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEK  495
             S DM+DLH S +FQAL   E SYLRIQ              +L+G  SS+D+AT+ENL+ 
Sbjct  300   SGDMIDLHLSQIFQAL-HSEKSYLRIQ------------DDTLSGITSSVDIATKENLDD  346

Query  494   LVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LV+IGE+LLKK VSRVNL+TG+ EP  H  TNE+AL   A+ 
Sbjct  347   LVKIGEELLKKRVSRVNLDTGIFEPSNHE-TNEEALTSFARL  387



>emb|CBI19552.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   472 bits (1215),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 241/402 (60%), Positives = 302/402 (75%), Gaps = 23/402 (6%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T GN++T+LSIDGGGIRG+IP  +L +LE++LQ+LDGEDAR++DYFDVI+GTST
Sbjct  61    SPLQPPTYGNLITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTST  120

Query  1388  GGLVTAMLTAPDEN-GRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVFGPKY  1215
             GGLVTAMLT P+EN GRPL++AKDIK FYL++ PKIFPQ        +   + ++ GPKY
Sbjct  121   GGLVTAMLTTPNENTGRPLFSAKDIKDFYLDHCPKIFPQHSHDPIPHVTKVVTALSGPKY  180

Query  1214  DGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCI  1035
             DGKYL +L+K++L + RL  TLTNVVIPTFDIK LQP IFSTYQ K  P ++A LSD+CI
Sbjct  181   DGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDICI  240

Query  1034  GTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDN  855
             GTSAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNPTLVAI +VTK+I   
Sbjct  241   GTSAAPTYLPAHYFETKDPAGRV-------REFNLIDGGVAANNPTLVAIGEVTKEITRG  293

Query  854   NPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEA  675
             +PD FPIKPMD  RFLVIS+GTG++  E KYN+ EAAKWG+L WL    STPL++VF +A
Sbjct  294   SPDFFPIKPMDYGRFLVISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQA  353

Query  674   SSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEK  495
             S DM+DLH S +FQAL   E SYLRIQ              +L+G  SS+D+AT+ENL+ 
Sbjct  354   SGDMIDLHLSQIFQAL-HSEKSYLRIQ------------DDTLSGITSSVDIATKENLDD  400

Query  494   LVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LV+IGE+LLKK VSRVNL+TG+ EP  H  TNE+AL   A+ 
Sbjct  401   LVKIGEELLKKRVSRVNLDTGIFEPSNHE-TNEEALTSFARL  441



>ref|XP_008361010.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=401

 Score =   469 bits (1208),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 244/398 (61%), Positives = 298/398 (75%), Gaps = 22/398 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN+++VLSIDGGGIRG+IP  ILA+LE++LQ+LDGEDARLADYFDVISGTSTGGL
Sbjct  10    QPPTYGNLISVLSIDGGGIRGLIPGTILAFLESELQKLDGEDARLADYFDVISGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQK-GGWFGEIWVSIRSVFGPKYDGKY  1203
             VTAMLT PDEN RPL+AAKDIK FYL   PKIFPQK G  F  I   I+ + GPKY+G Y
Sbjct  70    VTAMLTTPDENNRPLFAAKDIKDFYLTESPKIFPQKTGSLFPHIAKIIKRLTGPKYNGNY  129

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L SL++++L + +L  TLTNVVIPTFDIKNLQP IFS+++AK  P  +A +SD+CI TSA
Sbjct  130   LHSLVRQKLGEKKLHQTLTNVVIPTFDIKNLQPTIFSSFEAKHKPPFDALVSDICIATSA  189

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYF+ ++        N   +E+N+IDGGVAANNPTLVAI +VTKQI   +PD 
Sbjct  190   APTYLPAHYFETKD-------HNGNVREFNLIDGGVAANNPTLVAIGEVTKQIIKGSPDF  242

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKPMD  R+LVIS+GTG++  E KY++  AAKWG+L+WL    STP+I+VF + S+DM
Sbjct  243   FPIKPMDYGRYLVISLGTGSSKVELKYSAHNAAKWGLLNWLTSGGSTPIIDVFSQGSADM  302

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VDL+ S VFQAL   E +YLRIQ               L G  SS+D+ATE+NL+ LV++
Sbjct  303   VDLNLSVVFQAL-HSEKNYLRIQ------------DDKLHGDVSSVDIATEKNLDNLVKV  349

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             GE LLK+PVSRVNLETG  E   H  TNE+AL R AK 
Sbjct  350   GEGLLKQPVSRVNLETGKFEVCNHE-TNEEALIRFAKL  386



>gb|KCW66178.1| hypothetical protein EUGRSUZ_F00014 [Eucalyptus grandis]
Length=409

 Score =   469 bits (1208),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 237/397 (60%), Positives = 297/397 (75%), Gaps = 21/397 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGGIRG+IP  ILA+LE++LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  10    QPPTYGNLITILSIDGGGIRGLIPGTILAFLESELQKLDGEDARIADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLT+PDEN RPL+AAKDIK FYL+N PKIFPQ    F      I++V GPKYDGKYL
Sbjct  70    VTAMLTSPDENNRPLFAAKDIKDFYLDNCPKIFPQDSCPFAPATKMIKAVTGPKYDGKYL  129

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
               L+K++L + RL  TLTNVVIPTFDIK+LQP IFS+Y+ KR P +NA LSD+CI TSAA
Sbjct  130   HKLVKEKLGNRRLHQTLTNVVIPTFDIKSLQPTIFSSYEVKRKPSINALLSDICISTSAA  189

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAHYF+ Q+   +        +E+N+IDGGVAANNPT VA+ +VTK+I   + D F
Sbjct  190   PTYLPAHYFETQDSTGK-------IREFNLIDGGVAANNPTFVAMGEVTKEIMGGSSDFF  242

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PIKPMD  RFLVIS+GTG+   E  Y+++EAAKWG+L WL     +PL++VFM+AS+DMV
Sbjct  243   PIKPMDYRRFLVISLGTGSQKVEGNYDAREAAKWGVLGWLSSNGGSPLVDVFMQASADMV  302

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D H S+VFQAL   E +YLRIQ              +L+ + +S+D+AT++NL  LV+ G
Sbjct  303   DFHLSSVFQAL-HLEANYLRIQ------------DDTLSDSVASVDIATKKNLNDLVKTG  349

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             E LLKKPVS+V+LETG         TNE+AL+R AK 
Sbjct  350   EALLKKPVSKVDLETGQHNACKLE-TNEEALRRFAKL  385



>ref|XP_009370195.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=560

 Score =   475 bits (1222),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 245/398 (62%), Positives = 297/398 (75%), Gaps = 22/398 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++TVLSIDGGGIRG+IP  ILA+LE++LQ+LDGEDARLADYFDVISGTSTGGL
Sbjct  10    QPPTYGNLITVLSIDGGGIRGLIPGTILAFLESELQKLDGEDARLADYFDVISGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGW-FGEIWVSIRSVFGPKYDGKY  1203
             VTAMLT PDEN RP+++AKDIK FYL   PKIFPQ   W F  I   I+S+ GPKY+GKY
Sbjct  70    VTAMLTTPDENNRPVFSAKDIKDFYLTESPKIFPQNTCWLFPYITKIIKSLTGPKYNGKY  129

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L SL++++L +I+L  TLTNVVIPTFDIKNLQP IFS+++ K  P  +A +SD+CI TSA
Sbjct  130   LHSLVRQKLGEIKLHQTLTNVVIPTFDIKNLQPTIFSSFEVKHKPFFDALVSDICIATSA  189

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTY PAHYF+ ++        N   +E+N+IDGGVAANNPTLVAI +VTKQI   +PD 
Sbjct  190   APTYFPAHYFETKDH-------NGNVREFNLIDGGVAANNPTLVAIGEVTKQIIKGSPDF  242

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKPMD  RFLVIS+GTG+   E KYN+ +A+KWG+L+WL    STP+I VF  A++DM
Sbjct  243   FPIKPMDYGRFLVISLGTGSPKAELKYNAHDASKWGLLNWLTSGGSTPIINVFSHATADM  302

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VDL+ S VFQAL   E +YLRIQ               L G  SSMD+ATE+NL+ LV++
Sbjct  303   VDLNLSVVFQAL-HSEKNYLRIQ------------DDKLHGDISSMDIATEKNLDNLVKV  349

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             GE LLK+PVSRVNLETG  E   H  TNE+AL R AK 
Sbjct  350   GEDLLKQPVSRVNLETGKFEACNHE-TNEEALIRFAKL  386


 Score =   129 bits (325),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 91/144 (63%), Gaps = 7/144 (5%)
 Frame = -3

Query  1451  ELDGEDARLADYFDVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQK  1272
             +LD EDAR+ADYFDVI+GTSTG LVTAML  PDEN  P    + ++       PK  P+ 
Sbjct  411   KLDVEDARIADYFDVIAGTSTGVLVTAMLATPDENNHPCLLPRILRNSTSLTAPKSSPRN  470

Query  1271  GG-------WFGEIWVSIRSVFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKN  1113
                       F ++   I+++ GPKYDG YL  L+ ++L   +L  TLTN+VIPTFDIK 
Sbjct  471   SNVYMFICPLFPKMTKIIKALSGPKYDGMYLHDLVGQKLGSKKLHQTLTNIVIPTFDIKQ  530

Query  1112  LQPVIFSTYQAKRCPKMNAYLSDV  1041
             LQP IFS+Y+ K  P  +A LSD+
Sbjct  531   LQPTIFSSYEVKSKPCFDALLSDM  554



>gb|KCW66171.1| hypothetical protein EUGRSUZ_F00007, partial [Eucalyptus grandis]
Length=403

 Score =   469 bits (1206),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 242/394 (61%), Positives = 291/394 (74%), Gaps = 21/394 (5%)
 Frame = -3

Query  1550  TGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTA  1371
             T GN +T+LSIDGGGIRG+IP  IL  LE++LQ+LDGEDAR+ DYFDVISGTSTGGLVTA
Sbjct  10    TYGNSITILSIDGGGIRGLIPGTILHLLESELQKLDGEDARIVDYFDVISGTSTGGLVTA  69

Query  1370  MLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSL  1191
             ML  PDEN RP+ AAKDIK FYLN+ PKIFPQ    F  +   I+++ GPKY+GKYL S+
Sbjct  70    MLATPDENNRPVVAAKDIKDFYLNHCPKIFPQDSCPFKPVTKRIKAMAGPKYNGKYLHSV  129

Query  1190  LKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTY  1011
             +++EL D RL  TLTNVVIPTFDIK+LQP IFS+YQ K+ P M+A LSD+CI TSAAPTY
Sbjct  130   VREELGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQLKKDPSMDALLSDICISTSAAPTY  189

Query  1010  LPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIK  831
             LPAH F+ ++   +        +E+N+IDGGVAANNPTLVA+ +VTK I   + D FPIK
Sbjct  190   LPAHQFETEDSTGKV-------REFNLIDGGVAANNPTLVAMGEVTKAIVGGSSDFFPIK  242

Query  830   PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLH  651
             PMD  RFL+IS+GTGT   E KY + EAAKWG+L WL    S PLI+VF  AS+DMVD H
Sbjct  243   PMDYRRFLMISLGTGTTKAEGKYTAPEAAKWGVLRWLTSGGS-PLIDVFSHASADMVDYH  301

Query  650   NSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKL  471
              SAVFQAL    ++YLRIQ              +L+G  SS+DVAT++NL  LV+IGE L
Sbjct  302   LSAVFQAL-QLHDNYLRIQ------------DDTLSGVLSSVDVATKKNLNDLVKIGEAL  348

Query  470   LKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LKKPVSRVNLET VSEP     TNE+AL+R AK 
Sbjct  349   LKKPVSRVNLETSVSEPTSSQETNEEALRRFAKL  382



>ref|XP_010664584.1| PREDICTED: patatin-like protein 2 isoform X2 [Vitis vinifera]
 emb|CBI19548.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   469 bits (1207),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 241/402 (60%), Positives = 301/402 (75%), Gaps = 23/402 (6%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T GN++T+LSIDGGGIRG+IP  +L +LE++LQ+LDGEDAR++DYFDVI+GTST
Sbjct  7     SPLQPPTYGNLITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTST  66

Query  1388  GGLVTAMLTAPDEN-GRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVFGPKY  1215
             GGLVTAMLT P+EN GRPL++AKDIK FYL++ PKIFPQ        +   + ++ GPKY
Sbjct  67    GGLVTAMLTTPNENTGRPLFSAKDIKDFYLDHCPKIFPQHSHDPIPHVTKVVTALSGPKY  126

Query  1214  DGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCI  1035
             DGKYL +L+K++L + RL  TLTNVVIPTFDIK LQP IFSTYQ K  P ++A LSD+CI
Sbjct  127   DGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDICI  186

Query  1034  GTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDN  855
             GTSAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNPTLVAI +VTK+I   
Sbjct  187   GTSAAPTYLPAHYFETKDPAGRV-------REFNLIDGGVAANNPTLVAIGEVTKEIIRG  239

Query  854   NPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEA  675
             +PD FPIKPMD  RFLVIS+GTG++  E KYN+ EAAKWG+L WL    STPL++VF +A
Sbjct  240   SPDFFPIKPMDYGRFLVISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQA  299

Query  674   SSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEK  495
             S DM+DLH S +FQAL   E SYLRIQ              +L G  SS+D+AT+ENL+ 
Sbjct  300   SGDMIDLHLSELFQAL-HSEKSYLRIQ------------DDTLRGITSSVDIATKENLDD  346

Query  494   LVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LV+IGE+LLKK VSRVNL+TG+ EP  H  TNE+AL   A+ 
Sbjct  347   LVKIGEELLKKRVSRVNLDTGIFEPSNHE-TNEEALTSFARL  387



>ref|XP_009612649.1| PREDICTED: patatin-like protein 2 [Nicotiana tomentosiformis]
Length=413

 Score =   469 bits (1207),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 239/401 (60%), Positives = 297/401 (74%), Gaps = 28/401 (7%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGGIRG+IP  IL +LE+QLQ LDG DARLADYFDVI+GTSTGGL
Sbjct  14    QPPTCGNLITILSIDGGGIRGLIPGTILEFLESQLQALDGVDARLADYFDVIAGTSTGGL  73

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKG-GWFG-----EIWVSIRSVFGPK  1218
             VTAML AP+++ RPL+AAKDIKPFYL +GP+IFPQ    WFG      +W   +   GPK
Sbjct  74    VTAMLAAPNKDKRPLFAAKDIKPFYLEHGPRIFPQNTMNWFGIGTITNMW---KLATGPK  130

Query  1217  YDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVC  1038
             Y GKYL  ++K++L    L +TLTNVVIPTFDIKN+QP IFS+Y+A++ P M+A LSD+C
Sbjct  131   YAGKYLHKVIKEKLGGTHLHETLTNVVIPTFDIKNMQPTIFSSYEARKNPLMDAKLSDIC  190

Query  1037  IGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFD  858
             I TSAAPTYLPAH F+ Q+   ++G  +    E+N+IDG +AANNPTL+A S+VTKQI+ 
Sbjct  191   ISTSAAPTYLPAHQFQTQD---RDGNFH----EFNLIDGAIAANNPTLIATSEVTKQIYA  243

Query  857   NNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFME  678
              NPD FPIKP D  RFLVISIGTG+A  E+K+N+K AAKWGIL WL +  S P+I+VF +
Sbjct  244   ENPDFFPIKPSDHGRFLVISIGTGSAKLEHKFNAKMAAKWGILGWLTNGGSNPIIDVFTQ  303

Query  677   ASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLE  498
                DMVD + S  FQAL   E+ YLRIQ              +L+GT SS+D+AT+EN+ 
Sbjct  304   GGDDMVDYYISVAFQALRSDEDHYLRIQ------------DDTLSGTDSSVDIATKENMA  351

Query  497   KLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             KLVEIGE LLKKPVSR+NL+ G+ EP    GTNE+ LKR A
Sbjct  352   KLVEIGETLLKKPVSRINLKKGIFEPHEIGGTNEETLKRFA  392



>ref|XP_002310732.1| patatin family protein [Populus trichocarpa]
 gb|EEE91182.1| patatin family protein [Populus trichocarpa]
Length=407

 Score =   469 bits (1206),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 238/395 (60%), Positives = 282/395 (71%), Gaps = 26/395 (7%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G+ +T+LSIDGGGIRGI+P VILAYLE QLQ LDGEDAR+ADYFDVISGTSTGGL+TAML
Sbjct  16    GSKITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGGLITAML  75

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG---WFGEIWVSIRSVFGPKYDGKYLRS  1194
              AP+E  RPL+ AKDI PFYLNN PKIFPQ  G   W   +W   +++ GPKYDGKYL  
Sbjct  76    AAPNEQQRPLFDAKDIVPFYLNNSPKIFPQTSGIFAWPTNVW---KAISGPKYDGKYLHK  132

Query  1193  LLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPT  1014
             L++  LKD RL  TLTNVVIPTFDIK +QPVIFS+YQ    P  +A LSD+CI TSAAPT
Sbjct  133   LVRDILKDTRLHQTLTNVVIPTFDIKKIQPVIFSSYQVPNNPIKDALLSDICIATSAAPT  192

Query  1013  YLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPI  834
             Y P HYFK Q+            +E+N+IDGG+AANNPTLVAIS+V KQ+   NPD FPI
Sbjct  193   YFPPHYFKNQDAQGNF-------EEFNLIDGGIAANNPTLVAISEVAKQMSKKNPDFFPI  245

Query  833   KPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDL  654
             KPM+  R+LVISIGTG   N   Y++K A++WG++ WL H   TPLI  +  ASSDMVD 
Sbjct  246   KPMNYERYLVISIGTGANKNGTTYSAKAASEWGVIGWLFHNGRTPLITCYNNASSDMVDY  305

Query  653   HNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEK  474
             HNS VFQA    EN YLRI             +  L G  SS+D+AT ENLE LV++GE 
Sbjct  306   HNSVVFQAF-HSENYYLRID------------EDKLQGDLSSVDIATTENLENLVKVGED  352

Query  473   LLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LLK PVSR+NL+TG  EP+   GT E+AL+R AK 
Sbjct  353   LLKSPVSRINLDTGAYEPLEDGGTYEEALQRFAKL  387



>ref|XP_009409669.1| PREDICTED: patatin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=433

 Score =   469 bits (1208),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 229/407 (56%), Positives = 307/407 (75%), Gaps = 21/407 (5%)
 Frame = -3

Query  1583  IERKPSQT-QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             +ER  S   QA T G ++T+LSIDGGGIRG+IPA IL++LE++LQ+LDG+D R+ADYFDV
Sbjct  1     MERSKSIVKQASTCGKLITILSIDGGGIRGVIPATILSFLESELQKLDGDDVRIADYFDV  60

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVF  1227
             I+GTSTGGLVTAML APDEN RPL+AAKD+K FYL + PKIFPQ GG+   +    RS++
Sbjct  61    IAGTSTGGLVTAMLAAPDENNRPLFAAKDMKSFYLEHSPKIFPQIGGFLAPVRRMFRSLW  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKY G YL SL++++L  +RL +TLTNV+IPTFDIK L P IFS+Y+ KR   ++A LS
Sbjct  121   GPKYSGTYLHSLIREKLGGVRLHETLTNVIIPTFDIKQLHPTIFSSYEVKRKSSLDACLS  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CIGT+AAPTY PAHYF+ ++    EG ++   +E+++IDGG+AANNP LVA+ +VTK+
Sbjct  181   DICIGTTAAPTYFPAHYFETKD---SEGSSS---REFHLIDGGIAANNPALVAVGEVTKE  234

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             +   NPD F  + +D  +FL+IS+GTG+A  E KY +K A++WG+  WLL   STPL++V
Sbjct  235   VHKKNPDHFNREAVDYRKFLLISLGTGSAKVEGKYRAKSASRWGVFGWLLGGGSTPLVDV  294

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
              M++ +D+VD+H S VF+AL   E++YLRI+              +LTG  SS D++TEE
Sbjct  295   LMQSCADIVDIHLSVVFKAL-RSESNYLRIE------------DDTLTGAVSSADISTEE  341

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPH-SGTNEDALKRLAKF  369
             NL+ LV +GE+LLKKPVSRVNLETGV EP+ +  GTNEDAL+R A+ 
Sbjct  342   NLDDLVSVGERLLKKPVSRVNLETGVFEPVGNGEGTNEDALRRFARL  388



>ref|XP_011008336.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
 ref|XP_011015438.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score =   468 bits (1204),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 237/395 (60%), Positives = 283/395 (72%), Gaps = 26/395 (7%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G+ +T+LSIDGGGIRGI+P VILAYLE QLQ LDGEDAR+ADYFDVISGTSTGGL+TAML
Sbjct  16    GSKITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGGLITAML  75

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFG---EIWVSIRSVFGPKYDGKYLRS  1194
              AP+E  RPL+ AKDI PFYLNN PKIFPQ  G F     +W   +++ GPKYDGKYL  
Sbjct  76    AAPNEQQRPLFEAKDIVPFYLNNSPKIFPQTSGMFAWPKNVW---KAISGPKYDGKYLHK  132

Query  1193  LLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPT  1014
             L++  LKD RL  TLTNVVIPTFDIK +QPVIFS+YQ    P  +A LSD+CI TSAAPT
Sbjct  133   LVRDILKDTRLQQTLTNVVIPTFDIKKIQPVIFSSYQVPNSPITDALLSDICIATSAAPT  192

Query  1013  YLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPI  834
             Y P HYFK Q+            +E+N+IDGG+AANNPTLVAIS+V+KQ+   NPD FPI
Sbjct  193   YFPPHYFKNQDAQGNF-------EEFNLIDGGIAANNPTLVAISEVSKQMSKKNPDFFPI  245

Query  833   KPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDL  654
             KP +  R+LVISIGTG   N   Y++K A++WG++ WL H   TPLI  +  ASSDMVD 
Sbjct  246   KPTNYERYLVISIGTGANRNGTTYSAKVASEWGVIGWLFHNGRTPLITCYNNASSDMVDY  305

Query  653   HNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEK  474
             HNS VFQA    EN YLRI             +  L G   S+D+AT+ENLE LV++GE 
Sbjct  306   HNSVVFQAF-HSENYYLRID------------EDKLQGDLYSVDIATKENLENLVKVGED  352

Query  473   LLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LLK PVSR+NL+TG  EP+   GTNE+AL+R AK 
Sbjct  353   LLKSPVSRINLDTGGYEPVEDGGTNEEALQRFAKL  387



>ref|XP_010064188.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66466.1| hypothetical protein EUGRSUZ_F00263 [Eucalyptus grandis]
Length=407

 Score =   468 bits (1204),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 241/397 (61%), Positives = 293/397 (74%), Gaps = 21/397 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGGIRG+IP  IL +LE++LQ+LDGEDAR+ADYFDVISGTSTGGL
Sbjct  10    QPPTYGNLITILSIDGGGIRGLIPGTILNFLESELQKLDGEDARIADYFDVISGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLT P+E  RP++AAKDIK FYL + PKIFPQ    F  +   I++V GPKYDGKYL
Sbjct  70    VTAMLTTPNEKNRPVFAAKDIKDFYLKHCPKIFPQDSCPFKPVTKMIKAVAGPKYDGKYL  129

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
               ++++EL D RL  TLTNVVIPTFDIK+LQP IFS+YQ K+ P ++A LSD+CI TSAA
Sbjct  130   HKVVREELGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQVKKDPSVDALLSDICISTSAA  189

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAH F+ ++   +        +E+N+IDGGVAANNPTLVA+ +VTK I   + D F
Sbjct  190   PTYLPAHKFETEDPTGKV-------REFNLIDGGVAANNPTLVAMGEVTKTIVGGSSDFF  242

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PIKPMD  RFLVIS+GTGT   E KY + EAAKWG+L WL     TPLI+VF +AS+DMV
Sbjct  243   PIKPMDYRRFLVISLGTGTGKVEGKYTAHEAAKWGVLGWLT-SGGTPLIDVFTQASADMV  301

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D H SAVFQAL    ++YLRIQ              +L+G  SS+DVAT++NL  LV+ G
Sbjct  302   DYHLSAVFQAL-QLHDNYLRIQ------------DDTLSGVLSSVDVATKKNLTDLVKTG  348

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             E LLKKP SRVNLE GV EP P+  TNE+AL R AK 
Sbjct  349   EALLKKPASRVNLENGVCEPTPNQETNEEALIRFAKL  385



>ref|XP_003603015.1| Patatin-like protein [Medicago truncatula]
 gb|AES73266.1| patatin-like phospholipase [Medicago truncatula]
Length=409

 Score =   468 bits (1204),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 248/407 (61%), Positives = 313/407 (77%), Gaps = 23/407 (6%)
 Frame = -3

Query  1583  IERKPS---QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYF  1413
             +ER  S   Q Q  T GN+VT+LSIDGGGIRGIIPA IL +LE+QLQELDGE ARLADYF
Sbjct  1     MERTQSSLLQIQPPTYGNLVTILSIDGGGIRGIIPATILEFLESQLQELDGESARLADYF  60

Query  1412  DVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRS  1233
             DVI+GTSTGGLVTAML+AP++  RPL+AAKDIKPFYL + PKIFPQ+   FG      RS
Sbjct  61    DVITGTSTGGLVTAMLSAPNDKKRPLFAAKDIKPFYLEHSPKIFPQQKDLFGSFGKLFRS  120

Query  1232  VFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAY  1053
             + GPKYDGKYL  +++++L +IR+ +TLTN+VIPTFDIK +QP+IFS+Y+ K+ P M+A 
Sbjct  121   LVGPKYDGKYLHEVVREKLGEIRVHETLTNIVIPTFDIKTMQPIIFSSYKIKKTPCMDAR  180

Query  1052  LSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVT  873
             LSD+CI TSAAPTYLP + FK Q+    EG T+    E+N+IDGGV ANNPTLVA+++VT
Sbjct  181   LSDICISTSAAPTYLPGYNFKNQD---TEGNTH----EFNLIDGGVCANNPTLVAMNEVT  233

Query  872   KQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
              QI + N D + IKPM+ SRFL+IS+GTGT  NE K+N+K AAKWG+L WL H  STPLI
Sbjct  234   NQIINQNNDFYAIKPMEYSRFLIISLGTGTPKNEQKFNAKMAAKWGLLDWLTHGGSTPLI  293

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             ++F ++S+DMVD H +AV +AL + +++YLRIQ              +LTGT SS+D++T
Sbjct  294   DMFSQSSADMVDFHLAAVTRAL-NSQHNYLRIQ------------DDTLTGTDSSVDIST  340

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
              ENLEKL +IG+KLLKKPVS+VNLE G+ EP+    TNEDALKR AK
Sbjct  341   TENLEKLCQIGDKLLKKPVSKVNLENGMFEPMEKGETNEDALKRFAK  387



>ref|XP_007226655.1| hypothetical protein PRUPE_ppa021897mg [Prunus persica]
 gb|EMJ27854.1| hypothetical protein PRUPE_ppa021897mg [Prunus persica]
Length=407

 Score =   468 bits (1203),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 245/398 (62%), Positives = 298/398 (75%), Gaps = 22/398 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++TVLSIDGGGIRG+IP  ILA+LE++LQ+LDGEDARLADYFDVI+GTSTGGL
Sbjct  10    QPPTYGNLITVLSIDGGGIRGLIPGTILAFLESELQKLDGEDARLADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVFGPKYDGKY  1203
             VTAMLTAPDEN RPL+AA DIK FYLN  PKIFPQ     F  +   I+++ GPKY+GKY
Sbjct  70    VTAMLTAPDENNRPLFAANDIKEFYLNECPKIFPQNTCPLFPHVTKIIKALTGPKYNGKY  129

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L SL++++L D +L  TLTNVVIPTFDI+NLQP IFS+++    P  +A LSD+CIGTSA
Sbjct  130   LHSLVRQKLGDKKLHQTLTNVVIPTFDIRNLQPTIFSSFEVNHKPCFDALLSDICIGTSA  189

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYF+ ++G   EG      KE+N+IDGGVAANNPTL+AI +VTK I   + D 
Sbjct  190   APTYLPAHYFETKDG---EGNV----KEFNLIDGGVAANNPTLLAIGEVTKAIIKGSSDF  242

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKPMD  RFLVIS+GTG+  +E KYN+ +AAKWG+L+WL    STP+I VF  +S+DM
Sbjct  243   FPIKPMDYGRFLVISLGTGSPKDEVKYNAHDAAKWGMLNWLTSGGSTPIINVFSYSSADM  302

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VDL+ S VFQAL   E +YLRIQ               L G  +S+DVATE+NL+ LV++
Sbjct  303   VDLNLSVVFQAL-HSEKNYLRIQ------------DDKLQGDVASVDVATEKNLDSLVKV  349

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             GE LLK+PVSRVNLETG  E   H  TNE+AL R AK 
Sbjct  350   GEGLLKQPVSRVNLETGKFEACNHE-TNEEALTRFAKL  386



>emb|CAN76066.1| hypothetical protein VITISV_001725 [Vitis vinifera]
Length=413

 Score =   468 bits (1204),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 241/402 (60%), Positives = 302/402 (75%), Gaps = 23/402 (6%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T GN++T+LSIDGGGIRG+IP  +L +LE++LQ+LDGEDAR++DYFDVI+GTST
Sbjct  7     SPLQPPTYGNLITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDVIAGTST  66

Query  1388  GGLVTAMLTAPDEN-GRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVFGPKY  1215
             GGLVTAMLT P+EN GRPL++AKDIK FYL++ PKIFPQ        +   + ++ GPKY
Sbjct  67    GGLVTAMLTTPNENTGRPLFSAKDIKDFYLDHCPKIFPQHSHDPIPHVTKVVTALSGPKY  126

Query  1214  DGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCI  1035
             DGKYL +L+K++L + RL  TLTNVVIPTFDIK LQP IFSTYQ K  P ++A LSD+CI
Sbjct  127   DGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPSLDALLSDICI  186

Query  1034  GTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDN  855
             GTSAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNPTLVAI +VTK+I   
Sbjct  187   GTSAAPTYLPAHYFETKDPAGRV-------REFNLIDGGVAANNPTLVAIGEVTKEITRG  239

Query  854   NPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEA  675
             +PD FPIKPMD  RFLVIS+GTG++  E KYN+ EAAKWG+L WL    STPL++VF +A
Sbjct  240   SPDFFPIKPMDYGRFLVISLGTGSSKAEEKYNADEAAKWGVLGWLTSGGSTPLVKVFTQA  299

Query  674   SSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEK  495
             S DM+DLH S +FQAL   E SYLRIQ              +L+G  SS+D+AT+ENL+ 
Sbjct  300   SGDMIDLHLSZIFQAL-HSEKSYLRIQ------------DDTLSGITSSVDIATKENLDD  346

Query  494   LVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LV+IGE+LLKK VSRVNL+TG+ EP  H  TNE+AL  L  +
Sbjct  347   LVKIGEELLKKRVSRVNLDTGIFEPSNHE-TNEEALTSLQDY  387



>ref|XP_010059968.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
Length=411

 Score =   467 bits (1202),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 237/401 (59%), Positives = 295/401 (74%), Gaps = 24/401 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGG+RG++P  ILA+LE++LQ+LDGEDARLADYFDVI+GTSTGGL
Sbjct  10    QPPTYGNLITILSIDGGGMRGLVPGAILAFLESELQKLDGEDARLADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLT+PD++ RPL+ AKDIK F+LNN PKIFPQ    F      I++V GPKYDGKYL
Sbjct  70    VTAMLTSPDKHNRPLFTAKDIKDFFLNNCPKIFPQDSCPFAPATNMIKAVTGPKYDGKYL  129

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
               L+K++L + RL  TLTNVVIPTFD K LQP IFS+Y+ K+ P ++A LSDVCI TSAA
Sbjct  130   HKLIKEKLGNTRLNQTLTNVVIPTFDAKQLQPTIFSSYEVKKKPSIDALLSDVCISTSAA  189

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAHYF+ Q+   +        +E+N+I GGVAANNPTLVA+ +V K+I   + D F
Sbjct  190   PTYLPAHYFETQDPTGKV-------REFNLIVGGVAANNPTLVAMGEVRKEIIGGSSDFF  242

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PI PMD  RFLVIS+GTG+A  E KYN+ EAAKWG+LSWL     +PLI+V M+AS+DMV
Sbjct  243   PINPMDYRRFLVISLGTGSAKVEGKYNASEAAKWGVLSWLSSNGGSPLIDVLMQASADMV  302

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D H S VFQAL   E +YLRIQ              +L+G  +S+D+A ++N+  LV+ G
Sbjct  303   DFHLSVVFQALL-IEANYLRIQ------------DDTLSGAVASVDIAMKKNMNDLVKTG  349

Query  479   EKLLKKPVSRVNLETG----VSEPIPHSGTNEDALKRLAKF  369
             E LLKKPVSRVNLETG      EP P+  TNE+AL+R AK 
Sbjct  350   EALLKKPVSRVNLETGRYEAFCEPTPNQETNEEALRRFAKL  390



>ref|XP_006434813.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
 gb|ESR48053.1| hypothetical protein CICLE_v10001337mg [Citrus clementina]
Length=403

 Score =   466 bits (1200),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 236/403 (59%), Positives = 304/403 (75%), Gaps = 21/403 (5%)
 Frame = -3

Query  1589  VKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             ++I+   S  Q  T GN++T+LSIDGGGIRG+IPA ILA+LE++LQ+LDGE+AR+ADYFD
Sbjct  1     MEIQTPRSPIQPPTFGNLITILSIDGGGIRGVIPATILAFLESELQKLDGEEARIADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             VISGTSTGGLVTAMLTAP+E  RPL+AAKDIK FYLN+ PKIFPQ    FG     I+S+
Sbjct  61    VISGTSTGGLVTAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSCPFGSATKLIKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  L+K++L D +L +TLTNVVIPTFDIKNLQP IFS+Y+ K+ P ++A L
Sbjct  121   TGPKYDGKYLHRLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+C+ TSAAPTYLPAH F+ ++   +        + +++IDGGVAANNPTLVA+++VTK
Sbjct  181   SDICVATSAAPTYLPAHSFETKDCTGK-------VRSFDLIDGGVAANNPTLVALNEVTK  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D + I  MD +RFLVIS+GTG    E KY++ +AAKWG+L WL  +SSTPL++
Sbjct  234   EINRGSSDYYAINAMDYTRFLVISLGTGAPKTEVKYDAIKAAKWGVLGWLSSESSTPLVD  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
             VFM++SSDM D H S  F+AL   EN YLRIQ              +LTG ++S+DVAT+
Sbjct  294   VFMQSSSDMTDFHISTAFKALHS-ENGYLRIQ------------DDTLTGDEASVDVATK  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKR  381
             +NLE LV IGE+LLKKPV++VN ETG+ EP    GTN++AL R
Sbjct  341   KNLESLVGIGERLLKKPVTKVNFETGLCEPCGQ-GTNDEALIR  382



>ref|XP_010059970.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW66464.1| hypothetical protein EUGRSUZ_F00262 [Eucalyptus grandis]
Length=406

 Score =   466 bits (1200),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 239/397 (60%), Positives = 296/397 (75%), Gaps = 21/397 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++TVLSIDGGGIRG+IP  +L +LE++LQ LDG+DAR+ DYFDVISGTSTGGL
Sbjct  10    QPPTYGNLITVLSIDGGGIRGLIPGTVLNFLESELQRLDGKDARIVDYFDVISGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLT PD N RP++AAKDIK FYLN+ PKIFPQ    F  +   I++V GPKYDGKYL
Sbjct  70    VTAMLTTPDGNNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKPVTKIIKAVAGPKYDGKYL  129

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
               ++++EL D RL  TLTN+VIPTFDIK+LQP IFS+YQ K+ P ++A LSD+CI TSAA
Sbjct  130   HDVVREELGDKRLHQTLTNIVIPTFDIKSLQPTIFSSYQVKKDPSVDALLSDICISTSAA  189

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAH F+ ++   +        +E+N+IDGGVAANNPTLVA+ +VTK I   + D F
Sbjct  190   PTYLPAHKFETKDFTGKV-------REFNLIDGGVAANNPTLVAMGEVTKTIMGGSSDFF  242

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
              IKPMD  RFLVIS+GTGT+  E KY + EAAKWG+L WL    S PLI+VF +AS+DMV
Sbjct  243   AIKPMDYRRFLVISLGTGTSKVEGKYTAHEAAKWGVLGWLTSGGS-PLIDVFSQASADMV  301

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D H SAVFQAL + +++YLRIQ              +L+G  SS+DVAT++NL  LV+ G
Sbjct  302   DFHLSAVFQAL-NLQDNYLRIQ------------DDTLSGVLSSVDVATKKNLNDLVKTG  348

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             E LLKKPVSRVNLE+GV +P  +  TNE+ALKR AK 
Sbjct  349   EALLKKPVSRVNLESGVCDPTSNQETNEEALKRFAKL  385



>ref|XP_010064191.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=422

 Score =   466 bits (1200),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 250/399 (63%), Positives = 306/399 (77%), Gaps = 20/399 (5%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             ++ Q  T GNI+T+LSIDGGGIRGIIPA ILA+LE++LQELDGEDARLADYFDVI+GTST
Sbjct  5     AKVQPPTYGNIITILSIDGGGIRGIIPATILAFLESELQELDGEDARLADYFDVIAGTST  64

Query  1388  GGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDG  1209
             GGLVTAMLTAP+E  R L+AAKDI+ FYL + PKIFPQK G +G +   ++S+ GPKYDG
Sbjct  65    GGLVTAMLTAPNEKNRSLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYDG  124

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGT  1029
             KYL  L++++L + RL DTLT+VVIPTFD++ LQP IFS+Y+  R P ++A LSD+CIGT
Sbjct  125   KYLHGLIREKLGEARLHDTLTHVVIPTFDVERLQPTIFSSYEVVRSPYLDARLSDICIGT  184

Query  1028  SAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNP  849
             SAAPTYLPAHYFK Q+    +G T    +E+++IDGGVAANNP LVAI+QV K+  + +P
Sbjct  185   SAAPTYLPAHYFKNQD---VQGCT----REFHLIDGGVAANNPALVAIAQVFKETANASP  237

Query  848   DLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASS  669
             D FP   M+  RFLVISIGTG+   E KYN+K AAKWG + WLLH  S PL++VF  AS+
Sbjct  238   DFFPFAEMNYGRFLVISIGTGSPKIERKYNAKMAAKWGTVDWLLHGGSVPLVDVFTTASA  297

Query  668   DMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLV  489
             DMVDLH SA FQAL   E++YLRIQ              +LT   S +D+AT+ENLE LV
Sbjct  298   DMVDLHISATFQAL-HFEDNYLRIQ------------DDTLTRKDSFVDIATKENLENLV  344

Query  488   EIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
              IGE+LLKKPVSRVNLETG+SEPI    TN DALKR+AK
Sbjct  345   WIGERLLKKPVSRVNLETGLSEPITKGTTNADALKRVAK  383



>gb|EYU30123.1| hypothetical protein MIMGU_mgv1a005982mg [Erythranthe guttata]
Length=462

 Score =   468 bits (1204),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 229/389 (59%), Positives = 299/389 (77%), Gaps = 20/389 (5%)
 Frame = -3

Query  1535  VTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAMLTAP  1356
             +TVLSIDGGGI+GI+PAVIL +LE+QLQELDG+  RLADYFDVI+GTSTGGLVTAM+T+P
Sbjct  27    ITVLSIDGGGIKGILPAVILDFLESQLQELDGDHVRLADYFDVIAGTSTGGLVTAMITSP  86

Query  1355  DENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLKKEL  1176
             DEN RPLYAAKDI PFYL N PKIFPQK  +      ++RS+ GP YDGK+LR +L+++L
Sbjct  87    DENNRPLYAAKDITPFYLENCPKIFPQKRRYL-PFEKTMRSLLGPLYDGKHLRRILEEKL  145

Query  1175  KDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLPAHY  996
             K I+L+  +TNV+IP FDIK LQPVIFSTY+AKR P ++A  SD+CI TSAAPT+LP H 
Sbjct  146   KGIKLSQAITNVIIPAFDIKRLQPVIFSTYEAKRSPLLDAKFSDICISTSAAPTFLPGHE  205

Query  995   FKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPMDLS  816
             F +++        N   KEYN+IDGGVAANNPTL+AI++VTK++F++N D F + P+D  
Sbjct  206   FIVKDD------LNCLEKEYNLIDGGVAANNPTLIAITEVTKKMFESNTDYFRMAPVDYP  259

Query  815   RFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNSAVF  636
             + L ISIGTG A  + KYN+K A+KWGI+ WLLH  +TPL+E+F ++S+DMVD H+S +F
Sbjct  260   QLLTISIGTGAARVDEKYNAKIASKWGIMDWLLHGGTTPLLEIFSQSSADMVDFHSSLLF  319

Query  635   QALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLKKPV  456
             QA    E++YLRIQ              +L+G ++++DVAT++NLE+LV IG++LL  PV
Sbjct  320   QAFY-SEHNYLRIQ------------DDTLSGIENTVDVATQDNLERLVAIGQRLLNNPV  366

Query  455   SRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             SRVNLETG +EPI   GTN+ A+KR A+ 
Sbjct  367   SRVNLETGQTEPIKDGGTNQAAIKRFARL  395



>ref|XP_008776828.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=386

 Score =   465 bits (1197),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 230/391 (59%), Positives = 293/391 (75%), Gaps = 21/391 (5%)
 Frame = -3

Query  1538  IVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAMLTA  1359
             +VTVLSIDGGG+RGIIP  ILA+LE++LQELDGED R+ADYFDV++GTSTGGLVTAML A
Sbjct  1     MVTVLSIDGGGVRGIIPGTILAFLESKLQELDGEDVRIADYFDVVAGTSTGGLVTAMLAA  60

Query  1358  PDENGRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVFGPKYDGKYLRSLLKK  1182
             PDEN RPL+AAK+I  FYL N PKIFP+ G G  G +   + S+ GPKYDGKYL S +K+
Sbjct  61    PDENNRPLFAAKEINDFYLENCPKIFPKNGNGILGSVKSLLGSIAGPKYDGKYLHSKVKQ  120

Query  1181  ELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLPA  1002
              L  IRL  TLTN+VIPTFDIK LQP IFST++ K+    +A LSD+CI TSAAPTYLPA
Sbjct  121   LLGGIRLHQTLTNIVIPTFDIKLLQPTIFSTFETKKEVSKDALLSDICISTSAAPTYLPA  180

Query  1001  HYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPMD  822
             HYF+ ++        N   + +N+IDGG+AANNPTL+A+++VTK+ F  N D FPIKP D
Sbjct  181   HYFQTKD-------FNRKSRSFNLIDGGIAANNPTLLALNEVTKESFKQNDDFFPIKPAD  233

Query  821   LSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNSA  642
               +FLV+S+GTG+A  E K+N+  A+KWG+L WL +   TPLI+ F +ASSDMVD+H S 
Sbjct  234   YGKFLVLSLGTGSAKQEKKFNASMASKWGVLGWLYNSGMTPLIDSFSQASSDMVDIHASV  293

Query  641   VFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLKK  462
             +FQAL  CE++YLRIQ              +L G  +S+DV+++ENL KLV+IG++LLKK
Sbjct  294   IFQAL-HCESNYLRIQ------------DDTLIGDTASVDVSSKENLLKLVQIGKELLKK  340

Query  461   PVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             PVSRVNLE+G+ E +  +GTNE+ L R AK 
Sbjct  341   PVSRVNLESGMYEAVQMAGTNEEELIRFAKM  371



>ref|XP_010320347.1| PREDICTED: patatin-like protein 2 isoform X2 [Solanum lycopersicum]
Length=388

 Score =   465 bits (1197),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 250/394 (63%), Positives = 305/394 (77%), Gaps = 21/394 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T G ++T+LSIDGGGIRGIIPA+IL YLE+QLQELDGEDARLADYFD+I+GTSTGGL
Sbjct  15    QPPTYGKLITILSIDGGGIRGIIPAIILEYLESQLQELDGEDARLADYFDIIAGTSTGGL  74

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVFGPKYDGKY  1203
             VTAMLTAP+++ RP++AAKDIKPFYL +GPKIFPQKG  +FG I  +++S+ GPKY+GKY
Sbjct  75    VTAMLTAPNKDKRPIFAAKDIKPFYLEHGPKIFPQKGMLFFGSIIKTLKSLIGPKYNGKY  134

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  ++K++L +  L +TLTNVVIPTFDIKNLQP IFST++AK  P M+A LSD+CI TS 
Sbjct  135   LHQVIKEKLGETHLHETLTNVVIPTFDIKNLQPTIFSTFEAKEKPLMDAKLSDICISTSG  194

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYFK Q+        +    E+N++DGGVAANNP LVA SQVTKQI   NPD 
Sbjct  195   APTYLPAHYFKTQD-------RDDNFHEFNLVDGGVAANNPALVATSQVTKQIMAGNPDF  247

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKP+D  RFLVIS+GTG+A  E KYN+K A+KWGIL WLL+  STP+++VF +AS DM
Sbjct  248   FPIKPIDYGRFLVISVGTGSAKVEQKYNAKIASKWGILGWLLNGGSTPIVDVFTQASGDM  307

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD H S VFQAL   EN YLR+Q              +L+GT SS+D++T+EN+ KLVEI
Sbjct  308   VDFHISVVFQALHSEEN-YLRVQ------------DDTLSGTDSSVDISTKENMNKLVEI  354

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKR  381
             G  LLKKPVSRVNL+TG+ E      TNE+ LKR
Sbjct  355   GTNLLKKPVSRVNLQTGLFEECKKDDTNEETLKR  388



>ref|XP_010061770.1| PREDICTED: patatin-like protein 2 isoform X1 [Eucalyptus grandis]
 gb|KCW68765.1| hypothetical protein EUGRSUZ_F02366 [Eucalyptus grandis]
Length=404

 Score =   465 bits (1197),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 232/405 (57%), Positives = 299/405 (74%), Gaps = 21/405 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +E   S  +  T GN++T+LSIDGGGIRG++P VILA+LE++LQ+LDGEDAR+ADYFDVI
Sbjct  1     MEYAKSTLKPPTYGNLITILSIDGGGIRGVVPGVILAFLESELQKLDGEDARIADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             +GTSTG L+TAMLTAP+E  RPL+AAK IK FY +NGPKIFPQK   F  I  S + VFG
Sbjct  61    AGTSTGALLTAMLTAPNEENRPLFAAKGIKSFYFDNGPKIFPQKSCLFSSITQSAKLVFG  120

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             PKYDGKYL SLL+ +L ++RL  TLTNVVIPTFDIK LQP+IFS+++ KR  +++A LSD
Sbjct  121   PKYDGKYLHSLLRAKLGNLRLHQTLTNVVIPTFDIKQLQPIIFSSFEEKRKTRLDALLSD  180

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CIG+SAAPTYLPAH+F+  +       +    ++YN+IDGG+AANNPTL+AIS+VT++I
Sbjct  181   ICIGSSAAPTYLPAHFFQTSD-------STGALRDYNLIDGGMAANNPTLIAISEVTREI  233

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                +P    I   +  RFLVIS+GTG+A  E KY +K  AKWG+  WL+  +S PLI+ F
Sbjct  234   TRKSPAFNSINASEFGRFLVISVGTGSAKIEEKYEAKSVAKWGVFGWLMGANSVPLIDAF  293

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
             M+ S+DMVD+H S VF+AL + E++YLRIQ              +L+GT S++D +T+EN
Sbjct  294   MQGSADMVDIHLSVVFKAL-NSESNYLRIQ------------DDTLSGTVSTVDTSTKEN  340

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             L  LV +GEKLLKKPVS+VNLETG  E      TNE ALKR AK 
Sbjct  341   LNNLVGVGEKLLKKPVSKVNLETGNLEASKME-TNEQALKRFAKL  384



>ref|XP_008808514.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=477

 Score =   468 bits (1203),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 230/392 (59%), Positives = 291/392 (74%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G++VTVLSIDGGG+RGIIP  ILA+LE++L +LDGEDAR+ADYFDV++GTSTGGLVTAML
Sbjct  91    GSLVTVLSIDGGGVRGIIPGTILAFLESKLHDLDGEDARIADYFDVVAGTSTGGLVTAML  150

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             TAP++N RPL+AA DI  FYL N PKIFPQK G F         V GPKYDGKYL S+++
Sbjct  151   TAPNKNNRPLFAADDITKFYLENSPKIFPQKTGIFSSTCNLFTVVTGPKYDGKYLHSIIR  210

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             + L + RL   LTN+VIPTFDIK LQP IFST++A+  P  ++ LSD+CI TSAAPTYLP
Sbjct  211   ELLGETRLHQALTNIVIPTFDIKLLQPTIFSTFEARHAPLKDSLLSDICISTSAAPTYLP  270

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AHYF+ ++        N   + +N++DGGVAANNPTL AIS+VTK+I   N D  PIKPM
Sbjct  271   AHYFETKDA-------NGNTRSFNLVDGGVAANNPTLAAISEVTKEILKKNEDFSPIKPM  323

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  +FLVIS+GTG+A NE ++++++A+KWG+L WL +  + PLI++F +AS+DMVD+H S
Sbjct  324   DYGKFLVISLGTGSAKNEERFSAQKASKWGVLRWLYNNGAAPLIDIFTQASADMVDIHAS  383

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              VFQAL    N YLRIQ              +LTG  SS+D++TEENL KLV+IG+ LLK
Sbjct  384   VVFQALHSTGN-YLRIQ------------DDNLTGNASSVDISTEENLLKLVQIGKDLLK  430

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             K VSRVNLETG+SE +    TNE+AL   AK 
Sbjct  431   KRVSRVNLETGLSEEVNGEVTNEEALIHFAKL  462



>ref|XP_009794733.1| PREDICTED: patatin-like protein 2 [Nicotiana sylvestris]
Length=410

 Score =   465 bits (1196),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 244/398 (61%), Positives = 303/398 (76%), Gaps = 21/398 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q+ T   +VT+LSIDGGGIRGIIPA IL YLE+QLQELDG+DARLADYFDVI+GTSTGGL
Sbjct  13    QSPTEEKLVTILSIDGGGIRGIIPATILEYLESQLQELDGKDARLADYFDVIAGTSTGGL  72

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLTAPD+ GRPL+AAKDI PFYL +GPKIFP  GG  G I   ++S+  PKYDGKYL
Sbjct  73    VTAMLTAPDKEGRPLFAAKDIVPFYLEHGPKIFPHNGGLLGSIKRMLKSLVRPKYDGKYL  132

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
               ++K++L + RL +TLTN+VIPTFDIKNLQP +F+T++AK    M+A L+D+CI TSAA
Sbjct  133   HKVIKEKLGETRLHETLTNIVIPTFDIKNLQPTVFTTFEAKENSLMDARLTDICISTSAA  192

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAHYFK QE        +   +E+N++DGGVAANNP LVA SQVTKQI   NPD F
Sbjct  193   PTYLPAHYFKNQE-------KDGNFQEFNLVDGGVAANNPALVATSQVTKQILHGNPDFF  245

Query  839   PIKPMDLSRFLVISIGTGTAGN-EYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             P+KP D  RFL+IS+GTG++   + KYN+K AAKWGI  WLL+  S+P++++   AS DM
Sbjct  246   PVKPEDYGRFLMISLGTGSSTKMKPKYNAKTAAKWGICKWLLYGGSSPILDLLTHASDDM  305

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD H SA+ QAL   EN+YLRIQ              +L GT SS+D++T+ N++KLVEI
Sbjct  306   VDFHISALLQAL-HSENNYLRIQ------------DDTLNGTDSSVDISTKVNMKKLVEI  352

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             G+ LLKK VSR+NL+TG+ EP  HSG+NE+ALKR AK 
Sbjct  353   GKILLKKTVSRINLQTGLLEPCQHSGSNEEALKRFAKL  390



>ref|XP_010269056.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
 ref|XP_010269064.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=408

 Score =   464 bits (1195),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 251/405 (62%), Positives = 303/405 (75%), Gaps = 19/405 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ER  S  Q  T GN++T+LSIDGGGIRGIIPA IL +LE+QLQELDGEDARLADYFDVI
Sbjct  1     MERASSCIQPPTYGNLITILSIDGGGIRGIIPAAILNFLESQLQELDGEDARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             +GTSTGGLVTAMLTAPD++ RPL+AAKDI+ FYL + PKIFPQ  G F      IR + G
Sbjct  61    AGTSTGGLVTAMLTAPDKDNRPLFAAKDIQAFYLEHCPKIFPQCKGPFSSAKKIIRQLAG  120

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             PKY+GKYL  L+K++L   RL DTLTNVVIPTFDIK+LQP IFS+Y+ K+ P ++A LSD
Sbjct  121   PKYNGKYLHGLVKEKLGASRLRDTLTNVVIPTFDIKHLQPTIFSSYEVKKKPFLDAQLSD  180

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CI T+AAPTYLPAH+F+ +      G      +++N+IDGGVAANNPT+VAIS+VTK+I
Sbjct  181   ICISTAAAPTYLPAHHFETK------GSHGTKVRKFNLIDGGVAANNPTIVAISEVTKEI  234

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                NPD FPIKPMD  RFLVIS+GTG+   + KY++K AAKWGIL WLL + STPL++VF
Sbjct  235   LKGNPDFFPIKPMDYGRFLVISLGTGSPKKDEKYSAKMAAKWGILGWLLSRGSTPLVDVF  294

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              +AS DMVD   S VFQAL   E +YLRIQ              +L  T +S+D+AT+EN
Sbjct  295   TQASGDMVDFQISVVFQAL-HSEINYLRIQ------------DDTLNETLASVDIATKEN  341

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LE LV++GE LLKKPVSRVNLETG    I   GTNE ALKR AK 
Sbjct  342   LENLVKVGEALLKKPVSRVNLETGSCVHIESEGTNEQALKRFAKL  386



>ref|XP_010064137.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW66176.1| hypothetical protein EUGRSUZ_F00012 [Eucalyptus grandis]
Length=406

 Score =   464 bits (1193),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 239/397 (60%), Positives = 292/397 (74%), Gaps = 21/397 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGGIRG+IP  IL +LE++LQ+LDGEDAR+ADYFDVISGTSTGGL
Sbjct  10    QPPTYGNLITILSIDGGGIRGLIPGTILNFLESELQKLDGEDARIADYFDVISGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             +TAMLT P+E  RP++AAKD+K FYL + PKIFPQ    F  +   I++V GPKYDGKYL
Sbjct  70    ITAMLTTPNEKNRPVFAAKDVKDFYLKHCPKIFPQDSCPFKPVTKMIKAVAGPKYDGKYL  129

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
               ++++EL D RL  TLTNVVIPTFDIK+LQP IFS+YQ KR P ++A L D+CI TSAA
Sbjct  130   HKVVREELGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQVKRDPSVDALLWDICISTSAA  189

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAH F+ ++   +        +E+N+IDGGVAANNPTLVA+ +VTK I   + D F
Sbjct  190   PTYLPAHKFETKDPTGKV-------REFNLIDGGVAANNPTLVAMGEVTKTIVGGSSDFF  242

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PIKP D  RFLVIS+GTGT   E KY + EAAKWG+L WL     TPLI+VF +AS+DMV
Sbjct  243   PIKPTDYRRFLVISLGTGTGKVEGKYTAHEAAKWGVLGWLT-SGGTPLIDVFTQASADMV  301

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D H  AVFQAL    ++YLRIQ              +L+G  SS+DVAT++NL  LV+ G
Sbjct  302   DYHLFAVFQAL-QLHDNYLRIQ------------DDTLSGVLSSVDVATKKNLTDLVKTG  348

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             E LLKKPVSRVNLETGV EP P+  TNE+AL R AK 
Sbjct  349   EALLKKPVSRVNLETGVCEPTPNQETNEEALMRFAKL  385



>gb|KCW66471.1| hypothetical protein EUGRSUZ_F00268 [Eucalyptus grandis]
Length=390

 Score =   463 bits (1191),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 248/398 (62%), Positives = 304/398 (76%), Gaps = 20/398 (5%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             ++ Q  T GNI+T+LSIDGGGIRGIIPA ILA+LE++LQELDGEDARLADYFDVI+GTST
Sbjct  5     AKVQPPTYGNIITILSIDGGGIRGIIPATILAFLESELQELDGEDARLADYFDVIAGTST  64

Query  1388  GGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDG  1209
             GGLVTAMLTAP+E  R L+AAKDI+ FYL + PKIFPQK G +G +   ++S+ GPKYDG
Sbjct  65    GGLVTAMLTAPNEKNRSLFAAKDIRSFYLEHSPKIFPQKRGLWGRVRNLVKSLTGPKYDG  124

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGT  1029
             KYL  L++++L + RL DTLT+VVIPTFD++ LQP IFS+Y+  R P ++A LSD+CIGT
Sbjct  125   KYLHGLIREKLGEARLHDTLTHVVIPTFDVERLQPTIFSSYEVVRSPYLDARLSDICIGT  184

Query  1028  SAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNP  849
             SAAPTYLPAHYFK Q+    +G T    +E+++IDGGVAANNP LVAI+QV K+  + +P
Sbjct  185   SAAPTYLPAHYFKNQD---VQGCT----REFHLIDGGVAANNPALVAIAQVFKETANASP  237

Query  848   DLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASS  669
             D FP   M+  RFLVISIGTG+   E KYN+K AAKWG + WLLH  S PL++VF  AS+
Sbjct  238   DFFPFAEMNYGRFLVISIGTGSPKIERKYNAKMAAKWGTVDWLLHGGSVPLVDVFTTASA  297

Query  668   DMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLV  489
             DMVDLH SA FQAL   E++YLRIQ              +LT   S +D+AT+ENLE LV
Sbjct  298   DMVDLHISATFQAL-HFEDNYLRIQ------------DDTLTRKDSFVDIATKENLENLV  344

Query  488   EIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
              IGE+LLKKPVSRVNLETG+SEPI    TN DALKR +
Sbjct  345   WIGERLLKKPVSRVNLETGLSEPITKGTTNADALKRCS  382



>ref|XP_010064136.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
Length=428

 Score =   464 bits (1194),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 299/406 (74%), Gaps = 21/406 (5%)
 Frame = -3

Query  1586  KIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             K ++  +  Q     +++TVLSIDGGGIRG+IP  +L +LE++LQ+LDG+DAR+ DYFDV
Sbjct  23    KSDQASALKQEQERKHLITVLSIDGGGIRGLIPGTVLNFLESELQKLDGKDARIVDYFDV  82

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVF  1227
             ISGTSTGGLVTAMLT PD N RP++AAKDIK FYLN+ PKIFPQ    F  +   I++V 
Sbjct  83    ISGTSTGGLVTAMLTTPDGNNRPVFAAKDIKDFYLNHCPKIFPQDSCPFKPVTKIIKAVA  142

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKYDGKYL  ++++EL D RL  TLTN+VIPTFDIK+LQP IFS+YQ K+ P ++A LS
Sbjct  143   GPKYDGKYLHDVVREELGDKRLHQTLTNIVIPTFDIKSLQPTIFSSYQVKKDPSVDALLS  202

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CI TSAAPTYLPAH F+ ++   +        +E+N+IDGGVAANNPTLVA+ +VTK 
Sbjct  203   DICISTSAAPTYLPAHKFETKDFTGK-------VREFNLIDGGVAANNPTLVAMGEVTKT  255

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             I   + D F IKPMD  RFLVIS+GTGT+  E KY + EAAKWG+L WL    S PLI+V
Sbjct  256   IMGGSSDFFAIKPMDYRRFLVISLGTGTSKVEGKYTAHEAAKWGVLGWLTSGGS-PLIDV  314

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F +AS+DMVD H SAVFQAL + +++YLRIQ              +L+G  SS+DVAT++
Sbjct  315   FSQASADMVDFHLSAVFQAL-NLQDNYLRIQ------------DDTLSGVLSSVDVATKK  361

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             NL  LV+ GE LLKKPVSRVNLE+GV +P  +  TNE+ALKR AK 
Sbjct  362   NLNDLVKTGEALLKKPVSRVNLESGVCDPTSNQETNEEALKRFAKL  407



>ref|XP_002281798.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
 emb|CBI21445.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   462 bits (1190),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 228/399 (57%), Positives = 298/399 (75%), Gaps = 20/399 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q +  + G+++T+LSIDGGG+RGII  +ILA LE++LQ+LDGEDARL+DYFDVI+GTS+G
Sbjct  10    QIKPPSRGSLITILSIDGGGVRGIISGIILASLESELQKLDGEDARLSDYFDVIAGTSSG  69

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             GL+T ML AP++N RPLYAA +IKPF   + PKIFP + G  G +    + + GPKYDGK
Sbjct  70    GLITTMLAAPNQNNRPLYAASEIKPFLFEHSPKIFPPRSGIIGSVVNFFKILTGPKYDGK  129

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL S + K L + +L  TLTNVVIPTFDIKNLQP IFS+YQ    P ++A LSD+CIGTS
Sbjct  130   YLHSQINKLLGNTKLDQTLTNVVIPTFDIKNLQPTIFSSYQMAATPSLDAKLSDICIGTS  189

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTYLPA+ F  Q+    +G T    +E+N+IDGG+AA+NPTLVAIS+VTKQ+ + NPD
Sbjct  190   AAPTYLPAYCFVNQD---DQGST----REFNLIDGGLAASNPTLVAISEVTKQVTNKNPD  242

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
               P KP+D    LVIS+G+G+   E+KYN+K AAKWGIL WL +  STPL++ F +AS+D
Sbjct  243   FSPFKPIDYGSLLVISVGSGSPKQEHKYNAKMAAKWGILGWLYNNGSTPLVDSFTQASAD  302

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD HN+ VFQALG C+ +YLRI             + +LTG  +S D+AT++N+ +LV+
Sbjct  303   MVDYHNAVVFQALG-CQENYLRID------------EATLTGDLASTDIATKKNMNELVK  349

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +GE+LLKKPVSRVNL+TG  E I + GTNE+AL+R AK 
Sbjct  350   VGEELLKKPVSRVNLDTGEYEAIKNGGTNEEALRRFAKL  388



>ref|XP_010061771.1| PREDICTED: patatin-like protein 2 isoform X2 [Eucalyptus grandis]
Length=380

 Score =   461 bits (1187),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 230/401 (57%), Positives = 297/401 (74%), Gaps = 21/401 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +E   S  +  T GN++T+LSIDGGGIRG++P VILA+LE++LQ+LDGEDAR+ADYFDVI
Sbjct  1     MEYAKSTLKPPTYGNLITILSIDGGGIRGVVPGVILAFLESELQKLDGEDARIADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             +GTSTG L+TAMLTAP+E  RPL+AAK IK FY +NGPKIFPQK   F  I  S + VFG
Sbjct  61    AGTSTGALLTAMLTAPNEENRPLFAAKGIKSFYFDNGPKIFPQKSCLFSSITQSAKLVFG  120

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             PKYDGKYL SLL+ +L ++RL  TLTNVVIPTFDIK LQP+IFS+++ KR  +++A LSD
Sbjct  121   PKYDGKYLHSLLRAKLGNLRLHQTLTNVVIPTFDIKQLQPIIFSSFEEKRKTRLDALLSD  180

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CIG+SAAPTYLPAH+F+  +       +    ++YN+IDGG+AANNPTL+AIS+VT++I
Sbjct  181   ICIGSSAAPTYLPAHFFQTSD-------STGALRDYNLIDGGMAANNPTLIAISEVTREI  233

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                +P    I   +  RFLVIS+GTG+A  E KY +K  AKWG+  WL+  +S PLI+ F
Sbjct  234   TRKSPAFNSINASEFGRFLVISVGTGSAKIEEKYEAKSVAKWGVFGWLMGANSVPLIDAF  293

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
             M+ S+DMVD+H S VF+AL + E++YLRIQ              +L+GT S++D +T+EN
Sbjct  294   MQGSADMVDIHLSVVFKAL-NSESNYLRIQ------------DDTLSGTVSTVDTSTKEN  340

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKR  381
             L  LV +GEKLLKKPVS+VNLETG  E      TNE ALKR
Sbjct  341   LNNLVGVGEKLLKKPVSKVNLETGNLEASKME-TNEQALKR  380



>ref|XP_002284571.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=425

 Score =   463 bits (1191),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 241/408 (59%), Positives = 304/408 (75%), Gaps = 24/408 (6%)
 Frame = -3

Query  1583  IERKP-SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             +E +P S  Q  T GN++T+LSIDGGGIRG+IP  +L +LE++LQ+LDGEDAR++DYFDV
Sbjct  13    MEEEPKSPLQPPTYGNLITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDV  72

Query  1406  ISGTSTGGLVTAMLTAPDEN-GRPLYAAKDIKPFYLNNGPKIFPQKGGW-FGEIWVSIRS  1233
             I+GTSTGGLVTAMLT P+EN GRPL++AKDIK FYL + P IFPQ        +  ++ S
Sbjct  73    IAGTSTGGLVTAMLTTPNENTGRPLFSAKDIKDFYLEHCPMIFPQHSYVPIPYVTKAVTS  132

Query  1232  VFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAY  1053
             + GPKYDGKYL +L+K++L + +L  TLTNVVIPTFDIK LQP IFSTYQ K  P ++A 
Sbjct  133   LSGPKYDGKYLHNLVKEKLGETQLHQTLTNVVIPTFDIKCLQPTIFSTYQVKSRPSLDAL  192

Query  1052  LSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVT  873
             LSD+CIGTSAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNP LVAI +VT
Sbjct  193   LSDICIGTSAAPTYLPAHYFETKDPTGRV-------REFNLIDGGVAANNPALVAIGEVT  245

Query  872   KQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             ++I   +PD FPIKPMD  RFLVIS+GTG++  E KYN+ +AA+WG+L WL    STPL+
Sbjct  246   QEIIRGSPDFFPIKPMDYGRFLVISLGTGSSKAEEKYNADQAAEWGLLGWLTSGGSTPLV  305

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             +VF +AS DMVDLH S VFQAL   E SYLRIQ              +L+G  SS+D+AT
Sbjct  306   DVFTQASGDMVDLHLSQVFQAL-HSEKSYLRIQ------------DDTLSGITSSVDIAT  352

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +ENL+ LV+IGE+LLKK VSRVNL+TGV EP  H  TNE+AL   A+ 
Sbjct  353   KENLDDLVKIGEELLKKRVSRVNLDTGVFEPSNHE-TNEEALTSFARL  399



>ref|XP_011017230.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
 ref|XP_011013052.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
Length=408

 Score =   462 bits (1189),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 245/419 (58%), Positives = 312/419 (74%), Gaps = 21/419 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++TVLSIDGGGIRG+IP  I+ +LE++LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  10    QPPTFGNLITVLSIDGGGIRGLIPGTIINFLESELQKLDGEDARIADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVFGPKYDGKY  1203
             VTAMLT PDEN RP++AAKDIK FYLN  PKIFPQ +   F ++   I+++ GPKYDGKY
Sbjct  70    VTAMLTCPDENSRPMFAAKDIKDFYLNQCPKIFPQPRCSLFTQVKKVIKALTGPKYDGKY  129

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  L+K+ L + RL  TLTNVVIPTFDIK  QP IFS+++AK+   ++A LSD+CI TSA
Sbjct  130   LHGLVKELLGNRRLHHTLTNVVIPTFDIKTFQPTIFSSFEAKKNHSLDALLSDICIATSA  189

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYF+ ++  +Q G      +E+N+IDGGVAANNP L+AIS+VTK+I   +PD 
Sbjct  190   APTYLPAHYFETKD--EQTGEV----REFNLIDGGVAANNPALIAISEVTKEIVKGSPDF  243

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKPMD  RFL+IS+GTG+   + KY + EAAKWG+L WL    STP+I+ F  AS+DM
Sbjct  244   FPIKPMDYGRFLLISLGTGSPKAQEKYKATEAAKWGLLGWLTSGGSTPVIDAFSHASADM  303

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VDLH S V QAL   EN+YLR+Q              +L+  + S+D+AT+ NLE LV++
Sbjct  304   VDLHISVVLQAL-HSENNYLRVQ------------DDTLSREECSVDIATKTNLEDLVKV  350

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTKRT*WF  306
             GE+LLKKPVSRVNLE+G+ E      TNE+AL R AK LS E++LR +RSP  K++  F
Sbjct  351   GERLLKKPVSRVNLESGLFEQSVKE-TNEEALARFAKILSQEKQLRRARSPHGKKSCKF  408



>ref|XP_009370176.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=406

 Score =   462 bits (1189),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 237/394 (60%), Positives = 296/394 (75%), Gaps = 24/394 (6%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G IVT+LSIDGGGIRG++PA ILA+LE++LQ+LDGEDAR+ADYFDVI+GTSTGGLVTAML
Sbjct  14    GKIVTILSIDGGGIRGLLPATILAFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAML  73

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGW--FGEIWVSIRSVFGPKYDGKYLRSL  1191
              AP+EN RPL+AAKDI  FYLN  PKIFPQK  W  F      I+++ GPKY+GKYL  L
Sbjct  74    AAPNENNRPLFAAKDIIDFYLNQCPKIFPQK-TWPIFPYTTKIIKALAGPKYNGKYLHRL  132

Query  1190  LKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTY  1011
             +++ L + +L DTLTNVVIPTFDIKNLQP IFS+++ K+ P  +A LSD+CIGTSAAPTY
Sbjct  133   IRERLGNKKLHDTLTNVVIPTFDIKNLQPAIFSSFKVKKKPSYDALLSDICIGTSAAPTY  192

Query  1010  LPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIK  831
             LPAHYF+ +    +        +E+N+IDGGVAANNPT +A+S+VT +I   NPD+FPIK
Sbjct  193   LPAHYFETKNAAGRT-------REFNLIDGGVAANNPTSLAVSEVTTEIRKANPDVFPIK  245

Query  830   PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLH  651
             PMD  RFLVIS+GTG++  E KY+++ AAKWG+L+WL    STP+I VF +AS+DMVDLH
Sbjct  246   PMDYGRFLVISLGTGSSKAEMKYHARSAAKWGLLNWLTSGGSTPIINVFSQASADMVDLH  305

Query  650   NSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKL  471
              S+ FQAL   EN YLRIQ              +L GT +S+D AT++NL  LV++GE L
Sbjct  306   LSSAFQALHSEEN-YLRIQ------------DDTLIGTITSVDRATKKNLTNLVKVGEGL  352

Query  470   LKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LKKPVSRVNL++G  E   H  TN +AL R AK 
Sbjct  353   LKKPVSRVNLDSGRFEATKHE-TNAEALIRFAKL  385



>ref|XP_009419098.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   462 bits (1189),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 240/408 (59%), Positives = 312/408 (76%), Gaps = 21/408 (5%)
 Frame = -3

Query  1592  MVKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYF  1413
             M K + K +Q QA T GN++T+LSIDGGGIRGIIPA IL++LE++LQ+LDGEDAR+ADYF
Sbjct  1     MEKSKSKINQIQAPTFGNLITILSIDGGGIRGIIPATILSFLESELQKLDGEDARIADYF  60

Query  1412  DVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRS  1233
             DVISGTSTGGLVTAMLTAPD+N RPL+AAKDIK FYL +  KIFPQ GG    +    ++
Sbjct  61    DVISGTSTGGLVTAMLTAPDDNNRPLFAAKDIKSFYLEHSSKIFPQIGGLLAGVRRMFQA  120

Query  1232  VFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAY  1053
             V+GPKY+GKYL SL+K++L  +RL  TLTNV+IPTFDIK L P+IFS+Y+ KR   ++A 
Sbjct  121   VWGPKYNGKYLHSLIKEKLGGVRLHQTLTNVIIPTFDIKQLHPIIFSSYEVKRNRILDAR  180

Query  1052  LSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVT  873
             LSD+CIGT+AAPTYLPAHYF       Q   +    +E++++DGGVAANNP LV++ +VT
Sbjct  181   LSDICIGTTAAPTYLPAHYF-------QTKCSKGSSREFHLVDGGVAANNPALVSVGEVT  233

Query  872   KQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             K++   NPD FP KPMD  + L+IS+GTG+A  E K+++K A+KWG+L WLL   S PL 
Sbjct  234   KELHKKNPDYFPYKPMDYRKILLISLGTGSAKVEGKFSAKRASKWGVLGWLLSSGSNPLF  293

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             +VFM++S+DMVD+H S VFQAL   +++YLRI+              +L+GT SS+D++T
Sbjct  294   DVFMQSSADMVDIHLSVVFQAL-QSKSNYLRIE------------DDTLSGTVSSVDIST  340

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPH-SGTNEDALKRLAK  372
             +ENL  LV +GE+LLKKPVSRVNLETG+ EP+ +  GTNEDALKR A+
Sbjct  341   KENLADLVNVGEQLLKKPVSRVNLETGIYEPVGNGEGTNEDALKRFAR  388



>emb|CBI19544.3| unnamed protein product [Vitis vinifera]
Length=460

 Score =   464 bits (1193),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 241/408 (59%), Positives = 304/408 (75%), Gaps = 24/408 (6%)
 Frame = -3

Query  1583  IERKP-SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             +E +P S  Q  T GN++T+LSIDGGGIRG+IP  +L +LE++LQ+LDGEDAR++DYFDV
Sbjct  48    MEEEPKSPLQPPTYGNLITILSIDGGGIRGLIPGTVLGFLESELQKLDGEDARISDYFDV  107

Query  1406  ISGTSTGGLVTAMLTAPDEN-GRPLYAAKDIKPFYLNNGPKIFPQKGGW-FGEIWVSIRS  1233
             I+GTSTGGLVTAMLT P+EN GRPL++AKDIK FYL + P IFPQ        +  ++ S
Sbjct  108   IAGTSTGGLVTAMLTTPNENTGRPLFSAKDIKDFYLEHCPMIFPQHSYVPIPYVTKAVTS  167

Query  1232  VFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAY  1053
             + GPKYDGKYL +L+K++L + +L  TLTNVVIPTFDIK LQP IFSTYQ K  P ++A 
Sbjct  168   LSGPKYDGKYLHNLVKEKLGETQLHQTLTNVVIPTFDIKCLQPTIFSTYQVKSRPSLDAL  227

Query  1052  LSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVT  873
             LSD+CIGTSAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNP LVAI +VT
Sbjct  228   LSDICIGTSAAPTYLPAHYFETKDPTGRV-------REFNLIDGGVAANNPALVAIGEVT  280

Query  872   KQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             ++I   +PD FPIKPMD  RFLVIS+GTG++  E KYN+ +AA+WG+L WL    STPL+
Sbjct  281   QEIIRGSPDFFPIKPMDYGRFLVISLGTGSSKAEEKYNADQAAEWGLLGWLTSGGSTPLV  340

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             +VF +AS DMVDLH S VFQAL   E SYLRIQ              +L+G  SS+D+AT
Sbjct  341   DVFTQASGDMVDLHLSQVFQAL-HSEKSYLRIQ------------DDTLSGITSSVDIAT  387

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +ENL+ LV+IGE+LLKK VSRVNL+TGV EP  H  TNE+AL   A+ 
Sbjct  388   KENLDDLVKIGEELLKKRVSRVNLDTGVFEPSNHE-TNEEALTSFARL  434



>ref|XP_011007290.1| PREDICTED: patatin-like protein 3 [Populus euphratica]
Length=407

 Score =   462 bits (1188),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 235/395 (59%), Positives = 281/395 (71%), Gaps = 26/395 (7%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G+ +T+LSIDGGGIRGI+P VILAYLE QLQ LDGEDAR+ADYFDVISGTSTGGL+TAML
Sbjct  16    GSKITILSIDGGGIRGILPGVILAYLEAQLQALDGEDARIADYFDVISGTSTGGLITAML  75

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFG---EIWVSIRSVFGPKYDGKYLRS  1194
              AP+E  RPL+ AKDI PFYLNN PKIFPQ  G F     +W   +++ GPKYDGKYL  
Sbjct  76    AAPNEQQRPLFEAKDIVPFYLNNSPKIFPQTSGMFAWPKNVW---KAISGPKYDGKYLHK  132

Query  1193  LLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPT  1014
             L++  LKD RL  TLTNVVIPTFDIK +QPVIFS+YQ    P  +A LSD+CI TSAAPT
Sbjct  133   LVRDILKDTRLQQTLTNVVIPTFDIKKIQPVIFSSYQVPNSPITDALLSDICIATSAAPT  192

Query  1013  YLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPI  834
             Y P HYFK Q+            +E+N+IDGG+AANNPTLVAIS+V+KQ+   NPD FPI
Sbjct  193   YFPPHYFKNQDAQGNF-------EEFNLIDGGIAANNPTLVAISEVSKQMSKKNPDFFPI  245

Query  833   KPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDL  654
             KP +  R+LVISIGTG   N   Y++K A++WG++ WL H   TPLI  +  ASSDMVD 
Sbjct  246   KPTNYERYLVISIGTGANRNGTTYSAKVASEWGVIGWLFHNGRTPLITCYNNASSDMVDY  305

Query  653   HNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEK  474
             HNS VFQA    EN YLRI             +  L G   S+D+AT+ENLE LV++GE 
Sbjct  306   HNSVVFQAF-HSENYYLRID------------EDKLQGDLYSVDIATKENLENLVKVGED  352

Query  473   LLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LLK PVSR+NL+TG  EP+    T E+AL+R AK 
Sbjct  353   LLKSPVSRINLDTGGYEPVEDGVTYEEALQRFAKL  387



>ref|XP_007017303.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
 gb|EOY14528.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
Length=437

 Score =   463 bits (1191),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 240/401 (60%), Positives = 297/401 (74%), Gaps = 23/401 (6%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T GN++TVLSIDGGGIRG+IP  ILA+LE+QLQ+LDGE ARLADYFDVI+GTST
Sbjct  21    SPLQPPTYGNLITVLSIDGGGIRGLIPGTILAFLESQLQKLDGEQARLADYFDVIAGTST  80

Query  1388  GGLVTAMLTAPDEN--GRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKY  1215
             GGLVTAMLT P+     RPL+AAKDI  FYL + PKIFPQ    F      ++S+ GPKY
Sbjct  81    GGLVTAMLTTPNPEVGNRPLFAAKDIIDFYLEHCPKIFPQDSSPFAPAANVVKSLMGPKY  140

Query  1214  DGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCI  1035
             DGKYL  +++++L + RL  TLTNVVIPTFDIK LQP IFS+Y+ K  P  +A LSD+CI
Sbjct  141   DGKYLHDIVREKLGETRLHQTLTNVVIPTFDIKQLQPKIFSSYEVKSNPSKDALLSDICI  200

Query  1034  GTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDN  855
             GTSAAPTYLPAH+F+ Q+   +       P E+N+IDGGVAANNP LVAI++V+K+I   
Sbjct  201   GTSAAPTYLPAHHFQSQDSTGK-------PIEFNLIDGGVAANNPALVAINEVSKEILRG  253

Query  854   NPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEA  675
             NP+ FPIKP D +RFLV+S+GTG+  +E KY++  AAKWGIL WL  + STPL+++FM+A
Sbjct  254   NPEFFPIKPTDYARFLVVSLGTGSPKSEEKYHANLAAKWGILGWLTSEHSTPLVDIFMQA  313

Query  674   SSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEK  495
             SSDMVD H + +FQAL   E+SYLRIQ              +L+   SS+DVAT+ENLE 
Sbjct  314   SSDMVDFHIATLFQAL-QSEDSYLRIQ------------DDTLSQQMSSVDVATKENLEN  360

Query  494   LVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             LV+ GE+LLKKPVSRVNLE G SEP   + TNE AL RLA+
Sbjct  361   LVKAGEELLKKPVSRVNLEDGKSEPA-GTVTNEKALIRLAE  400



>ref|XP_010942708.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=411

 Score =   462 bits (1188),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 234/392 (60%), Positives = 289/392 (74%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G +VTVLSIDGGG+RGIIP  ILA+LE++LQELDGEDAR+ DYFDVI+GTSTGGLVTAML
Sbjct  16    GRLVTVLSIDGGGVRGIIPGTILAFLESKLQELDGEDARIVDYFDVIAGTSTGGLVTAML  75

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             TAP++N RPL+AAKDI  FYL N  KIFPQK G F  I+    +V GPKY GKYL S ++
Sbjct  76    TAPNKNNRPLFAAKDITKFYLENSSKIFPQKNGIFSSIFNLFTAVTGPKYSGKYLHSKIQ  135

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             + L + RL   LT++VIPTFDIK LQP IFST++A+  P  +A LSD+CIGTSAAPTYLP
Sbjct  136   ELLGETRLHQVLTDIVIPTFDIKLLQPTIFSTFEARHAPLKDALLSDICIGTSAAPTYLP  195

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AHYF+ ++        N   + +N++DGGVAANNPTL A+  +TK+I   N  LFPIKP 
Sbjct  196   AHYFETKDA-------NGNIRSFNLVDGGVAANNPTLAAMGLITKEICKENKHLFPIKPT  248

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  +FLVIS+GTG+A  E K++++EA+KWGIL WL    +TPLI VF +AS+DMVD+H S
Sbjct  249   DYGKFLVISLGTGSAKIEEKFSAQEASKWGILGWLYDHGATPLINVFTQASADMVDIHTS  308

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
             AVFQAL   EN YLRIQ              +L G+ SS+D++T+ENL KLV+IG  LLK
Sbjct  309   AVFQALYSKEN-YLRIQ------------DDTLIGSTSSVDISTKENLLKLVQIGNDLLK  355

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             K VSRVNLETG+ E +   GTNE+AL   AK 
Sbjct  356   KHVSRVNLETGLFELVEGEGTNEEALTHFAKL  387



>emb|CDP02483.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   461 bits (1187),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 244/392 (62%), Positives = 299/392 (76%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             GN+VT+LSIDGGGIRGIIP VILAYLE+QLQELDGE+AR+ADYFDVI+GTSTGGL+TAML
Sbjct  19    GNLVTILSIDGGGIRGIIPGVILAYLESQLQELDGEEARIADYFDVIAGTSTGGLITAML  78

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
              AP+EN RPLYAAKDI PFYL N PKIFPQ GG FG +  + +++ GP YDGKY++ L+K
Sbjct  79    AAPNENHRPLYAAKDIVPFYLENSPKIFPQIGGPFGGVVNAFKTLIGPGYDGKYVQQLIK  138

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
               L   RL  TLT++V+PTFDIK LQPVIFS+YQ    P ++A LSD+CIGTSAAPT+LP
Sbjct  139   SNLGSTRLHQTLTSIVVPTFDIKILQPVIFSSYQVTDNPVVDALLSDICIGTSAAPTFLP  198

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             A+YFK  +    E       +E+N+IDGG+AANNPTLVA+S+VTKQ+   NPD FPIKPM
Sbjct  199   AYYFKNSDAQGNE-------REFNLIDGGIAANNPTLVAVSEVTKQVMKKNPDFFPIKPM  251

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  RFLVIS+GTG+  NE+ YN+K A+KWG+  WL +K STPLI+   +AS+DMVD HNS
Sbjct  252   DYGRFLVISLGTGSDKNEHTYNAKMASKWGVFGWLYYKGSTPLIKAVNQASADMVDFHNS  311

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              VFQAL   +N YLRIQ              +LTGT SS+  AT++NL+ LV++GE+LLK
Sbjct  312   VVFQALHSDDN-YLRIQ------------DDALTGTLSSVATATKQNLDNLVKVGEELLK  358

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             KPV RVNL +G  EP+ + GTN DAL R AK 
Sbjct  359   KPVLRVNLTSGDHEPVENGGTNMDALTRFAKL  390



>ref|XP_004501586.1| PREDICTED: patatin-3-Kuras 1-like isoform X1 [Cicer arietinum]
Length=409

 Score =   461 bits (1187),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 247/407 (61%), Positives = 309/407 (76%), Gaps = 20/407 (5%)
 Frame = -3

Query  1592  MVKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYF  1413
             M + +    Q Q  T G +VT+LSIDGGGIRGIIPA IL YLETQLQELDGE ARLADYF
Sbjct  3     MKRTQSSLLQIQPPTYGKLVTILSIDGGGIRGIIPATILEYLETQLQELDGESARLADYF  62

Query  1412  DVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRS  1233
             DVI+GTSTGGLVTAMLTAP+ N RPL+AAKDIKPFYL + PKIFPQ    FG +    RS
Sbjct  63    DVITGTSTGGLVTAMLTAPNHNQRPLFAAKDIKPFYLEHCPKIFPQHKDLFGSVTKLFRS  122

Query  1232  VFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAY  1053
             + GPKYDGKYL  +++++L +IR+ +TLTN+VIPTFDIK +QP+IFS+Y+ K  P  +A 
Sbjct  123   LAGPKYDGKYLHDMVREKLGEIRVHETLTNIVIPTFDIKTMQPIIFSSYKVKTTPCFDAR  182

Query  1052  LSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVT  873
             LSD+CIGTSAAPTYLP + FK Q+   ++G T+    E+N+IDGGV ANNPTLVA+++VT
Sbjct  183   LSDICIGTSAAPTYLPGYNFKNQD---EDGNTH----EFNLIDGGVCANNPTLVAVNEVT  235

Query  872   KQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             KQI + N D   IKPM+ SRFL+IS+GTGT  NE K++SK AAKWG+L WL H  STPLI
Sbjct  236   KQIINQNNDFDSIKPMEYSRFLIISLGTGTPKNEQKFDSKLAAKWGLLDWLTHGGSTPLI  295

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             ++F ++S DMVD + + V QAL + +++YLRIQ              +LTG  SS+D+AT
Sbjct  296   DMFSQSSGDMVDYNLATVTQAL-NSQDNYLRIQ------------DDTLTGIDSSVDIAT  342

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             +ENL+KL +IGE+LLKKP+S VNLETGV EP  +  TN+DALKR AK
Sbjct  343   KENLDKLCQIGERLLKKPLSNVNLETGVFEPTQNRETNQDALKRFAK  389



>ref|XP_010065725.1| PREDICTED: patatin-like protein 2 [Eucalyptus grandis]
 gb|KCW88150.1| hypothetical protein EUGRSUZ_A00540 [Eucalyptus grandis]
Length=406

 Score =   461 bits (1186),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 239/397 (60%), Positives = 291/397 (73%), Gaps = 21/397 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGGIRG+IP  IL +LE +LQ+LDGEDAR+ADYFDVISGTSTGGL
Sbjct  10    QPPTFGNLITILSIDGGGIRGLIPGTILNFLECELQKLDGEDARIADYFDVISGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAML  P+E  RP++AAKDIK FYL + PKIFPQ    F  +   I++V GPKYDGKYL
Sbjct  70    VTAMLATPNEKNRPVFAAKDIKDFYLEHCPKIFPQDSCPFKPVTKMIKAVAGPKYDGKYL  129

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
              +++++EL D RL  TLTNVVIPTFDIK+LQP IFS+YQ K+   ++A LSD+CI TSAA
Sbjct  130   HNVVREELGDKRLHQTLTNVVIPTFDIKSLQPTIFSSYQVKKDRSVDALLSDICISTSAA  189

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAH F+ ++   +        +E+N+IDGGVAANNPTLVA+ +VTK I   + D F
Sbjct  190   PTYLPAHKFETKDPTGKV-------REFNLIDGGVAANNPTLVAMGEVTKTIMGGSSDFF  242

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PIKPMD  RFLVIS+GTGT   E KY + EAAKWG+L WL     TPLI+VF +AS+DMV
Sbjct  243   PIKPMDYRRFLVISLGTGTGKVEGKYTAHEAAKWGVLGWLT-SGGTPLIDVFTQASADMV  301

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D H  AVFQAL    ++YLRIQ              +L+G  SS+DVAT++NL  LV+ G
Sbjct  302   DYHLCAVFQAL-QLHDNYLRIQ------------DDTLSGVLSSVDVATKKNLTDLVKTG  348

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             E LLKKPVSRVNLETGV EP  +  TNE+AL R AK 
Sbjct  349   EALLKKPVSRVNLETGVGEPTTNQETNEEALIRFAKL  385



>ref|XP_009380972.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=402

 Score =   460 bits (1184),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 231/392 (59%), Positives = 294/392 (75%), Gaps = 21/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G +VTVLSIDGGG+RG+IPA +LA+LE++LQELDG DAR+ADYFDVI+GTSTGGLVTAML
Sbjct  16    GKLVTVLSIDGGGVRGLIPATLLAFLESKLQELDGADARIADYFDVIAGTSTGGLVTAML  75

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVFGPKYDGKYLRSLL  1188
             TAPD++ RPL+ AK I  FYL+N PKIFP+ K G    +     +V GPKYDGKYL S +
Sbjct  76    TAPDKDKRPLFTAKQIIQFYLDNCPKIFPRKKAGLLNPLLNLFGAVTGPKYDGKYLHSKV  135

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             ++ L D +L+ TLTNVVIPTFDIK LQP+IFST++ K  P  +A LSDVC+ TSAAPTYL
Sbjct  136   QQLLGDTKLSQTLTNVVIPTFDIKFLQPIIFSTFETKSTPLKDALLSDVCVSTSAAPTYL  195

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKP  828
             P H F+ ++    EG T    +E+N+IDGGVAANNPTL A++QVTK+IF  N D FPIKP
Sbjct  196   PGHCFETKD---DEGST----REFNLIDGGVAANNPTLTAMNQVTKEIFMENADFFPIKP  248

Query  827   MDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHN  648
             +D  RFLVIS+GTG+   E +++++E+ KWG+L WL +K +TP+I++F +AS+DMVD+H 
Sbjct  249   VDYGRFLVISLGTGSNKQEERFSAEESGKWGLLGWLYNKGTTPIIDIFSQASADMVDIHA  308

Query  647   SAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLL  468
             S +FQAL   E  YLRIQ            + +L G  +S+DV+T ENLEKL+E+G  LL
Sbjct  309   SVLFQAL-HSEQHYLRIQ------------EDALVGDTASVDVSTRENLEKLMEVGGNLL  355

Query  467   KKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             KKPVSRVNLE G  EP    GTNE+AL R A+
Sbjct  356   KKPVSRVNLENGTFEPCDGEGTNEEALTRFAR  387



>ref|XP_008228776.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=428

 Score =   461 bits (1187),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 241/398 (61%), Positives = 294/398 (74%), Gaps = 22/398 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             QA T GN++TVLSIDGGGIRG+IP  IL YLE +LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  10    QAPTYGNLITVLSIDGGGIRGLIPGTILGYLEAELQKLDGEDARIADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVFGPKYDGKY  1203
             VTAML  PDEN RP++AAKDIK FYL + PKIFPQK    F      I+++ GPKYDGKY
Sbjct  70    VTAMLATPDENNRPVFAAKDIKDFYLTHCPKIFPQKHCPIFPYATKIIKALAGPKYDGKY  129

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  L+ ++L D +L  TLTNVVIPTFDIK LQP IFS+Y+ K  P  +A LSD+CI TSA
Sbjct  130   LHDLVGQKLGDKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKHKPGFDAKLSDICIATSA  189

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYF+  +    EG      +E+N+IDGGVAANNPTL+AI +VTK I   + D 
Sbjct  190   APTYLPAHYFETMD---PEGNV----REFNLIDGGVAANNPTLLAIGEVTKTIIKGSSDF  242

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKPMD +RFLVIS+GTG+A  E+KY++  AAKWG+L WL     TP+I+VF ++S+DM
Sbjct  243   FPIKPMDYTRFLVISLGTGSAKAEFKYHALSAAKWGLLDWLTSGGGTPIIDVFSQSSADM  302

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD H S VFQAL   EN+YLRIQ              +LTG  SS+D+A ++NL+ L+ +
Sbjct  303   VDYHLSVVFQAL-RSENNYLRIQ------------DDTLTGHVSSVDIADKQNLDDLLLV  349

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             GE+LLKKPVSRVNLETG  EP  H  +NE+AL R AK 
Sbjct  350   GERLLKKPVSRVNLETGRVEPSKHE-SNEEALTRFAKL  386



>ref|XP_003603014.1| Patatin-like protein [Medicago truncatula]
 gb|AES73265.1| patatin-like phospholipase [Medicago truncatula]
Length=408

 Score =   460 bits (1184),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 253/426 (59%), Positives = 321/426 (75%), Gaps = 23/426 (5%)
 Frame = -3

Query  1583  IERKPS---QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYF  1413
             +ER  S   Q Q  T GN+VT+LSIDGGGIRGIIPA IL +LE+QLQELDGE ARLADYF
Sbjct  1     MERTQSSLLQIQPPTYGNLVTILSIDGGGIRGIIPATILEFLESQLQELDGESARLADYF  60

Query  1412  DVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRS  1233
             DVI+GTSTGGLVTAML+AP++  RPL+AAKDIKPFYL + PKIFPQ+    G +    +S
Sbjct  61    DVITGTSTGGLVTAMLSAPNDKQRPLFAAKDIKPFYLEHCPKIFPQQKHMLGSVGKLFKS  120

Query  1232  VFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAY  1053
             + GPKYDG YL S+++++L +IR+ +TLTN+VIPTFDIK  QP+IFS+Y+ K  P M+A 
Sbjct  121   LAGPKYDGNYLHSVVREKLGEIRVHETLTNIVIPTFDIKTSQPIIFSSYKIKNAPCMDAR  180

Query  1052  LSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVT  873
             LSD+CI TSAAPTYLP + FK Q+       T    +E+N+IDGGV ANNP LVA+++VT
Sbjct  181   LSDICISTSAAPTYLPGYNFKNQD-------TEGNVREFNLIDGGVCANNPALVAVNEVT  233

Query  872   KQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
              QI + N D + IKPM+ SRFL+IS+GTGT  NE K++SK AAKWG+L WL H  STPLI
Sbjct  234   TQIINENNDFYAIKPMEYSRFLIISLGTGTPKNEQKFDSKLAAKWGLLDWLTHGGSTPLI  293

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             ++F ++S DMVD H + V QAL +C+++YLRIQ              +LTGT SS+D++T
Sbjct  294   DIFSQSSGDMVDFHLATVTQAL-NCQDNYLRIQ------------DDTLTGTDSSVDIST  340

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrS  333
             +ENLEKL +IG++LLKKPVS+VNLE G+ EPI +  TN++ALKR AK LS ER+LRE  S
Sbjct  341   KENLEKLCQIGDRLLKKPVSKVNLENGMFEPIENGETNQEALKRFAKILSQERKLRELTS  400

Query  332   PVTKRT  315
             P T  T
Sbjct  401   PHTNNT  406



>ref|XP_010028264.1| PREDICTED: patatin-like protein 1 [Eucalyptus grandis]
 gb|KCW54972.1| hypothetical protein EUGRSUZ_I00938 [Eucalyptus grandis]
Length=407

 Score =   460 bits (1183),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 230/408 (56%), Positives = 304/408 (75%), Gaps = 23/408 (6%)
 Frame = -3

Query  1583  IERKPSQTQAH--TGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             +E+K S  +    T G ++T+LSIDGGG+RGIIP VIL YLE QLQELDGE ARLADYFD
Sbjct  1     MEKKASSLKIRPPTYGKLITILSIDGGGVRGIIPGVILGYLEAQLQELDGEGARLADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             VI+GTSTGGL+TAML+APD + RPL+AAKDI PFYL N PKIFPQ  G  G +  +I+S+
Sbjct  61    VIAGTSTGGLITAMLSAPDAHNRPLFAAKDIVPFYLENCPKIFPQGCGSLGSVLNTIKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKY+G YL  L++K L   RL DTLT++VIPTFDIK LQPV+FS+Y+  +   ++A +
Sbjct  121   TGPKYNGVYLHKLIRKLLGSTRLHDTLTSLVIPTFDIKKLQPVLFSSYEVSKHSFLDAQV  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+CIGTSAAPTY PA+YFK ++   ++G  +    E+N+IDGG+AANNPTL+AIS+VT+
Sbjct  181   SDICIGTSAAPTYFPAYYFKTED---KDGRVH----EFNLIDGGLAANNPTLIAISEVTR  233

Query  869   QIFDNNPDLFPIK-PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             QI   +PD F IK P+D +R LVIS+GTG+  +E K+++K+A+KWG+ SWL    S+PLI
Sbjct  234   QILKEDPDFFDIKSPIDYTRLLVISLGTGSDTSELKFDAKKASKWGLFSWLYEDGSSPLI  293

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             + + + S+D+VD HNS  F+     E++YLRI               +L GT SS+D +T
Sbjct  294   DAYTQGSADLVDYHNSVAFKTY-QSEDNYLRIN------------DDTLKGTLSSVDTST  340

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             ++NLE LV++GE LL+K VSRVNL+TG  EPIP++GTNE+ALKR AK 
Sbjct  341   KKNLEDLVKVGEDLLRKAVSRVNLDTGHYEPIPNAGTNEEALKRFAKL  388



>ref|XP_007222710.1| hypothetical protein PRUPE_ppa006466mg [Prunus persica]
 gb|EMJ23909.1| hypothetical protein PRUPE_ppa006466mg [Prunus persica]
Length=410

 Score =   460 bits (1183),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 241/398 (61%), Positives = 293/398 (74%), Gaps = 22/398 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             QA T GN++TVLSIDGGGIRG+IP  IL YLE +LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  10    QAPTYGNLITVLSIDGGGIRGLIPGTILGYLEAELQKLDGEDARIADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVFGPKYDGKY  1203
             VTAML  PDEN RP++AAKDIK FYL + PKIFPQK    F      I+++ GPKYDGKY
Sbjct  70    VTAMLATPDENNRPVFAAKDIKDFYLTHCPKIFPQKHCPIFPYTTKIIKALAGPKYDGKY  129

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  L+ ++L D +L  TLTNVVIPTFDIK LQP IFS+Y+ K  P  +A LSD+CI TSA
Sbjct  130   LHDLVGQKLGDKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKHKPGFDAKLSDICIATSA  189

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYF+  +    EG      +E+N+IDGGVAANNPTL+AI +VTK I   + D 
Sbjct  190   APTYLPAHYFETMD---PEGNV----REFNLIDGGVAANNPTLLAIGEVTKTIIKGSSDF  242

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKPMD +RFLVIS+GTG+A  E+KY++  AAKWG+L WL     TP+I+VF ++S+DM
Sbjct  243   FPIKPMDYARFLVISLGTGSAKAEFKYHALSAAKWGLLDWLTSGGGTPIIDVFSQSSADM  302

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD H S VFQAL   EN+YLRIQ              +LTG  SS+D+A ++NL+ L+ +
Sbjct  303   VDYHLSVVFQAL-HSENNYLRIQ------------DDTLTGHVSSVDIADKKNLDDLLIV  349

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             GE LLKKPVSRVNLETG  EP  H  +NE+AL R AK 
Sbjct  350   GEGLLKKPVSRVNLETGRVEPSKHE-SNEEALTRFAKL  386



>ref|XP_008393828.1| PREDICTED: patatin-like protein 2 isoform X2 [Malus domestica]
Length=408

 Score =   459 bits (1181),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 239/398 (60%), Positives = 293/398 (74%), Gaps = 22/398 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             QA T GN++T+LSIDGGGIRG+IP  IL YLE++LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  10    QAPTYGNLITILSIDGGGIRGLIPGTILGYLESELQKLDGEDARIADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVFGPKYDGKY  1203
             VTAML  PD+N RP+++AKDIK FYL + PKIFPQK    F ++   I+++ GPKYDGKY
Sbjct  70    VTAMLATPDDNNRPVFSAKDIKDFYLTHCPKIFPQKHCPLFPKMTKIIKALSGPKYDGKY  129

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  L+ ++L   +L  TLTNVVIPTFDIK LQP IFS+Y+ K  P  +A LSD+CI TSA
Sbjct  130   LHDLVGQKLGSKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKSKPFFDALLSDICIATSA  189

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYF   E    EG      K++N+IDGGVAANNPTL+AI +VTK I   + D 
Sbjct  190   APTYLPAHYF---ETIDPEGNV----KDFNLIDGGVAANNPTLLAIGEVTKTIISGSEDF  242

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKPMD  RFLVIS+GTG+A  E+KY +  AAKWG+L WL     TP+I+VF ++SSDM
Sbjct  243   FPIKPMDYGRFLVISLGTGSAKAEFKYRAHSAAKWGLLDWLTSGGGTPIIDVFSQSSSDM  302

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD H S VFQAL   EN+YLRIQ              +LTG  SS+D+A ++NL+ L+++
Sbjct  303   VDYHLSVVFQAL-HSENNYLRIQ------------DDTLTGQVSSVDIADKKNLDDLLKV  349

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             GE LLKKPVSRVNLETG  EP  H  +NE+AL R AK 
Sbjct  350   GEGLLKKPVSRVNLETGRVEPSKHE-SNEEALTRFAKL  386



>ref|XP_007227183.1| hypothetical protein PRUPE_ppa019615mg [Prunus persica]
 gb|EMJ28382.1| hypothetical protein PRUPE_ppa019615mg [Prunus persica]
Length=383

 Score =   458 bits (1178),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 230/390 (59%), Positives = 294/390 (75%), Gaps = 28/390 (7%)
 Frame = -3

Query  1538  IVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAMLTA  1359
             ++T+LSIDGGGIRG+IPA IL++LE++LQ+LDGEDAR+ADYFDV++GTSTGGLVTAMLT 
Sbjct  1     MITILSIDGGGIRGLIPATILSFLESELQKLDGEDARIADYFDVVAGTSTGGLVTAMLTT  60

Query  1358  PDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLKKE  1179
             P+EN RPL++AKDI  FY+N+ PKIFPQK          I+++ GPKYDGKYL  L++++
Sbjct  61    PNENDRPLFSAKDISDFYMNHCPKIFPQKKKI-------IKALGGPKYDGKYLHGLIRQK  113

Query  1178  LKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLPAH  999
             L D ++  TLTNVVIPTFDIKNLQP +FS+++ +  P  NA LSDVCIGTSAAPT+LPAH
Sbjct  114   LGDTKMDQTLTNVVIPTFDIKNLQPTVFSSFRVRHKPSYNALLSDVCIGTSAAPTFLPAH  173

Query  998   YFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPMDL  819
             YF+ ++   Q        +E+N+IDGGVAANNPTL+AI +VT +I   NPD FP+KP+D 
Sbjct  174   YFETKDEFGQ-------TREFNLIDGGVAANNPTLLAICEVTNEIKKANPDFFPVKPVDY  226

Query  818   SRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNSAV  639
              RFLVIS+GTGT+  E KYNS  AAKWG+L+WL    +TP+I VF +AS+DMVDLH S V
Sbjct  227   GRFLVISLGTGTSKAELKYNSHTAAKWGLLNWLTSGGTTPIINVFSQASADMVDLHLSGV  286

Query  638   FQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLKKP  459
             FQAL   E+ YLRIQ              +L GT SS+DVAT++NL +LV +GE LLK+ 
Sbjct  287   FQAL-HSEDYYLRIQ------------DDTLRGTVSSVDVATKKNLSRLVTVGEGLLKER  333

Query  458   VSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             VSRVNL++G  E      TNE+AL+R+AK 
Sbjct  334   VSRVNLDSGRFEASDRE-TNEEALRRVAKL  362



>gb|AAX99411.1| patatin-like protein [Gossypium hirsutum]
Length=434

 Score =   460 bits (1183),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 236/400 (59%), Positives = 295/400 (74%), Gaps = 23/400 (6%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T GN++T+LSIDGGGIRG+IP  +LA+LE+QLQ+LDGE ARLADYFD+ISGTST
Sbjct  21    SPLQPPTYGNLITLLSIDGGGIRGLIPGTLLAFLESQLQKLDGEQARLADYFDIISGTST  80

Query  1388  GGLVTAMLTAPD--ENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKY  1215
             GGLVTAMLT PD  +  RPL+AAKDI  FYL + PKIFPQ    F      ++S+ GPKY
Sbjct  81    GGLVTAMLTTPDPKKENRPLFAAKDINEFYLEHCPKIFPQDSSPFAPAANVVKSLMGPKY  140

Query  1214  DGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCI  1035
             DGKYL  +++++L + +L  TLTNVVIPTFDIK LQP IFSTY+ K  P  +A LSD+CI
Sbjct  141   DGKYLHDIVREKLGETKLHQTLTNVVIPTFDIKQLQPRIFSTYEVKSHPCTDALLSDICI  200

Query  1034  GTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDN  855
              TSAAPTYLPAH+F+ Q+   +        KE+N+IDGGVAANNPTLVA+++VTK+I   
Sbjct  201   ATSAAPTYLPAHHFQTQDSTGKT-------KEFNLIDGGVAANNPTLVAMNEVTKEILRG  253

Query  854   NPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEA  675
             NP+ FPIKP D +RFLV+S+GTG+  +E KY++   AKWG+L WL  + STPL+++FM+A
Sbjct  254   NPEFFPIKPTDYARFLVVSLGTGSPKSEGKYHANMTAKWGVLGWLTSEHSTPLVDIFMQA  313

Query  674   SSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEK  495
             SSDMVD H + VFQAL   ENSYLRIQ              +L+   SS+D+AT+ENLE 
Sbjct  314   SSDMVDFHIATVFQAL-QSENSYLRIQ------------DDTLSQQISSVDIATKENLEN  360

Query  494   LVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             LV++GE+LLKKPVSRVNLE G  EP     TN +AL RLA
Sbjct  361   LVKVGEELLKKPVSRVNLENGQFEPAGKI-TNGEALIRLA  399



>ref|XP_008393827.1| PREDICTED: patatin-like protein 2 isoform X1 [Malus domestica]
Length=407

 Score =   459 bits (1180),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 239/398 (60%), Positives = 293/398 (74%), Gaps = 22/398 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             QA T GN++T+LSIDGGGIRG+IP  IL YLE++LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  10    QAPTYGNLITILSIDGGGIRGLIPGTILGYLESELQKLDGEDARIADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVFGPKYDGKY  1203
             VTAML  PD+N RP+++AKDIK FYL + PKIFPQK    F ++   I+++ GPKYDGKY
Sbjct  70    VTAMLATPDDNNRPVFSAKDIKDFYLTHCPKIFPQKHCPLFPKMTKIIKALSGPKYDGKY  129

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  L+ ++L   +L  TLTNVVIPTFDIK LQP IFS+Y+ K  P  +A LSD+CI TSA
Sbjct  130   LHDLVGQKLGSKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKSKPFFDALLSDICIATSA  189

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYF   E    EG      K++N+IDGGVAANNPTL+AI +VTK I   + D 
Sbjct  190   APTYLPAHYF---ETIDPEGNV----KDFNLIDGGVAANNPTLLAIGEVTKTIISGSEDF  242

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKPMD  RFLVIS+GTG+A  E+KY +  AAKWG+L WL     TP+I+VF ++SSDM
Sbjct  243   FPIKPMDYGRFLVISLGTGSAKAEFKYRAHSAAKWGLLDWLTSGGGTPIIDVFSQSSSDM  302

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD H S VFQAL   EN+YLRIQ              +LTG  SS+D+A ++NL+ L+++
Sbjct  303   VDYHLSVVFQAL-HSENNYLRIQ------------DDTLTGQVSSVDIADKKNLDDLLKV  349

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             GE LLKKPVSRVNLETG  EP  H  +NE+AL R AK 
Sbjct  350   GEGLLKKPVSRVNLETGRVEPSKHE-SNEEALTRFAKL  386



>ref|XP_009367378.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=407

 Score =   458 bits (1179),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 239/398 (60%), Positives = 292/398 (73%), Gaps = 22/398 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             QA T GN++T+LSIDGGGIRG+IP  IL YLE++LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  10    QAPTFGNLITILSIDGGGIRGLIPGTILGYLESELQKLDGEDARIADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVFGPKYDGKY  1203
             VTAML  PD+N RP++AAKDIK FYL + PKIFPQK    F ++   I+++ GPKYDGKY
Sbjct  70    VTAMLATPDDNNRPVFAAKDIKDFYLTHCPKIFPQKHCPLFPKMTKIIKALSGPKYDGKY  129

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  L+ ++L   +L  TLTNVVIPTFDIK LQP IFS+Y+ K  P  +A LSD+CI TSA
Sbjct  130   LHDLVGQKLGSKKLHQTLTNVVIPTFDIKQLQPTIFSSYEVKSKPSFDALLSDICIATSA  189

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYF   E    EG      K++N+IDGGVAANNPTL+AI +VTK I   + D 
Sbjct  190   APTYLPAHYF---ETIDPEGNV----KDFNLIDGGVAANNPTLLAIGEVTKTIISGSEDF  242

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FPIKPMD  RFLVIS+GTG+   E+KY +  AAKWG+L WL     TP+I+VF ++SSDM
Sbjct  243   FPIKPMDYGRFLVISLGTGSPKAEFKYRAHSAAKWGLLDWLTSGGGTPIIDVFSQSSSDM  302

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD H S VFQAL   EN+YLRIQ              +LTG  SS+D+A ++NL+ L+++
Sbjct  303   VDYHLSVVFQAL-HSENNYLRIQ------------DDTLTGQVSSVDIADKKNLDDLLKV  349

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             GE LLKKPVSRVNLETG  EP  H  +NE+AL R AK 
Sbjct  350   GEGLLKKPVSRVNLETGRVEPSKHE-SNEEALTRFAKL  386



>ref|XP_011030334.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=415

 Score =   458 bits (1179),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 265/421 (63%), Positives = 314/421 (75%), Gaps = 21/421 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             IE   S  Q  T GN +TVLSIDGGGIRGIIP  ILA+LE++LQ+LDG DARLADYFDVI
Sbjct  11    IETLRSPIQPPTFGNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVI  70

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             SGTSTGGLVTAML  P+E  RPL+AAKDI  FYL N PKIFPQ G         IRS+ G
Sbjct  71    SGTSTGGLVTAMLATPNEQNRPLFAAKDINDFYLENCPKIFPQDGSPLASAGKLIRSLRG  130

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             PKYDGK+L S++K++L D RL  T+TN+VIPTFDIK LQP IFS+YQ K  P  +A LSD
Sbjct  131   PKYDGKFLHSIVKEKLGDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNNPSTDALLSD  190

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CIGTSAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNPTLVA+S+V+K+I
Sbjct  191   ICIGTSAAPTYLPAHYFETKDPSGKV-------REFNLIDGGVAANNPTLVAMSEVSKEI  243

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                NPD FP  PMD  RFLV+S+GTGTA +E KY++ EAAKWGIL WL   +STPL++VF
Sbjct  244   TRKNPDFFPTAPMDYGRFLVLSLGTGTAKSEEKYDADEAAKWGILGWLTSDNSTPLVDVF  303

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              EAS DMVDLH S VFQAL   EN YLRIQ              +LTGT SS+DVAT+EN
Sbjct  304   TEASGDMVDLHISTVFQALHSEEN-YLRIQ------------DDTLTGTLSSVDVATKEN  350

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVT  324
             LE LV++GEKLLKKPVSRV+L TGV  P+    TNE+AL ++AK LS E+ LR+SRSPV 
Sbjct  351   LENLVKVGEKLLKKPVSRVDLGTGVFTPV-DKMTNEEALIKMAKLLSREKHLRDSRSPVG  409

Query  323   K  321
             K
Sbjct  410   K  410



>ref|XP_007017304.1| Phospholipase A 2A, IIA,PLA2A isoform 2 [Theobroma cacao]
 gb|EOY14529.1| Phospholipase A 2A, IIA,PLA2A isoform 2 [Theobroma cacao]
Length=438

 Score =   459 bits (1181),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 240/402 (60%), Positives = 297/402 (74%), Gaps = 24/402 (6%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T GN++TVLSIDGGGIRG+IP  ILA+LE+QLQ+LDGE ARLADYFDVI+GTST
Sbjct  21    SPLQPPTYGNLITVLSIDGGGIRGLIPGTILAFLESQLQKLDGEQARLADYFDVIAGTST  80

Query  1388  GGLVTAMLTAPDEN--GRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKY  1215
             GGLVTAMLT P+     RPL+AAKDI  FYL + PKIFPQ    F      ++S+ GPKY
Sbjct  81    GGLVTAMLTTPNPEVGNRPLFAAKDIIDFYLEHCPKIFPQDSSPFAPAANVVKSLMGPKY  140

Query  1214  DGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCI  1035
             DGKYL  +++++L + RL  TLTNVVIPTFDIK LQP IFS+Y+ K  P  +A LSD+CI
Sbjct  141   DGKYLHDIVREKLGETRLHQTLTNVVIPTFDIKQLQPKIFSSYEVKSNPSKDALLSDICI  200

Query  1034  GTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDN  855
             GTSAAPTYLPAH+F+ Q+   +       P E+N+IDGGVAANNP LVAI++V+K+I   
Sbjct  201   GTSAAPTYLPAHHFQSQDSTGK-------PIEFNLIDGGVAANNPALVAINEVSKEILRG  253

Query  854   NPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEA  675
             NP+ FPIKP D +RFLV+S+GTG+  +E KY++  AAKWGIL WL  + STPL+++FM+A
Sbjct  254   NPEFFPIKPTDYARFLVVSLGTGSPKSEEKYHANLAAKWGILGWLTSEHSTPLVDIFMQA  313

Query  674   SSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEK  495
             SSDMVD H + +FQAL   E+SYLRIQ              +L+   SS+DVAT+ENLE 
Sbjct  314   SSDMVDFHIATLFQAL-QSEDSYLRIQ------------DDTLSQQMSSVDVATKENLEN  360

Query  494   LVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDAL-KRLAK  372
             LV+ GE+LLKKPVSRVNLE G SEP   + TNE AL  RLA+
Sbjct  361   LVKAGEELLKKPVSRVNLEDGKSEPA-GTVTNEKALISRLAE  401



>ref|XP_004957049.1| PREDICTED: patatin-05-like [Setaria italica]
Length=384

 Score =   457 bits (1176),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 247/397 (62%), Positives = 303/397 (76%), Gaps = 24/397 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN+VT+LSIDGGGIRGIIPAV+L++LE++LQ+LDGE+ARLADYFDVI+GTSTGGL
Sbjct  8     QPPTYGNLVTILSIDGGGIRGIIPAVVLSFLESELQKLDGEEARLADYFDVIAGTSTGGL  67

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VT+ML AP++  RPL+AAKDI+ FY+N+ PKIFPQK G FG I    RS+ GP YDGKYL
Sbjct  68    VTSMLAAPNKKNRPLFAAKDIQEFYMNHAPKIFPQKRGPFGGIMRIFRSLSGPSYDGKYL  127

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAK--RCPKMNAYLSDVCIGTS  1026
               +++K+L   RL +TLT+VVIPTFDIK LQP IFS+Y+ K  +C  M+A LSD+CI TS
Sbjct  128   HEVVRKKLGITRLHETLTDVVIPTFDIKRLQPTIFSSYEVKNDKCNTMDALLSDICISTS  187

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTYLPAHYFK ++     G T    KE+++IDGGVAANNP LVAI +VTKQIF  NPD
Sbjct  188   AAPTYLPAHYFKTEDC---HGNT----KEFHLIDGGVAANNPALVAIGEVTKQIFKENPD  240

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
              FPIKPMD  RFLVIS+GTGTA  E  YN++ A  WG+L WLL   STPL+++F +AS+D
Sbjct  241   FFPIKPMDYGRFLVISLGTGTAKYEVNYNAQTAKSWGVLGWLLGSGSTPLVDIFTQASAD  300

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD+H SAVF+AL   E +YLRIQ              +L GT SS+D+AT++N+EKL  
Sbjct  301   MVDIHISAVFKAL-HSEQNYLRIQ------------DDTLQGTLSSVDIATKDNMEKLAS  347

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHS--GTNEDALKR  381
             IG+ LLKKPVSRVNLETG   P  HS   TN++ALKR
Sbjct  348   IGDALLKKPVSRVNLETGHMVPAYHSPEMTNKEALKR  384



>ref|XP_008801772.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=402

 Score =   457 bits (1177),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 229/396 (58%), Positives = 298/396 (75%), Gaps = 28/396 (7%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G++VTVLSIDGGG+RGIIP  ILA+LE++LQ+LDGEDAR+ADYFDV++GTSTGGLVTAML
Sbjct  16    GSLVTVLSIDGGGVRGIIPGTILAFLESKLQDLDGEDARIADYFDVVAGTSTGGLVTAML  75

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVF----GPKYDGKYLR  1197
             TAP++N RPL+AA+DI  FYL N PKIFPQK G    I  S R++F    GPKYDGKYLR
Sbjct  76    TAPNKNNRPLFAAEDIPKFYLENSPKIFPQKAG----ICSSTRNLFSVVTGPKYDGKYLR  131

Query  1196  SLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAP  1017
             S++++ L + RL   LT++VIPTFDIK L P IFST++A+  P  ++ LSD+CI TSAAP
Sbjct  132   SIIRELLGETRLHQALTDIVIPTFDIKLLHPTIFSTFEARHAPLKDSLLSDICISTSAAP  191

Query  1016  TYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFP  837
             TYLPAHYF+ ++    +G T    + +N++DGGVAANNPTLVAIS+V K+I   N D  P
Sbjct  192   TYLPAHYFETKDA---KGNT----RSFNLVDGGVAANNPTLVAISEVMKEILKKNEDFSP  244

Query  836   IKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVD  657
              KPMD  +FLVIS+GTG+A NE ++++++A+KWG+L WL +  +TPLI++F +AS+DMVD
Sbjct  245   FKPMDYGKFLVISLGTGSAKNEERFSAQKASKWGVLGWLYNNGATPLIDIFKQASADMVD  304

Query  656   LHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGE  477
             +H S VFQAL    N YLRIQ              +LTG  SS+D++T+ENL +L++IG+
Sbjct  305   IHASVVFQALHSTGN-YLRIQ------------DDNLTGKASSVDISTDENLLRLMQIGK  351

Query  476   KLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
              LLKK VSRVNLETG+SE +    TNE+ L   AK 
Sbjct  352   DLLKKRVSRVNLETGLSEEVSEDETNEEELMHFAKL  387



>emb|CDP04311.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   457 bits (1177),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 239/396 (60%), Positives = 305/396 (77%), Gaps = 21/396 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN VT+LSIDGGGIRGIIP+VIL +LE++LQ+LDG+DARLADYFDVI+GTSTGGL
Sbjct  10    QLPTYGNTVTILSIDGGGIRGIIPSVILGFLESELQKLDGKDARLADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAML AP+EN RPLYAAKDIK FYL N PKIFPQ+  + G+    +R + GPKYDGKYL
Sbjct  70    VTAMLAAPNENNRPLYAAKDIKDFYLENCPKIFPQESNFLGQAQQELRLLSGPKYDGKYL  129

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
              +LL++++   +L  TLTNVVIPTFDIK LQP IFS+Y  K  P ++  LSD+CIGTSAA
Sbjct  130   HNLLQQKVGKTKLHQTLTNVVIPTFDIKLLQPTIFSSYAIKNEPSLDGVLSDICIGTSAA  189

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PT+LPAH+F+ +        ++   +E+N++DGGVAANNPTLVA++QVT++I   N D  
Sbjct  190   PTFLPAHHFETKN-------SDGSKREFNLVDGGVAANNPTLVAMNQVTREISKGNSDFS  242

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             P+KP++  RFLV+S+GTGTA  E KY++  AAKWGIL+WL++  S+PL++VF EASSDMV
Sbjct  243   PMKPLEFDRFLVLSLGTGTAKIEQKYDADNAAKWGILAWLVNGGSSPLVDVFTEASSDMV  302

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D H + +FQ L  CE +YLRIQ              +LTG  SS+D+AT+ NLE LV++G
Sbjct  303   DFHLATIFQTL-QCEANYLRIQ------------DDTLTGDLSSVDIATKTNLENLVQVG  349

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             EKLLKKPVSRVNL++GV EP+ + GTNEDALK+ A+
Sbjct  350   EKLLKKPVSRVNLQSGVFEPL-NQGTNEDALKKFAE  384



>ref|XP_011030324.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=417

 Score =   457 bits (1176),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 263/416 (63%), Positives = 312/416 (75%), Gaps = 21/416 (5%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T GN +TVLSIDGGGIRGIIP  ILA+LE++LQ+LDG DARLADYFDVISGTST
Sbjct  18    SPIQPPTFGNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTST  77

Query  1388  GGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDG  1209
             GGLVTAML  P+E  RPL+AAKDI  FYL N PKIFPQ G         IRS+ GPKYDG
Sbjct  78    GGLVTAMLATPNEQNRPLFAAKDINDFYLENCPKIFPQDGSPLASAGKLIRSLRGPKYDG  137

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGT  1029
             K+L S++K++L D RL  T+TN+VIPTFDIK LQP IFS+YQ K  P  +A LSD+CIGT
Sbjct  138   KFLHSIVKEKLGDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNNPSTDALLSDICIGT  197

Query  1028  SAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNP  849
             SAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNPTLVA+S+V+K+I   NP
Sbjct  198   SAAPTYLPAHYFETKDPSGKV-------REFNLIDGGVAANNPTLVAMSEVSKEITRKNP  250

Query  848   DLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASS  669
             D FP  PMD  RFLV+S+GTGTA +E KY++ EAAKWGIL WL   +STPL++VF EAS 
Sbjct  251   DFFPTAPMDYGRFLVLSLGTGTAKSEEKYDADEAAKWGILGWLTSDNSTPLVDVFTEASG  310

Query  668   DMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLV  489
             DMVDLH S VFQAL   EN YLRIQ              +LTGT SS+DVAT+ENLE LV
Sbjct  311   DMVDLHISTVFQALHSEEN-YLRIQ------------DDTLTGTLSSVDVATKENLENLV  357

Query  488   EIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTK  321
             ++GEKLLKKPVSRV+L TGV  P+    TNE+AL ++AK LS E+ LR+SRSPV K
Sbjct  358   KVGEKLLKKPVSRVDLGTGVFTPV-DKMTNEEALIKMAKLLSREKHLRDSRSPVGK  412



>ref|XP_006374982.1| hypothetical protein POPTR_0014s03330g [Populus trichocarpa]
 gb|ERP52779.1| hypothetical protein POPTR_0014s03330g [Populus trichocarpa]
Length=417

 Score =   457 bits (1176),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 264/416 (63%), Positives = 312/416 (75%), Gaps = 21/416 (5%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T GN +TVLSIDGGGIRGIIP  ILA+LE++LQ+LDG DARLADYFDVISGTST
Sbjct  18    SPIQPPTFGNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTST  77

Query  1388  GGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDG  1209
             GGLVTAML AP+E  RPL++AKDI  FYL N PKIFPQ G  F      I S+ GPKYDG
Sbjct  78    GGLVTAMLAAPNEQNRPLFSAKDIIDFYLENCPKIFPQDGSPFASAGKLITSLRGPKYDG  137

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGT  1029
             K+L S+ K+++ D RL  T+TN+VIPTFDIK LQP IFS+YQ K  P M+A LSD+CIGT
Sbjct  138   KFLHSIAKEKMGDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSMDALLSDICIGT  197

Query  1028  SAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNP  849
             SAAPTY PAHYF+ + GP  +       +E+N+IDGGVAANNPTLVA+S+V+K+I   NP
Sbjct  198   SAAPTYFPAHYFETK-GPSGK------VREFNLIDGGVAANNPTLVAVSEVSKEITRKNP  250

Query  848   DLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASS  669
             D FP  PMD  RFLV+S+GTGTA +E KY++ EAAKWGIL WL   +STPL++VF EAS 
Sbjct  251   DFFPTAPMDYGRFLVLSLGTGTAKSEEKYDADEAAKWGILGWLTSDNSTPLVDVFTEASG  310

Query  668   DMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLV  489
             DMVDLH S VFQAL   EN YLRIQ              +LTGT SSMDVAT+ENLE LV
Sbjct  311   DMVDLHVSTVFQALHSEEN-YLRIQ------------DDTLTGTLSSMDVATKENLENLV  357

Query  488   EIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTK  321
             ++GEKLLKKPVSRV+L TG+  P     TNE+AL ++AK LS E+ LR+SRSPV K
Sbjct  358   KVGEKLLKKPVSRVDLGTGIFTPT-DKMTNEEALIKMAKLLSREKHLRDSRSPVGK  412



>ref|XP_008813724.1| PREDICTED: patatin-like protein 2 isoform X1 [Phoenix dactylifera]
Length=410

 Score =   456 bits (1174),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 237/398 (60%), Positives = 305/398 (77%), Gaps = 21/398 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             QA T GN++T+LSIDGGGIRGIIPAVIL++LE +LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  12    QAPTYGNLITILSIDGGGIRGIIPAVILSFLELELQKLDGEDARIADYFDVIAGTSTGGL  71

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLTAPDE+ RPL+AAKDI+ FYL   PKIFPQ GG    I   +R+++GP+Y+GKYL
Sbjct  72    VTAMLTAPDEDNRPLFAAKDIESFYLAESPKIFPQYGGILAPITRMVRALWGPRYNGKYL  131

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
               L+++ L  +RL  TLTNVVIPTFDIK L P IFS+Y+ KR   +NA LSD+CIGT+AA
Sbjct  132   HKLIRENLGSMRLHQTLTNVVIPTFDIKRLHPTIFSSYEVKRKSILNAQLSDICIGTTAA  191

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAHYF+ ++            +E+++IDGGVAANNP L+AI +VTK++   NPD F
Sbjct  192   PTYLPAHYFETKDAKGN-------VREFHLIDGGVAANNPALIAIREVTKEVHKGNPDYF  244

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             P +PMD  + L+IS+GTG+A  E +Y +K A+KWG+L WLL   STPL++VFM++S+DMV
Sbjct  245   PYRPMDYRKLLLISLGTGSAKVEERYTAKRASKWGVLGWLLSGGSTPLVDVFMQSSADMV  304

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D+H S VFQAL   E++YLRI+              +L GT SS+DV+T++NL+ LV+ G
Sbjct  305   DIHISVVFQAL-RSESNYLRIE------------DDTLNGTVSSVDVSTKDNLQDLVKRG  351

Query  479   EKLLKKPVSRVNLETGVSEPIPH-SGTNEDALKRLAKF  369
             E+LLKKPVSRVNLETGV E + +  GTN+DAL+R AK 
Sbjct  352   EQLLKKPVSRVNLETGVFETVGNGEGTNKDALRRFAKL  389



>ref|XP_008779158.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=404

 Score =   456 bits (1173),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 259/415 (62%), Positives = 308/415 (74%), Gaps = 21/415 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q QA T GN++TVLSIDGGGIRGIIPA ILA+LE+QLQE DG DARLADYFDVI+GTSTG
Sbjct  6     QIQAPTYGNLITVLSIDGGGIRGIIPATILAFLESQLQEHDGVDARLADYFDVIAGTSTG  65

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             GLVTAMLTAP+E  RP++ AKDIK FYL + PKIFPQ  G     + + R   GPKYDGK
Sbjct  66    GLVTAMLTAPNEKNRPIFEAKDIKAFYLEHSPKIFPQPRGPIDGAFNAFRLFSGPKYDGK  125

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL   +K+ L  +RL  TLTNVVIP FDIK LQP IFS+Y+ K    ++A LSD+ I TS
Sbjct  126   YLHQTIKERLGSLRLHQTLTNVVIPAFDIKKLQPTIFSSYEVKHNALLDAELSDISISTS  185

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTYLP HYFKI+        ++   +E+N+IDGGVAANNP LVA+S+VTK+IF  N D
Sbjct  186   AAPTYLPGHYFKIKN-------SDGKVREFNLIDGGVAANNPALVAMSEVTKEIFRGNTD  238

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
              FPIKP D  RFLVIS+GTGTA NE K+++KE++KWG+L WLL   S PL++ F +ASSD
Sbjct  239   FFPIKPTDYGRFLVISLGTGTAKNEEKFDAKESSKWGVLGWLLSGGSNPLVDAFTQASSD  298

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD+H S VFQAL   ++ YLRIQ              +L GT SS+DVAT+ENL+ LV+
Sbjct  299   MVDIHISVVFQAL-HSDSKYLRIQ------------DDTLKGTVSSVDVATKENLDSLVK  345

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTK  321
             IGE+LLKKP SR+NLETGV EP+    TNE ALKR AK LS ERRLRE RSP TK
Sbjct  346   IGEELLKKPTSRINLETGVYEPVDKE-TNEQALKRFAKILSEERRLREMRSPYTK  399



>ref|XP_009390266.1| PREDICTED: patatin-like protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   456 bits (1174),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 228/392 (58%), Positives = 292/392 (74%), Gaps = 21/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G  VTVL IDGGG+RG+IPA I+A+LE +LQ+LDG +AR+ADYFDVI+GTSTGGLVTAML
Sbjct  23    GKRVTVLCIDGGGVRGLIPATIIAFLEAELQKLDGPEARIADYFDVIAGTSTGGLVTAML  82

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQK-GGWFGEIWVSIRSVFGPKYDGKYLRSLL  1188
             TAP++  RPL+AAKDI  FYL+N PKIFPQK  G F      + +V GPKYDGKYL +++
Sbjct  83    TAPNKEKRPLFAAKDIVQFYLDNSPKIFPQKNAGLFNSALNLVGAVSGPKYDGKYLHAII  142

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             ++ L D RL+ TLTNVVIPTFDIK LQP IFSTYQ K  P  +A LSD+CIGTSAAPTYL
Sbjct  143   RQLLGDTRLSQTLTNVVIPTFDIKFLQPTIFSTYQTKSTPLKDALLSDICIGTSAAPTYL  202

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKP  828
             P HYF+ ++        N   + +N++DGGVAANNPTL A+++V+K+I  +NPD F  +P
Sbjct  203   PGHYFETKDD-------NGNKRSFNLVDGGVAANNPTLTAMTEVSKEILLSNPDFFSYQP  255

Query  827   MDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHN  648
             ++  RFLVIS+GTG    E K+ ++E+AKWG+L WLL+K +TPLI++F +AS+DMVD+H 
Sbjct  256   VEYDRFLVISLGTGAPKQEEKFTAQESAKWGVLGWLLNKGTTPLIDIFTQASADMVDIHA  315

Query  647   SAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLL  468
             S +FQAL   +N YLRI+              +LTG  SS+DV+T++NL+ LV+IG  LL
Sbjct  316   SVLFQALNKGKN-YLRIE------------DDTLTGQTSSVDVSTKKNLQDLVDIGNSLL  362

Query  467   KKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             KKPVSRVN+ETG SE +   GTNE AL   AK
Sbjct  363   KKPVSRVNIETGHSEAVDGEGTNEAALTGFAK  394



>ref|XP_009403085.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=413

 Score =   456 bits (1173),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 227/391 (58%), Positives = 290/391 (74%), Gaps = 20/391 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++TVLSIDGGG+RGIIP  I+ +LET+LQELDG DAR+ADYFDV++GTSTGGL+TAM+
Sbjct  27    GKLITVLSIDGGGVRGIIPGTIINFLETKLQELDGPDARVADYFDVVTGTSTGGLLTAMI  86

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             TAPDE  RPL++AKDI  FYL N PKIFPQ  G+   +     ++ GPKYDGKYL S +K
Sbjct  87    TAPDEKQRPLFSAKDIIDFYLQNCPKIFPQGSGFLSSVRKLAGAIMGPKYDGKYLHSKVK  146

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
               LKDI+L+ TLTNV+IP FDIK LQP+IFS+++A+  P  +A+++D+CI TSAAPT+LP
Sbjct  147   DLLKDIKLSQTLTNVIIPAFDIKLLQPIIFSSFEARLEPLKDAHVADICISTSAAPTFLP  206

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AHYF+ Q+       +N   + YN+IDGGVAANNPTLVA+SQ+ K++F  N D    KP+
Sbjct  207   AHYFETQD-------SNGNTRSYNLIDGGVAANNPTLVAMSQIKKEMFLMNQDFHSYKPI  259

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D   F++ISIGTG A  E K+++  A+KWGIL WL H  STPLI+ F  AS+D+VD+H S
Sbjct  260   DYHNFIIISIGTGAAKVEKKFSAHLASKWGILQWLYHGGSTPLIDSFSHASADIVDVHMS  319

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
             +VFQ+L  CE +YLRIQ              +L G  SS+DV+T+ENL +LV+IGE LLK
Sbjct  320   SVFQSL-HCEQNYLRIQ------------DETLMGQASSVDVSTKENLLELVKIGESLLK  366

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             KPVSRVNLETG  E +   GTN +AL RLAK
Sbjct  367   KPVSRVNLETGDFEEVKGEGTNAEALTRLAK  397



>ref|XP_007227189.1| hypothetical protein PRUPE_ppa019532mg [Prunus persica]
 gb|EMJ28388.1| hypothetical protein PRUPE_ppa019532mg [Prunus persica]
Length=410

 Score =   456 bits (1173),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 244/406 (60%), Positives = 307/406 (76%), Gaps = 23/406 (6%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ER  S  Q+ T GNIVTVLSIDGGGIRGIIP  IL +LE++LQ+LDGE+ARLADYFDVI
Sbjct  1     MERARSFLQSPTYGNIVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGW--FGEIWVSIRSV  1230
             +GTSTGGLVTAMLT PDEN RPL+AAKDI  FYL + PKIFPQ   +   GE    +++V
Sbjct  61    AGTSTGGLVTAMLTTPDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGEAMDMVKAV  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  ++K+ L DIRL+DTLTNV+IPTFDIK LQP++FS+Y+ K+   +NA L
Sbjct  121   SGPKYDGKYLHKIVKEILGDIRLSDTLTNVIIPTFDIKRLQPMVFSSYEEKKNTSINALL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+CIGTSAAPTYLPAH+F+ +    +        +++++IDGGVAANNP LVAIS+VTK
Sbjct  181   SDICIGTSAAPTYLPAHHFETKTSTGE-------SRDFDLIDGGVAANNPALVAISEVTK  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   N D F I+  +  RFLVIS+GTG+A +E KYN+ +AAKWG+L WL    STPL++
Sbjct  234   EIHQGNSDFFAIRSTEYGRFLVISLGTGSAKSEEKYNADDAAKWGLLGWLTKGGSTPLVD  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
             VF +ASSDMVD H + VF+AL DCE +YLRIQ              +L  T SS+D+AT+
Sbjct  294   VFTQASSDMVDFHLATVFRAL-DCEKNYLRIQ------------DDTLEKTVSSVDIATQ  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             ENL  LV++GE+LLKKPVSRVNL+TG+ EP  H  TNE+AL R+A+
Sbjct  341   ENLNNLVKVGEELLKKPVSRVNLQTGIYEP-AHQDTNEEALVRVAQ  385



>ref|XP_006829694.1| hypothetical protein AMTR_s00126p00050070 [Amborella trichopoda]
 gb|ERM97110.1| hypothetical protein AMTR_s00126p00050070 [Amborella trichopoda]
Length=405

 Score =   456 bits (1172),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 233/401 (58%), Positives = 293/401 (73%), Gaps = 21/401 (5%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             SQ  +   G+ +T+LSIDGGG+RGIIP +IL++LE+QLQ LDGE+ RL DYFDVI+GTST
Sbjct  7     SQNVSPLYGDFITILSIDGGGVRGIIPGIILSFLESQLQALDGEEVRLVDYFDVIAGTST  66

Query  1388  GGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDG  1209
             GGLVT MLTAPDEN RPLYAAKDI PFYL + PKIFP   G F      I +V GPKYDG
Sbjct  67    GGLVTTMLTAPDENKRPLYAAKDIVPFYLEHCPKIFPHPRGPFSSALKVISAVIGPKYDG  126

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRC-PKMNAYLSDVCIG  1032
             KYLR L ++ LKD RL DTLTNVVIPTFDI  LQP IFS+YQ K      +A LSD+CIG
Sbjct  127   KYLRRLARETLKDKRLHDTLTNVVIPTFDINILQPTIFSSYQLKDGNTSQDALLSDICIG  186

Query  1031  TSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNN  852
             TSAAPT+LPAHYF+  +G   E       + +++IDGGV ANNPTLVAIS+VTK+I   N
Sbjct  187   TSAAPTFLPAHYFE-NKGSGGE------VRFFDLIDGGVVANNPTLVAISEVTKEISRRN  239

Query  851   PDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEAS  672
             P+ F  KP+D +RFLVIS+GTG+A  +  Y++K AA WGI+ WL +K ++PL+E F + S
Sbjct  240   PEFFKTKPLDYARFLVISLGTGSAKTQNTYSAKAAAGWGIIGWLYNKGNSPLVESFTQGS  299

Query  671   SDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKL  492
             +DMVD HNS VFQAL + E++YLRIQ            +  L+   +S+D++T+ENL+ L
Sbjct  300   ADMVDFHNSVVFQAL-NSEDNYLRIQ------------EDDLSNEAASVDISTKENLQNL  346

Query  491   VEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             V IG++LLK PVSRVN+ETG+ EP+ +  TNE+AL   AK 
Sbjct  347   VNIGQQLLKNPVSRVNVETGLFEPLKNQSTNEEALVIFAKL  387



>ref|XP_007047215.1| Uncharacterized protein TCM_000589 [Theobroma cacao]
 gb|EOX91372.1| Uncharacterized protein TCM_000589 [Theobroma cacao]
Length=401

 Score =   456 bits (1172),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 230/407 (57%), Positives = 293/407 (72%), Gaps = 27/407 (7%)
 Frame = -3

Query  1583  IERKPS--QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             +ER+ S  + Q  T GN++T+LSIDGGG+RGIIP VILA LE++LQ +DGEDARLADYFD
Sbjct  1     MERRLSSLKIQPPTYGNLITILSIDGGGVRGIIPGVILAKLESELQNIDGEDARLADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             VI+GTSTGGL+T M+ AP+EN RPLYAAKDI PFYL N PKIFPQ  G  G     ++++
Sbjct  61    VIAGTSTGGLITTMVAAPNENDRPLYAAKDIVPFYLENSPKIFPQMSGVLGWAAKLLKAL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GP+YDGKYLR L++  L   +L  TLT+V IPTFDI  LQP IFSTYQ    P M+A L
Sbjct  121   TGPRYDGKYLRKLIRGILGTTKLHQTLTSVAIPTFDITKLQPTIFSTYQIPINPDMDAPL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             +D+CIGTSAAPTY P +YFK  E            +E+N+IDGG+AANNPTLVAI +VTK
Sbjct  181   ADICIGTSAAPTYFPPYYFKNNE------------EEFNLIDGGIAANNPTLVAIREVTK  228

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             QI   NP+   + P+D +RFLVIS+G G+   E KYN+KEA+KWG++ WL   + TP+I+
Sbjct  229   QIMKENPNFSDMDPLDYTRFLVISLGGGSNRLEKKYNAKEASKWGVICWLFENNHTPIID  288

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
              + EAS DMVD HNS VF+AL   E+ YLRI               +L G  +S+DVAT+
Sbjct  289   CYSEASKDMVDYHNSVVFEAL-HSEDKYLRID------------DDTLRGELASVDVATK  335

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             EN++ LV++GE LLKK V+R+NL+TG+ EPI + GTNE+AL+R AK 
Sbjct  336   ENMDNLVKVGEDLLKKTVTRINLDTGLYEPIENGGTNEEALRRFAKL  382



>ref|XP_008220192.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=417

 Score =   455 bits (1171),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 243/407 (60%), Positives = 308/407 (76%), Gaps = 23/407 (6%)
 Frame = -3

Query  1586  KIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             ++ER  S  Q+ T GNIVTVLSIDGGGIRGIIP  IL +LE++LQ+LDGE+ARLADYFDV
Sbjct  7     QMERARSFLQSPTYGNIVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLADYFDV  66

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGW--FGEIWVSIRS  1233
             I+GTSTGGLVTAMLT PDEN RPL+AAKDI  FYL + PKIFPQ   +   G+    +++
Sbjct  67    IAGTSTGGLVTAMLTTPDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGDAMDMVKA  126

Query  1232  VFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAY  1053
             V GPKYDGKYL  ++K+ L DIRL+DTLTNV+IPTFDIK LQP++FS+Y+ K+   +NA 
Sbjct  127   VSGPKYDGKYLHKIVKEILGDIRLSDTLTNVIIPTFDIKRLQPMVFSSYEEKKNTSINAL  186

Query  1052  LSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVT  873
             LSD+CIGTSAAPTYLPAH+F+ +    +        +++++IDGGVAANNP LVAIS++T
Sbjct  187   LSDICIGTSAAPTYLPAHHFETKTSTGE-------SRDFDLIDGGVAANNPALVAISEMT  239

Query  872   KQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             K+I   N D F I+  +  RFLVIS+GTG+A +E KYN+ +AAKWG+L WL    STPL+
Sbjct  240   KEIHQGNSDFFAIRSTEYGRFLVISLGTGSAKSEEKYNADDAAKWGLLGWLTKGGSTPLV  299

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             +VF +ASSDMVD H + VFQAL DCE +YLRIQ              +L  T SS+D+AT
Sbjct  300   DVFTQASSDMVDFHLATVFQAL-DCEKNYLRIQ------------DDTLEKTVSSVDIAT  346

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             +ENL  LV++GE+LLKKPVSRVNL+TG+ EP  H  TNE+AL R+A+
Sbjct  347   QENLNNLVKVGEELLKKPVSRVNLQTGIYEP-AHQETNEEALVRVAQ  392



>ref|XP_006829702.1| hypothetical protein AMTR_s00126p00063230 [Amborella trichopoda]
 gb|ERM97118.1| hypothetical protein AMTR_s00126p00063230 [Amborella trichopoda]
Length=407

 Score =   455 bits (1170),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 233/400 (58%), Positives = 283/400 (71%), Gaps = 20/400 (5%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T G ++T+LSIDGGGIRG IPA IL++LE QLQ LDGED R+ADYFDVI+GTST
Sbjct  9     SMNQPPTYGEMITILSIDGGGIRGTIPATILSFLEHQLQILDGEDVRIADYFDVIAGTST  68

Query  1388  GGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDG  1209
             GGLVTAML  P ++ RPLYAAKDI  FYL + PKIFPQ  G           V  PKYDG
Sbjct  69    GGLVTAMLATPGKDNRPLYAAKDIPTFYLEHCPKIFPQSSGVLASTTKLWGVVSRPKYDG  128

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGT  1029
             KYL  L+++EL D +L  TLTN+V+PTFDI+ +QP +FSTYQ +     +A LSD+CI T
Sbjct  129   KYLHDLIRRELGDKKLHQTLTNIVVPTFDIRIMQPAVFSTYQLRDYSIKDALLSDICIST  188

Query  1028  SAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNP  849
             SAAPTYLPAHYF   E    +G+     K ++++DGGVAANNPTLVA+ +VT++IF  NP
Sbjct  189   SAAPTYLPAHYF---ETMGSDGMV----KNFHLVDGGVAANNPTLVAVGEVTREIFRKNP  241

Query  848   DLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASS  669
             D FPIKPMD  RFLVIS+GTG+  +   Y++K+AAKWG+L WL H   TPLI+ F  ASS
Sbjct  242   DFFPIKPMDYGRFLVISLGTGSPKSTDNYSAKDAAKWGVLGWLYHNGGTPLIDTFTHASS  301

Query  668   DMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLV  489
             DMVD H S VF+AL   E +YLRIQ              +LTG  SS+D+AT+ENLE LV
Sbjct  302   DMVDFHLSVVFRAL-HSERNYLRIQ------------GDTLTGHASSVDIATKENLENLV  348

Query  488   EIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
              IG  LLKKPVSR+N+ETG+ EP+   GTNE AL R AK 
Sbjct  349   MIGSDLLKKPVSRLNMETGLFEPVEGEGTNEQALTRFAKL  388



>ref|XP_009390265.1| PREDICTED: patatin-like protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   455 bits (1170),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 228/396 (58%), Positives = 292/396 (74%), Gaps = 25/396 (6%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G  VTVL IDGGG+RG+IPA I+A+LE +LQ+LDG +AR+ADYFDVI+GTSTGGLVTAML
Sbjct  23    GKRVTVLCIDGGGVRGLIPATIIAFLEAELQKLDGPEARIADYFDVIAGTSTGGLVTAML  82

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQK-----GGWFGEIWVSIRSVFGPKYDGKYL  1200
             TAP++  RPL+AAKDI  FYL+N PKIFPQK      G F      + +V GPKYDGKYL
Sbjct  83    TAPNKEKRPLFAAKDIVQFYLDNSPKIFPQKKFGCSAGLFNSALNLVGAVSGPKYDGKYL  142

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
              +++++ L D RL+ TLTNVVIPTFDIK LQP IFSTYQ K  P  +A LSD+CIGTSAA
Sbjct  143   HAIIRQLLGDTRLSQTLTNVVIPTFDIKFLQPTIFSTYQTKSTPLKDALLSDICIGTSAA  202

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLP HYF+ ++        N   + +N++DGGVAANNPTL A+++V+K+I  +NPD F
Sbjct  203   PTYLPGHYFETKDD-------NGNKRSFNLVDGGVAANNPTLTAMTEVSKEILLSNPDFF  255

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
               +P++  RFLVIS+GTG    E K+ ++E+AKWG+L WLL+K +TPLI++F +AS+DMV
Sbjct  256   SYQPVEYDRFLVISLGTGAPKQEEKFTAQESAKWGVLGWLLNKGTTPLIDIFTQASADMV  315

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             D+H S +FQAL   +N YLRI+              +LTG  SS+DV+T++NL+ LV+IG
Sbjct  316   DIHASVLFQALNKGKN-YLRIE------------DDTLTGQTSSVDVSTKKNLQDLVDIG  362

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
               LLKKPVSRVN+ETG SE +   GTNE AL   AK
Sbjct  363   NSLLKKPVSRVNIETGHSEAVDGEGTNEAALTGFAK  398



>ref|XP_006374976.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
 gb|ERP52773.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
Length=415

 Score =   454 bits (1169),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 262/421 (62%), Positives = 313/421 (74%), Gaps = 21/421 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             IE   S  Q  T GN +TVLSIDGGGIRGIIP  ILA+LE++LQ+LDG DARLADYFDVI
Sbjct  11    IETLRSPIQPPTFGNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVI  70

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             SGTSTGGLVTAML AP+E  RPL+AAKDI  FYL N PKIF Q G         I+S+ G
Sbjct  71    SGTSTGGLVTAMLAAPNEQNRPLFAAKDINDFYLENCPKIFHQDGSPLASAGKLIKSLKG  130

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             PKYDGK L S++K++L D RL  T+TN+VIPTFDIK LQP IFS+YQ K  P  +A LSD
Sbjct  131   PKYDGKILHSIVKEKLGDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSTDALLSD  190

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CIGTSAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNPTLVA+S+V+K+I
Sbjct  191   ICIGTSAAPTYLPAHYFETKDPSGKV-------REFNLIDGGVAANNPTLVAMSEVSKEI  243

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                NPD FP  PMD  RFLV+S+GTGTA +E KY++ EAAKWG+L WL   +STPL++VF
Sbjct  244   TRKNPDFFPAAPMDYGRFLVLSLGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVF  303

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              EAS DMVDLH S VFQAL  CE +Y+RIQ              +LTGT SS+DVAT+EN
Sbjct  304   TEASGDMVDLHISTVFQAL-HCEENYIRIQ------------DDTLTGTLSSVDVATKEN  350

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVT  324
             LE LV++GEKLLKKPVSRV+L TGV  P+    TNE+AL ++AK LS E+ LR SRSPV 
Sbjct  351   LENLVKVGEKLLKKPVSRVDLGTGVFTPV-DKMTNEEALIKMAKLLSREKHLRYSRSPVG  409

Query  323   K  321
             K
Sbjct  410   K  410



>ref|XP_008220177.1| PREDICTED: patatin-like protein 2 [Prunus mume]
Length=406

 Score =   453 bits (1166),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 228/393 (58%), Positives = 295/393 (75%), Gaps = 22/393 (6%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++T+LSIDGGGIRG+IPA IL++LE++LQ+LDGEDAR+ADYFDV++GTSTGGLVTAML
Sbjct  14    GKMITILSIDGGGIRGLIPATILSFLESELQKLDGEDARIADYFDVVAGTSTGGLVTAML  73

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVFGPKYDGKYLRSLL  1188
             T P+E  RPL++AKDI  FY+N+ PKIFPQK    F      I+++ GPKYDGKYL  L+
Sbjct  74    TTPNEKDRPLFSAKDISDFYMNHCPKIFPQKKFPLFRYTRKIIKALTGPKYDGKYLHGLI  133

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             +++L D ++  TLTNVVIPTFDIKNLQP +FS+++ +  P  +A LSDVCIGTSAAPT+L
Sbjct  134   RQKLGDKKMHQTLTNVVIPTFDIKNLQPTVFSSFRVRHKPSYDALLSDVCIGTSAAPTFL  193

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKP  828
             PAHYF+ ++   Q        +E+N+IDGG+AANNPTL+AI +V+ +I   NPD FP+KP
Sbjct  194   PAHYFETKDEFGQT-------REFNLIDGGIAANNPTLLAICEVSNEIKKANPDFFPVKP  246

Query  827   MDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHN  648
             +D  RFLVIS+GTGT+  E KYN+  AAKWG+L+WL    STP+I VF +AS+DMVDLH 
Sbjct  247   VDYGRFLVISLGTGTSKAEVKYNAHTAAKWGLLNWLTSGGSTPIINVFSQASADMVDLHL  306

Query  647   SAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLL  468
             S VFQAL   E+ YLRIQ              +L GT SS+DVAT++NL +LV +GE LL
Sbjct  307   SGVFQAL-HSEDYYLRIQ------------DDTLRGTVSSVDVATKKNLSRLVTVGEGLL  353

Query  467   KKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             K+ VSRVNL++G  E      TNE+AL+R+AK 
Sbjct  354   KERVSRVNLDSGRFEASDRE-TNEEALRRVAKL  385



>ref|XP_010926367.1| PREDICTED: patatin-like protein 2 [Elaeis guineensis]
Length=402

 Score =   453 bits (1165),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 227/392 (58%), Positives = 287/392 (73%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G +VT+LSIDGGG+RGIIP  IL +LE +LQELDG DAR+ADYFD+I+GTSTGGLVT ML
Sbjct  16    GKVVTILSIDGGGVRGIIPGTILEFLEAKLQELDGPDARIADYFDIIAGTSTGGLVTTML  75

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             TAP+++ RPL++AKDI  FYL N PKIFPQ+ G          +V GPKYDGK+L S +K
Sbjct  76    TAPNKDNRPLFSAKDIIQFYLENCPKIFPQRTGLLAGALNLFGAVSGPKYDGKFLHSKVK  135

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             + L D +L  TLTN+VIP FDIK LQPVIFST++ K  P  +A LSD+CI TSAAPTYLP
Sbjct  136   ELLGDTKLHQTLTNIVIPAFDIKLLQPVIFSTFETKTDPSKDALLSDICISTSAAPTYLP  195

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AHYF+ ++    +G T    + +N++DGGVAANNP L+A SQ+TKQIF NN D    KP 
Sbjct  196   AHYFETKD---SQGKT----RSFNLVDGGVAANNPMLIATSQITKQIFWNNEDFSKFKPT  248

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D ++FLV+S+GTG+   E K+ + E+AKWG+L WL +K STP+I++F ++S+DMVD+H S
Sbjct  249   DFAKFLVVSLGTGSPKQEQKFTAPESAKWGLLGWLQNKGSTPIIDIFSQSSADMVDIHAS  308

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              +FQAL   E +YLRIQ              +L G  +S+DV+T ENL KLV++G+ LLK
Sbjct  309   ILFQAL-RSEKNYLRIQ------------DDTLEGDTASVDVSTSENLRKLVQVGQDLLK  355

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             KPVSRVNLETGVSE     GTNEDAL R AK 
Sbjct  356   KPVSRVNLETGVSEACDVEGTNEDALIRFAKM  387



>ref|XP_009383171.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
 ref|XP_009383172.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=409

 Score =   453 bits (1166),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 252/418 (60%), Positives = 316/418 (76%), Gaps = 22/418 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q QA T GN++T+LSIDGGGI+GIIPA ILA+LE++LQ+LDGEDARLADYFD ++GTSTG
Sbjct  9     QIQAPTYGNLITILSIDGGGIKGIIPATILAFLESELQKLDGEDARLADYFDAMAGTSTG  68

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             GLVTAMLTAP+   RPLYAAKDIK FYLN+ PKIFPQ    F      IR++ GP+YDGK
Sbjct  69    GLVTAMLTAPNMQNRPLYAAKDIKEFYLNHSPKIFPQSSWPFNTAAKVIRAIIGPRYDGK  128

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL  L+++ L + RL  TLTNVVIPTFDIK LQP IFS+Y+ K  P ++A LSD+CIGTS
Sbjct  129   YLHELIRRNLGETRLHQTLTNVVIPTFDIKRLQPTIFSSYKVKNNPLLDARLSDICIGTS  188

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTYLPA+ F+ ++   Q  I     +E+N+IDGG+AANNP LVA+ ++TK+ F+ NPD
Sbjct  189   AAPTYLPAYDFQTEDS--QGNI-----REFNLIDGGLAANNPALVAMGEITKETFEENPD  241

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
              FPIKPMD  RFLVIS+GTG++  E +Y++  A +WG+L WLL   STPL++ FM+AS+D
Sbjct  242   FFPIKPMDYHRFLVISLGTGSSKEE-RYSANHAKRWGVLGWLLSNGSTPLVDAFMQASAD  300

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD+H S  FQAL   +N YLRI+  A            L+G  +S+D +T+ENLE LV+
Sbjct  301   MVDIHISEAFQALHSGKN-YLRIEDDA------------LSGILASVDTSTKENLENLVK  347

Query  485   IGEKLLKKPVSRVNLETGVSEPIPH-SGTNEDALKRLAKFlsnerrlresrSPVTKRT  315
             +GE LLKKPVSRVNLETG  EP+    GTNE+AL RLAK LS+ERRLRE RSP +K +
Sbjct  348   VGEMLLKKPVSRVNLETGHVEPVSEGEGTNEEALIRLAKLLSDERRLREMRSPHSKSS  405



>ref|XP_003576611.1| PREDICTED: patatin-like protein 2 isoform X1 [Brachypodium distachyon]
Length=404

 Score =   453 bits (1165),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 244/394 (62%), Positives = 299/394 (76%), Gaps = 27/394 (7%)
 Frame = -3

Query  1541  NIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAMLT  1362
             N++TVLSIDGGGIRGII AV LA+LET+LQ+LDGE+ARLADYFDVI+GTSTGGLVTAMLT
Sbjct  17    NLITVLSIDGGGIRGIIAAVALAFLETELQKLDGEEARLADYFDVIAGTSTGGLVTAMLT  76

Query  1361  APDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLKK  1182
             AP+++ RPL+AAKDI+ FY+++ PKIFPQ  G FG I   +RS+ GP YDGKYL  +++K
Sbjct  77    APNKDRRPLFAAKDIQAFYMDHAPKIFPQLRGAFGRIMKVLRSLSGPSYDGKYLHEVVRK  136

Query  1181  ELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPK-MNAYLSDVCIGTSAAPTYLP  1005
             +L  IRL  TLTNVVIPTFDIK LQP IFS+Y+ K+    M+A LSD+CI TSAAPTYLP
Sbjct  137   KLGSIRLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKKRNTMDALLSDICISTSAAPTYLP  196

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AHYFK ++        +   KE+N+IDGGVAANNP LVAI +VTKQIF  NPD FPIKPM
Sbjct  197   AHYFKTED-------LHGNIKEFNLIDGGVAANNPALVAIGEVTKQIFKENPDFFPIKPM  249

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  RFLVIS+GTG++  E KYN+++A  WG+L WLL   STPL+++F  AS+DMVD+H +
Sbjct  250   DYGRFLVISLGTGSSKFEEKYNAQKAKSWGVLDWLLSSGSTPLVDIFTRASADMVDIHIA  309

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
             AVF+AL   E +YLRIQ              +L GT SS+DVAT++NLEKLV +GE LLK
Sbjct  310   AVFKAL-HSEQNYLRIQ------------DDTLQGTLSSVDVATKDNLEKLVNVGEMLLK  356

Query  464   KPVSRVNLETGVSEPIPHSG----TNEDALKRLA  375
             K VSR NLETG  + +P  G    TNE AL+R A
Sbjct  357   KSVSRANLETG--QMVPTCGDSEMTNEKALERFA  388



>ref|XP_004501587.1| PREDICTED: patatin-3-Kuras 1-like isoform X2 [Cicer arietinum]
Length=402

 Score =   452 bits (1163),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 247/407 (61%), Positives = 305/407 (75%), Gaps = 27/407 (7%)
 Frame = -3

Query  1592  MVKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYF  1413
             M + +    Q Q  T G +VT+LSIDGGGIRGIIPA IL YLETQLQELDGE ARLADYF
Sbjct  3     MKRTQSSLLQIQPPTYGKLVTILSIDGGGIRGIIPATILEYLETQLQELDGESARLADYF  62

Query  1412  DVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRS  1233
             DVI+GTSTGGLVTAMLTAP+ N RPL+AAKDIKPFYL + PKIFPQ    F       RS
Sbjct  63    DVITGTSTGGLVTAMLTAPNHNQRPLFAAKDIKPFYLEHCPKIFPQHKYLF-------RS  115

Query  1232  VFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAY  1053
             + GPKYDGKYL  +++++L +IR+ +TLTN+VIPTFDIK +QP+IFS+Y+ K  P  +A 
Sbjct  116   LAGPKYDGKYLHDMVREKLGEIRVHETLTNIVIPTFDIKTMQPIIFSSYKVKTTPCFDAR  175

Query  1052  LSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVT  873
             LSD+CIGTSAAPTYLP + FK Q+   ++G T+    E+N+IDGGV ANNPTLVA+++VT
Sbjct  176   LSDICIGTSAAPTYLPGYNFKNQD---EDGNTH----EFNLIDGGVCANNPTLVAVNEVT  228

Query  872   KQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             KQI + N D   IKPM+ SRFL+IS+GTGT  NE K++SK AAKWG+L WL H  STPLI
Sbjct  229   KQIINQNNDFDSIKPMEYSRFLIISLGTGTPKNEQKFDSKLAAKWGLLDWLTHGGSTPLI  288

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             ++F ++S DMVD + + V QAL   +N YLRIQ              +LTG  SS+D+AT
Sbjct  289   DMFSQSSGDMVDYNLATVTQALNSQDN-YLRIQ------------DDTLTGIDSSVDIAT  335

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             +ENL+KL +IGE+LLKKP+S VNLETGV EP  +  TN+DALKR AK
Sbjct  336   KENLDKLCQIGERLLKKPLSNVNLETGVFEPTQNRETNQDALKRFAK  382



>ref|XP_006374981.1| hypothetical protein POPTR_0014s03320g [Populus trichocarpa]
 gb|ERP52778.1| hypothetical protein POPTR_0014s03320g [Populus trichocarpa]
Length=417

 Score =   453 bits (1165),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 259/416 (62%), Positives = 312/416 (75%), Gaps = 21/416 (5%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T GN +TVLSIDGGGIRGIIP  ILA+LE++LQ+LDG DARLADYFDVISGTST
Sbjct  18    SPIQPPTFGNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVISGTST  77

Query  1388  GGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDG  1209
             GGLVTAML  P+E  RPL+AAKDI  FYL N PKIFPQ G         I+S+ GPKYDG
Sbjct  78    GGLVTAMLATPNEQNRPLFAAKDINEFYLENCPKIFPQDGSPLASAGKLIKSLRGPKYDG  137

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGT  1029
             K+L S++K++L D RL  T+TN+VIPTFDIK LQP IFS+YQ K  P  +A LSD+CIGT
Sbjct  138   KFLHSIVKEKLGDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSTDALLSDICIGT  197

Query  1028  SAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNP  849
             SAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNPTLVA+S+V+K+I   NP
Sbjct  198   SAAPTYLPAHYFETKDPSGKV-------REFNLIDGGVAANNPTLVAVSEVSKEITRKNP  250

Query  848   DLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASS  669
             D FP  PMD  RFLV+S+GTGTA +E KY++ EAAKWG+L WL   +STPL++VF EAS 
Sbjct  251   DFFPTAPMDYGRFLVLSLGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVFTEASG  310

Query  668   DMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLV  489
             DMVDLH S VFQAL   EN YLRIQ              +LTGT SS+DVAT+ENLE LV
Sbjct  311   DMVDLHVSTVFQALHSEEN-YLRIQ------------DDTLTGTLSSVDVATKENLENLV  357

Query  488   EIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTK  321
             ++GEKLLKKPV+RV+L TG+  P+    TNE+AL ++AK LS E+ LR+SRSPV K
Sbjct  358   KVGEKLLKKPVARVDLGTGIFTPV-DKMTNEEALIKMAKSLSREKHLRDSRSPVGK  412



>ref|XP_002301195.2| hypothetical protein POPTR_0002s12980g [Populus trichocarpa]
 gb|EEE80468.2| hypothetical protein POPTR_0002s12980g [Populus trichocarpa]
Length=411

 Score =   452 bits (1163),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 234/400 (59%), Positives = 294/400 (74%), Gaps = 24/400 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++TVLSIDGGGIRG+IP  I+ +LE++LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  10    QPPTFGNLITVLSIDGGGIRGLIPGTIINFLESELQKLDGEDARIADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVFGPKYDGKY  1203
             VTAMLT PDEN R ++AAKDIK FYLN  PKIFPQ +   F ++   I+++ GPKYDGKY
Sbjct  70    VTAMLTCPDENSRAMFAAKDIKDFYLNQCPKIFPQPRCSLFTQVKKVIKALTGPKYDGKY  129

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCP---KMNAYLSDVCIG  1032
             L  L+K+ L + RL  TLT VVIPTFDIK  QP IFS+++ +      K+   LSD+CI 
Sbjct  130   LHGLVKELLGNRRLHHTLTKVVIPTFDIKTFQPTIFSSFEVRFASLLLKLEKPLSDICIA  189

Query  1031  TSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNN  852
             TSAAPTYLPAHYF+ ++  +Q G      +E+N+IDGGVAANNP L+AIS+VTK+I   +
Sbjct  190   TSAAPTYLPAHYFETKD--EQTGEV----REFNLIDGGVAANNPALIAISEVTKEIVKGS  243

Query  851   PDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEAS  672
             PD FPIKPMD  RFL+IS+GTG+   + KY + EAAKWG+L WL    STP+I+ F  AS
Sbjct  244   PDFFPIKPMDYGRFLLISLGTGSPKAQEKYKATEAAKWGLLGWLTSGGSTPVIDAFSHAS  303

Query  671   SDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKL  492
             +DMVDLH S V QAL   EN+YLRIQ              +L+  + S+D+AT+ NLE L
Sbjct  304   ADMVDLHISVVLQAL-HSENNYLRIQ------------DDTLSREECSVDIATKTNLEDL  350

Query  491   VEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             V++GE+LLKKPVSRVNLE+G+SEP     TNE+AL R AK
Sbjct  351   VKVGERLLKKPVSRVNLESGLSEPSVKE-TNEEALARFAK  389



>ref|XP_006374977.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
 gb|ERP52774.1| hypothetical protein POPTR_0014s03280g [Populus trichocarpa]
Length=415

 Score =   452 bits (1163),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 259/421 (62%), Positives = 314/421 (75%), Gaps = 21/421 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             I+   S  Q  T GN +T+LSIDGGGIRGIIP  ILA+LE++LQ+LDG DARLADYFDVI
Sbjct  11    IDTLRSPLQPPTFGNQITILSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVI  70

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             SGTSTGGLVTAML AP+E  RPL+AAKDI  FYL N PKIF Q G         I+S+ G
Sbjct  71    SGTSTGGLVTAMLAAPNEQNRPLFAAKDINDFYLENCPKIFHQDGSPLASAGKLIKSLKG  130

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             P+YDGK+L S++K++L D RL  T+TN+VIPTFDIK LQP IFS+YQ K  P  +A LSD
Sbjct  131   PQYDGKFLHSIVKEKLGDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSTDALLSD  190

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CIGTSAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNPTLVA+S+V+K+I
Sbjct  191   ICIGTSAAPTYLPAHYFETKDPSGKV-------REFNLIDGGVAANNPTLVAMSEVSKEI  243

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                NPD FP  PMD  RFLV+S+GTGTA +E KY++ EAAKWG+L WL   +STPL++VF
Sbjct  244   TRKNPDFFPAAPMDYGRFLVLSLGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVF  303

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              EAS DMVDLH S VFQAL  CE +Y+RIQ              +LTGT SS+DVAT+EN
Sbjct  304   TEASGDMVDLHISTVFQAL-HCEENYIRIQ------------DDTLTGTLSSVDVATKEN  350

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVT  324
             LE LV++GEKLLKKPVSRV+L TGV  P+    TNE+AL ++AK LS E+ LR SRSPV 
Sbjct  351   LENLVKVGEKLLKKPVSRVDLGTGVFTPV-DKMTNEEALIKMAKLLSREKHLRYSRSPVG  409

Query  323   K  321
             K
Sbjct  410   K  410



>ref|XP_002449853.1| hypothetical protein SORBIDRAFT_05g024430 [Sorghum bicolor]
 gb|EES08841.1| hypothetical protein SORBIDRAFT_05g024430 [Sorghum bicolor]
Length=413

 Score =   452 bits (1162),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 221/394 (56%), Positives = 286/394 (73%), Gaps = 19/394 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++TVLSIDGGGIRG+IPA I+  LET+LQELDG DAR+ADYFDVI+GTSTG L+T+ML
Sbjct  22    GRLITVLSIDGGGIRGLIPATIITCLETKLQELDGPDARIADYFDVIAGTSTGALLTSML  81

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVFGPKYDGKYLRSLL  1188
              APDEN RPL+AAKD+  FYL NGP IFPQ K GW   +   I ++ GPKYDG +L   +
Sbjct  82    AAPDENRRPLFAAKDLTTFYLENGPNIFPQRKVGWLTPVANLIGTMRGPKYDGVFLHDKI  141

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             K    D+R+ DT+TN+V+P FD+K LQP+IFSTY+AK     NA+LSD+CI TSAAPTY 
Sbjct  142   KSLTHDVRIADTVTNIVVPAFDVKYLQPIIFSTYEAKTDALKNAHLSDICISTSAAPTYF  201

Query  1007  PAHYFKIQ-EGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIK  831
             PAHYF  +  GP        PP+EY+++DGGVAANNPT++A+S +TK++   NPD  P K
Sbjct  202   PAHYFTTEPAGPGDA----RPPREYHLVDGGVAANNPTMIAMSMLTKEVLRRNPDFNPGK  257

Query  830   PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLH  651
             P +   +LVIS+GTG+A    KY + + AKWG++ WL     TP+I++F  AS+DMVD+H
Sbjct  258   PTEYRNYLVISVGTGSAKLAEKYTAPQCAKWGLIQWLYEGGFTPIIDIFSHASADMVDIH  317

Query  650   NSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKL  471
              + +F+AL  CE +YLRIQ              SLTG  SS+D+AT+EN+E L+ IG+KL
Sbjct  318   AAVLFEAL-HCEKNYLRIQ------------DDSLTGHASSVDIATKENMEALIGIGKKL  364

Query  470   LKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LKKPV+RVN++TG+ EP+   GTNEDAL R AK 
Sbjct  365   LKKPVARVNIDTGMYEPVAGEGTNEDALARFAKM  398



>ref|XP_006374978.1| hypothetical protein POPTR_0014s03290g [Populus trichocarpa]
 gb|ERP52775.1| hypothetical protein POPTR_0014s03290g [Populus trichocarpa]
Length=417

 Score =   452 bits (1162),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 260/421 (62%), Positives = 315/421 (75%), Gaps = 21/421 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             IE   S  Q  T GN +TVLSIDGGGIRGIIP  ILA+LE++LQ+LDG +ARLADYFDVI
Sbjct  11    IETLRSPIQPPTFGNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGAEARLADYFDVI  70

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             SGTSTGGLVTAML  P+E  RPL+AAKDI  FYL N PKIFPQ G         I+S+ G
Sbjct  71    SGTSTGGLVTAMLATPNEQNRPLFAAKDINDFYLENCPKIFPQDGSPLASAGKLIKSLRG  130

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             PKYDGK+L S+++++L D RL  T+TN+VIPTFDIK LQP+IFS+YQ K  P  +A LSD
Sbjct  131   PKYDGKFLHSIVQEKLGDKRLHQTMTNIVIPTFDIKRLQPIIFSSYQVKNDPSTDALLSD  190

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CIGTSAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNPTLVA+S+V+K+I
Sbjct  191   ICIGTSAAPTYLPAHYFETKDPSGKV-------REFNLIDGGVAANNPTLVAMSEVSKEI  243

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                NPD FP  PMD  RFLV+S+GTGTA +E KY++ EAAKWG+L WL   +STPL++VF
Sbjct  244   TRKNPDFFPTAPMDYGRFLVLSLGTGTAKSEEKYDADEAAKWGVLGWLTSDNSTPLVDVF  303

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              EAS DMVDLH S VFQAL   EN YLRIQ              +L+GT SS+DVAT+EN
Sbjct  304   TEASGDMVDLHISTVFQALHSEEN-YLRIQ------------DDTLSGTLSSVDVATKEN  350

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVT  324
             LE LV++GEKLLKKPVSRV+L TGV  P+    TNE+AL ++AK LS E+ LR+SRSPV 
Sbjct  351   LENLVKVGEKLLKKPVSRVDLGTGVFTPV-DKMTNEEALIKMAKLLSREKHLRDSRSPVG  409

Query  323   K  321
             K
Sbjct  410   K  410



>ref|XP_010101004.1| Patatin group A-3 [Morus notabilis]
 gb|EXB86652.1| Patatin group A-3 [Morus notabilis]
Length=407

 Score =   451 bits (1160),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 235/398 (59%), Positives = 287/398 (72%), Gaps = 21/398 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGGIRG+IP  IL +LE +LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  8     QPPTYGNLITILSIDGGGIRGLIPGTILNFLEEELQKLDGEDARIADYFDVIAGTSTGGL  67

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVFGPKYDGKY  1203
             VTAML+APDE  RP++AAKDIK FYL   PKIFPQ     F  +   I+++ GPKYDGKY
Sbjct  68    VTAMLSAPDEKNRPVFAAKDIKDFYLTQCPKIFPQNNCPVFPHLAKIIKALSGPKYDGKY  127

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  L+K++L   +L  TLTNVVIPTFDIK   P IFS+Y  K  P  +A LSD+CI TSA
Sbjct  128   LHKLVKEKLGSTKLHQTLTNVVIPTFDIKQQHPTIFSSYGVKNNPSYDALLSDICIATSA  187

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYFK  +     G+     +E+N+IDGGVAANNPTLVAI +V+K+I   N D 
Sbjct  188   APTYLPAHYFKTADAAG--GVL----REFNLIDGGVAANNPTLVAIGEVSKEIIRGNQDF  241

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             FP+KP+D  RFLVIS+GTG+   E KYN+ EAAKWG+LSWL+   STP+I+ +  AS+DM
Sbjct  242   FPMKPLDYGRFLVISLGTGSPKAEKKYNAPEAAKWGVLSWLISGGSTPIIDAYSHASADM  301

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD +   VFQAL   E  YLRIQ              +L+G  SS+D+ATE+NL+ LV +
Sbjct  302   VDRNLCVVFQAL-HSEKKYLRIQ------------DDTLSGAVSSVDIATEKNLDDLVNV  348

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             GEKLL+KPVSRVNLETGV E   H  TN +AL R AK 
Sbjct  349   GEKLLQKPVSRVNLETGVFEVCNHE-TNAEALTRFAKM  385



>emb|CAN81920.1| hypothetical protein VITISV_021802 [Vitis vinifera]
Length=407

 Score =   451 bits (1159),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 250/417 (60%), Positives = 303/417 (73%), Gaps = 59/417 (14%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q  T GN+VT+LSIDGGGIRGIIPA ILA LET+LQELDG+DAR+ADYFDVI+GTSTG
Sbjct  8     QIQPPTYGNLVTILSIDGGGIRGIIPATILARLETRLQELDGDDARIADYFDVIAGTSTG  67

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
                                AKDIKPFYL +GPKIFPQ  G FG I   +RS+ GPKYDGK
Sbjct  68    -------------------AKDIKPFYLEHGPKIFPQTRGIFGWIMSILRSIVGPKYDGK  108

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQA------------------  1080
             YL+ L+K++L   RL +TLT+VVIPTFDIK+LQP IFSTY+                   
Sbjct  109   YLKRLIKEKLGGTRLHETLTSVVIPTFDIKSLQPTIFSTYEVALALSLWLYLFGPPLNWV  168

Query  1079  --KRCPKMNAYLSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAAN  906
               KR P ++A L+D+CIG+SAAPTY PA++FK Q+   +EG T    +E+++IDGGVAAN
Sbjct  169   WVKRSPCLDAPLADICIGSSAAPTYFPAYFFKNQD---KEGKT----QEFDLIDGGVAAN  221

Query  905   NPTLVAISQVTKQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILS  726
             NP LVAI+QVTKQ+FD NPD FPIKPMD  RFLVISIGTG+  +E KYN+K A+KWG+L 
Sbjct  222   NPALVAITQVTKQVFDRNPDFFPIKPMDFGRFLVISIGTGSPKSEQKYNAKMASKWGVLG  281

Query  725   WLLHKSSTPLIEVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSL  546
             WLLH  STPL++VFM+AS+DMVD H S VFQAL   E++YLRIQ              +L
Sbjct  282   WLLHGGSTPLVDVFMQASADMVDFHISMVFQAL-HSEDNYLRIQ------------DDTL  328

Query  545   TGTQSSMDVATEENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
              G  +S+DV TEENL+ LV+IGE+LLKKPVSRVNLETG+SEP+ + GTNE+ALKR A
Sbjct  329   RGKDASVDVTTEENLDNLVKIGERLLKKPVSRVNLETGLSEPVENGGTNEEALKRFA  385



>ref|XP_007226924.1| hypothetical protein PRUPE_ppa015844mg [Prunus persica]
 gb|EMJ28123.1| hypothetical protein PRUPE_ppa015844mg [Prunus persica]
Length=410

 Score =   451 bits (1159),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 242/406 (60%), Positives = 306/406 (75%), Gaps = 23/406 (6%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ER  S  Q+ T GNIVTVLSIDGGGIRGIIP  IL +LE++LQ+LDGE+ARLADYFDVI
Sbjct  1     MERARSFLQSPTYGNIVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGW--FGEIWVSIRSV  1230
             +GTSTGGLVTAMLT PDEN RPL+AAKDI  FYL + PKIFPQ   +   GE    +++V
Sbjct  61    AGTSTGGLVTAMLTTPDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGEAMDMVKAV  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  ++K+ L DIRL+DTLTNV+IPTFDIK LQP++FS+Y+ K+   +NA L
Sbjct  121   SGPKYDGKYLHKIVKEILGDIRLSDTLTNVIIPTFDIKRLQPMVFSSYEEKKNTSINALL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+CIGTSAAPTYLPAH+F+ +    +        +++++IDGGVAANNP LVAIS+VTK
Sbjct  181   SDICIGTSAAPTYLPAHHFETKTSTGE-------SRDFDLIDGGVAANNPALVAISEVTK  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   N D F I+  +  RFLVIS+GTG+A +E KY++ +AAKWG+L WL    S+PL++
Sbjct  234   EIHQGNSDFFAIRSTEYGRFLVISLGTGSAKSEEKYDADDAAKWGLLGWLTKGGSSPLVD  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
             VF +ASSDMVD H + VFQAL D E +YLRIQ              +L  T SS+D+AT+
Sbjct  294   VFTQASSDMVDFHLATVFQAL-DSEKNYLRIQ------------DDTLEKTVSSVDIATQ  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             ENL  LV++GE+LLKKPVSRVNL+TG+ EP  H  TNE+AL R+A+
Sbjct  341   ENLNNLVKVGEELLKKPVSRVNLQTGIYEP-AHQDTNEEALVRVAQ  385



>ref|XP_011017228.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
 ref|XP_011017229.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
Length=405

 Score =   451 bits (1159),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 249/404 (62%), Positives = 306/404 (76%), Gaps = 21/404 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +E + S  Q  T GN+VTVLSIDGGGIRGIIP  ILA+LE++LQ+LDGEDARLADYFDVI
Sbjct  1     METQGSPHQPPTYGNLVTVLSIDGGGIRGIIPGTILAFLESELQKLDGEDARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             SGTSTGGLVTAMLTAP+E  RPL+AAKDI  FYL N PKIF Q G  F      I++  G
Sbjct  61    SGTSTGGLVTAMLTAPNEQNRPLFAAKDINDFYLKNSPKIFHQDGSPFAAAGKLIKAFSG  120

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             PKYDGKYL S++K++L+D RL  TLTNVVIPTFDIK LQP IFS+YQ K  P  +A LSD
Sbjct  121   PKYDGKYLHSIVKEKLRDKRLHQTLTNVVIPTFDIKYLQPTIFSSYQVKNDPSTDALLSD  180

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CIGTSAAPTYLPAHYF+ ++    EG      + +N++DGGVAANNPTLVAI +V+K+I
Sbjct  181   ICIGTSAAPTYLPAHYFETKDS---EGKV----RAFNLVDGGVAANNPTLVAIGEVSKEI  233

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
               ++PD FP+KP D  R+LV+S+GTGTA  E KY++ +AAKWG+L WL   +STPL++VF
Sbjct  234   NRDSPDFFPMKPTDYGRYLVLSLGTGTAKTEEKYDANKAAKWGVLGWLTSDNSTPLVDVF  293

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              +ASSDMVDLH + VFQAL   E +YLRIQ              +LTGT +S+D+AT+EN
Sbjct  294   TQASSDMVDLHLATVFQAL-RSEKNYLRIQ------------DDTLTGTLASVDIATKEN  340

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             LE LV++GE LLKKPVS VNL+TGV EP  +  TNE+AL + A+
Sbjct  341   LENLVKVGEGLLKKPVSSVNLDTGVFEPA-NRLTNEEALIKFAE  383



>gb|KCW66463.1| hypothetical protein EUGRSUZ_F00261 [Eucalyptus grandis]
Length=383

 Score =   449 bits (1156),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 230/388 (59%), Positives = 286/388 (74%), Gaps = 21/388 (5%)
 Frame = -3

Query  1583  IERKPS-QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             +ER  S   Q  T GN++T+LSIDGGG+RG++P  ILA+LE++LQ+LDGEDARLADYFDV
Sbjct  1     MERSKSLPLQPPTYGNLITILSIDGGGMRGLVPGAILAFLESELQKLDGEDARLADYFDV  60

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVF  1227
             I+GTSTGGLVTAMLT+PD++ RPL+ AKDIK F+LNN PKIFPQ    F      I++V 
Sbjct  61    IAGTSTGGLVTAMLTSPDKHNRPLFTAKDIKDFFLNNCPKIFPQDSCPFAPATNMIKAVT  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKYDGKYL  L+K++L + RL  TLTNVVIPTFD K LQP IFS+Y+ K+ P ++A LS
Sbjct  121   GPKYDGKYLHKLIKEKLGNTRLNQTLTNVVIPTFDAKQLQPTIFSSYEVKKKPSIDALLS  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             DVCI TSAAPTYLPAHYF+ Q+   +        +E+N+I GGVAANNPTLVA+ +V K+
Sbjct  181   DVCISTSAAPTYLPAHYFETQDPTGKV-------REFNLIVGGVAANNPTLVAMGEVRKE  233

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             I   + D FPI PMD  RFLVIS+GTG+A  E KYN+ EAAKWG+LSWL     +PLI+V
Sbjct  234   IIGGSSDFFPINPMDYRRFLVISLGTGSAKVEGKYNASEAAKWGVLSWLSSNGGSPLIDV  293

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
              M+AS+DMVD H S VFQAL   E +YLRIQ              +L+G  +S+D+A ++
Sbjct  294   LMQASADMVDFHLSVVFQALL-IEANYLRIQ------------DDTLSGAVASVDIAMKK  340

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSE  423
             N+  LV+ GE LLKKPVSRVNLETG  E
Sbjct  341   NMNDLVKTGEALLKKPVSRVNLETGRYE  368



>ref|XP_010238242.1| PREDICTED: patatin-like protein 2 isoform X2 [Brachypodium distachyon]
Length=399

 Score =   450 bits (1157),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 243/394 (62%), Positives = 297/394 (75%), Gaps = 32/394 (8%)
 Frame = -3

Query  1541  NIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAMLT  1362
             N++TVLSIDGGGIRGII AV LA+LET+LQ+LDGE+ARLADYFDVI+GTSTGGLVTAMLT
Sbjct  17    NLITVLSIDGGGIRGIIAAVALAFLETELQKLDGEEARLADYFDVIAGTSTGGLVTAMLT  76

Query  1361  APDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLKK  1182
             AP+++ RPL+AAKDI+ FY+++ PKIFPQ  G FG I   +RS+ GP YDGKYL  +++K
Sbjct  77    APNKDRRPLFAAKDIQAFYMDHAPKIFPQLRGAFGRIMKVLRSLSGPSYDGKYLHEVVRK  136

Query  1181  ELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPK-MNAYLSDVCIGTSAAPTYLP  1005
             +L  IRL  TLTNVVIPTFDIK LQP IFS+Y+ K+    M+A LSD+CI TSAAPTYLP
Sbjct  137   KLGSIRLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKKRNTMDALLSDICISTSAAPTYLP  196

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AHYFK ++        +   KE+N+IDGGVAANNP LVAI +VTKQIF  NPD FPIKPM
Sbjct  197   AHYFKTED-------LHGNIKEFNLIDGGVAANNPALVAIGEVTKQIFKENPDFFPIKPM  249

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  RFLVIS+GTG++  E KYN+++A  WG+L WLL   STPL+++F  AS+DMVD+H +
Sbjct  250   DYGRFLVISLGTGSSKFEEKYNAQKAKSWGVLDWLLSSGSTPLVDIFTRASADMVDIHIA  309

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
             AVF+AL   E +YLRIQ                 GT SS+DVAT++NLEKLV +GE LLK
Sbjct  310   AVFKAL-HSEQNYLRIQ-----------------GTLSSVDVATKDNLEKLVNVGEMLLK  351

Query  464   KPVSRVNLETGVSEPIPHSG----TNEDALKRLA  375
             K VSR NLETG  + +P  G    TNE AL+R A
Sbjct  352   KSVSRANLETG--QMVPTCGDSEMTNEKALERFA  383



>ref|XP_006374974.1| hypothetical protein POPTR_0014s03260g [Populus trichocarpa]
 gb|ERP52771.1| hypothetical protein POPTR_0014s03260g [Populus trichocarpa]
Length=392

 Score =   449 bits (1155),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 244/406 (60%), Positives = 298/406 (73%), Gaps = 32/406 (8%)
 Frame = -3

Query  1505  IRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAMLTAPDENGRPLYAA  1326
             +RGIIP  ILA+LE++LQ+LDG DARLADYFDVISGTSTGGLVTAML AP+E  RPL+AA
Sbjct  1     MRGIIPGTILAFLESELQKLDGADARLADYFDVISGTSTGGLVTAMLAAPNEQNRPLFAA  60

Query  1325  KDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLKKELKDIRLTDTLT  1146
             KDI  FYL N PKIF Q G         I+S+ GPKYDGK L S++K++L D RL  T+T
Sbjct  61    KDINDFYLENCPKIFHQDGSPLASAGKLIKSLKGPKYDGKILHSIVKEKLGDKRLHQTMT  120

Query  1145  NVVIPTFDIKNLQPVIFSTYQAKR-----CPK------MNAYLSDVCIGTSAAPTYLPAH  999
             N+VIPTFDIK LQP IFS+YQ +      CP        +A LSD+CIGTSAAPTYLPAH
Sbjct  121   NIVIPTFDIKRLQPTIFSSYQNRFTLQNICPNNTYRLSTDALLSDICIGTSAAPTYLPAH  180

Query  998   YFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPMDL  819
             YF+ ++   +        +E+N+IDGGVAANNPTLVA+S+V+K+I   NPD FP  PMD 
Sbjct  181   YFETKDPSGK-------VREFNLIDGGVAANNPTLVAVSEVSKEITRKNPDFFPTAPMDY  233

Query  818   SRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNSAV  639
              RFLV+S+GTGTA  E KY++ EAAKWG+L WL  ++STPL++VF EAS DM+DLH S V
Sbjct  234   GRFLVLSLGTGTAKCEEKYDADEAAKWGVLGWLTSENSTPLVDVFTEASGDMIDLHISTV  293

Query  638   FQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLKKP  459
             FQAL  CE +YLRIQ              +LTGT SS+DVAT+ENLE LV++GEKLLKKP
Sbjct  294   FQAL-HCEENYLRIQ------------DDTLTGTLSSVDVATKENLENLVKVGEKLLKKP  340

Query  458   VSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTK  321
             VSRV+L TG+  P+    TNE+AL ++AK LS E+ LR+SRSPV K
Sbjct  341   VSRVDLGTGIFTPVDKM-TNEEALIKMAKLLSREKHLRDSRSPVGK  385



>ref|XP_006354909.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=408

 Score =   450 bits (1157),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 231/396 (58%), Positives = 293/396 (74%), Gaps = 24/396 (6%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G  +T+LSIDGGGIRG+IPA IL YLE+QLQELDGEDARLADYFD+I+GTSTGGLVTAML
Sbjct  15    GKFITILSIDGGGIRGLIPATILEYLESQLQELDGEDARLADYFDIITGTSTGGLVTAML  74

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVFGPKYDGKYLRSLL  1188
             TAP+++ RPL+AAKDIKPFYL +GPKIFPQ      G I      + GPKY+GKYL  ++
Sbjct  75    TAPNKDNRPLFAAKDIKPFYLEHGPKIFPQNNMILIGSIIKGWTFLTGPKYNGKYLHQVI  134

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             K++L + +L +TLTNVVIPTFDIKN+QP IFST++AK+   MNA LSD+CIGTSAAPTYL
Sbjct  135   KEKLGETKLHETLTNVVIPTFDIKNIQPTIFSTFEAKKHSIMNAKLSDICIGTSAAPTYL  194

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNP---DLFP  837
             PAH F+ Q    ++G  +    E+N+IDG +AANNPT +AIS+VTKQI + NP   +   
Sbjct  195   PAHNFQTQ---NEDGKFH----EFNLIDGAIAANNPTFIAISEVTKQICEQNPYFKNFDE  247

Query  836   IKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVD  657
             + P +  +FLVISIGTG+A  E+KY++K A+ WGI  WL    S P+I+ F +AS DMVD
Sbjct  248   MTPTNYGKFLVISIGTGSAKLEHKYDAKIASNWGIFGWLTGGGSNPIIDAFADASDDMVD  307

Query  656   LHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGE  477
              H S VFQ++   +  YLRIQ              +L+G  SS+D++T+EN++KLVEIG 
Sbjct  308   YHISVVFQSIS-SQKQYLRIQ------------DDTLSGADSSVDISTKENMDKLVEIGT  354

Query  476   KLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
              LLKKPVSRVNL+TG+ E +   GTNE+ALKR AK 
Sbjct  355   NLLKKPVSRVNLKTGLFEQLDTGGTNEEALKRFAKL  390



>ref|XP_006339912.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=399

 Score =   449 bits (1156),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 241/393 (61%), Positives = 297/393 (76%), Gaps = 20/393 (5%)
 Frame = -3

Query  1550  TGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTA  1371
             T G ++T+LSIDGGGIRGIIP VILAYLE+QLQELDGEDAR+ADYFD+I+GTSTGGLVTA
Sbjct  15    TTGKLITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARIADYFDLIAGTSTGGLVTA  74

Query  1370  MLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSL  1191
             ML AP++  RPLYAAKDI PFYL + PKIF Q GG FG +    + + GPKYDGKYL +L
Sbjct  75    MLAAPNKAKRPLYAAKDITPFYLEHSPKIFHQTGGPFGGVINLTKMLNGPKYDGKYLHTL  134

Query  1190  LKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTY  1011
             +K  L   RL DTLT VVIPTFDIK LQPVIFS+Y+ K  P  +A L+D+CI TSAAPT+
Sbjct  135   IKGLLGGTRLHDTLTAVVIPTFDIKELQPVIFSSYETKSKPVSDAELADICISTSAAPTF  194

Query  1010  LPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIK  831
             LPAH FK ++    E        E+N+IDGGVAANNPTL+AI +VTKQ+   + DLFPIK
Sbjct  195   LPAHSFKTKDAQNNE-------HEFNLIDGGVAANNPTLIAIGEVTKQVLMKHEDLFPIK  247

Query  830   PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLH  651
             PM+  RFLVIS+GTG A NE KYN+K AAKWG+LSWL H +STP+IE F +AS+DMVD H
Sbjct  248   PMEYGRFLVISLGTGNAKNEGKYNAKMAAKWGLLSWLTHDNSTPIIEAFNQASADMVDYH  307

Query  650   NSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKL  471
             N  VF+AL   ++ YLRIQ              +LTG  +S+D+AT+ENLE LV++GE+L
Sbjct  308   NFVVFKAL-QSDDQYLRIQ------------DDTLTGNLASVDIATKENLEGLVKVGERL  354

Query  470   LKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             L KP S++NL+ GV E + + GTN++AL+R AK
Sbjct  355   LDKPASKINLDKGVYEAVENGGTNKEALRRFAK  387



>gb|KHG27256.1| Patatin group M-3 [Gossypium arboreum]
Length=412

 Score =   450 bits (1157),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 245/406 (60%), Positives = 299/406 (74%), Gaps = 23/406 (6%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +E    Q QA T G+++T+LSIDGGGIRGIIP  IL +LE+QLQELDGEDARLADYFDVI
Sbjct  1     MEGAKEQLQAPTYGDLITILSIDGGGIRGIIPGTILGFLESQLQELDGEDARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVF  1227
             +GTSTGGLVTAMLT P+E  RPL+AAKDIK FYL N P IFPQ G   F      I+++ 
Sbjct  61    AGTSTGGLVTAMLTCPNEKNRPLFAAKDIKDFYLTNCPNIFPQPGCPLFSRTTKVIKALS  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKYDGK+L +++K +L + RL  TLTNVVIPTFDIK+LQP IFS+YQ K+ P ++A L+
Sbjct  121   GPKYDGKFLHNIVKDKLGETRLHQTLTNVVIPTFDIKHLQPAIFSSYQVKKKPTLDALLT  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CI TSAAPTYLPAHYFKIQ         N   +EYN+IDGGVAANNPTLVA+ +V+K+
Sbjct  181   DICIATSAAPTYLPAHYFKIQ-------TDNGDVREYNLIDGGVAANNPTLVAMGEVSKE  233

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             I   NPD FP KPMD  +FLVIS+GTG+  +E +YN+K++AKWG+L WL    STPL++V
Sbjct  234   IIKGNPDFFPTKPMDYGKFLVISLGTGSKKDEKRYNAKQSAKWGMLGWLTSGGSTPLVDV  293

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F +AS DMVDLH S VF+AL    + YLRIQ               L+G  SS+D+AT  
Sbjct  294   FTQASGDMVDLHLSVVFEALH--SDKYLRIQ------------DDGLSGDVSSVDIATAN  339

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             NL +LV++GE LLKK VSRVNLETG+ EP     TNE+ALKR AK 
Sbjct  340   NLNELVKVGEGLLKKQVSRVNLETGIFEPFKEE-TNEEALKRFAKL  384



>ref|XP_008797306.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=409

 Score =   449 bits (1155),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 235/409 (57%), Positives = 302/409 (74%), Gaps = 22/409 (5%)
 Frame = -3

Query  1592  MVKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYF  1413
             M K +   SQ  A T GN++T+LSIDGG IRGIIPA+IL+ LE++LQ+LDGEDAR+ADYF
Sbjct  1     MEKSKSNISQIHAPTYGNLITILSIDGG-IRGIIPAIILSSLESELQKLDGEDARIADYF  59

Query  1412  DVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRS  1233
             DVI+GT TGGL  AML APDE+ RPL+AAKDIK FYL   PKIFPQ GG    I   +R+
Sbjct  60    DVIAGTDTGGLAAAMLAAPDEDNRPLFAAKDIKSFYLVESPKIFPQYGGILAPIMRMVRA  119

Query  1232  VFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAY  1053
             ++GPKY GKYL  L+++ L   RL  TLTNVVIPTFDIK L   IFS+Y+ KR   +NA 
Sbjct  120   LWGPKYTGKYLHKLIRENLGSTRLHQTLTNVVIPTFDIKRLHSTIFSSYEVKRKSSLNAQ  179

Query  1052  LSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVT  873
             LSD+CIG +AAPTYLP+HYF+ ++    EG      +E+++IDGGVAANNP L+AI +VT
Sbjct  180   LSDICIGATAAPTYLPSHYFETKDA---EGNV----REFHLIDGGVAANNPALIAIGEVT  232

Query  872   KQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             K++   NPD FP KPMD  + L+IS+GTG+   E +Y++K A+KWG+L W L   STPL+
Sbjct  233   KEVHKGNPDYFPYKPMDYRKLLLISLGTGSTKVEERYSAKRASKWGVLGWFLSSGSTPLV  292

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             +VFM++S++MVD+H S VFQAL   E++YLRI+              +L+GT SS DV+T
Sbjct  293   DVFMQSSANMVDIHISVVFQAL-RSESNYLRIE------------DDTLSGTISSADVST  339

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPH-SGTNEDALKRLAKF  369
             ++NLE LV+ GE+LLK+PVSRVNLETGV EP+ +  GTNEDAL+R AK 
Sbjct  340   KDNLEDLVKRGEQLLKRPVSRVNLETGVFEPVGNGEGTNEDALRRFAKL  388



>ref|XP_010269035.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=405

 Score =   449 bits (1155),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 241/405 (60%), Positives = 300/405 (74%), Gaps = 20/405 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ER  S  Q  T GN++T+LSIDGGGIRGIIP +IL YLE+QLQELDG+DARLADYFDVI
Sbjct  1     MERTKSSLQPPTYGNLITILSIDGGGIRGIIPGIILGYLESQLQELDGKDARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             +GTSTGGLVTAMLTAP+E  RPL++A+DIK FYL   P+IFPQ           ++++ G
Sbjct  61    AGTSTGGLVTAMLTAPNEKNRPLFSAEDIKAFYLEQCPRIFPQLSCPLAPAAKVMKALIG  120

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             PKYDGKYL  ++K++L+  RL  TLTNVV+PTFDIKNLQP IFS+Y+ K  P ++A+LSD
Sbjct  121   PKYDGKYLHRVVKEKLETTRLHQTLTNVVVPTFDIKNLQPTIFSSYEVKSKPSLDAFLSD  180

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CI TSAAPTYLPAHYF+ Q+        +   +E+N+IDGGVAANNPTLVA+ +VTK+I
Sbjct  181   ICISTSAAPTYLPAHYFQTQD-------PDGKVREFNLIDGGVAANNPTLVAMREVTKEI  233

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                +PD FPIKPMD  RFLVIS+GTG      KY++ +AAKWG++ WLL   STPL++VF
Sbjct  234   TKGSPDFFPIKPMDYGRFLVISLGTGAPKAAEKYSAHQAAKWGVMGWLLEGGSTPLVDVF  293

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
               AS DMVDLH S VFQAL   E++YLRIQ              +L  T SS+DVAT+EN
Sbjct  294   THASGDMVDLHISVVFQAL-RSEDNYLRIQ------------DDTLGSTVSSVDVATKEN  340

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             L+ LV++GE LLK PVSRVNL+TG+ EP    GTNE+ L+R AK 
Sbjct  341   LDNLVKVGEALLKNPVSRVNLDTGIYEPSKTKGTNEEELRRFAKL  385



>ref|XP_002880810.1| hypothetical protein ARALYDRAFT_481516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57069.1| hypothetical protein ARALYDRAFT_481516 [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score =   449 bits (1154),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 294/405 (73%), Gaps = 21/405 (5%)
 Frame = -3

Query  1589  VKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             ++++   S  Q  T GN+VT+LSIDGGGIRG+IPAVIL +LE++LQ+LDGE+ARLADYFD
Sbjct  1     MQMDSPKSPLQPPTYGNLVTILSIDGGGIRGLIPAVILGFLESELQKLDGEEARLADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             VI+GTSTGGLVTAMLTAP++ GRPL+AA +IK FYL   PKIFPQ    F      ++S+
Sbjct  61    VIAGTSTGGLVTAMLTAPNKEGRPLFAASEIKDFYLEQCPKIFPQDHFPFSAAKNLVKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  L+  +L D +L+ TLTNVVIPTFDIK LQP IFS+Y+ K  P  NA L
Sbjct  121   TGPKYDGKYLHQLIHAKLGDTKLSQTLTNVVIPTFDIKYLQPTIFSSYEVKNHPLKNATL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             +D+ I TSAAPTYLPAH+FK+++            KEYN+IDGGVAANNP L+AI +VT 
Sbjct  181   ADIAISTSAAPTYLPAHFFKVEDSTGNV-------KEYNLIDGGVAANNPALLAIGEVTN  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D FPI+P D  RFLV+S+GTG    E K+N+KE A WG+LSWL H +STP+I+
Sbjct  234   EITRGSSDFFPIRPNDYGRFLVLSLGTGNHKAEEKFNAKEVAGWGLLSWLTHDNSTPIID  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
              F +ASSDMVD H SAVFQAL   E +Y+RIQ              +LTG  +S+D+AT 
Sbjct  294   AFSQASSDMVDFHLSAVFQAL-HSEANYIRIQ------------DDTLTGDAASVDIATA  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             ENL+ L + G++LLKKPV+RVNL++G +E   +  TNE AL +LA
Sbjct  341   ENLDILAKTGDELLKKPVARVNLDSGCNEN-AYETTNEHALIKLA  384



>ref|XP_008337062.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=406

 Score =   448 bits (1153),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 231/406 (57%), Positives = 299/406 (74%), Gaps = 22/406 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ER  S  +    G +V VLSIDGGGIRG+IPA ILA+LE++LQ+LDGEDAR+ADYFDVI
Sbjct  1     MERSGSVGRPPVLGKMVRVLSIDGGGIRGLIPATILAFLESELQKLDGEDARIADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVF  1227
             +GTSTGGLVTAML AP+EN RPL+AAKDI  FY ++ PKIFPQ     F      I+++ 
Sbjct  61    AGTSTGGLVTAMLAAPNENNRPLFAAKDIIDFYFHHCPKIFPQNTCPIFRYTIKIIKALA  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKY+GKYL SL+++++ + +L +TLTNVVIPTFDIKNLQP +FS ++ KR P  +A LS
Sbjct  121   GPKYNGKYLHSLIREKMGNKKLHETLTNVVIPTFDIKNLQPTVFSNHRVKRKPSYBALLS  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+ I TSAAPTYLPAHYFK ++   ++       KE+N+IDGGVAANNPTL+A+ ++T +
Sbjct  181   DIXIATSAAPTYLPAHYFKTKDAAGRD-------KEFNLIDGGVAANNPTLLAVCEMTNE  233

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             I   NP LFP+KP+D  RFLVIS+GTG++  E KY+++ AAKWG+L+WL    STP+I+V
Sbjct  234   IKKENPVLFPVKPVDYGRFLVISLGTGSSKAELKYHARSAAKWGLLNWLTSGGSTPIIDV  293

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F +AS+DMVDLH S VFQAL   E +YLRIQ              +L GT SS+D+AT++
Sbjct  294   FSQASADMVDLHLSGVFQAL-HSEKNYLRIQ------------DDTLHGTISSVDIATKK  340

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             NL  LV++GE LLK+ VSRVNL++G  E   H  TN +AL R AK 
Sbjct  341   NLANLVKVGEGLLKQQVSRVNLDSGKFEASNHE-TNAEALIRFAKL  385



>ref|XP_002277318.1| PREDICTED: patatin-like protein 1 [Vitis vinifera]
 emb|CBI21443.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   448 bits (1153),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 236/391 (60%), Positives = 293/391 (75%), Gaps = 19/391 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             GN++TVLSIDGGGI+GIIP +IL +LE++LQ+LDGEDARLADYFDV+SGTSTGGL+  ML
Sbjct  11    GNLITVLSIDGGGIKGIIPGIILDFLESELQKLDGEDARLADYFDVVSGTSTGGLIATML  70

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             TAP+EN RPLYAA  IKPFYL NGPKIFPQK G    +    ++  GPKYDGKYL SLLK
Sbjct  71    TAPNENNRPLYAASGIKPFYLENGPKIFPQKSGILASVENLFKAFTGPKYDGKYLHSLLK  130

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
              +L+D RL  TLTNVVIPTFDIK LQP IFS+YQ    P ++A L+D+CI TSAAPT+LP
Sbjct  131   DKLRDTRLHQTLTNVVIPTFDIKELQPTIFSSYQVTTTPSLDAKLADICISTSAAPTFLP  190

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             A+YF   E P ++G      +E+N+ DGGVAANNPTL+AIS+V KQ+ + NPD  P KPM
Sbjct  191   AYYF---ENPDEKG---GKMREFNLTDGGVAANNPTLLAISEVAKQVSNKNPDFSPFKPM  244

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             +  R LVIS+GTG+A  E+KYN K A+KWG++ WL +  +TPL+E F +AS+DMVD + S
Sbjct  245   EYDRLLVISLGTGSAKTEHKYNGKMASKWGLVEWLYNGGNTPLVECFAQASTDMVDFYIS  304

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
               FQ     E +YLRI               +LTGT +S+DVAT+ENL  LV++GEKLLK
Sbjct  305   LAFQT-HQYEENYLRID------------DDTLTGTLASLDVATKENLNNLVQVGEKLLK  351

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             KPVSRVNLETG  EP+ + G+NE AL++ AK
Sbjct  352   KPVSRVNLETGQYEPVKNGGSNEKALRKFAK  382



>ref|XP_004288052.1| PREDICTED: patatin group A-3-like [Fragaria vesca subsp. vesca]
Length=407

 Score =   448 bits (1153),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 244/404 (60%), Positives = 301/404 (75%), Gaps = 24/404 (6%)
 Frame = -3

Query  1574  KPS--QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVIS  1401
             +PS  Q Q    GN++TVLSIDGGGIRGIIP V+L YLE+QLQ LDGEDAR+ADYFDVIS
Sbjct  6     RPSLLQVQPPRYGNLITVLSIDGGGIRGIIPGVLLTYLESQLQHLDGEDARIADYFDVIS  65

Query  1400  GTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGP  1221
             GTSTGGL+TAML APDEN RPL+AAKDI PFYL+N PKIFPQ  G    +   ++ + GP
Sbjct  66    GTSTGGLITAMLAAPDENNRPLFAAKDIVPFYLDNCPKIFPQSRGLCATVTDLVKVLIGP  125

Query  1220  KYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDV  1041
             KYDGKYL  L++  + D RL+ TLTNV+IPTFDIK L PVIFSTYQ    P  NA LSD+
Sbjct  126   KYDGKYLHKLIRSIVGDKRLSQTLTNVIIPTFDIKTLLPVIFSTYQVASYPVKNAKLSDI  185

Query  1040  CIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIF  861
             CIGTSAAPTY PAHYF+      Q+G TN    ++N+IDGGVAANNP LVAI++VTKQI 
Sbjct  186   CIGTSAAPTYFPAHYFENH----QQGETN----KFNLIDGGVAANNPALVAITEVTKQIM  237

Query  860   DNNPDLFPIKPMDL-SRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
               NPD   ++P++L  RFL+I++GTG+  +E +Y++K A+KWGILSWL    S+PL+  +
Sbjct  238   RKNPDFSEVQPLELYERFLLITLGTGSNKSELRYSAKMASKWGILSWLYDDGSSPLVNSY  297

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              EASSDMV  HN A+F+AL   EN+YLRI               +LTG  SS+D AT+EN
Sbjct  298   NEASSDMVAYHNCAIFEAL-QSENNYLRID------------DDTLTGDLSSVDKATKEN  344

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             LE LVE+GE+LLKK VSR+NL+TG+ EP+ + GTNE+AL+R AK
Sbjct  345   LENLVEVGEQLLKKQVSRMNLDTGLYEPVENGGTNEEALQRFAK  388



>ref|XP_006374973.1| hypothetical protein POPTR_0014s03250g [Populus trichocarpa]
 gb|ERP52770.1| hypothetical protein POPTR_0014s03250g [Populus trichocarpa]
Length=414

 Score =   448 bits (1152),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 255/421 (61%), Positives = 314/421 (75%), Gaps = 21/421 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             I+   S  Q  T GN +TVLSIDGGGIRGIIP  ILA+LE++LQ+LDG DARLADYFDVI
Sbjct  10    IQTLRSPIQPPTFGNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYFDVI  69

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             SGTSTGGLVTAML AP+E  RPL++AKDI  FYL N PKIF Q G         I+S+ G
Sbjct  70    SGTSTGGLVTAMLAAPNEQNRPLFSAKDINDFYLENCPKIFHQDGCPLASAGKLIKSLRG  129

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             P YDGK+L S++K++L D RL  T+TN+VIPTFDIK LQP IFS+YQ K  P  +A LSD
Sbjct  130   PTYDGKFLHSIVKEKLGDKRLHQTMTNIVIPTFDIKRLQPTIFSSYQVKNDPSTDALLSD  189

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CIGTSAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNPTLVA+S+V+K+I
Sbjct  190   ICIGTSAAPTYLPAHYFETKDPSGK-------VREFNLIDGGVAANNPTLVAMSEVSKEI  242

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                NPD FP  PMD  RFLV+S+GTG+A  E KY++ EAAKWG+L WL  ++STPL++VF
Sbjct  243   TRKNPDFFPTAPMDYGRFLVLSLGTGSAKCEEKYDADEAAKWGVLGWLTSENSTPLVDVF  302

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              EAS DM+DLH S VFQAL  CE +Y+RIQ              +LTGT SS+D+AT+EN
Sbjct  303   TEASGDMIDLHISTVFQAL-HCEENYIRIQ------------DDTLTGTLSSVDIATKEN  349

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVT  324
             LE LV++GEKLLKKPVSRV+L TG+  P+    TNE+AL ++AK LS E+ LR+SRSPV 
Sbjct  350   LENLVKVGEKLLKKPVSRVDLGTGIFTPV-DKMTNEEALIKMAKLLSREKHLRDSRSPVG  408

Query  323   K  321
             K
Sbjct  409   K  409



>ref|XP_009370175.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=406

 Score =   447 bits (1151),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 233/394 (59%), Positives = 288/394 (73%), Gaps = 24/394 (6%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G IVTVLSIDGGGIRG+IPA IL +LE++LQ+LDGEDAR+ADYFDVI+GTSTGGLVTAML
Sbjct  14    GKIVTVLSIDGGGIRGLIPATILTFLESELQKLDGEDARIADYFDVIAGTSTGGLVTAML  73

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGW--FGEIWVSIRSVFGPKYDGKYLRSL  1191
              AP+E+ RPL+AAKDI  FYLN  PKIFPQ   W  F      I+++ GPKY+GKYL  L
Sbjct  74    AAPNESNRPLFAAKDIIDFYLNQCPKIFPQ-NTWPIFPNTTKIIKALAGPKYNGKYLHRL  132

Query  1190  LKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTY  1011
             +++ L + +L DTLTNVVIPTFDIKNL   IFS ++ K+ P  +A LSD+CIGTSAAPTY
Sbjct  133   IRERLGNKKLHDTLTNVVIPTFDIKNLHTTIFSNFKMKKKPSYDALLSDICIGTSAAPTY  192

Query  1010  LPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIK  831
             LPAHYF   E     G T    +E+N+IDGGVAANNPTL+A+ +   +I   NPD+FP K
Sbjct  193   LPAHYF---EAKNAAGRT----REFNLIDGGVAANNPTLLAVCEAINEIRKVNPDVFPAK  245

Query  830   PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLH  651
             PMD  RFLVIS+GTG++  E KY+++ +AKWG+L WL    STP+I VF +AS+DMVDLH
Sbjct  246   PMDYGRFLVISLGTGSSKTEMKYHARSSAKWGLLDWLTSGGSTPIINVFSQASNDMVDLH  305

Query  650   NSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKL  471
              SAV QAL   EN YLRIQ              +L GT +S+D+AT++NL  LV++GE L
Sbjct  306   LSAVLQALHSEEN-YLRIQ------------DDTLRGTIASVDIATKKNLTNLVKVGEGL  352

Query  470   LKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LKKPVSRVNL++G  +   H  TN +AL R AK 
Sbjct  353   LKKPVSRVNLDSGRFKATKHE-TNAEALTRFAKL  385



>ref|XP_002301194.1| patatin-like family protein [Populus trichocarpa]
 gb|EEE80467.1| patatin-like family protein [Populus trichocarpa]
Length=405

 Score =   447 bits (1151),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 248/404 (61%), Positives = 305/404 (75%), Gaps = 21/404 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +E   S  Q  T GN++TVLSIDGGGIRGIIP  ILA+LE++LQ+LDGEDARLADYFDVI
Sbjct  1     METPGSPHQPPTYGNLITVLSIDGGGIRGIIPGTILAFLESELQKLDGEDARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             SGTSTGGLVTAMLTAP+E  RPL+AAKDI  FYL + P+IFPQ G  F      I++  G
Sbjct  61    SGTSTGGLVTAMLTAPNEQNRPLFAAKDINDFYLKHSPRIFPQDGSPFAAAGNLIKAFSG  120

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             PKYDGKYL S++K++L + RL  TLTNVVIPTFDIK LQP IFS+YQ K  P  +A LSD
Sbjct  121   PKYDGKYLHSIVKEKLGEKRLHQTLTNVVIPTFDIKYLQPTIFSSYQVKNDPSTDALLSD  180

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CIGTSAAPTYLPAHYF+ ++    EG      + +N++DGGVAANNPTLVAI +V+K+I
Sbjct  181   ICIGTSAAPTYLPAHYFETKD---SEGKV----RGFNLVDGGVAANNPTLVAIGEVSKEI  233

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
               ++PD FP+KP D  RFLV+S+GTGTA  E KY++ +AAKWG+L WL   +STPL++VF
Sbjct  234   NRDSPDFFPVKPTDYGRFLVLSLGTGTAKTEEKYDANKAAKWGVLGWLTSDNSTPLVDVF  293

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              +ASSDMVDLH   VFQAL   E +YLRIQ              +LTGT +S+D+AT+EN
Sbjct  294   TQASSDMVDLHLGTVFQALL-SEKNYLRIQ------------DDTLTGTLASVDIATKEN  340

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             LE LV++GE LLKKPVSRVNL+TGV EP  +  TNE+AL + A+
Sbjct  341   LENLVKVGEGLLKKPVSRVNLDTGVFEPA-NKLTNEEALIKFAE  383



>gb|KCW54973.1| hypothetical protein EUGRSUZ_I00941 [Eucalyptus grandis]
Length=403

 Score =   447 bits (1150),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 226/405 (56%), Positives = 288/405 (71%), Gaps = 25/405 (6%)
 Frame = -3

Query  1580  ERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVIS  1401
             ER   + Q    G ++T+LSIDGGG+RGIIP VIL YLE QLQELDGE ARLADYFDVI+
Sbjct  4     ERLSLKIQPPKYGKLITILSIDGGGVRGIIPGVILDYLEAQLQELDGEGARLADYFDVIA  63

Query  1400  GTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGP  1221
             GTSTGGL+TAML+APD + RPL+AAKDI PFYL N PKIFPQ  G  G +  ++RS+ GP
Sbjct  64    GTSTGGLITAMLSAPDADNRPLFAAKDIVPFYLENCPKIFPQGCGCLGSVVSTLRSLAGP  123

Query  1220  KYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDV  1041
             KY+G YL  L++K L   RL  +LT +VIPTFDIK L+PV+FS+Y+  +   ++A LSD+
Sbjct  124   KYNGVYLHKLIRKLLGTTRLHASLTGLVIPTFDIKKLEPVLFSSYEVSKHSFLDAQLSDI  183

Query  1040  CIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIF  861
             CIGTSAAPTY PAHYF  +E             E+N+IDGG+ ANNPTLVA+S+VTKQI 
Sbjct  184   CIGTSAAPTYFPAHYFTTEE-----------THEFNLIDGGMVANNPTLVAVSEVTKQIL  232

Query  860   DNNPDLFPIK-PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                     IK P+D +R LVIS+GTG+  +E  +N+K+A+KWG+  WL    ++PLI+++
Sbjct  233   REEAHFIDIKPPVDYTRLLVISLGTGSDTSELMFNAKKASKWGLFCWLYQDGTSPLIDIY  292

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              + SSD+VD HNS VF+A    E +YLRI               SL GT SS+D +T+EN
Sbjct  293   SQGSSDLVDYHNSVVFKAY-QSEKNYLRIN------------DDSLKGTLSSVDTSTKEN  339

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LE LV++GE LLKKPVSR +L+TG  E IP++GTNE+ALKR AK 
Sbjct  340   LEGLVKVGEHLLKKPVSRFDLDTGRYESIPNAGTNEEALKRFAKL  384



>ref|XP_008220193.1| PREDICTED: patatin-like protein 2 isoform X1 [Prunus mume]
Length=417

 Score =   447 bits (1151),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 240/407 (59%), Positives = 306/407 (75%), Gaps = 23/407 (6%)
 Frame = -3

Query  1586  KIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             ++ER  S  Q+ T GNIVTVLSIDGGGIRGIIP  IL +LE++LQ+LDGE+ARL DYFDV
Sbjct  7     QMERARSFLQSPTYGNIVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLVDYFDV  66

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGW--FGEIWVSIRS  1233
             I+GTSTGGLVTAMLT PDEN RPL+AAKDI  FYL + PKIFPQ   +   G+    +++
Sbjct  67    IAGTSTGGLVTAMLTTPDENNRPLFAAKDINDFYLEHCPKIFPQDSNYTLIGKAMDMVKA  126

Query  1232  VFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAY  1053
             V GPKYDGKYL  ++K+ L DIRL+DTLTNV+IPTFDIK LQP++FS+Y+ K+   +NA 
Sbjct  127   VSGPKYDGKYLHKIMKEILGDIRLSDTLTNVIIPTFDIKRLQPMVFSSYEEKKNTSINAL  186

Query  1052  LSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVT  873
             LSD+CIGTSAAPTYLPAH+F+ +    +        +++++IDGGVAANNP LVA+S+VT
Sbjct  187   LSDICIGTSAAPTYLPAHHFETKTSTGES-------RDFDLIDGGVAANNPALVAMSEVT  239

Query  872   KQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             K+I   N D F I+  +  RFLVIS+GTG+A +E KY++ +AAKWG+L WL    S+PLI
Sbjct  240   KEIHQGNSDFFAIRSTEYGRFLVISLGTGSAKSEEKYDADDAAKWGLLGWLTKGGSSPLI  299

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             +VF +AS+DMVD H + VFQAL DCE +YLRIQ              +L  T SS+D+AT
Sbjct  300   DVFTQASNDMVDFHLATVFQAL-DCEKNYLRIQ------------DDTLEKTVSSVDIAT  346

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             +ENL  LV++GE+LLKKPVSRVNL+TG+ EP  H  TNE AL R+A+
Sbjct  347   QENLNNLVKVGEELLKKPVSRVNLQTGIYEPAHHE-TNEVALIRVAQ  392



>ref|XP_010098699.1| Patatin group A-3 [Morus notabilis]
 gb|EXB75602.1| Patatin group A-3 [Morus notabilis]
Length=434

 Score =   448 bits (1152),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 230/392 (59%), Positives = 294/392 (75%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             GN++TVLSIDGGGIRGIIPA IL++ E+QLQELDGE+ARLADYFDVI+GTSTGGL+ AML
Sbjct  46    GNLITVLSIDGGGIRGIIPATILSFFESQLQELDGEEARLADYFDVIAGTSTGGLIAAML  105

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
              APDEN RP  AAKDI PFYL +  KIF Q  G+   +   + ++ GPKYD KYL  L++
Sbjct  106   AAPDENKRPCIAAKDITPFYLEHASKIFQQTSGFLKSVRSFLGNLAGPKYDEKYLHGLMR  165

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
              +L + RL DT+TN+VIPTFDIK LQP +FS+Y+ +  P ++  LSD+CIGTSAAPTYLP
Sbjct  166   DKLGETRLHDTVTNLVIPTFDIKRLQPTVFSSYEVRSSPDLDVKLSDICIGTSAAPTYLP  225

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             A+YF  Q+        N   +E++++DGGVAANNPTL+AIS+VTKQI+  N D  P+KPM
Sbjct  226   AYYFTNQDA-------NGNVREFDLVDGGVAANNPTLIAISEVTKQIYKQNRDFSPLKPM  278

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D SRFLVISIGTG+A  E KY +  AA+WGI+ WL +    P+++V+ +ASSDMVDLH S
Sbjct  279   DYSRFLVISIGTGSAKIEQKYTASMAAEWGIIKWLFNNGDVPIVDVYSQASSDMVDLHMS  338

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              +FQAL   ++ YLRIQ               L G +S +D+AT+ENL+KLV+IGE+LLK
Sbjct  339   VIFQALH-SQDRYLRIQ------------DDELAGEESLVDIATKENLDKLVQIGEQLLK  385

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             KP++RVNLETG+SEP+ +  TN+DALKR AK 
Sbjct  386   KPLARVNLETGLSEPLENGVTNKDALKRFAKL  417



>ref|XP_011081971.1| PREDICTED: patatin-like protein 1 [Sesamum indicum]
Length=403

 Score =   447 bits (1149),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 234/392 (60%), Positives = 293/392 (75%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             GN++T+LSIDGGGIRGIIPA IL  LE++LQ+LDG+DAR+ADYFDVI+GTSTGGLVTAML
Sbjct  15    GNLITILSIDGGGIRGIIPAKILESLESELQKLDGQDARIADYFDVIAGTSTGGLVTAML  74

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             TAPD N RPLYAAKDI  FY+ +GPKIFP KGG  G +   +  +  PKY GKYL  L++
Sbjct  75    TAPDANNRPLYAAKDIAAFYVKHGPKIFPHKGGVIGSLESMVVQLGRPKYKGKYLHKLIR  134

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
               L   RL DTLTNVVIPTFDI+NLQP +FS+Y+ K  P ++A LSD+CIGTSAAPT+ P
Sbjct  135   DNLGQTRLHDTLTNVVIPTFDIRNLQPTVFSSYEMKNMPYLDALLSDICIGTSAAPTFFP  194

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AH+F     P   G +     ++N+IDGGVAANNPTLVAIS+VTKQ+  N+PD FPI+PM
Sbjct  195   AHHF---TNPDASGKS----WDFNLIDGGVAANNPTLVAISEVTKQVLRNDPDFFPIQPM  247

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D +R LVIS+GTG+A  E KY ++ AAKWG+  WL+  ++TP+++VF +AS DMVD    
Sbjct  248   DYNRLLVISLGTGSAKQERKYTAEMAAKWGLFGWLIQGNNTPILDVFNQASKDMVDYFLC  307

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              +FQ+L   E++YLRIQ              SLTG  +S+DV T++NL +L +IGE LLK
Sbjct  308   VIFQSL-HSEDNYLRIQ------------DDSLTGANASVDVTTKQNLSELAKIGENLLK  354

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
              P+SRVNL TG SEPIP+ GTNEDALK+ AK 
Sbjct  355   GPISRVNLLTGNSEPIPNGGTNEDALKKFAKL  386



>ref|XP_010089434.1| Patatin group A-3 [Morus notabilis]
 gb|EXB37800.1| Patatin group A-3 [Morus notabilis]
Length=399

 Score =   446 bits (1148),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 236/392 (60%), Positives = 292/392 (74%), Gaps = 25/392 (6%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             GN++T+LSIDGGGIRGIIP VIL +LE+ LQELDGED RLADYFDVI+GTSTGGLVTAML
Sbjct  16    GNVITILSIDGGGIRGIIPGVILNFLESHLQELDGEDVRLADYFDVITGTSTGGLVTAML  75

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
              APD N RPL++AKDI PFY+ +GPKIFPQ  G F  +   ++ + GPKY+GKYLR L++
Sbjct  76    AAPDANNRPLFSAKDIVPFYIEHGPKIFPQTRGPFASVVDFVKELIGPKYNGKYLRKLVR  135

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             ++L    L  TLTNVVIPTFD+K LQP IFS+YQ +   +  A LSD+CI TSAAPTY P
Sbjct  136   EKLGQTGLQQTLTNVVIPTFDLKKLQPTIFSSYQTRSSTESEAKLSDICISTSAAPTYFP  195

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             ++YFKIQ+            KEYN+IDG +AANNP LVAIS+VTKQI   N D  P KPM
Sbjct  196   SYYFKIQD------------KEYNLIDGAIAANNPALVAISEVTKQIIWKNEDFDPNKPM  243

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D +RFLVISIGTG+  +E KY+SK+A KWG+L W+ +K STP+I+ +MEAS+DMVD HN 
Sbjct  244   DYNRFLVISIGTGSNRSEKKYDSKKATKWGVLDWIYNKGSTPIIDSYMEASADMVDFHNC  303

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              VFQA    ENSYLR+             + +L G  +S D+AT+ENL+KLVE+G+ LLK
Sbjct  304   VVFQAF-HSENSYLRVN------------EDTLKGDLASADIATDENLQKLVEVGQSLLK  350

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             KPVSR NL+TG+ E I + GTNE+AL+R AK 
Sbjct  351   KPVSRQNLDTGIYEHIENGGTNEEALQRFAKL  382



>ref|XP_011071103.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
 ref|XP_011071104.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
Length=408

 Score =   447 bits (1149),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 245/399 (61%), Positives = 303/399 (76%), Gaps = 21/399 (5%)
 Frame = -3

Query  1565  QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTG  1386
             Q Q    G ++ +LSIDGGGIRGIIP VILA+LE++LQ LD E+ARLADYFDVI+GTSTG
Sbjct  9     QIQECVSGKLIRILSIDGGGIRGIIPGVILAFLESRLQMLDSEEARLADYFDVIAGTSTG  68

Query  1385  GLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGK  1206
             GLVTAMLTAP+E+ RP++AAKDIK FYL+  PKIFPQ+    G     I+S  GPKYDG 
Sbjct  69    GLVTAMLTAPNEDNRPMFAAKDIKAFYLDECPKIFPQQSHALGHAAKVIKSFSGPKYDGI  128

Query  1205  YLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTS  1026
             YL SL+K++L D++L +TLT+VVIPTFDIK+LQPVIFS+Y+ K  P ++A LSD+CIGTS
Sbjct  129   YLHSLIKEKLGDVKLHETLTDVVIPTFDIKSLQPVIFSSYEVKNEPSLDASLSDICIGTS  188

Query  1025  AAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPD  846
             AAPTYLPAHYF   E    EG      +E+N+IDGGVAANNPTLVAI+QVTK+I   + +
Sbjct  189   AAPTYLPAHYF---ENKDSEGRI----REFNLIDGGVAANNPTLVAINQVTKEITRGSSE  241

Query  845   LFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSD  666
             +FP+KP +  RFLV+S+GTG+A  E KY+++ AAKWG+L WLL+  STPL +VF  ASSD
Sbjct  242   IFPLKPKEDGRFLVLSLGTGSAKAEEKYDAEGAAKWGVLGWLLNGGSTPLFDVFNRASSD  301

Query  665   MVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVE  486
             MVD H +  FQAL   +N+YLRIQ              +LTG  SS+DVAT+ENLE LV+
Sbjct  302   MVDFHTTTFFQAL-HSQNNYLRIQ------------DDTLTGAMSSVDVATKENLEDLVK  348

Query  485   IGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
              GEKLLKKPVSRVN ETG+ EP  + GTNE+AL RLA+ 
Sbjct  349   AGEKLLKKPVSRVNWETGIYEP-SNQGTNEEALIRLAEL  386



>ref|NP_180224.1| phospholipase A 2A [Arabidopsis thaliana]
 sp|O48723.1|PLP2_ARATH RecName: Full=Patatin-like protein 2; Short=AtPLP2; AltName: 
Full=Patatin-related phospholipase A IIalpha; Short=pPLAIIa; 
AltName: Full=Phospholipase A IIA; Short=AtPLAIIA [Arabidopsis 
thaliana]
 gb|AAC14504.1| similar to latex allergen from Hevea brasiliensis [Arabidopsis 
thaliana]
 gb|AAL32722.1| similar to latex allergen [Arabidopsis thaliana]
 gb|AAM13304.1| similar to latex allergen [Arabidopsis thaliana]
 gb|AEC07858.1| phospholipase A 2A [Arabidopsis thaliana]
Length=407

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 229/405 (57%), Positives = 296/405 (73%), Gaps = 21/405 (5%)
 Frame = -3

Query  1589  VKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             ++++   S  Q  T GN+VT+LSIDGGGIRG+IPAVIL +LE++LQ+LDGE+ARLADYFD
Sbjct  1     MQMDSPKSPLQPPTYGNLVTILSIDGGGIRGLIPAVILGFLESELQKLDGEEARLADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             VI+GTSTGGLVTAMLTAP++ GRPL+AA +IK FYL   PKIFPQ    F      ++S+
Sbjct  61    VIAGTSTGGLVTAMLTAPNKEGRPLFAASEIKDFYLEQCPKIFPQDHFPFSAAKKLVKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  L+  +L D +L+ TLTNVVIPTFDIK+LQP IFS+Y+ K  P  +A L
Sbjct  121   TGPKYDGKYLHQLIHAKLGDTKLSQTLTNVVIPTFDIKHLQPTIFSSYEVKNHPLKDATL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             +D+ I TSAAPTYLPAH+FK+++        N   KEYN+IDGGVAANNP L+AI +VT 
Sbjct  181   ADIAISTSAAPTYLPAHFFKVED-------LNGNAKEYNLIDGGVAANNPALLAIGEVTN  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D FPI+P D  RFLV+S+GTG    E K+N+KE A WG+L+WL H +STP+I+
Sbjct  234   EISGGSSDFFPIRPNDYGRFLVLSLGTGNHKAEEKFNAKEVAGWGLLNWLTHDNSTPIID  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
              F +ASSDMVD H SAVF+AL   E +Y+RIQ              +LTG  +S+D+AT 
Sbjct  294   AFSQASSDMVDFHLSAVFRAL-HSEANYIRIQ------------DDTLTGDAASVDIATV  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             ENL+ L + G++LLKKPV+RVNL++G +E   +  TNE AL +LA
Sbjct  341   ENLDILAKTGDELLKKPVARVNLDSGCNEN-AYETTNEHALIKLA  384



>ref|XP_008220195.1| PREDICTED: patatin-like protein 2 isoform X2 [Prunus mume]
Length=415

 Score =   446 bits (1147),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 239/405 (59%), Positives = 304/405 (75%), Gaps = 21/405 (5%)
 Frame = -3

Query  1586  KIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             ++ER  S  Q+ T GNIVTVLSIDGGGIRGIIP  IL +LE++LQ+LDGE+ARL DYFDV
Sbjct  7     QMERARSFLQSPTYGNIVTVLSIDGGGIRGIIPGTILKFLESELQKLDGEEARLVDYFDV  66

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVF  1227
             I+GTSTGGLVTAMLT PDEN RPL+AAKDI  FYL + PKIFPQ       +   +++V 
Sbjct  67    IAGTSTGGLVTAMLTTPDENNRPLFAAKDINDFYLEHCPKIFPQDRYLTSYLTSMVKAVS  126

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKYDGKYL  ++K+ L DIRL+DTLTNV+IPTFDIK LQP++FS+Y+ K+   +NA LS
Sbjct  127   GPKYDGKYLHKIMKEILGDIRLSDTLTNVIIPTFDIKRLQPMVFSSYEEKKNTSINALLS  186

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CIGTSAAPTYLPAH+F+ +    +        +++++IDGGVAANNP LVA+S+VTK+
Sbjct  187   DICIGTSAAPTYLPAHHFETKTSTGES-------RDFDLIDGGVAANNPALVAMSEVTKE  239

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             I   N D F I+  +  RFLVIS+GTG+A +E KY++ +AAKWG+L WL    S+PLI+V
Sbjct  240   IHQGNSDFFAIRSTEYGRFLVISLGTGSAKSEEKYDADDAAKWGLLGWLTKGGSSPLIDV  299

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F +AS+DMVD H + VFQAL DCE +YLRIQ              +L  T SS+D+AT+E
Sbjct  300   FTQASNDMVDFHLATVFQAL-DCEKNYLRIQ------------DDTLEKTVSSVDIATQE  346

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             NL  LV++GE+LLKKPVSRVNL+TG+ EP  H  TNE AL R+A+
Sbjct  347   NLNNLVKVGEELLKKPVSRVNLQTGIYEP-AHHETNEVALIRVAQ  390



>ref|XP_010269043.1| PREDICTED: patatin-like protein 2 isoform X2 [Nelumbo nucifera]
Length=381

 Score =   445 bits (1144),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 239/401 (60%), Positives = 298/401 (74%), Gaps = 20/401 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ER  S  Q  T GN++T+LSIDGGGIRGIIP +IL YLE+QLQELDG+DARLADYFDVI
Sbjct  1     MERTKSSLQPPTYGNLITILSIDGGGIRGIIPGIILGYLESQLQELDGKDARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             +GTSTGGLVTAMLTAP+E  RPL++A+DIK FYL   P+IFPQ           ++++ G
Sbjct  61    AGTSTGGLVTAMLTAPNEKNRPLFSAEDIKAFYLEQCPRIFPQLSCPLAPAAKVMKALIG  120

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             PKYDGKYL  ++K++L+  RL  TLTNVV+PTFDIKNLQP IFS+Y+ K  P ++A+LSD
Sbjct  121   PKYDGKYLHRVVKEKLETTRLHQTLTNVVVPTFDIKNLQPTIFSSYEVKSKPSLDAFLSD  180

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CI TSAAPTYLPAHYF+ Q+        +   +E+N+IDGGVAANNPTLVA+ +VTK+I
Sbjct  181   ICISTSAAPTYLPAHYFQTQD-------PDGKVREFNLIDGGVAANNPTLVAMREVTKEI  233

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                +PD FPIKPMD  RFLVIS+GTG      KY++ +AAKWG++ WLL   STPL++VF
Sbjct  234   TKGSPDFFPIKPMDYGRFLVISLGTGAPKAAEKYSAHQAAKWGVMGWLLEGGSTPLVDVF  293

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
               AS DMVDLH S VFQAL   E++YLRIQ              +L  T SS+DVAT+EN
Sbjct  294   THASGDMVDLHISVVFQAL-RSEDNYLRIQ------------DDTLGSTVSSVDVATKEN  340

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKR  381
             L+ LV++GE LLK PVSRVNL+TG+ EP    GTNE+ L+R
Sbjct  341   LDNLVKVGEALLKNPVSRVNLDTGIYEPSKTKGTNEEELRR  381



>ref|XP_006339914.1| PREDICTED: patatin-05-like [Solanum tuberosum]
Length=405

 Score =   445 bits (1145),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 235/391 (60%), Positives = 298/391 (76%), Gaps = 20/391 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++T+L+IDGGGIRGIIP VILAYLE+QLQELDGE+AR+ADYFDVI+GTSTGGLVTAML
Sbjct  20    GKLITILAIDGGGIRGIIPGVILAYLESQLQELDGENARIADYFDVIAGTSTGGLVTAML  79

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
              AP+++ RPLYAAKDI PFY+ + PKIFPQ  G F  +    + + GPKYDGKYL +L K
Sbjct  80    AAPNKDKRPLYAAKDITPFYIEHSPKIFPQISGLFAGVINLTKMMNGPKYDGKYLHALTK  139

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             + L   RL DTLT VVIPTFDIK LQPVIFS+Y+A   P ++A L+D+CI TSAAPT+LP
Sbjct  140   RLLGGTRLHDTLTAVVIPTFDIKTLQPVIFSSYEANSKPDLDAELADICISTSAAPTFLP  199

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             A+ FK Q+   ++       +E+N+IDGGVAANNPTL+AI +VTKQ    + DLFPIKPM
Sbjct  200   AYCFKTQDAQNKD-------REFNLIDGGVAANNPTLIAIGEVTKQTLMKHGDLFPIKPM  252

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  RFLVIS+GTG A NE KYN+K AAKWG+LSWL H +STP+IE F +AS+DMVD HN 
Sbjct  253   DYGRFLVISLGTGNAKNEEKYNAKMAAKWGLLSWLTHDNSTPIIEAFNQASADMVDYHNF  312

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              VF+AL   ++ YLRIQ              +LTG  +S+D++T+ENLE L+++GE+LL 
Sbjct  313   VVFKAL-HSDDKYLRIQ------------DDTLTGNLASVDISTKENLEGLIKVGEELLD  359

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             KP S++NL+ GV E + + GTN++AL+R AK
Sbjct  360   KPTSKINLDKGVYEAVENGGTNKEALRRFAK  390



>ref|XP_006387188.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
 gb|ERP46102.1| hypothetical protein POPTR_1581s00200g [Populus trichocarpa]
Length=403

 Score =   444 bits (1143),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 245/408 (60%), Positives = 302/408 (74%), Gaps = 21/408 (5%)
 Frame = -3

Query  1592  MVKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYF  1413
             M  ++   S  Q  T GN +TVLSIDGGGIRGIIP  ILA+LE++LQ+LDG DARLADYF
Sbjct  1     MANMQTPRSPLQLPTRGNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGADARLADYF  60

Query  1412  DVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRS  1233
             DVISGTSTGGLVTAML AP++  RPL+AAKDI  FYL N PKIFPQ    F      +++
Sbjct  61    DVISGTSTGGLVTAMLAAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKT  120

Query  1232  VFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAY  1053
             + GPKYDGK+L S++K++L D  L  TLTN+VIPTFDIK LQP IFS+Y  K  P  +A 
Sbjct  121   LGGPKYDGKFLHSIVKEKLGDTWLHQTLTNIVIPTFDIKRLQPTIFSSYNVKNNPSTDAL  180

Query  1052  LSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVT  873
             LSD+CIGTSAAPTYLPAHYF+ ++   +        +++N+IDGGVAANNPTLVAIS+V+
Sbjct  181   LSDICIGTSAAPTYLPAHYFETKDPSGK-------VRDFNLIDGGVAANNPTLVAISEVS  233

Query  872   KQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             K I    PD + + PM+  RFLV+S+GTGTA +E KY+++EAAKWG+L WL    STPL+
Sbjct  234   KAINREGPDSYRMNPMEYGRFLVLSLGTGTAKSEEKYDAEEAAKWGLLGWLTSDHSTPLV  293

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             +VF +AS+DMVD H S VFQAL   EN YLRIQ              +LTGT SS+DVAT
Sbjct  294   DVFTQASADMVDFHISTVFQALNSEEN-YLRIQ------------DDTLTGTLSSVDVAT  340

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +ENLE LV++GE+LLKKPVSRVNL TGV EPI +  TNE+AL++LAK 
Sbjct  341   KENLENLVKVGEELLKKPVSRVNLATGVFEPI-NKMTNEEALRKLAKL  387



>ref|XP_004979715.1| PREDICTED: patatin-2-Kuras 1-like [Setaria italica]
Length=410

 Score =   444 bits (1143),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 215/392 (55%), Positives = 283/392 (72%), Gaps = 21/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++TVLSIDGGGIRG+IPA I+A+LE +LQELDG DAR+ADYFDVI+GTSTG L+T+ML
Sbjct  23    GKLITVLSIDGGGIRGLIPATIIAFLEAKLQELDGLDARIADYFDVIAGTSTGALLTSML  82

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVFGPKYDGKYLRSLL  1188
              APD+N RPL+ AKD+  FYL NGP IFP+ K G+       + +V GPKYDG +L   +
Sbjct  83    AAPDKNNRPLFTAKDLNTFYLKNGPNIFPEKKAGFLTPAAKLLGAVRGPKYDGVFLHDKI  142

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             K    D+R+ DT+TNV++P FD+K LQPVIFSTY+AK  P  NA+L+D+CI TSAAPTY 
Sbjct  143   KSLTHDVRVADTVTNVIVPAFDVKYLQPVIFSTYEAKHDPLKNAHLADICISTSAAPTYF  202

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKP  828
             PAH+F   +G           +EY++++GGVAANNPT+ A+S +TK++  +NPD  P KP
Sbjct  203   PAHFFTTSDGKGGS-------REYHLVNGGVAANNPTMAAMSMLTKEVLRHNPDFNPGKP  255

Query  827   MDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHN  648
              D   +L+ISIGTG+A  E KY + + AKWG+L WL +   TP+I++F  ASSDMVD+H 
Sbjct  256   SDYRHYLIISIGTGSAKQEEKYTAPQCAKWGLLQWLYNGGFTPIIDIFSHASSDMVDIHA  315

Query  647   SAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLL  468
             + +F+AL  CE +YLRIQ              SLTG  SS+D+ T+EN+E L+ IG +LL
Sbjct  316   AVLFEAL-HCEKNYLRIQ------------DDSLTGDTSSVDITTKENMEALIRIGHELL  362

Query  467   KKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             KKPVSRVN++TG+ EP+   GTNE+AL R AK
Sbjct  363   KKPVSRVNIDTGMYEPVNGEGTNEEALARFAK  394



>ref|XP_007017307.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
 gb|EOY14532.1| Phospholipase A 2A, IIA,PLA2A isoform 1 [Theobroma cacao]
Length=410

 Score =   444 bits (1143),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 246/404 (61%), Positives = 302/404 (75%), Gaps = 23/404 (6%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +E    + Q  T G+++T+LSIDGGGIRGIIP  ILA LE++LQ+LDGEDARLADYFDVI
Sbjct  1     MEGAKDRLQPPTYGDLITILSIDGGGIRGIIPGTILAVLESELQKLDGEDARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVF  1227
             +GTSTGGLVT MLT P+E  RPL+AAKDIK FYLN  PKIFPQ G   F +    I+++ 
Sbjct  61    AGTSTGGLVTGMLTCPNEKNRPLFAAKDIKDFYLNYCPKIFPQPGCPLFAQTSKVIKALS  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKYDGK+L SL+K++L D RL  TLTNVVIPTFDI +LQP IFS+YQ K  P ++A LS
Sbjct  121   GPKYDGKFLHSLVKEKLGDTRLHQTLTNVVIPTFDIHHLQPTIFSSYQVKTKPTLDALLS  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CIGTSAAPTYLPAHYFK ++   Q+G      +EYN+IDGGVAANNPTLVA+ +V+K+
Sbjct  181   DICIGTSAAPTYLPAHYFKTED---QKGNV----REYNLIDGGVAANNPTLVAMGEVSKE  233

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             I   N D FPIKPMD  RFLVIS+GTG+   E K++++EAAKWG+L WL    STPL++V
Sbjct  234   IIKGNADFFPIKPMDYGRFLVISLGTGSRKAEEKFSAQEAAKWGLLGWLTSGGSTPLVDV  293

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F +AS DMVDLH S VF+AL    + YLRIQ              +L+G  SS+DVAT+E
Sbjct  294   FTQASGDMVDLHLSVVFEALH--SDKYLRIQ------------DDTLSGVVSSVDVATKE  339

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             NL +LV++G+ LLKK VSRVNLETG+ EP     TNE+ALKR A
Sbjct  340   NLNELVKVGQALLKKQVSRVNLETGIFEPFSEE-TNEEALKRFA  382



>ref|XP_010429587.1| PREDICTED: patatin-like protein 2 [Camelina sativa]
Length=407

 Score =   444 bits (1142),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 291/405 (72%), Gaps = 21/405 (5%)
 Frame = -3

Query  1589  VKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             ++++   S  Q  T GN+VT+LSIDGGGIRG+IPAVIL +LE++LQ+LDGEDARLADYFD
Sbjct  1     MQMDSPKSPLQPPTYGNLVTILSIDGGGIRGLIPAVILGFLESELQKLDGEDARLADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             V++GTSTGGLVTAMLTAP++ GRPL+AA +IK FYL + PKIFPQ    F      ++S+
Sbjct  61    VVAGTSTGGLVTAMLTAPNKEGRPLFAASEIKEFYLEHCPKIFPQDHFPFSAAKNLVKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDG+YL  L+  +L D +L  TLTNVVIPTFDIK LQP IFS+Y+ K  P  NA L
Sbjct  121   TGPKYDGEYLHQLIHAKLGDTKLNQTLTNVVIPTFDIKRLQPTIFSSYEVKNNPLKNATL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             +D+ I TSAAPTYLPAH+F+ ++            KEYN+IDGGVAANNP LVAI +VT 
Sbjct  181   ADIAISTSAAPTYLPAHFFRTEDSTGNV-------KEYNLIDGGVAANNPALVAIGEVTN  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D FPI+P D  RFLV+S+GTG    E K+N+KE A WG+LSWL H SSTPLI+
Sbjct  234   EITKGSSDFFPIRPNDYGRFLVLSLGTGNHKCEEKFNAKEVAGWGLLSWLTHDSSTPLID  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
              F +ASSDMVD H SAVF+AL   E +Y+RIQ              +L G  +S+D+AT 
Sbjct  294   AFTQASSDMVDFHLSAVFRAL-HSEANYIRIQ------------DDTLIGDAASVDIATV  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             ENL+ L + GE+LLKKPVSRVNL++G +E   +  TN  AL +LA
Sbjct  341   ENLDVLAKTGEELLKKPVSRVNLDSGSNEN-AYQTTNGMALIKLA  384



>ref|XP_006419185.1| hypothetical protein CICLE_v10030450mg, partial [Citrus clementina]
 gb|ESR32425.1| hypothetical protein CICLE_v10030450mg, partial [Citrus clementina]
Length=381

 Score =   443 bits (1140),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 238/401 (59%), Positives = 304/401 (76%), Gaps = 21/401 (5%)
 Frame = -3

Query  1589  VKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             ++I+   S  Q  T GN+VT+LSIDGGGIRGIIPA ILA+LE++LQ+LDGE+AR+ADYFD
Sbjct  1     MEIQTPRSPIQPPTFGNLVTILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             VISGTSTGGLVTAMLTAP+E  RPL+AAKDIK FYLN+ PKIFPQ  G FG     I+S+
Sbjct  61    VISGTSTGGLVTAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  L+K++L D +L +TLTNVVIPTFDIKNLQP IFS+Y+ K+ P ++A L
Sbjct  121   TGPKYDGKYLHRLVKEKLGDKKLHETLTNVVIPTFDIKNLQPTIFSSYEMKQNPSLDASL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+C+ TSAAPTYLPAH F+ ++       +    + +++IDGGVAANNPTLVA+++VTK
Sbjct  181   SDICVATSAAPTYLPAHSFETKD-------STGTVRRFDLIDGGVAANNPTLVALNEVTK  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D + I  MD +RFLVIS+GTG    E KY++ +AAKWG+L WL  +SSTPL++
Sbjct  234   EINRGSSDYYAINAMDYTRFLVISLGTGAPKTEAKYDALKAAKWGVLGWLSSESSTPLVD  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
             VFM++SSDM D H S  F+AL   EN YLRIQ              +LTG ++S+DVAT+
Sbjct  294   VFMQSSSDMTDFHISTAFKAL-HSENGYLRIQ------------DDTLTGDEASVDVATK  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDAL  387
             +NLE LV IGE+LLKKPV++VN ETG+ EP    GTN++AL
Sbjct  341   KNLESLVGIGERLLKKPVTKVNFETGLCEPCGQ-GTNDEAL  380



>ref|XP_004310193.1| PREDICTED: patatin group A-3-like [Fragaria vesca subsp. vesca]
Length=407

 Score =   444 bits (1142),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 246/407 (60%), Positives = 304/407 (75%), Gaps = 23/407 (6%)
 Frame = -3

Query  1583  IERKPS-QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             +ER  S   Q  T GN++TVLSIDGGGIRGIIP  ILA+LE++LQ LDGE+ARLADYFDV
Sbjct  1     MERTSSFAMQPPTFGNLITVLSIDGGGIRGIIPGTILAFLESELQMLDGENARLADYFDV  60

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGW-FGEIWVSIRSV  1230
             ISGTSTGGLVTAMLTAP+EN RPL+AAKDIK FYL + PKIFPQK GW F      I+++
Sbjct  61    ISGTSTGGLVTAMLTAPNENNRPLFAAKDIKDFYLTHSPKIFPQKSGWLFPRARKIIKAL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  L++++L D +L  TLTNVVIP FDIKNLQP IFS+++ K  P  +A L
Sbjct  121   AGPKYDGKYLHGLVREKLGDKKLNQTLTNVVIPAFDIKNLQPAIFSSFEVKNKPTFDALL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+CI TSAAPTYLPAH+FK   G K E       +E+++IDGG+AANNPTLVAI +VTK
Sbjct  181   SDICIATSAAPTYLPAHFFKTN-GLKGE------VREFHLIDGGLAANNPTLVAIGEVTK  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D FPIKPMD  RFLVIS+GTG++  E KYN+  A+KWG+L+WL    STPLI+
Sbjct  234   EIIKGSSDFFPIKPMDYGRFLVISLGTGSSKAELKYNAHVASKWGVLNWLTSGGSTPLID  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
              F +AS+DMVDLH SAVF+AL   E +YLRIQ              +L+G  SS+D+AT+
Sbjct  294   AFSQASADMVDLHLSAVFKAL-HSEKNYLRIQ------------DDTLSGDVSSVDIATQ  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +NL++L+++G  LLK+PVSRVNLETG  E   H  TN +AL+R AK 
Sbjct  341   KNLDRLLKVGNGLLKQPVSRVNLETGKFEACNHE-TNAEALRRFAKL  386



>ref|XP_002460354.1| hypothetical protein SORBIDRAFT_02g026818 [Sorghum bicolor]
 gb|EER96875.1| hypothetical protein SORBIDRAFT_02g026818 [Sorghum bicolor]
Length=373

 Score =   442 bits (1138),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 237/391 (61%), Positives = 294/391 (75%), Gaps = 22/391 (6%)
 Frame = -3

Query  1577  RKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISG  1398
              K    Q  T GN+VT+LSIDGGGIRGIIPAV+L +LE++LQ+LDGE+ARLADYFDV++G
Sbjct  2     EKGKHIQPPTYGNLVTILSIDGGGIRGIIPAVVLTFLESELQKLDGEEARLADYFDVVAG  61

Query  1397  TSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPK  1218
             TSTGGLVT+ML AP+   RPL+AAKDI+ FY+N+ PKIFPQ+ G FG+I    RS+ GP 
Sbjct  62    TSTGGLVTSMLVAPNNTNRPLFAAKDIQAFYMNHAPKIFPQQRGPFGKIMRIFRSLSGPS  121

Query  1217  YDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAK--RCPKMNAYLSD  1044
             YDGKYL  +++K+L   RL +TLT+VVIPTFDIK LQP+IFS+Y+ K  +   M+A LSD
Sbjct  122   YDGKYLHDVVRKKLGITRLHETLTDVVIPTFDIKRLQPIIFSSYEVKNEKYNTMDALLSD  181

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +CI TSAAPTYLPAHYFK ++     G T    KE+++IDGGVAANNP LVAI +VTKQI
Sbjct  182   ICISTSAAPTYLPAHYFKTEDC---HGNT----KEFHLIDGGVAANNPALVAIGEVTKQI  234

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
             F  NPD FPIKPMD  RFLVIS+GTG+A  E  YN+++A  WG+L WLL   STPL+++F
Sbjct  235   FKENPDFFPIKPMDYGRFLVISLGTGSAKFEANYNAQKAKSWGVLGWLLGSGSTPLVDIF  294

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              +AS+DMVD+H SAVF+AL   E +YLRIQ              +L GT SS+DVAT+EN
Sbjct  295   TQASADMVDIHISAVFKAL-HSEQNYLRIQ------------DDTLQGTLSSVDVATKEN  341

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPH  411
             +EKL  +G+ LLKKPVS VNLETG   P  H
Sbjct  342   MEKLARVGDMLLKKPVSHVNLETGHMVPACH  372



>ref|XP_008777430.1| PREDICTED: patatin-like protein 2 [Phoenix dactylifera]
Length=402

 Score =   444 bits (1141),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 225/393 (57%), Positives = 284/393 (72%), Gaps = 24/393 (6%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G +VTVLSIDGGG+RGIIP  ILA+LE++LQ+LDG+DAR+ADYFD+I+GTSTGGLVTAML
Sbjct  16    GRLVTVLSIDGGGVRGIIPGTILAFLESKLQDLDGKDARIADYFDIIAGTSTGGLVTAML  75

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             T P+++ RPL+AAKDI  FYL + PKIFPQK G    I     +V GPKYDGKYL   ++
Sbjct  76    TTPNKDNRPLFAAKDITKFYLEHCPKIFPQKTGILSSITKLFTAVTGPKYDGKYLHLKVR  135

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             + L + RL   LTN+VIP FDIK LQP +FST++A+  P  N  LSD+CI TSAAPTYLP
Sbjct  136   ELLGESRLHQALTNIVIPAFDIKFLQPTVFSTFEARNTPLKNPLLSDICISTSAAPTYLP  195

Query  1004  AHYFKIQ--EGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIK  831
             AHYF+ +  +G KQ          +N++DGGVAANNPTL A+SQ+ K++   N D   IK
Sbjct  196   AHYFETKDAQGNKQ---------SFNLVDGGVAANNPTLAAMSQIAKEVCVENKDFHSIK  246

Query  830   PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLH  651
             P+D S+FLVIS+GTG+A  E K+ ++EA+KWG+L WL     TPLI  F +AS+DMVD+H
Sbjct  247   PVDYSKFLVISLGTGSAKLEEKFTAQEASKWGVLGWLYDSGDTPLINAFTQASADMVDIH  306

Query  650   NSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKL  471
               A+FQAL  C  +YLRIQ              +L G+ SS+DV+T+ENL KLV+IG  L
Sbjct  307   LCAMFQALA-CRENYLRIQ------------DDNLIGSTSSVDVSTKENLLKLVQIGSDL  353

Query  470   LKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             LKK VSRVNLETG+ E +    TNE+AL RLAK
Sbjct  354   LKKHVSRVNLETGLFEEVKGDVTNEEALTRLAK  386



>ref|XP_002451118.1| hypothetical protein SORBIDRAFT_05g024380 [Sorghum bicolor]
 gb|AAD22170.1|AF061282_24 patatin-like protein [Sorghum bicolor]
 gb|EES10106.1| hypothetical protein SORBIDRAFT_05g024380 [Sorghum bicolor]
Length=410

 Score =   444 bits (1141),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 215/393 (55%), Positives = 285/393 (73%), Gaps = 22/393 (6%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++T+LSIDGGGIRG+IPA I+AYLE +LQELDG DAR+ADYFDVI+GTSTG L+T+ML
Sbjct  22    GKLITILSIDGGGIRGLIPATIIAYLEAKLQELDGPDARIADYFDVIAGTSTGALLTSML  81

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVFGPKYDGKYLRSLL  1188
              APD+N RPL+AAKD+  FYL NGPKIFPQ K GW   +   I ++ GPKYDG +L   +
Sbjct  82    AAPDDNNRPLFAAKDLTTFYLENGPKIFPQRKAGWLTPVANLIGTMRGPKYDGVFLHDKI  141

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             K    D+++ DT+TN+++P FD+K LQP+IFSTY+AK     NA+LSD+CI TSAAPTY 
Sbjct  142   KSLTHDVKVADTVTNIIVPAFDVKYLQPIIFSTYEAKTDALKNAHLSDICISTSAAPTYF  201

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPI-K  831
             PAH+FK +        T    +EY+++DGGVAANNPT+VA+S +TK++   NPD   + +
Sbjct  202   PAHFFKTEA-------TGGRSREYHLVDGGVAANNPTMVAMSMLTKEVHRRNPDFNVVGR  254

Query  830   PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLH  651
             P + + +LVIS+GTG+A    KY +++ AKWG++ WL H   TP+I++F  ASSDMVD+H
Sbjct  255   PTEYTNYLVISVGTGSAKQAEKYTAEQCAKWGLIQWLYHGGFTPIIDIFSHASSDMVDIH  314

Query  650   NSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKL  471
              S +FQAL  CE +YLRIQ              SLTG  SS+D+AT+EN+E L+ IG++L
Sbjct  315   ASVLFQAL-HCEKNYLRIQ------------DDSLTGDASSVDIATKENMESLIGIGQEL  361

Query  470   LKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             LKKPV+RVN++TGV E     GTN +AL   AK
Sbjct  362   LKKPVARVNIDTGVYESCSGEGTNAEALAHFAK  394



>ref|XP_006354908.1| PREDICTED: patatin-3-Kuras 1-like [Solanum tuberosum]
Length=409

 Score =   444 bits (1141),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 235/414 (57%), Positives = 304/414 (73%), Gaps = 25/414 (6%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G  +T+LSIDGGGIRG+IPA IL YLE+QLQELDGEDARLADYFD+I+GTSTGGLVTAML
Sbjct  15    GKFITILSIDGGGIRGLIPATILEYLESQLQELDGEDARLADYFDIIAGTSTGGLVTAML  74

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVFGPKYDGKYLRSLL  1188
             TAP+++ RPL+AAKDIKPFYL +GPKIFPQ      G I    R + GPKYDGKYLR ++
Sbjct  75    TAPNKDNRPLFAAKDIKPFYLEHGPKIFPQNNMILIGSIIKGWRFLTGPKYDGKYLREVI  134

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             K++L + +L +TLTNVVIPTFDIKN+QP IFST++AK+  +M+A L D+CIGTSAAPTYL
Sbjct  135   KEKLGETKLHETLTNVVIPTFDIKNIQPTIFSTFEAKKYSRMDAKLFDICIGTSAAPTYL  194

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNP---DLFP  837
             PAH F+ Q    ++G      +E+N+IDG +AANNPT +AI++VTKQIF+  P   +   
Sbjct  195   PAHNFQTQN---EDG----KFQEFNLIDGAIAANNPTFIAINEVTKQIFEQTPYFKNFDE  247

Query  836   IKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVD  657
             +KP +  +FLVISIGTG+A   +KY++K A+ WGI  WL    S P+I+ F +AS+DMVD
Sbjct  248   MKPANYGKFLVISIGTGSAKLVHKYDAKIASNWGIFGWLSDGGSNPIIDAFADASNDMVD  307

Query  656   LHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGE  477
              H S VFQ +   +  YLRIQ              +L+G   S+D++T+EN++KLVEIG 
Sbjct  308   YHISVVFQCVC-SQKQYLRIQ------------DDTLSGEDFSVDISTKENMDKLVEIGT  354

Query  476   KLLKKPVSRVNLETGVSEPIPHS-GTNEDALKRLAKFlsnerrlresrSPVTKR  318
              LLKKPVSRVNL+T + EP+  + GTNE+ALK  AK LS E++ R  + P T +
Sbjct  355   NLLKKPVSRVNLKTCLFEPLGTTGGTNEEALKEFAKLLSEEKKFRNPKVPTTNK  408



>gb|AAM63157.1| similar to latex allergen from Hevea brasiliensis [Arabidopsis 
thaliana]
Length=405

 Score =   444 bits (1141),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 228/397 (57%), Positives = 291/397 (73%), Gaps = 21/397 (5%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T GN+VT+LSIDGGGIRG+IPAVIL +LE++LQ+LDGE+ARLADYFDVI+GTST
Sbjct  6     SPLQPPTYGNLVTILSIDGGGIRGLIPAVILGFLESELQKLDGEEARLADYFDVIAGTST  65

Query  1388  GGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDG  1209
             GGLVTAMLTAP++ GRPL+AA +IK FYL   PKIFPQ    F      ++S+ GPKYDG
Sbjct  66    GGLVTAMLTAPNKEGRPLFAASEIKDFYLEQCPKIFPQDHFPFSAAKKLVKSLTGPKYDG  125

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGT  1029
             KYL  L+  +L D +L+ TLTNVVIPTFDIK+LQP IFS+Y+ K  P  +A L+D+ I T
Sbjct  126   KYLHQLIHAKLGDTKLSQTLTNVVIPTFDIKHLQPTIFSSYEVKNHPLKDATLADIAIST  185

Query  1028  SAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNP  849
             SAAPTYLPAH+FK+++        N   KEYN+IDGGVAANNP L+AI +VT +I   + 
Sbjct  186   SAAPTYLPAHFFKVED-------LNGNAKEYNLIDGGVAANNPALLAIGEVTNEISGGSS  238

Query  848   DLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASS  669
             D FPI+P D  RFLV+S+GTG    E K+N+KE A WG+L+WL H +STP+I+ F +ASS
Sbjct  239   DFFPIRPNDYGRFLVLSLGTGNHKAEEKFNAKEVAGWGLLNWLTHDNSTPIIDAFSQASS  298

Query  668   DMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLV  489
             DMVD H SAVF+AL   E +Y+RIQ              +LTG  +S+D+AT ENL+ L 
Sbjct  299   DMVDFHLSAVFRAL-HSEANYIRIQ------------DDTLTGDAASVDIATVENLDILA  345

Query  488   EIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRL  378
             + G++LLKKPV+RVNL++G +E   +  TNE AL +L
Sbjct  346   KTGDELLKKPVARVNLDSGCNEN-AYETTNEHALIKL  381



>ref|XP_006488152.1| PREDICTED: patatin-05-like [Citrus sinensis]
Length=408

 Score =   443 bits (1140),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 239/406 (59%), Positives = 306/406 (75%), Gaps = 21/406 (5%)
 Frame = -3

Query  1589  VKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             ++I+   S  Q  T GN+VT+LSIDGGGIRGIIPA ILA+LE++LQ+LDGE+AR+ADYFD
Sbjct  1     MEIQTPRSPIQPPTFGNLVTILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             VISGTSTGGLVTAMLTAP+E  RPL+AAKDIK FYLN+ PKIFPQ  G FG     I+S+
Sbjct  61    VISGTSTGGLVTAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  L+K++L D +L +TLTNVVIPTFDIK LQP IFS+ + K+ P ++A L
Sbjct  121   TGPKYDGKYLHHLVKEKLGDKKLHETLTNVVIPTFDIKKLQPTIFSSCEMKQNPSLDASL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+C+ TSAAPTYLPAH F+ ++       +    + +++IDGGVAANNPTLVA+++VTK
Sbjct  181   SDICVATSAAPTYLPAHSFETKD-------STGTVRRFDLIDGGVAANNPTLVALNEVTK  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D + I  MD +RFLVIS+GTG    E KY++ +AAKWG+L WL  +SSTPL++
Sbjct  234   EINRGSSDYYAINAMDYTRFLVISLGTGAPKTEVKYDALKAAKWGVLGWLSSESSTPLVD  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
             VFM++SSDM D H S  F+AL   EN YLRIQ              +LTG ++S+DVAT+
Sbjct  294   VFMQSSSDMTDFHISTAFKAL-HSENGYLRIQ------------DDTLTGDEASVDVATK  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             +NLE LV IGE+LLKKPV++VN ETG+ EP    GTN++AL RLA+
Sbjct  341   KNLESLVGIGERLLKKPVTKVNFETGLCEPCGQ-GTNDEALIRLAE  385



>ref|XP_006285520.1| hypothetical protein CARUB_v10006962mg [Capsella rubella]
 gb|EOA18418.1| hypothetical protein CARUB_v10006962mg [Capsella rubella]
Length=414

 Score =   443 bits (1140),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 223/392 (57%), Positives = 285/392 (73%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G++VT+LS+DGGG+RGII  V+LAYLE QLQELDGEDARLADYFDVI+GTSTGGLVTAML
Sbjct  16    GSLVTILSLDGGGVRGIIAGVVLAYLEKQLQELDGEDARLADYFDVIAGTSTGGLVTAML  75

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             T PD  GRP +AAKDI PFYL + PKIFPQ  G F  +    + + GPKY GKYLR+LL 
Sbjct  76    TVPDGTGRPYFAAKDIVPFYLEHCPKIFPQPSGVFALLPKLPKLLSGPKYSGKYLRNLLS  135

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             K L + +L  TLTNVVIPTFDIK LQP +FS+YQA   P +N  +SD+C+GTSAAPT+ P
Sbjct  136   KLLGEAKLHQTLTNVVIPTFDIKKLQPTVFSSYQALVDPSLNVKVSDICVGTSAAPTFFP  195

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
              HYF  ++    +G T     E+N++DG + ANNPTLVA++ V+KQI  NNPD+  IKP+
Sbjct  196   PHYFSNED---SQGNTT----EFNLVDGAITANNPTLVAMTAVSKQIVKNNPDMGDIKPL  248

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
                +FLVISIGTG+   E KY++K+AAKWGI+SWL    STP++++ ME+S DM+  H+S
Sbjct  249   GYDQFLVISIGTGSTKKEEKYSAKKAAKWGIISWLYDNGSTPILDITMESSRDMIHFHSS  308

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              VF+AL   E+ YLRI               +L G  SSMD+AT+ NLE LV+IGEK+LK
Sbjct  309   VVFKAL-QSEDKYLRID------------DDTLDGNVSSMDLATKSNLENLVKIGEKILK  355

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
               V ++N++TGV EP+  + TN++ LKR AK 
Sbjct  356   NRVVQMNIDTGVYEPVTENVTNDEQLKRYAKI  387



>ref|XP_006408594.1| hypothetical protein EUTSA_v10002000mg [Eutrema salsugineum]
 gb|ESQ50047.1| hypothetical protein EUTSA_v10002000mg [Eutrema salsugineum]
Length=407

 Score =   443 bits (1139),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 231/405 (57%), Positives = 292/405 (72%), Gaps = 21/405 (5%)
 Frame = -3

Query  1589  VKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             +++E   S  Q  T GN+VT+LSIDGGG+RGIIPA ILA+LE++LQ+LDGE+ARLADYFD
Sbjct  1     MEMESPKSPLQPPTYGNLVTILSIDGGGVRGIIPATILAFLESELQKLDGEEARLADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             V++GTSTGGLVTAMLTAP++ GRPL+AA +IK FYL + PKIFPQ    F      ++S+
Sbjct  61    VMAGTSTGGLVTAMLTAPNKEGRPLFAASEIKDFYLEHCPKIFPQDHFPFSAAKNLVKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDG+YL  L+  +L + RL  TLTNVVIPTFDIK+LQP IFS+Y+ K     NA L
Sbjct  121   TGPKYDGEYLHQLIHAKLGETRLHQTLTNVVIPTFDIKHLQPTIFSSYEVKNNSLKNATL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             +D+ I TSAAPTYLPAH+FK Q             KEYN+IDGGVAANNP LVAI +VTK
Sbjct  181   ADIAISTSAAPTYLPAHFFKTQNSAGN-------VKEYNLIDGGVAANNPALVAIGEVTK  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + + FPI+P D  RFLV+S+GTG    E K+N+KE A WG+LSWL H +STPLI+
Sbjct  234   EITRGSSEFFPIRPNDYGRFLVLSLGTGNRKAEEKFNAKEVAGWGMLSWLTHDNSTPLID  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
              FM+ASSDMVD H S+VF+AL   E +Y+RIQ              +L G  +S+D+AT 
Sbjct  294   AFMQASSDMVDFHLSSVFRAL-HSEANYIRIQ------------DDTLNGDAASVDIATV  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             ENL  L +IG+++LKK VSRVNLE+G +E   +  TNE AL +LA
Sbjct  341   ENLNILAKIGDEILKKVVSRVNLESGSNEN-AYEVTNEKALIKLA  384



>ref|XP_002282597.1| PREDICTED: patatin-like protein 2 isoform X1 [Vitis vinifera]
 emb|CBI19546.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   443 bits (1140),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 243/402 (60%), Positives = 301/402 (75%), Gaps = 23/402 (6%)
 Frame = -3

Query  1568  SQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTST  1389
             S  Q  T GN++T+LSIDGGGIRGIIP  +L +LE++LQ+LDGEDAR++DYFDVI+GTST
Sbjct  7     SPLQPPTYGNLITILSIDGGGIRGIIPGTVLGFLESELQKLDGEDARISDYFDVIAGTST  66

Query  1388  GGLVTAMLTAPDEN-GRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVFGPKY  1215
             GGLVTAMLT P+EN GRPL++AKDIK FYL +GPKIFPQ        +   + ++ GPKY
Sbjct  67    GGLVTAMLTTPNENTGRPLFSAKDIKDFYLEHGPKIFPQHSHDPIPRVTKVVTALSGPKY  126

Query  1214  DGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCI  1035
             DGKYL +L+K++L + RL  TLTNVVIPTFDIK LQP IFSTYQ K  P ++A LSD+CI
Sbjct  127   DGKYLHNLVKEKLGETRLHQTLTNVVIPTFDIKRLQPTIFSTYQVKSRPCLDALLSDICI  186

Query  1034  GTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDN  855
             GTSAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNPTLVAI +VTK+I   
Sbjct  187   GTSAAPTYLPAHYFETKDPAGRV-------REFNLIDGGVAANNPTLVAIGEVTKEIIRG  239

Query  854   NPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEA  675
             +PD FPIKPMD  RFLVIS+GTG++  E KYN+ EAAKWG+L WL    STPL++VF +A
Sbjct  240   SPDFFPIKPMDYGRFLVISLGTGSSKAEEKYNADEAAKWGLLGWLTSGGSTPLVQVFTQA  299

Query  674   SSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEK  495
             S+DMVDLH S  FQAL   E SYLRIQ              +L+G  SS+D+AT+ENL+ 
Sbjct  300   SADMVDLHLSEAFQAL-HSEKSYLRIQ------------DDTLSGITSSVDIATKENLDD  346

Query  494   LVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LV+IGE+LLKK VSRVNL+TG+ EP  H  TNE+AL    + 
Sbjct  347   LVKIGEELLKKRVSRVNLDTGIFEPSNHE-TNEEALTSFTRL  387



>ref|XP_006663045.1| PREDICTED: patatin-2-Kuras 1-like [Oryza brachyantha]
Length=411

 Score =   443 bits (1139),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 223/403 (55%), Positives = 285/403 (71%), Gaps = 20/403 (5%)
 Frame = -3

Query  1577  RKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISG  1398
             R P  T     G ++TVLSIDGGGIRG+IPA ILA LE +LQELDG +AR+ADYFDVI+G
Sbjct  12    RVPEPTPPPCQGRLITVLSIDGGGIRGLIPATILACLEAKLQELDGPEARIADYFDVIAG  71

Query  1397  TSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVFGP  1221
             TSTG L+T+MLTAPDEN RPL+AA D+  FYL NGPKIFPQ K G+   +   +  V+GP
Sbjct  72    TSTGALITSMLTAPDENRRPLFAAADLNTFYLENGPKIFPQRKAGFLTPLVNMMGVVWGP  131

Query  1220  KYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDV  1041
             KYDG +L   +K    D+ + DT+TN+V+P FD+K LQP+IFSTY+A+  P  NA+LSD+
Sbjct  132   KYDGSFLHDKIKSLTHDVAIADTVTNIVVPAFDVKRLQPIIFSTYEAQGDPLKNAHLSDI  191

Query  1040  CIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIF  861
             CI TSAAPTY PAH+F+I +    E      P+E+++IDGGVAANNPT+VA+S +++++ 
Sbjct  192   CISTSAAPTYFPAHFFQIPDPAGGE------PREFHLIDGGVAANNPTMVAMSMISREVL  245

Query  860   DNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFM  681
               N D    KP D   +LVISIGTGTA    KY + E AKWG+L WL     TPLI++F 
Sbjct  246   RQNQDFKLGKPADYRHYLVISIGTGTAKIAQKYTAPECAKWGVLRWLYDGGFTPLIDIFT  305

Query  680   EASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENL  501
              AS+DMVD+H S +FQ+L  CE SYLRIQ              SL G  SS+D+AT+EN+
Sbjct  306   HASADMVDIHASVLFQSLC-CEQSYLRIQ------------DDSLEGHTSSVDIATKENM  352

Query  500   EKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             E L+ IG+ LLKKPV+RVN++TGV E +   GTNE+AL R AK
Sbjct  353   EALIGIGKGLLKKPVARVNIDTGVHEAVDGEGTNEEALARFAK  395



>ref|XP_009410116.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=413

 Score =   443 bits (1139),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 213/391 (54%), Positives = 292/391 (75%), Gaps = 20/391 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++TVLSIDGGG+RG+IP  I+++LE++LQELDG DAR+ADYFDVI+GTSTGGL+TAM+
Sbjct  27    GKLITVLSIDGGGVRGLIPGTIISFLESKLQELDGPDARIADYFDVITGTSTGGLLTAMI  86

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             TAP+EN RP+++AK++  FYL N PKIFPQ  G+   +     ++ GPKYDGK+L + +K
Sbjct  87    TAPNENNRPMFSAKEVIDFYLENSPKIFPQAKGFLSSVTKLAGAIMGPKYDGKFLHTKVK  146

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
               L + +L+ TLTNV+IPTFDIK LQPVIFS+++A+     +A+L+D+CI TSAAPTYLP
Sbjct  147   DLLTETKLSQTLTNVIIPTFDIKLLQPVIFSSFEARLAAVKDAHLADICISTSAAPTYLP  206

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AHYF+ ++       ++   + YN+IDGG+AANNPTLVA+SQ+ K+I   N D    K +
Sbjct  207   AHYFETKD-------SDGNTRSYNLIDGGIAANNPTLVAMSQIKKEIALMNKDFANFKSI  259

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D   F+VISIGTG+A  E K+++  A+KWG+L WL H  STPLI+ F + S+D+VD+H S
Sbjct  260   DYHNFIVISIGTGSAKIEQKFSADLASKWGVLQWLYHGGSTPLIDSFFQGSADVVDIHMS  319

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
             ++FQ+L +CE +YLRIQ              +L G +SS+DV+T+ENL++LV+IG+ LLK
Sbjct  320   SLFQSL-NCEKNYLRIQ------------DDTLVGERSSVDVSTKENLQELVQIGKNLLK  366

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             KPVSRVNLETG+ E +   GTN DAL  LA+
Sbjct  367   KPVSRVNLETGIFEELDGEGTNADALTHLAQ  397



>ref|XP_006473887.1| PREDICTED: patatin-05-like [Citrus sinensis]
Length=408

 Score =   443 bits (1139),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 239/406 (59%), Positives = 306/406 (75%), Gaps = 21/406 (5%)
 Frame = -3

Query  1589  VKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             ++I+   S  Q  T GN++T+LSIDGGGIRGIIPA ILA+LE++LQ+LDGE+AR+ADYFD
Sbjct  1     MEIQSPRSPIQPPTFGNLITILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             VISGTSTGGLVTAMLTAP+E  RPL+AAKDIK FYLN+ PKIFPQ  G FG     I+S+
Sbjct  61    VISGTSTGGLVTAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  L+K++L + +L +TLTNVVIPTFDIK LQP IFS+ + K+ P ++A L
Sbjct  121   TGPKYDGKYLHRLVKEKLGNKKLHETLTNVVIPTFDIKKLQPTIFSSCEMKQNPSLDASL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+CI TSAAPTYLPAH F+ ++       +    + +++IDGGVAANNPTLVA+++VTK
Sbjct  181   SDICIATSAAPTYLPAHTFETKD-------STGKVRRFDLIDGGVAANNPTLVALNEVTK  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D + I  MD +RFLVIS+GTG    E KY++ +AAKWG+L WL  +SSTPL++
Sbjct  234   EINRGSSDYYAINAMDYTRFLVISLGTGAPKTEVKYDALKAAKWGVLGWLSSESSTPLVD  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
             VFM++SSDM D H S  F+AL   EN YLRIQ              +LTG ++S+DVAT+
Sbjct  294   VFMQSSSDMTDFHISTAFKAL-HSENGYLRIQ------------DDTLTGDEASVDVATK  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             +NLE LV IGE+LLKKPV++VN ETG+ EP    GTNE+AL RLA+
Sbjct  341   KNLESLVGIGERLLKKPVTKVNFETGLCEPYGQ-GTNEEALIRLAE  385



>ref|XP_010101003.1| Patatin group A-3 [Morus notabilis]
 gb|EXB86651.1| Patatin group A-3 [Morus notabilis]
Length=411

 Score =   443 bits (1139),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 250/425 (59%), Positives = 313/425 (74%), Gaps = 27/425 (6%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ER  S  Q+ T GN++TVLSIDGGGIRGIIPA++L +LE++LQ+LDGEDAR+ADYFDVI
Sbjct  1     MERARSFLQSPTYGNVITVLSIDGGGIRGIIPAIVLGFLESELQKLDGEDARIADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQK----GGWFGEIWVSIR  1236
             +GTSTGGLVTAML AP+E  RPL+AAKDIK FYL + PKIFPQ      G   EI   I+
Sbjct  61    AGTSTGGLVTAMLAAPNEKNRPLFAAKDIKNFYLQHCPKIFPQDSIPLAGRATEI---IK  117

Query  1235  SVFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNA  1056
             S+ GPKYDGKYL  LLK++L D++L  TLTNV+IPTFDIK LQP+IFS+Y+ KR P ++A
Sbjct  118   SLTGPKYDGKYLHKLLKEKLGDLKLHQTLTNVIIPTFDIKRLQPIIFSSYEVKRNPSLDA  177

Query  1055  YLSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQV  876
              LSD+CIGTSAAPTYLPAH F        E       +E+++IDGGVAANNP LVA++++
Sbjct  178   LLSDICIGTSAAPTYLPAHCF------NTENSNGEVVREFHIIDGGVAANNPALVAVNEI  231

Query  875   TKQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPL  696
              K+I   NPD  PIKPM+  RFLVIS+GTG+  +  KYN+ EAAKWGI+ WL    STPL
Sbjct  232   AKEIHQGNPDFSPIKPMEFGRFLVISLGTGSPKSVEKYNADEAAKWGIIGWLNSHHSTPL  291

Query  695   IEVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVA  516
              ++F EASSD+VD   + VFQAL   +N YLRIQ              +L  T+SS+D+A
Sbjct  292   ADIFTEASSDLVDFFLATVFQALHSDKN-YLRIQ------------DDTLGYTESSVDMA  338

Query  515   TEENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresr  336
             TEENL  LV+IGE LLKK +SRVNL++G+ E   H  TNE+AL+R+A+ LS ER  RE+R
Sbjct  339   TEENLGNLVKIGEALLKKSISRVNLDSGIYETF-HETTNEEALRRVARMLSRERMTREAR  397

Query  335   SPVTK  321
             SP+ K
Sbjct  398   SPIRK  402



>ref|XP_010417357.1| PREDICTED: patatin-like protein 2 [Camelina sativa]
Length=407

 Score =   442 bits (1138),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 230/405 (57%), Positives = 292/405 (72%), Gaps = 21/405 (5%)
 Frame = -3

Query  1589  VKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             ++++   S  Q  T GN+VT+LSIDGGGIRG+IPAVIL +LE++LQ+LDGEDARLADYFD
Sbjct  1     MQMDSPKSPLQPPTYGNLVTILSIDGGGIRGLIPAVILGFLESELQKLDGEDARLADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             V++GTSTGGLVTAMLTAP++ GRPL+AA +IK FYL   PKIFPQ    F      ++S+
Sbjct  61    VVAGTSTGGLVTAMLTAPNKEGRPLFAASEIKEFYLEQCPKIFPQDHFPFSAAKNLVKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDG+YL  L+  +L D +L  TLTNVVIPTFDIK+LQP IFS+Y+ K  P  NA L
Sbjct  121   TGPKYDGEYLHQLIHAKLGDTKLNQTLTNVVIPTFDIKHLQPTIFSSYEVKNNPLKNATL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             +D+ I TSAAPTYLPAH+F+ ++            KEYN+IDGGVAANNP LVAI +VT 
Sbjct  181   ADIAISTSAAPTYLPAHFFRTEDSTGNV-------KEYNLIDGGVAANNPALVAIGEVTN  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D FPI+P D  RFLV+S+GTG+   E K+N+KE A WG+LSWL H +STPLI+
Sbjct  234   EITRGSSDFFPIRPNDYGRFLVLSLGTGSHKCEEKFNAKEVAGWGLLSWLTHDNSTPLID  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
              F +ASSDMVD H SAVF+AL   E +Y+RIQ              +L G  +S+D+AT 
Sbjct  294   AFTQASSDMVDFHLSAVFRAL-HSEPNYIRIQ------------DDTLNGDAASVDIATV  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             ENL+ L + GE+LLKKPVSRVNL++G +E   +  TN  AL +LA
Sbjct  341   ENLDILAKTGEELLKKPVSRVNLDSGSNEN-AYQTTNGMALIKLA  384



>ref|XP_010101001.1| Patatin group A-3 [Morus notabilis]
 gb|EXB86649.1| Patatin group A-3 [Morus notabilis]
Length=408

 Score =   442 bits (1138),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 249/421 (59%), Positives = 316/421 (75%), Gaps = 20/421 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ER  S  Q+ T GN++TVLSIDGGGIRGIIP +IL+ LE +LQ+LDGEDARLADYFDVI
Sbjct  1     MERARSFLQSPTYGNVITVLSIDGGGIRGIIPGIILSCLEAELQKLDGEDARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             +GTSTGGLVTAMLTAP+E+ RP +AAKDIK FYL + PKIFPQ+         +++++ G
Sbjct  61    AGTSTGGLVTAMLTAPNEDTRPRFAAKDIKDFYLQHCPKIFPQESFPLAGAAETLKAMMG  120

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             PKYDGKYL +LL+++L D+RL  TLTNVVIPTFDIK LQP IFS+Y+ K+ P ++A LSD
Sbjct  121   PKYDGKYLHNLLREKLGDLRLHQTLTNVVIPTFDIKRLQPTIFSSYEVKKNPSLDALLSD  180

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             +C GTSAAPTYLPAH F+  +   Q        +E+++IDGGVAANNP LVAI++V+K+I
Sbjct  181   ICTGTSAAPTYLPAHRFETSDSSGQ-------VREFHLIDGGVAANNPALVAINEVSKEI  233

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                N D FPIKP D  RFLVIS+GTG+   + KY++KEAAKWG+L WL   +S+PL+++F
Sbjct  234   HQGNNDFFPIKPTDYGRFLVISLGTGSPKADEKYDAKEAAKWGVLGWLNSHNSSPLVDIF  293

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              +ASSD+VD   S VFQAL   E +YLRIQ              +L+   SS+D+AT+EN
Sbjct  294   TQASSDLVDFFLSTVFQAL-HSEKNYLRIQ------------DDTLSEKVSSVDIATKEN  340

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVT  324
             L +LV++GE LLKKPVSRVNLETGV EP  H  TNE+AL R+A  LS ER+ RE+RSP+ 
Sbjct  341   LNELVKVGEALLKKPVSRVNLETGVCEPSHHHVTNEEALIRVAGILSRERKAREARSPIG  400

Query  323   K  321
             K
Sbjct  401   K  401



>ref|XP_006434817.1| hypothetical protein CICLE_v10003658mg [Citrus clementina]
 gb|ESR48057.1| hypothetical protein CICLE_v10003658mg [Citrus clementina]
Length=408

 Score =   442 bits (1138),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 239/406 (59%), Positives = 306/406 (75%), Gaps = 21/406 (5%)
 Frame = -3

Query  1589  VKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             ++I+   S  Q  T GN+VT+LSIDGGGIRGIIPA ILA+LE++LQ+LDGE+AR+ADYFD
Sbjct  1     MEIQTPRSPIQPPTFGNLVTILSIDGGGIRGIIPATILAFLESELQKLDGEEARIADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             +ISGTSTGGLVTAMLTAP+E  RPL+AAKDIK FYLN+ PKIFPQ  G FG     I+S+
Sbjct  61    MISGTSTGGLVTAMLTAPNEQNRPLFAAKDIKEFYLNHCPKIFPQSSGPFGPATKLIKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  L+K++L + +L +TLTNVVIPTFDIK LQP IFS+ + K+ P ++A L
Sbjct  121   TGPKYDGKYLHRLVKEKLGNKKLHETLTNVVIPTFDIKKLQPTIFSSCEMKQNPSLDASL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+CI TSAAPTYLPAH F+ ++   +        + +++IDGGVAANNPTLVA+++VTK
Sbjct  181   SDICIATSAAPTYLPAHTFETKDSTGKV-------RRFDLIDGGVAANNPTLVALNEVTK  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D + I  MD +RFLVIS+GTG    E KY++ +AAKWG+L WL  +SSTPL++
Sbjct  234   EINRGSSDYYAINAMDYTRFLVISLGTGAPKTEVKYDALKAAKWGVLGWLSSESSTPLVD  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
             VFM++SSDM D H S  F+AL   EN YLRIQ              +LTG Q+S+DVAT+
Sbjct  294   VFMQSSSDMTDFHISTAFKAL-HSENGYLRIQ------------DDTLTGDQASVDVATK  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             +NLE LV IGE+LLKKPV++VN ETG+ EP    GTN++AL RLA+
Sbjct  341   KNLESLVGIGERLLKKPVTKVNFETGLCEPCGQ-GTNDEALIRLAE  385



>ref|XP_009367381.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=397

 Score =   442 bits (1136),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 226/394 (57%), Positives = 290/394 (74%), Gaps = 22/394 (6%)
 Frame = -3

Query  1550  TGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTA  1371
             T   ++TVLSIDGGGIRG+IPA IL +LE++LQ+LDGEDAR+ADYFDVI+GTSTGGLVTA
Sbjct  4     TSRKLITVLSIDGGGIRGLIPATILGFLESELQKLDGEDARIADYFDVIAGTSTGGLVTA  63

Query  1370  MLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSL  1191
             MLT P+EN RPL+AAKD+K FYL+  PKIFPQK  WF      ++++ GPKY+GKYL  L
Sbjct  64    MLTTPNENDRPLFAAKDLKDFYLSECPKIFPQK-IWFPYTRKIMKALTGPKYNGKYLHGL  122

Query  1190  LKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTY  1011
             ++++L + +L +TLTNVVIPTFDI+NLQPV+FS+ + ++ P  +A LSD+CI TSAAPTY
Sbjct  123   IRQKLGNNKLHNTLTNVVIPTFDIRNLQPVVFSSCRVEKKPCTDALLSDICIATSAAPTY  182

Query  1010  LPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIK  831
             LPAHYF+ +             +EYN+IDGGVAANNPT VAI +V  +I   N D+ P+K
Sbjct  183   LPAHYFETKYAAGT-------VREYNLIDGGVAANNPTFVAICEVVNEIEKENSDIVPVK  235

Query  830   PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLH  651
              +D  RFLVIS+GTG++  E +Y++  AAKWG+L+WL    STP+I+VF +AS+DMVDLH
Sbjct  236   RVDYGRFLVISLGTGSSKAEREYHASAAAKWGLLNWLTSGGSTPIIDVFSQASADMVDLH  295

Query  650   NSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKL  471
              S VFQA    EN YLRIQ              +L GT SS+DVAT++NL  LV++GE L
Sbjct  296   LSGVFQAFNSEEN-YLRIQ------------DDTLHGTISSVDVATKKNLANLVKVGEGL  342

Query  470   LKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LK+PVSRVNL++G  E   H  TN +AL R AK 
Sbjct  343   LKQPVSRVNLDSGRFEASKHE-TNAEALTRFAKL  375



>emb|CDP01337.1| unnamed protein product [Coffea canephora]
Length=407

 Score =   442 bits (1136),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 246/405 (61%), Positives = 305/405 (75%), Gaps = 22/405 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +E   S  Q  T GN +T+LSIDGGGIRGIIP VIL +LE++LQ+LDGEDARLADYFDVI
Sbjct  1     MESYRSFLQPPTYGNSITILSIDGGGIRGIIPGVILGFLESELQKLDGEDARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVF  1227
             SGTSTGGLVTAML AP++  RPL+AAK+IK FYL+N P+IFPQ+     G+    I++V 
Sbjct  61    SGTSTGGLVTAMLAAPNDKNRPLFAAKEIKDFYLDNCPQIFPQETHLMLGQAEKLIKAVT  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKYDGKYL +LLK++L + +L  TLTNVVIPTFDIK LQP IFS+Y  K  P ++A L 
Sbjct  121   GPKYDGKYLHNLLKQKLGETKLHQTLTNVVIPTFDIKLLQPTIFSSYALKHHPSLDALLR  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CIGTSAAPTYLPAH F+ ++       ++   KE+N+IDGGVAANNP LVA++ VTK+
Sbjct  181   DICIGTSAAPTYLPAHKFETED-------SDGSVKEFNLIDGGVAANNPALVAMNHVTKE  233

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             +   NPD F I+  + SRFLV+S+GTGTA  E KY++++AAKWGIL WL    STPL++V
Sbjct  234   VSQGNPDFFSIRSQEYSRFLVLSLGTGTAKEEGKYDAEQAAKWGILGWLTSGGSTPLVDV  293

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F +ASSDMVD H S VFQ L   EN YLRIQ              +LTG  +S+DVATEE
Sbjct  294   FSQASSDMVDFHLSTVFQTLQSEEN-YLRIQ------------DDTLTGDLASVDVATEE  340

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             NL+ LV++GE LLKKPVSR+NLETGV EP+ + GTNE+ALKRLA+
Sbjct  341   NLQNLVKVGENLLKKPVSRINLETGVFEPL-NKGTNEEALKRLAE  384



>ref|XP_004291128.1| PREDICTED: patatin group A-3-like [Fragaria vesca subsp. vesca]
Length=434

 Score =   443 bits (1139),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 239/404 (59%), Positives = 299/404 (74%), Gaps = 21/404 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +ER  S  Q+ T GN+VTVLSIDGGGIRGIIP  +L++LE++LQ+LDGEDARLADYFDVI
Sbjct  1     MERARSFLQSPTYGNLVTVLSIDGGGIRGIIPGTMLSFLESELQKLDGEDARLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVF  1227
             +GTSTGGLVTAMLTAPDEN RPL+AAKDI  FYL + PK+FPQ      GE    +++V 
Sbjct  61    AGTSTGGLVTAMLTAPDENNRPLFAAKDINDFYLEHCPKMFPQHSTPLIGEAVEMLKAVK  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKY+GKYL  ++K++L D+ L  TLTNV+IPTFDIK LQP+IFS+Y+ K+   +NA LS
Sbjct  121   GPKYNGKYLHDIVKEKLGDVTLNKTLTNVIIPTFDIKRLQPIIFSSYEVKKKDSLNALLS  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CI TSAAPTYLPAH+F+ ++    E       +E+++IDGGVAANNP LVA+S+VTK+
Sbjct  181   DICIATSAAPTYLPAHHFQTKDCSTGEA------REFDLIDGGVAANNPALVALSEVTKE  234

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             I   NPD FPIKP +  RFLVIS+GTG+A  E KY +  A +WG+L WL    S PL++V
Sbjct  235   IHQGNPDFFPIKPNEYGRFLVISLGTGSAKCEEKYEATNAGRWGVLGWLTGGGSCPLVDV  294

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F +ASSDMVD H S VFQAL   E +YLRIQ              +L  T  S+D+AT E
Sbjct  295   FTQASSDMVDYHLSTVFQAL-HSEKNYLRIQ------------DDTLEKTVCSVDIATHE  341

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             NL  LV++GE+LLKKPVSRVN+ETG+ EP  H  TNE+AL R+A
Sbjct  342   NLNNLVKVGEELLKKPVSRVNMETGMFEP-AHQSTNEEALVRVA  384



>ref|XP_008384958.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=397

 Score =   441 bits (1135),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 228/394 (58%), Positives = 287/394 (73%), Gaps = 22/394 (6%)
 Frame = -3

Query  1550  TGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTA  1371
             T   ++TVLSIDGGGIRG+IPA IL +LE++LQ+LDGEDAR+ADYFDVI+GTSTGGLVTA
Sbjct  4     TSRKLITVLSIDGGGIRGLIPATILGFLESELQKLDGEDARIADYFDVIAGTSTGGLVTA  63

Query  1370  MLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSL  1191
             MLT P+EN RPL+AA+DIK FYL   PKIFPQK  W       ++++ GPKYDGKYL  L
Sbjct  64    MLTTPNENDRPLFAAEDIKDFYLXECPKIFPQK-IWLPYTRKIMKALTGPKYDGKYLHGL  122

Query  1190  LKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTY  1011
             ++++L + +L +TLTNVVIPTFDI+NLQPV+FS+ + ++ P  +A LSD+CI TSAAPTY
Sbjct  123   IRQKLGNNKLHBTLTNVVIPTFDIRNLQPVVFSSLRVEKKPCTDALLSDICIATSAAPTY  182

Query  1010  LPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIK  831
             LPAHYF+ +             +EYN+IDGGVAANNPT VAI +V  +I   N D+ P+K
Sbjct  183   LPAHYFETKYAAGT-------VREYNLIDGGVAANNPTFVAICEVMNEIEKENSDIVPVK  235

Query  830   PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLH  651
               D  RFLVIS+GTG++  E KY +  AAKWG+L+WL    STP+I+VF +AS+DMVDLH
Sbjct  236   XXDYGRFLVISLGTGSSKAERKYXAPAAAKWGLLNWLTSGGSTPIIDVFSQASADMVDLH  295

Query  650   NSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKL  471
              S VFQAL   EN YLRIQ              +L GT SS+DVAT++NL  LV++GE L
Sbjct  296   LSGVFQALNSEEN-YLRIQ------------DDTLHGTVSSVDVATKKNLANLVKVGEGL  342

Query  470   LKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LK+PVSRVNL++G  E   H  TN +AL R AK 
Sbjct  343   LKQPVSRVNLDSGRFEASNHE-TNAEALTRFAKL  375



>ref|XP_009393655.1| PREDICTED: patatin-like protein 2 [Musa acuminata subsp. malaccensis]
Length=414

 Score =   442 bits (1137),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 213/391 (54%), Positives = 289/391 (74%), Gaps = 20/391 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++TVLSIDGGG+RG+IP  +LA+LE +LQELDG DAR+ADYFDVI+GTSTGGL++AM+
Sbjct  28    GKLITVLSIDGGGVRGLIPGTVLAFLELKLQELDGPDARIADYFDVITGTSTGGLLSAMI  87

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             T+PDEN RPL++A  +  FYL N PKIFPQ  G F  +   + ++ GPKYDGK+L S +K
Sbjct  88    TSPDENKRPLFSANQVIDFYLENSPKIFPQGSGMFSSLTKLVSAIRGPKYDGKFLHSKVK  147

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             + L + +L++TLTNV+IPTFDIK LQPVIFS+++A+  P  NA+L+D+CI TSAAPTYLP
Sbjct  148   QLLTETKLSETLTNVIIPTFDIKLLQPVIFSSFEARHSPLKNAHLADICISTSAAPTYLP  207

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AHYF+  +       ++     YN+IDGG+AANNPTLVA+SQ+ K+I   N +    K +
Sbjct  208   AHYFETTD-------SDGKSHSYNLIDGGIAANNPTLVAMSQIKKEIALTNKNFANFKSI  260

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  +F++ISIGTG+A  E K+++  A+KWG+L WL H  S PLI+ F + S+D+VD+H S
Sbjct  261   DYHKFIIISIGTGSAKVEQKFSAHLASKWGVLQWLYHGGSNPLIDSFFQGSADVVDIHMS  320

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
             ++FQ+L +CE +YLRIQ              +L G +SS+DV+T+ENL +LV+IG+ LL 
Sbjct  321   SLFQSL-NCEKNYLRIQ------------DDTLMGERSSVDVSTKENLLELVQIGKNLLN  367

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             K VSRVNLETG+ + I   GTN DAL +LAK
Sbjct  368   KKVSRVNLETGIFQEIDEEGTNADALTQLAK  398



>ref|XP_011038246.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   441 bits (1135),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 243/408 (60%), Positives = 302/408 (74%), Gaps = 21/408 (5%)
 Frame = -3

Query  1592  MVKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYF  1413
             M  ++   S  Q  T GN +TVLSIDGGGIRGIIP  ILA+LE++LQ+LDG DARLADYF
Sbjct  1     MANMQTPRSPLQLPTRGNHITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYF  60

Query  1412  DVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRS  1233
             DVISGTSTGGLVTAML AP++  RPL+AAKDI  FYL N PKIFPQ    F      +++
Sbjct  61    DVISGTSTGGLVTAMLAAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSKFASAANLVKT  120

Query  1232  VFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAY  1053
             + GPKYDGK+L S++K++L D  L  TLTN+VIPTFDIK+LQP IFS+Y+ K  P  +  
Sbjct  121   LRGPKYDGKFLHSIVKEKLGDTWLQQTLTNIVIPTFDIKHLQPTIFSSYKVKNNPSTDVL  180

Query  1052  LSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVT  873
             LSD+CIGTSAAPTYLPAHYF+ ++   +        +++N+IDGGVAANNPTLVAIS+V+
Sbjct  181   LSDICIGTSAAPTYLPAHYFETKDPSGK-------VRDFNLIDGGVAANNPTLVAISEVS  233

Query  872   KQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             K I    PD + + PM+  RFLV+S+GTGTA +E KY+++EAA+WG+L WL    STPL+
Sbjct  234   KAINREGPDSYHMNPMEYGRFLVLSLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLV  293

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             +VF +AS DMVD H S VFQAL   EN YLRIQ              +LTGT SS+DVAT
Sbjct  294   DVFTQASGDMVDFHISTVFQALSSEEN-YLRIQ------------DDTLTGTLSSVDVAT  340

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +ENLE LV++GE+LLKKPVSRVNL TGV EPI +  TNE+AL++LAK 
Sbjct  341   KENLENLVKVGEELLKKPVSRVNLATGVFEPI-NKMTNEEALRKLAKL  387



>ref|XP_004979713.1| PREDICTED: patatin-3-Kuras 1-like [Setaria italica]
Length=408

 Score =   441 bits (1135),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 213/393 (54%), Positives = 283/393 (72%), Gaps = 21/393 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++TVLSIDGGGIRG+IPA I+A LE +LQELDG DAR+ADYFDVI+GTSTG L+T+ML
Sbjct  21    GRLITVLSIDGGGIRGLIPATIIACLEAKLQELDGPDARIADYFDVIAGTSTGALLTSML  80

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVFGPKYDGKYLRSLL  1188
              APDEN RPLYAAKD+  FYL NGPKIFPQ K GW       + ++ GPKYDG +L   +
Sbjct  81    AAPDENKRPLYAAKDLTTFYLENGPKIFPQRKLGWLTSAMNLVGTMRGPKYDGVFLHDKI  140

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             K    D+R+ DT+TNVV+P FD+K LQPVIF+TY+AK  P  NA+LSD+CI TSAAPTY 
Sbjct  141   KSLTHDVRVADTVTNVVVPAFDVKFLQPVIFTTYEAKADPLKNAHLSDICISTSAAPTYF  200

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKP  828
             PAH+F   +G           +EY+++DGGVAANNPT++A+S +TK++   NPD  P KP
Sbjct  201   PAHFFTTDDGKGGS-------REYHLVDGGVAANNPTMIAMSMLTKEVLRRNPDFNPGKP  253

Query  827   MDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHN  648
              +   +L+IS+GTG+A    KY + + AKWG++ WL     TP+I++F  AS+DMVD+H 
Sbjct  254   TEYRNYLIISVGTGSAKLAEKYTAPQCAKWGLIQWLYEGGFTPIIDIFSHASADMVDIHA  313

Query  647   SAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLL  468
             + +F++L  C+ +YLRIQ              SLTG  SS+D+AT+EN+E L+ IG++LL
Sbjct  314   AVLFESL-HCQKNYLRIQ------------DDSLTGDASSVDIATKENMEALIGIGKELL  360

Query  467   KKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +KPV+RVN++TG+ E +   GTNEDAL R A+ 
Sbjct  361   RKPVARVNIDTGMYEAVAGEGTNEDALARFARM  393



>gb|KFK30333.1| hypothetical protein AALP_AA7G248300 [Arabis alpina]
Length=411

 Score =   442 bits (1136),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 223/392 (57%), Positives = 284/392 (72%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             GN+VT+LS+DGGG+RGII  VILAYLE QLQELDGED RLADYFDV++GTSTGGL+TAML
Sbjct  16    GNLVTILSLDGGGVRGIIAGVILAYLEKQLQELDGEDMRLADYFDVVAGTSTGGLMTAML  75

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             T PDE GRP +AAKDI P YL + PKIFPQ  G F  +    + + GPKYDGKYL++LL 
Sbjct  76    TVPDETGRPQFAAKDIVPVYLEHSPKIFPQPEGLFARLPKLPKLLSGPKYDGKYLKNLLS  135

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             K L + +L  TLTN+VIPTFDIK LQP IFS+YQ+   P ++  LSD+CIGTSAAPT+ P
Sbjct  136   KVLGETKLHQTLTNIVIPTFDIKKLQPTIFSSYQSLVYPSLDVKLSDICIGTSAAPTFFP  195

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
              HYF       ++ + N+   E+++IDGG+ ANNPTLVA++ VTKQI  NNPD+  +KP+
Sbjct  196   PHYFS-----NEDILGNN--SEFHLIDGGITANNPTLVAMTAVTKQIVKNNPDMGELKPL  248

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
               ++FLVISIGTG+A  E KYN+K+AAKWGI+SWL    STP++++ M++S D+V  H+S
Sbjct  249   GYNKFLVISIGTGSAKKEEKYNAKKAAKWGIISWLYDDGSTPILDIAMDSSHDIVHFHSS  308

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              VF AL   E  YLRI               +L G  SSMD+AT+ NLE LV+IGEK+LK
Sbjct  309   VVFTAL-QSEEKYLRID------------DDTLEGVASSMDLATKPNLENLVKIGEKMLK  355

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
               V  +N++TGV EP+  + TN+  LKR AK 
Sbjct  356   NKVVHMNIDTGVYEPVAKNVTNDQELKRFAKI  387



>ref|XP_006829697.1| hypothetical protein AMTR_s00126p00052700 [Amborella trichopoda]
 gb|ERM97113.1| hypothetical protein AMTR_s00126p00052700 [Amborella trichopoda]
Length=404

 Score =   441 bits (1135),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 234/403 (58%), Positives = 295/403 (73%), Gaps = 20/403 (5%)
 Frame = -3

Query  1577  RKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISG  1398
             R   + Q  + G+++T+LSIDGGGIRGIIPA IL++LE++LQ LDGE+ RL DYFDV++G
Sbjct  4     RSSIENQPPSFGDLITILSIDGGGIRGIIPATILSFLESELQNLDGEEVRLVDYFDVMAG  63

Query  1397  TSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPK  1218
             TSTGGLVTAM+TAP +N RPLYAAKDI  FYL++ PKIF Q  G  G +   + +V GPK
Sbjct  64    TSTGGLVTAMITAPGDNNRPLYAAKDITSFYLDHCPKIFSQTSGLLGSVRKFVSAVTGPK  123

Query  1217  YDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVC  1038
             YDGKYL  L++K+L D RL  TLT VVIPTFDI+ LQP IFS+YQ K     +A LSD+C
Sbjct  124   YDGKYLHKLVRKQLGDKRLHQTLTKVVIPTFDIRLLQPTIFSSYQMKADKSKDALLSDIC  183

Query  1037  IGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFD  858
             I TSAAPTYLPAHYF+  EG       +   K +++IDGG+AANNPTLVA+ ++T+++  
Sbjct  184   ISTSAAPTYLPAHYFE-NEG------NDGKIKSFHLIDGGIAANNPTLVAMGEITREVHK  236

Query  857   NNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFME  678
              NPD FPIKPMD  RFLVIS+GTG+A +   Y +K+AAKWG+L WL +   TPLI+ F +
Sbjct  237   ENPDFFPIKPMDYGRFLVISLGTGSAKSTDNYTAKDAAKWGVLGWLYNNGGTPLIDTFQQ  296

Query  677   ASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLE  498
             AS+DMVD+H S VFQAL   E SYLRIQ              +LTG  SS+D+ATE+NL+
Sbjct  297   ASADMVDIHISNVFQAL-HSEQSYLRIQ------------DDTLTGDTSSVDIATEKNLK  343

Query  497   KLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
              LV++G +LL+K VSRVNLETG  EP+P+ GTNE AL R AK 
Sbjct  344   DLVKVGTELLQKQVSRVNLETGKFEPVPNEGTNEQALIRFAKL  386



>ref|XP_009792908.1| PREDICTED: patatin-like protein 1 [Nicotiana sylvestris]
Length=406

 Score =   441 bits (1135),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 245/423 (58%), Positives = 315/423 (74%), Gaps = 34/423 (8%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++T+L+IDGGGIRGIIP VIL+YLE+QLQELDG+DAR+ADYFD+I+GTSTGGLVTAML
Sbjct  18    GTLITILTIDGGGIRGIIPGVILSYLESQLQELDGKDARIADYFDLIAGTSTGGLVTAML  77

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
              AP+++ RPLYAAKDI PFYL + PKIFPQ GG    I    +++ GPKYDGKYL  L+K
Sbjct  78    AAPNKDKRPLYAAKDITPFYLEHSPKIFPQMGGPLAGIINLTKAMGGPKYDGKYLHKLIK  137

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
               L   RL DTLT VVIPTFDIK LQPVIFS+Y+A   P ++A L+D+CI TSAAPT+LP
Sbjct  138   GILGGTRLHDTLTAVVIPTFDIKKLQPVIFSSYEAILKPDLDAELADICISTSAAPTFLP  197

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             A+ FK ++    E       +E+N+IDGGVAANNPTLVAI +VTKQ+   + DLFPIKPM
Sbjct  198   AYGFKNKDAQDSE-------REFNLIDGGVAANNPTLVAIGEVTKQVLMQHGDLFPIKPM  250

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  RFLVIS+GTG A NE+K+N++ AAKWG+LSWLL+ +STP+I+ F +AS+DMVD HN 
Sbjct  251   DYGRFLVISLGTGNAKNEHKFNAQMAAKWGLLSWLLNNNSTPIIDAFNQASADMVDYHNF  310

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              VF+AL   ++ YLRIQ              +LTG  +S+D+AT+ENL+ LV++GE LL+
Sbjct  311   VVFKAL-HSDDKYLRIQ------------DDTLTGNLASVDIATKENLQSLVKVGEHLLE  357

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKFlsnerrlresrSPVTKRT*WFRQSYKVS  285
             KPVS++NL+ GV E + + GTN++AL+R AK LS+ER+              FR+S   S
Sbjct  358   KPVSKINLDKGVYEAVENGGTNKEALQRFAKILSDERK--------------FRESNASS  403

Query  284   RLI  276
             RL+
Sbjct  404   RLV  406



>ref|XP_010680418.1| PREDICTED: patatin-like protein 1 [Beta vulgaris subsp. vulgaris]
Length=407

 Score =   441 bits (1134),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 235/392 (60%), Positives = 290/392 (74%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             GN++T+LSIDGGGIRGIIPAV+L +LE+QLQ+LDGE+ARLADYFDVI+GTSTGGL+TAML
Sbjct  19    GNLITILSIDGGGIRGIIPAVMLEFLESQLQKLDGEEARLADYFDVIAGTSTGGLITAML  78

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             TAP++  RPLYAAK+I PFYL + PKIF Q  G FG I   ++ + GPKYDGKYL +L+K
Sbjct  79    TAPNDKTRPLYAAKEITPFYLEHCPKIFRQPSGIFGSIGTLMKLLSGPKYDGKYLHNLVK  138

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             + L   RL   LTNVVIPTFDIKNLQPV+FSTY      +++  LSD+CIGTSAAPT+LP
Sbjct  139   ELLGQRRLHQALTNVVIPTFDIKNLQPVLFSTYMVPIAKELDVLLSDICIGTSAAPTFLP  198

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AH+F   E    +G      KE+N+IDGG+AANNP+LVAIS+VTKQI  +NP+ FPIK  
Sbjct  199   AHHF---ENKDDQGNV----KEFNLIDGGIAANNPSLVAISEVTKQIVKSNPNFFPIKAT  251

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  R LVIS+GTG+   E  YN+K AAKWGI+SWL    +TPL++ F ++ +DMVD HNS
Sbjct  252   DRERLLVISLGTGSDKVEQLYNAKSAAKWGIISWLFDNGNTPLLDAFNQSKADMVDFHNS  311

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
               FQA G  +N YLRIQ              +L G  +S+DVAT ENL  LV IG+ LLK
Sbjct  312   VAFQAYGSLDN-YLRIQ------------DDTLKGVSASVDVATTENLANLVTIGKALLK  358

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             KPVSR+N +TG  +PIP+ GTNE+AL R AK 
Sbjct  359   KPVSRINFDTGRYQPIPNGGTNEEALIRFAKL  390



>ref|XP_004291130.1| PREDICTED: patatin group A-3-like [Fragaria vesca subsp. vesca]
Length=419

 Score =   441 bits (1134),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 233/400 (58%), Positives = 287/400 (72%), Gaps = 24/400 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN+VT+LSIDGGGIRG+IPA IL +LE++LQ+LDG+DARLADYFDVI+GTSTGGL
Sbjct  10    QPPTFGNLVTILSIDGGGIRGLIPAAILDFLESELQKLDGKDARLADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENG--RPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSVFGPKYDG  1209
             VTAM+  PDEN   RP++AAKDIK FYL + PKIFPQ+    F      I+++ GPKYDG
Sbjct  70    VTAMIATPDENNNNRPVFAAKDIKDFYLTHCPKIFPQRHCPLFPHAVKIIKALAGPKYDG  129

Query  1208  KYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGT  1029
             KYL +L++++L D +L  TLTNVVIPTFDIK LQP IFS+ + K  P  +A+L D+CI T
Sbjct  130   KYLHNLVREKLGDKKLNKTLTNVVIPTFDIKQLQPTIFSSLEVKSKPCSDAFLRDICIAT  189

Query  1028  SAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNP  849
             SAAPTYLPAHYF+ ++            +E+N+IDGGV ANNPTLVAI +VTK I   + 
Sbjct  190   SAAPTYLPAHYFETED-------VQGKVREFNLIDGGVCANNPTLVAIGEVTKTILKGSS  242

Query  848   DLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASS  669
             D FPIKPMD  RFLVIS+GTG+   E KY++  AAKWG+L WL     TPLI+VF ++SS
Sbjct  243   DFFPIKPMDYGRFLVISLGTGSPKIELKYHAHAAAKWGLLDWLTSGGGTPLIDVFSQSSS  302

Query  668   DMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLV  489
             DMVD + S VFQAL   EN YLRIQ              +LTG  SS+D+A E+NL+ L+
Sbjct  303   DMVDFNLSVVFQALHSKEN-YLRIQ------------DDTLTGQVSSVDIAEEKNLDDLL  349

Query  488   EIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             ++GE LLKKPVSRVNLETG  E      TN +AL R AK 
Sbjct  350   KVGEGLLKKPVSRVNLETGNYEAFTEE-TNAEALTRFAKL  388



>ref|XP_010472600.1| PREDICTED: patatin-like protein 2 [Camelina sativa]
Length=407

 Score =   440 bits (1132),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 230/405 (57%), Positives = 289/405 (71%), Gaps = 21/405 (5%)
 Frame = -3

Query  1589  VKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFD  1410
             +K++   S  Q  T GN+VT+LSIDGGGIRG+IPAVIL +LE++LQ+LDGEDARLADYFD
Sbjct  1     MKMDSPKSPLQPPTYGNLVTILSIDGGGIRGLIPAVILGFLESELQKLDGEDARLADYFD  60

Query  1409  VISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSV  1230
             V++GTSTGGLVTAMLT P++ GRPL+AA +IK FYL   PKIFPQ    F      ++S+
Sbjct  61    VMAGTSTGGLVTAMLTTPNKEGRPLFAASEIKDFYLEQCPKIFPQDHFPFSAAKNLVKSL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDG+YL  L+  +L D +L  TLTNVVIPTFDIK LQP IFS+Y+ K  P  NA L
Sbjct  121   TGPKYDGEYLHQLIHAKLGDTKLNQTLTNVVIPTFDIKRLQPTIFSSYEVKNNPLKNATL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             +D+ I TSAAPTYLPAH+F+ ++            KEYN+IDGGVAANNP LVAI +VT 
Sbjct  181   ADIAISTSAAPTYLPAHFFRTEDSTGNV-------KEYNLIDGGVAANNPALVAIGEVTN  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D FPI+P D  RFLV+S+GTG    E K+N+KE A WG+LSWL H +STPLI+
Sbjct  234   EITRGSSDFFPIRPNDYGRFLVLSLGTGNHKCEEKFNAKEVAGWGLLSWLTHDNSTPLID  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
              F +ASSDMVD H SAVF+AL   E +Y+RIQ              +L G  +S+D+AT 
Sbjct  294   AFTQASSDMVDFHLSAVFRAL-HSEPNYIRIQ------------DDTLNGDAASVDIATV  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             ENL+ L + GE+LLKKPVSRVNL++G +E   +  TN  AL +LA
Sbjct  341   ENLDILAKTGEELLKKPVSRVNLDSGSNEN-AYQTTNGMALIKLA  384



>ref|XP_002510255.1| Patatin precursor, putative [Ricinus communis]
 gb|EEF52442.1| Patatin precursor, putative [Ricinus communis]
Length=407

 Score =   440 bits (1132),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 238/406 (59%), Positives = 300/406 (74%), Gaps = 21/406 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +E   +  QA T GN+VT+LSIDGGGIRGIIP  IL++LE++ Q+LDGEDAR+ADYFDVI
Sbjct  1     MEGTNAHLQAPTYGNLVTILSIDGGGIRGIIPGTILSFLESEFQKLDGEDARIADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVF  1227
             +GTSTGGLVTAML +P+E  RP++AAKDI  FYLN  PKIFPQ +   F ++   I+++ 
Sbjct  61    TGTSTGGLVTAMLASPNEKNRPIFAAKDINEFYLNECPKIFPQHRFQLFAQVSKVIKAIA  120

Query  1226  GPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLS  1047
             GPKYDGKYL +L+K++L + RL  TLTNV+IPTFDIK LQP IFS++Q K    +NA LS
Sbjct  121   GPKYDGKYLHNLVKEKLGNTRLNQTLTNVIIPTFDIKKLQPTIFSSFQVKNNSSLNARLS  180

Query  1046  DVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQ  867
             D+CI TSAAPTYLPAHYFK +E  ++ G      +++N+IDGGVAANNPTLVA+ +VTK+
Sbjct  181   DICISTSAAPTYLPAHYFKTKE--EKTGKV----RDFNLIDGGVAANNPTLVALGEVTKE  234

Query  866   IFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEV  687
             I   + D FPIKPMD  RFLVIS+GTG    E KY + +AAKWG+L WL    STPL++V
Sbjct  235   IIKGSQDFFPIKPMDYGRFLVISLGTGAPKAEEKYTADKAAKWGVLGWLTANGSTPLVDV  294

Query  686   FMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEE  507
             F  AS+DMVDLH S +FQAL  CE +YLRIQ              +L  T SS+D+AT+ 
Sbjct  295   FTHASADMVDLHISELFQAL-HCEKNYLRIQ------------DDTLNKTVSSVDIATKS  341

Query  506   NLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             NL++LV+ GE+LLKKPVSR+NLE G+ EP     TNE+AL R AK 
Sbjct  342   NLDELVKTGERLLKKPVSRINLENGIFEPCSKE-TNEEALIRFAKL  386



>ref|XP_011070718.1| PREDICTED: patatin-like protein 2 [Sesamum indicum]
Length=428

 Score =   441 bits (1133),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 229/389 (59%), Positives = 295/389 (76%), Gaps = 21/389 (5%)
 Frame = -3

Query  1535  VTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAMLTAP  1356
             +TVLSIDGGGI+GIIPAVIL +LE+QLQELDG+  RLADYFDVI+GTSTGGLVTAMLT+P
Sbjct  20    ITVLSIDGGGIKGIIPAVILDFLESQLQELDGKQTRLADYFDVIAGTSTGGLVTAMLTSP  79

Query  1355  DENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLKKEL  1176
             DEN RPLYAAKDIKPFYL N PKIFPQ   WF      ++S+ GP YDGK+L  +LK++L
Sbjct  80    DENNRPLYAAKDIKPFYLENCPKIFPQTHSWF-PFGQELKSLLGPLYDGKHLHGILKEKL  138

Query  1175  KDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLPAHY  996
             K  +L+ ++TNVVIP FDIK LQPVIFSTY+AKR   ++A  SD+CI TSAAPT+ P H 
Sbjct  139   KHTKLSQSITNVVIPAFDIKRLQPVIFSTYEAKRSALLDAKFSDICISTSAAPTFFPGHE  198

Query  995   FKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPMDLS  816
             F  ++   ++G      +EYN+IDGGVAANNP L+AIS+V KQ+FD+N +L  ++ ++L 
Sbjct  199   FATKD---EKGNV----REYNLIDGGVAANNPALIAISEVMKQMFDSNMELLGMRAVELP  251

Query  815   RFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNSAVF  636
             R L++S+GTG A  + KYN+K AA+WGIL WLL+  + PL+E+F +AS+DMVD H S +F
Sbjct  252   RLLIVSVGTGAARVDEKYNTKLAARWGILDWLLYGGTAPLLEIFTQASADMVDFHTSLLF  311

Query  635   QALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLKKPV  456
             QAL   E++YLRIQ              +L G +SS+DVAT ENL++LV IGE+LLK PV
Sbjct  312   QALF-SEDNYLRIQ------------DDTLCGIESSVDVATRENLDRLVTIGERLLKGPV  358

Query  455   SRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             SRV+  TG+S+P+ + GTNEDA+ R A+ 
Sbjct  359   SRVDFSTGLSQPLQNGGTNEDAIIRFARL  387



>emb|CDP07844.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   439 bits (1130),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 241/405 (60%), Positives = 291/405 (72%), Gaps = 28/405 (7%)
 Frame = -3

Query  1571  PSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTS  1392
             P Q    T GN++T+LSIDGGGIRGIIPA IL +LE+QLQELDGEDAR+ADYFDVI+GTS
Sbjct  8     PVQILPPTNGNLITILSIDGGGIRGIIPAAILDFLESQLQELDGEDARIADYFDVIAGTS  67

Query  1391  TGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYD  1212
             TGGL+TAMLTAP+E  RPLYAAK+IKPFYL NGPKIFPQK G  G I      + GP YD
Sbjct  68    TGGLITAMLTAPNEKNRPLYAAKEIKPFYLGNGPKIFPQKSGILGLIKPVQNFIPGPLYD  127

Query  1211  GKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIG  1032
             GKYL  +LK++L   RL  TLTNVVIPTFD+K LQP IFSTY+ K  P ++A LSD+CIG
Sbjct  128   GKYLHKILKEKLGQTRLRQTLTNVVIPTFDVKYLQPTIFSTYEVKASPLLDALLSDICIG  187

Query  1031  TSAAPTYLPAHYFKIQEGPKQEGITNHPPK----EYNVIDGGVAANNPTLVAISQVTKQI  864
             TSAAPTY P HYF           TN   K    ++N+ DGGVAANNPT++A+SQVTKQ+
Sbjct  188   TSAAPTYFPVHYF-----------TNQDDKGNVWDFNLTDGGVAANNPTILAMSQVTKQM  236

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
               N+PD   +KP D +RFLVISIGTG+A  E K++++   KW  L W+L+ +  PL+E+F
Sbjct  237   IKNDPDFSQMKPTDYARFLVISIGTGSAKIEKKFSAEMVNKWNPLGWVLNGTVPPLVEMF  296

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              +AS DMVD   S +FQAL   E +YLRIQ              +LTG  +S+DVAT+EN
Sbjct  297   AQASGDMVDYQISVIFQAL-HSEANYLRIQ------------DDTLTGQSASVDVATKEN  343

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +EKL EIG  LLKKPVSRVNL TG  E + + GTNE+ALKR AK 
Sbjct  344   MEKLGEIGSNLLKKPVSRVNLLTGAVEQVENGGTNEEALKRFAKL  388



>ref|XP_009367379.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=397

 Score =   439 bits (1129),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 225/394 (57%), Positives = 288/394 (73%), Gaps = 22/394 (6%)
 Frame = -3

Query  1550  TGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTA  1371
             T   ++TVLSIDGGGIRG+IPA IL +LE++LQ+LDGEDAR+ADYFDVI+GTSTGGLVTA
Sbjct  4     TSRKLITVLSIDGGGIRGLIPATILGFLESELQKLDGEDARIADYFDVIAGTSTGGLVTA  63

Query  1370  MLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSL  1191
             MLT P+EN RPL+AAKD+K FYL+  PKIFPQK  WF      ++++ GPKY+GKYL  L
Sbjct  64    MLTTPNENDRPLFAAKDLKDFYLSECPKIFPQK-IWFSYTRKIMKALTGPKYNGKYLHGL  122

Query  1190  LKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTY  1011
             ++++L + +L +TLTNVVIPTFDI+NLQPV+FS+   ++ P  +A LSD+CI TSAAPTY
Sbjct  123   IRQKLGNNKLHNTLTNVVIPTFDIRNLQPVVFSSCGVEKKPCTDALLSDICIATSAAPTY  182

Query  1010  LPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIK  831
             LPAHYF+ +             +EYN+IDGGVAANNPT VAI +V  +I   N D+  +K
Sbjct  183   LPAHYFETKYAAGT-------VREYNLIDGGVAANNPTFVAICEVVNEIEKENSDIVSVK  235

Query  830   PMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLH  651
              +D  RFLVIS+GTG++  E +Y++  AAKWG+L+WL    STP+I+VF +AS+DMVDLH
Sbjct  236   RVDYGRFLVISLGTGSSKAEREYHASAAAKWGLLNWLTSGGSTPIIDVFSQASADMVDLH  295

Query  650   NSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKL  471
              S VFQA    EN YLRIQ              +L GT SS+DVAT++NL  LV++GE L
Sbjct  296   LSRVFQAFNSEEN-YLRIQ------------DDTLHGTISSVDVATKKNLANLVKVGEGL  342

Query  470   LKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             LK+PVSRVNL++G  E   H  TN +AL R AK 
Sbjct  343   LKQPVSRVNLDSGRFEASKHE-TNAEALTRFAKL  375



>ref|XP_004499077.1| PREDICTED: patatin-2-Kuras 3-like isoform X3 [Cicer arietinum]
Length=372

 Score =   438 bits (1126),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 222/363 (61%), Positives = 276/363 (76%), Gaps = 21/363 (6%)
 Frame = -3

Query  1457  LQELDGEDARLADYFDVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFP  1278
             +QELDGEDARLADYFDVISGTSTGGLVTAM+ APD+N RPL+AAKDIKPFYL + PKIFP
Sbjct  1     MQELDGEDARLADYFDVISGTSTGGLVTAMIAAPDKNNRPLFAAKDIKPFYLEHCPKIFP  60

Query  1277  QKGGWFGEIWVSI-RSVFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPV  1101
             Q  G  G +   + RS+ GPKYDGKYL  +++++L DIRL +T+TN+VIPTFDIK+LQP+
Sbjct  61    QHRGLGGIMLAKVVRSLGGPKYDGKYLHDVIREKLGDIRLHETITNIVIPTFDIKSLQPI  120

Query  1100  IFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDG  921
             IFS+YQ ++ P ++A LSD+CI TSAAPTYLPA+ F  ++        N+  +E+N+IDG
Sbjct  121   IFSSYQLEKSPCLDAKLSDICISTSAAPTYLPAYNFTNKD-------PNNHEEEFNLIDG  173

Query  920   GVAANNPTLVAISQVTKQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAK  741
             GV ANNP LVA+++VTKQI + +PD FPIKP++  RFL+IS+GTGTA NE K+++  AAK
Sbjct  174   GVCANNPALVAMNEVTKQIINQSPDFFPIKPLEYGRFLIISLGTGTAKNEEKFSADIAAK  233

Query  740   WGILSWLLHKSSTPLIEVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHS  561
             WG+L WL +  S PLI+VF ++S DMVD H S V QAL   +N YLRIQ           
Sbjct  234   WGLLGWLTNSGSNPLIDVFTQSSGDMVDFHLSCVTQALHSQDN-YLRIQ-----------  281

Query  560   FQTSLTGTQSSMDVATEENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKR  381
                +LTG  SS+D+ATEENLEKL EIG+KLLKKPVSRVNLE G  EP+    TNE ALKR
Sbjct  282   -DDTLTGDVSSVDIATEENLEKLCEIGDKLLKKPVSRVNLENGHFEPVIDGETNEQALKR  340

Query  380   LAK  372
             LAK
Sbjct  341   LAK  343



>emb|CDM80597.1| unnamed protein product [Triticum aestivum]
Length=434

 Score =   440 bits (1132),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 220/391 (56%), Positives = 290/391 (74%), Gaps = 25/391 (6%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G+IVTVLSIDGGG+RGIIP  ILA+LE +LQ+LDG +AR++DYFDVI+GTSTGGLVTAML
Sbjct  49    GSIVTVLSIDGGGVRGIIPGTILAFLEEKLQDLDGPEARISDYFDVIAGTSTGGLVTAML  108

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVFGPKYDGKYLRSLL  1188
             +APD+ GRPL+AAKDI  FYL++ P IFPQ   G FG     +RS+ GPKY+G+YL S++
Sbjct  109   SAPDDAGRPLFAAKDINQFYLDHCPNIFPQASKGPFG----LMRSMMGPKYNGEYLHSVV  164

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             K+ L D+R+ DTL NVVIPTFDIK LQP IFSTY A +    NA LSDVCI TSAAPTYL
Sbjct  165   KELLGDMRVGDTLNNVVIPTFDIKLLQPTIFSTYNAMKDKSKNALLSDVCISTSAAPTYL  224

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKP  828
             P H+F+ +    ++G      +E+N+IDGGVAANNPTL+A++ V+KQI   NPD FPIKP
Sbjct  225   PGHHFRTEH---EDGKV----REFNLIDGGVAANNPTLLAMTDVSKQILMGNPDFFPIKP  277

Query  827   MDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHN  648
              D  +F+++S+GTGTA  E K+++ E +KWG+L WL ++ +TP+I+ F +AS+D+VD+H 
Sbjct  278   ADYGKFMILSLGTGTAKIEEKFDAAECSKWGLLGWLYNRGATPIIDSFSQASADLVDIHA  337

Query  647   SAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLL  468
             S +FQAL  CE  YLRIQ               L G  +S+DV+T+ENL +L+++G+ LL
Sbjct  338   SVLFQAL-HCEKRYLRIQ------------DDELKGETASVDVSTQENLNRLIDVGKALL  384

Query  467   KKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             K+ V +VN ETG +EP  + GTNE+ L   A
Sbjct  385   KRQVCKVNAETGKNEPDQNRGTNEEELVNFA  415



>ref|XP_002262942.1| PREDICTED: patatin-like protein 2 [Vitis vinifera]
Length=397

 Score =   439 bits (1128),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 225/398 (57%), Positives = 290/398 (73%), Gaps = 26/398 (7%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G +VTVLSIDGGG+RGIIP  +LA+LE++ QELDG+DAR+ADYFDVI+GTSTGGLVTAML
Sbjct  8     GRMVTVLSIDGGGVRGIIPGTLLAFLESKFQELDGDDARIADYFDVIAGTSTGGLVTAML  67

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVS-----IRSVFGPKYDGKY  1203
             TAP+++ RP++AAKDI  FYL++ P+IFPQ +   FG+  +S     I +V GPKY+GKY
Sbjct  68    TAPNKDNRPVFAAKDINSFYLDHCPEIFPQNRRISFGKSTISRFGSLIDAVRGPKYNGKY  127

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L+SL    L  + L  TLTNVVIPTFDIK LQPVIFST +AK     NA LSD+CI TSA
Sbjct  128   LQSLAVDLLDKVYLKQTLTNVVIPTFDIKLLQPVIFSTDEAKVNVAKNARLSDICISTSA  187

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYF+ +E        N   + +N+IDGGVAANNPTLVA+S ++K+I  +N   
Sbjct  188   APTYLPAHYFETKEA-------NGKTRSFNLIDGGVAANNPTLVAMSHISKEILMDNTQF  240

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
               +KPMD    LV+S+GTG   +E KY++ EA++WG+  W  +  +TPL+++F  ASSDM
Sbjct  241   IEMKPMDSKSMLVLSLGTGAPKHEEKYSAAEASRWGLHRWAYNNGATPLLDIFSHASSDM  300

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD+H S VFQ+LG CE +YLRIQ              +LTG +SS+DVAT ENL++L EI
Sbjct  301   VDIHVSTVFQSLG-CEKNYLRIQ------------DDTLTGEESSVDVATTENLQRLGEI  347

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             G++LL KP+SRVNLETG  E +   GTN++AL + AK 
Sbjct  348   GKELLAKPLSRVNLETGRHEQLEGEGTNQEALTQFAKL  385



>gb|EMS66123.1| Patatin group A-3 [Triticum urartu]
Length=405

 Score =   439 bits (1129),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 241/415 (58%), Positives = 298/415 (72%), Gaps = 42/415 (10%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGGIRGIIPAV LA+LE++LQ+LDGE+ARLADYFDVI+GTSTGGL
Sbjct  11    QPPTYGNLITILSIDGGGIRGIIPAVALAFLESELQKLDGEEARLADYFDVIAGTSTGGL  70

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAMLTAP++  RPL+AAKDI+ FY+N+ P+IFPQ  G FG I   +RS+ GP YDGKYL
Sbjct  71    VTAMLTAPNKKRRPLFAAKDIQAFYMNHAPRIFPQLRGAFGRIMGILRSLSGPYYDGKYL  130

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPK---------------  1065
               +++K+L   RL  TLTNVVIPTFDIK LQP IFS+Y+                     
Sbjct  131   HEVVRKKLGSARLHQTLTNVVIPTFDIKRLQPTIFSSYEVSLFSSLSNLSGDLIMMVKKK  190

Query  1064  -----MNAYLSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNP  900
                  MNA LSD+CI TSAAPTYLPAHYFK ++       ++   KE+N+IDGGVAANNP
Sbjct  191   KKKNTMNALLSDICISTSAAPTYLPAHYFKTED-------SHGNIKEFNLIDGGVAANNP  243

Query  899   TLVAISQVTKQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWL  720
              LVAI +V+KQIF  +PD FPIKPMD  RFLVIS+GTG++  E KY++++A  WG+L WL
Sbjct  244   ALVAIGEVSKQIFKQDPDFFPIKPMDYGRFLVISLGTGSSKFEEKYDAQKAKSWGVLDWL  303

Query  719   LHKSSTPLIEVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTG  540
             L   STPL+++F  AS+DMVD+H ++VF+AL   E +YLRIQ              +L G
Sbjct  304   LSSGSTPLVDIFTRASADMVDIHIASVFKAL-HSEQNYLRIQ------------DDNLRG  350

Query  539   TQSSMDVATEENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPH--SGTNEDALKR  381
             T SS+DVAT++NLEKLV +GE LLKKPVSR NLETG   P       TNE+ALKR
Sbjct  351   TLSSVDVATKDNLEKLVNVGEMLLKKPVSRANLETGQMVPACSDIEETNEEALKR  405



>ref|XP_002510259.1| Patatin T5 precursor, putative [Ricinus communis]
 gb|EEF52446.1| Patatin T5 precursor, putative [Ricinus communis]
Length=405

 Score =   439 bits (1129),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 240/396 (61%), Positives = 301/396 (76%), Gaps = 21/396 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             QA T GN+VT+LSIDGGGIRGIIP  IL++LE++LQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  9     QAPTYGNLVTILSIDGGGIRGIIPGTILSFLESELQKLDGEDARIADYFDVITGTSTGGL  68

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYL  1200
             VTAML +P+E  RP++AAKDIK FYLN  PKIFPQ   W  ++   I+++ GPKYDGKYL
Sbjct  69    VTAMLASPNEKNRPVFAAKDIKDFYLNECPKIFPQH-CWQPQVSKVIKAIAGPKYDGKYL  127

Query  1199  RSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAA  1020
              +L+K++L + RL  TLTN+VIPTFD+K LQP IFS++Q K  P +NA LSD+CI TSAA
Sbjct  128   HNLVKEKLGNTRLNQTLTNIVIPTFDVKKLQPTIFSSFQVKNNPSINALLSDICISTSAA  187

Query  1019  PTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLF  840
             PTYLPAHYF+I+E  K E +     +++N+IDGGVAANNPTLVA+ +VTK+I   + D F
Sbjct  188   PTYLPAHYFEIKE-EKTEKV-----RKFNLIDGGVAANNPTLVAMGEVTKEIIKGSQDFF  241

Query  839   PIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMV  660
             PIKPMD  RFLVIS+GTG    E KY++ +AAKWG+L WL    STPL++VF  AS+DMV
Sbjct  242   PIKPMDYGRFLVISLGTGAPKAEEKYSADDAAKWGVLGWLTASGSTPLVDVFTHASADMV  301

Query  659   DLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIG  480
             DLH S +FQAL   E +YLRIQ              +L+ T +S+DVAT++NL  L +IG
Sbjct  302   DLHISVLFQAL-HSERNYLRIQ------------DDTLSETVASVDVATKKNLNDLAKIG  348

Query  479   EKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             E LLKKPVSRVNLETG+ E + +  TNE+AL R AK
Sbjct  349   EGLLKKPVSRVNLETGIFELV-NEETNEEALIRFAK  383



>emb|CBI25858.3| unnamed protein product [Vitis vinifera]
Length=378

 Score =   438 bits (1126),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 223/390 (57%), Positives = 286/390 (73%), Gaps = 24/390 (6%)
 Frame = -3

Query  1538  IVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAMLTA  1359
             +VTVLSIDGGG+RGIIP  +LA+LE++ QELDG+DAR+ADYFDVI+GTSTGGLVTAMLTA
Sbjct  1     MVTVLSIDGGGVRGIIPGTLLAFLESKFQELDGDDARIADYFDVIAGTSTGGLVTAMLTA  60

Query  1358  PDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLKKE  1179
             P+++ RP++AAKDI  FYL++ P+IFPQ    FG +   I +V GPKY+GKYL+SL    
Sbjct  61    PNKDNRPVFAAKDINSFYLDHCPEIFPQN-SRFGSL---IDAVRGPKYNGKYLQSLAVDL  116

Query  1178  LKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLPAH  999
             L  + L  TLTNVVIPTFDIK LQPVIFST +AK     NA LSD+CI TSAAPTYLPAH
Sbjct  117   LDKVYLKQTLTNVVIPTFDIKLLQPVIFSTDEAKVNVAKNARLSDICISTSAAPTYLPAH  176

Query  998   YFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPMDL  819
             YF+ +E        N   + +N+IDGGVAANNPTLVA+S ++K+I  +N     +KPMD 
Sbjct  177   YFETKEA-------NGKTRSFNLIDGGVAANNPTLVAMSHISKEILMDNTQFIEMKPMDS  229

Query  818   SRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNSAV  639
                LV+S+GTG   +E KY++ EA++WG+  W  +  +TPL+++F  ASSDMVD+H S V
Sbjct  230   KSMLVLSLGTGAPKHEEKYSAAEASRWGLHRWAYNNGATPLLDIFSHASSDMVDIHVSTV  289

Query  638   FQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLKKP  459
             FQ+LG CE +YLRIQ              +LTG +SS+DVAT ENL++L EIG++LL KP
Sbjct  290   FQSLG-CEKNYLRIQ------------DDTLTGEESSVDVATTENLQRLGEIGKELLAKP  336

Query  458   VSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +SRVNLETG  E +   GTN++AL + AK 
Sbjct  337   LSRVNLETGRHEQLEGEGTNQEALTQFAKL  366



>gb|EMS45954.1| Patatin group A-3 [Triticum urartu]
Length=398

 Score =   438 bits (1126),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 285/392 (73%), Gaps = 19/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++TVLSIDGGGIRG+IP+ ILA+LE++LQELDG DAR+ADYFDVI+GTSTG LVT+ML
Sbjct  9     GRLITVLSIDGGGIRGLIPSTILAFLESKLQELDGPDARIADYFDVIAGTSTGALVTSML  68

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVFGPKYDGKYLRSLL  1188
              AP EN RPL+AAKDI  FYL+NGPKIFPQ+  G+   +   + +V GPKYDGK+L   +
Sbjct  69    AAPGENKRPLFAAKDINQFYLDNGPKIFPQRRWGFLTPVANLLGAVMGPKYDGKFLHDKI  128

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             K    D+ + DT+TN+V+PTFDIK LQPVIF+TY+AK  P  NA+LSD+CI TSAAPTY 
Sbjct  129   KNLTNDVTVADTVTNIVVPTFDIKYLQPVIFNTYEAKVNPLKNAHLSDICISTSAAPTYF  188

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKP  828
             PAH+F        + +   P +EY+++DGGVAANNPT+VA+S +T+++   NPD    KP
Sbjct  189   PAHHFTT-----HDPLGKLPDREYHLVDGGVAANNPTMVAMSMITQEVMRRNPDFTHGKP  243

Query  827   MDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHN  648
              + S +L+ISIGTGTA    KY + + AKWG+L WL     TPL+++F  AS+DMVD+H 
Sbjct  244   AEYSNYLIISIGTGTAKQAEKYTAPDCAKWGVLRWLKDGRFTPLLDIFSHASADMVDIHA  303

Query  647   SAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLL  468
             + +FQ+L   E +YLRIQ              SLTG  SS+D++T+EN+E L+ IG KLL
Sbjct  304   AVLFQSL-RVEKNYLRIQ------------DDSLTGHTSSVDISTKENMEALIGIGNKLL  350

Query  467   KKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             K  V+RVN++TG+ EP+   GTNE+AL R AK
Sbjct  351   KMSVARVNIDTGMYEPVDDEGTNEEALARFAK  382



>ref|XP_010269013.1| PREDICTED: patatin-like protein 2 isoform X1 [Nelumbo nucifera]
Length=404

 Score =   438 bits (1126),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 240/405 (59%), Positives = 299/405 (74%), Gaps = 21/405 (5%)
 Frame = -3

Query  1583  IERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVI  1404
             +E + S     T GN++T+LSIDGGGIRGIIP +IL +LE+QLQELDGED RLADYFDVI
Sbjct  1     MEGEKSCLHPPTHGNLITILSIDGGGIRGIIPGIILGFLESQLQELDGEDVRLADYFDVI  60

Query  1403  SGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFG  1224
             +GTSTGGLVTAMLT P+E  RPL++AKDIK FYL N P+IFPQ+   F      I+S+ G
Sbjct  61    AGTSTGGLVTAMLTTPNEKKRPLFSAKDIKNFYLENAPRIFPQQSCPFAHAAKVIKSLSG  120

Query  1223  PKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSD  1044
             P+Y G YL +L++K+L   RL  TLTNVVIPTFD+K LQP IFS+YQ K  P ++A LSD
Sbjct  121   PRYKGYYLHNLVRKKLGSTRLHQTLTNVVIPTFDVKELQPTIFSSYQLKCKPSLDALLSD  180

Query  1043  VCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQI  864
             VCIGTSAAPTYLPAHYF+ ++   +EG      +E+N+IDGGVAANNP LVAI +V+K I
Sbjct  181   VCIGTSAAPTYLPAHYFETKD---EEGKV----REFNLIDGGVAANNPALVAIGEVSKDI  233

Query  863   FDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVF  684
                NPD F IKPM+  RFLV+S+GTG   +E+KY +K+A+KWG+L WL    S+PL++VF
Sbjct  234   I-KNPDSFSIKPMEFGRFLVLSLGTGAPKSEHKYGAKQASKWGVLGWLHSDGSSPLVDVF  292

Query  683   MEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEEN  504
              +AS DMVD H SAVFQAL   +N YLRIQ              +L GT SS+D A++EN
Sbjct  293   TQASGDMVDYHVSAVFQALSSKDN-YLRIQ------------DDTLGGTVSSVDFASKEN  339

Query  503   LEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             L+ LV++GE LLKKPVSRVNL+TG+ EP     TNE+AL+R AK 
Sbjct  340   LDNLVKVGEALLKKPVSRVNLDTGIYEPCKEQITNEEALRRFAKL  384



>ref|XP_010548401.1| PREDICTED: patatin-like protein 1 [Tarenaya hassleriana]
Length=395

 Score =   437 bits (1125),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 222/392 (57%), Positives = 280/392 (71%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G +VT+LS+DGGG+RGII  VILA LE +LQELDGE ARLADYFDV++GTSTGGLVTAML
Sbjct  9     GKLVTILSLDGGGVRGIIAGVILARLEKELQELDGEGARLADYFDVMAGTSTGGLVTAML  68

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             TAP+E GRPL+AAK+I PFY+ + PKIF Q GGW   + +  R + GPKYDGKYL  LL+
Sbjct  69    TAPNELGRPLFAAKEIVPFYMEHSPKIFSQPGGWLSVLPMPPRLLSGPKYDGKYLHELLR  128

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             K L D RL  TLTN+VIPTFDIK L P IFS+Y+    P ++A LSD+CI TSAAPT+LP
Sbjct  129   KLLGDKRLHQTLTNIVIPTFDIKKLNPTIFSSYKILTDPTLDAKLSDICISTSAAPTFLP  188

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             +HYF  ++        N    E+N+IDGGV ANNPTLVA++ V+KQI  NNPD+  + P+
Sbjct  189   SHYFVNED-------INGKKTEFNLIDGGVTANNPTLVAMTAVSKQIIMNNPDMGNMNPL  241

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
                 FLV+SIGTG+A  E KYN+ +++KWGILSWL    S+P+I+ + E+SSDMV  H S
Sbjct  242   GYDHFLVVSIGTGSAKKEEKYNATKSSKWGILSWLYEDGSSPIIDCYSESSSDMVHYHIS  301

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
               FQAL D + +YLRI               +L G  SS+D++T+ NLE LV+IGEK+LK
Sbjct  302   VAFQAL-DSQENYLRID------------DDTLEGDTSSLDISTKANLENLVKIGEKMLK  348

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
               V ++N+ETG  EP+P   TNE  LKR AK 
Sbjct  349   NRVEKMNIETGKYEPVPDDITNEQELKRFAKI  380



>gb|KFK32501.1| hypothetical protein AALP_AA6G250900, partial [Arabis alpina]
Length=384

 Score =   437 bits (1124),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 224/381 (59%), Positives = 280/381 (73%), Gaps = 21/381 (6%)
 Frame = -3

Query  1517  DGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAMLTAPDENGRP  1338
             DGGGIRGIIPA ILA+LE++LQ+LDGE+ARLADYFDV++GTSTGGLVTAMLTAP++ GRP
Sbjct  1     DGGGIRGIIPAAILAFLESELQKLDGEEARLADYFDVMAGTSTGGLVTAMLTAPNKEGRP  60

Query  1337  LYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLKKELKDIRLT  1158
             L+AA DIK FYL + PKIFPQ    F      ++S+ GPKYDG+YL  L+   L D RL 
Sbjct  61    LFAASDIKDFYLEHCPKIFPQDHFPFSAAKTLVKSLTGPKYDGEYLHQLIHDLLGDTRLH  120

Query  1157  DTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLPAHYFKIQEG  978
              TLTNVVIPTFDIK+LQP IFS+Y+ K+ P  NA L+D+ I TSAAPTYLPAH+FK ++ 
Sbjct  121   QTLTNVVIPTFDIKHLQPTIFSSYEVKKNPLKNATLADIAISTSAAPTYLPAHFFKTEDS  180

Query  977   PKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPMDLSRFLVIS  798
                        KE+N+IDGGVAANNP LVAI +VT++I   + D FPIKP D  RFLV+S
Sbjct  181   AGN-------VKEFNLIDGGVAANNPALVAIGEVTREITRGSSDFFPIKPNDYGRFLVLS  233

Query  797   IGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNSAVFQALGDC  618
             +GTGT   E K+++KE A WG+LSWL H +STPLI+ FM+ASSDMVD H SAVFQAL   
Sbjct  234   LGTGTPKAEEKFDAKEVAGWGMLSWLTHDNSTPLIDAFMQASSDMVDFHLSAVFQAL-HS  292

Query  617   ENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLKKPVSRVNLE  438
             E +Y+RIQ              +L+G  +S+D++T ENL+ L + G++LL KPVSRVNLE
Sbjct  293   EANYIRIQ------------DDTLSGDAASVDISTVENLDVLAKTGDELLNKPVSRVNLE  340

Query  437   TGVSEPIPHSGTNEDALKRLA  375
             +G +E   +  TNE AL +LA
Sbjct  341   SGCNEN-AYEVTNEKALIKLA  360



>ref|XP_008393826.1| PREDICTED: patatin-like protein 2 [Malus domestica]
Length=415

 Score =   438 bits (1126),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 238/407 (58%), Positives = 303/407 (74%), Gaps = 23/407 (6%)
 Frame = -3

Query  1586  KIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             ++ER  S  Q+ T GN+VTVLSIDGGGIRGIIP  IL++LE++LQ+LDGEDARLADYFDV
Sbjct  6     QMERARSFLQSPTYGNLVTVLSIDGGGIRGIIPGTILSFLESELQKLDGEDARLADYFDV  65

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSV  1230
             I+GTSTGGLVTAMLT PDEN RPL++AKDI  FYL + PKIFPQ      GE    ++++
Sbjct  66    ITGTSTGGLVTAMLTTPDENNRPLFSAKDINAFYLEHCPKIFPQDSAPLIGEAVDMVKNL  125

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYD KYL +++K++L D RL DTLTNV+IPTFDIK LQP IFS+Y+AK+   ++A L
Sbjct  126   TGPKYDXKYLHNIVKEKLGDKRLNDTLTNVIIPTFDIKRLQPTIFSSYEAKKKSCVDALL  185

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+CI TSAAPTYLPAH+F+ +    +        +E+++IDGGVAANNP LVAI++VTK
Sbjct  186   SDICIATSAAPTYLPAHHFETKTSTGE-------TREFHLIDGGVAANNPALVAINEVTK  238

Query  869   QIFDNNPDL-FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             +I   N D  F  +P    RFLV+S+GTG+A  E KY++ + AKWG+L+WL    S PLI
Sbjct  239   ZIHQGNSDFNFSXRPTXYGRFLVVSLGTGSAKCEEKYHANDVAKWGLLAWLTSGGSCPLI  298

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             +VF +ASSDMVD H + VFQAL +CE SYLRIQ              +L  T SS+D+AT
Sbjct  299   DVFTQASSDMVDFHLATVFQAL-NCEKSYLRIQ------------DDTLEKTVSSVDIAT  345

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             +ENL+ LV++GEKLLKKPVSRVN++TG  EP  H  TNE+AL R+A+
Sbjct  346   KENLDNLVKVGEKLLKKPVSRVNMDTGAFEP-AHQSTNEEALVRIAR  391



>ref|XP_009367484.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=415

 Score =   437 bits (1125),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 238/406 (59%), Positives = 303/406 (75%), Gaps = 23/406 (6%)
 Frame = -3

Query  1586  KIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             ++ER  S  Q+ T GN+VTVLSIDGGGIRGIIP  IL++LE++LQ+LDGEDARLADYFDV
Sbjct  6     QMERARSFLQSPTYGNLVTVLSIDGGGIRGIIPGTILSFLESELQKLDGEDARLADYFDV  65

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSV  1230
             I+GTSTGGLVTAMLT PDEN RPL++AKDI  FYL + PKIFPQ      GE    ++++
Sbjct  66    ITGTSTGGLVTAMLTTPDENNRPLFSAKDINAFYLEHCPKIFPQGSAPLIGEAVDMVKNL  125

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL +++K++L D RL DTLTNV+IPTFDIK LQP IFS+Y+AK+   ++A L
Sbjct  126   TGPKYDGKYLHNIVKEKLGDKRLNDTLTNVIIPTFDIKRLQPTIFSSYEAKKKSCVDALL  185

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+CI TSAAPTYLPAH+F+ +    +        +E+++IDGGVAANNP LVAI++VTK
Sbjct  186   SDICIATSAAPTYLPAHHFETKTSTGE-------TREFHLIDGGVAANNPALVAINEVTK  238

Query  869   QIFDNNPDL-FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             +I   N D  F  +P +  RFLV+S+GTG+A  E KY++ + AKWG+L+WL    S PLI
Sbjct  239   EIHQGNSDFNFSTRPTEYGRFLVVSLGTGSAKCEEKYHANDVAKWGLLAWLTSGGSCPLI  298

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             +VF +ASSDMVD H + VFQAL +CE SYLRIQ              +L    SS+D+AT
Sbjct  299   DVFTQASSDMVDFHLATVFQAL-NCEKSYLRIQ------------DDTLEKIVSSVDIAT  345

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             +ENL+ LV++GEKLLKKPVSRVN++TG  EP  H  TNE+AL R+A
Sbjct  346   KENLDNLVKVGEKLLKKPVSRVNMDTGAFEP-AHQSTNEEALVRVA  390



>gb|EMT13605.1| Patatin group A-3 [Aegilops tauschii]
Length=397

 Score =   437 bits (1123),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 285/392 (73%), Gaps = 19/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++TVLSIDGGGIRG+IP+ ILA LE++LQELDG DAR+ADYFDVI+GTSTG LVT+ML
Sbjct  9     GRLITVLSIDGGGIRGLIPSTILACLESKLQELDGPDARIADYFDVIAGTSTGALVTSML  68

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVFGPKYDGKYLRSLL  1188
              AP EN RPL+AAKDI  FYL+NGPKIFPQ+  G+   +   + +V GPKYDGK+L   +
Sbjct  69    AAPGENKRPLFAAKDINQFYLDNGPKIFPQRRWGFLTPVANLLGAVMGPKYDGKFLHDKI  128

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             K    D+ + DT+TN+V+PTFDIK LQPVIF+TY+AK  P  NA+LSD+CI TSAAPTY 
Sbjct  129   KNLTNDVTVADTVTNIVVPTFDIKYLQPVIFNTYEAKVDPLKNAHLSDICISTSAAPTYF  188

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKP  828
             PAH+F        + +   P +EY+++DGGVAANNPT+VA+S +T+++   NPD    KP
Sbjct  189   PAHHFTT-----HDPLGKLPDREYHLVDGGVAANNPTMVAMSMITQEVMRRNPDFTHGKP  243

Query  827   MDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHN  648
              + S +L+ISIGTGTA    KY + + AKWG+L WL     TPL+++F  AS+DMVD+H 
Sbjct  244   AEYSNYLIISIGTGTAKQAEKYTAPDCAKWGVLRWLKDGRFTPLLDIFSHASADMVDIHA  303

Query  647   SAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLL  468
             + +FQ+L   E +YLRIQ              SLTG  SS+D++T+EN++ L+EIG KLL
Sbjct  304   AVLFQSL-RVEKNYLRIQ------------DDSLTGHTSSVDISTKENMQALIEIGNKLL  350

Query  467   KKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             K  V+RVN++TG+ EP+   GTNE+AL R AK
Sbjct  351   KMSVARVNIDTGMYEPVDGEGTNEEALARFAK  382



>gb|ACG31156.1| patatin T5 precursor [Zea mays]
Length=410

 Score =   437 bits (1125),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 213/392 (54%), Positives = 279/392 (71%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++T+LSIDGGGIRG+IPA I+AYLE +LQELDG DAR+ADYFDVI+GTSTG L+ +ML
Sbjct  22    GKLITILSIDGGGIRGLIPATIIAYLEAKLQELDGPDARIADYFDVIAGTSTGALLASML  81

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVFGPKYDGKYLRSLL  1188
              APDEN RPL+AAKD+  FYL NGPKIFPQ K G    +   +  V GPKYDG +L   +
Sbjct  82    AAPDENNRPLFAAKDLTTFYLENGPKIFPQKKAGLLTPLRNLLGLVRGPKYDGVFLHDKI  141

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             K    D+R+ DT+TNV++P FD+K LQP+IFSTY+AK     NA+LSD+CI TSAAPTY 
Sbjct  142   KSLTHDVRVADTVTNVIVPAFDVKYLQPIIFSTYEAKTDTLKNAHLSDICISTSAAPTYF  201

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKP  828
             PAH+F      K E     PP+EY+++DGGVAANNPT+VA+S +TK++   NP+     P
Sbjct  202   PAHFF------KTEATDGRPPREYHLVDGGVAANNPTMVAMSMLTKEVHRRNPNFNAGSP  255

Query  827   MDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHN  648
              + + +L+IS+GTG+A    KY +++ AKWG++ WL +   TP+I++F  ASSDMVD+H 
Sbjct  256   TEYTNYLIISVGTGSAKQAEKYTAEQCAKWGLIQWLYNGGFTPIIDIFSHASSDMVDIHA  315

Query  647   SAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLL  468
             S +FQAL  CE  YLRIQ              +LTG  SS+D+AT+EN+E L+ IG++LL
Sbjct  316   SILFQAL-HCEKKYLRIQ------------DDTLTGNASSVDIATKENMESLISIGQELL  362

Query  467   KKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             KKPV+RVN++TGV E     GTN  +L   AK
Sbjct  363   KKPVARVNIDTGVYESCDGEGTNAQSLADFAK  394



>ref|XP_009603683.1| PREDICTED: patatin-like protein 1 [Nicotiana tomentosiformis]
Length=407

 Score =   437 bits (1124),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 233/391 (60%), Positives = 299/391 (76%), Gaps = 20/391 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++T+L+IDGGGIRGIIP VIL+YLE+QLQELDG+DAR+ADYFD+I+GTSTGGLVTAML
Sbjct  19    GTLITILAIDGGGIRGIIPGVILSYLESQLQELDGKDARIADYFDLIAGTSTGGLVTAML  78

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
              AP+++ RPLYAAKDI PFYL + PKIFPQ  G    I    +++ GPKYDGKYL  L+K
Sbjct  79    AAPNKDKRPLYAAKDITPFYLEHSPKIFPQISGPLAGIINLTKAMGGPKYDGKYLHKLIK  138

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
               L   RL DTLT VVIPTFDIK LQPVIF++Y+A   P ++A L+D+CI TSAAPT+LP
Sbjct  139   DILGGTRLHDTLTAVVIPTFDIKKLQPVIFNSYEAILKPDLDAELADICISTSAAPTFLP  198

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             A+ FK ++    E       +E+N+IDGGVAANNPTLVAI +VTKQ+   + DLFPIKPM
Sbjct  199   AYGFKNKDAQDNE-------REFNLIDGGVAANNPTLVAIGEVTKQVLMQHADLFPIKPM  251

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  RFLVIS+GTG A NE+KYN++ AAKWG+LSWL + +STP+I+ F +AS+DMVD HN 
Sbjct  252   DYGRFLVISLGTGNAKNEHKYNAQMAAKWGLLSWLFNDNSTPIIDAFNQASADMVDFHNF  311

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              VF+AL   ++ YLRIQ              +LTG  +S+D+AT+ENL+ LV++GE LL+
Sbjct  312   VVFKAL-HSDDKYLRIQ------------DDTLTGNLASVDIATKENLQGLVKVGEHLLE  358

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             KPVS++NL+ GV E + + GTN++AL+R AK
Sbjct  359   KPVSKINLDKGVYEAVENGGTNKEALQRFAK  389



>ref|XP_011038245.1| PREDICTED: patatin-like protein 2 isoform X1 [Populus euphratica]
Length=404

 Score =   437 bits (1124),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 243/409 (59%), Positives = 302/409 (74%), Gaps = 22/409 (5%)
 Frame = -3

Query  1592  MVKIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYF  1413
             M  ++   S  Q  T GN +TVLSIDGGGIRGIIP  ILA+LE++LQ+LDG DARLADYF
Sbjct  1     MANMQTPRSPLQLPTRGNHITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLADYF  60

Query  1412  DVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIR  1236
             DVISGTSTGGLVTAML AP++  RPL+AAKDI  FYL N PKIFPQ     F      ++
Sbjct  61    DVISGTSTGGLVTAMLAAPNKQNRPLFAAKDINDFYLENCPKIFPQDSSSKFASAANLVK  120

Query  1235  SVFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNA  1056
             ++ GPKYDGK+L S++K++L D  L  TLTN+VIPTFDIK+LQP IFS+Y+ K  P  + 
Sbjct  121   TLRGPKYDGKFLHSIVKEKLGDTWLQQTLTNIVIPTFDIKHLQPTIFSSYKVKNNPSTDV  180

Query  1055  YLSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQV  876
              LSD+CIGTSAAPTYLPAHYF+ ++   +        +++N+IDGGVAANNPTLVAIS+V
Sbjct  181   LLSDICIGTSAAPTYLPAHYFETKDPSGK-------VRDFNLIDGGVAANNPTLVAISEV  233

Query  875   TKQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPL  696
             +K I    PD + + PM+  RFLV+S+GTGTA +E KY+++EAA+WG+L WL    STPL
Sbjct  234   SKAINREGPDSYHMNPMEYGRFLVLSLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPL  293

Query  695   IEVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVA  516
             ++VF +AS DMVD H S VFQAL   EN YLRIQ              +LTGT SS+DVA
Sbjct  294   VDVFTQASGDMVDFHISTVFQALSSEEN-YLRIQ------------DDTLTGTLSSVDVA  340

Query  515   TEENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             T+ENLE LV++GE+LLKKPVSRVNL TGV EPI +  TNE+AL++LAK 
Sbjct  341   TKENLENLVKVGEELLKKPVSRVNLATGVFEPI-NKMTNEEALRKLAKL  388



>gb|KDP38383.1| hypothetical protein JCGZ_04308 [Jatropha curcas]
Length=412

 Score =   437 bits (1124),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 240/398 (60%), Positives = 297/398 (75%), Gaps = 21/398 (5%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++TVLSIDGGGIRGIIP  IL++LE+QLQ+LDGEDAR+ADYFDVI+GTSTGGL
Sbjct  10    QPPTYGNLITVLSIDGGGIRGIIPGTILSFLESQLQKLDGEDARIADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKG-GWFGEIWVSIRSVFGPKYDGKY  1203
             VTAML AP+E  RP++AAKDIK FYLN  PKIFPQ+    F +    I+++ GPKYDGKY
Sbjct  70    VTAMLAAPNEKNRPVFAAKDIKDFYLNECPKIFPQRSCALFPQTTKVIKAISGPKYDGKY  129

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  L+K++L + RL  TLTNVVIPTFDIK LQP IFS+YQ K  P ++A LSD+CI TSA
Sbjct  130   LHRLVKEKLGNTRLNQTLTNVVIPTFDIKRLQPTIFSSYQVKNKPCLDALLSDICISTSA  189

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYF+ ++  ++ G      +E+N+IDGGVAANNPTLVA+ +VTK+I   + D 
Sbjct  190   APTYLPAHYFETKD--EKTGKV----REFNLIDGGVAANNPTLVAVGEVTKEITKGSQDF  243

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
               IKPMD  RFLVIS+GTG    E KY++ +AAKWG++ WL    STPL++VF  AS+DM
Sbjct  244   LAIKPMDYRRFLVISLGTGAPKAEEKYHAHDAAKWGVIGWLTSNGSTPLVDVFTHASADM  303

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD H S VFQAL  CE++YLRIQ              +L+ T SS+DVAT+ENL+ LV++
Sbjct  304   VDFHISVVFQAL-RCESNYLRIQ------------DDTLSKTVSSVDVATKENLDNLVKV  350

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             GE LLKKPVSRVN ETG+ E +    TNE+AL R AK 
Sbjct  351   GEGLLKKPVSRVNSETGIYESLTKE-TNEEALIRFAKL  387



>gb|KDO79282.1| hypothetical protein CISIN_1g015720mg [Citrus sinensis]
Length=402

 Score =   437 bits (1123),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 241/400 (60%), Positives = 294/400 (74%), Gaps = 24/400 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T  N++T+LSIDGGGIRGIIP VILAYLE+QLQELDGEDARLADYFDVI+GTSTGGL
Sbjct  10    QPPTYANLITILSIDGGGIRGIIPGVILAYLESQLQELDGEDARLADYFDVIAGTSTGGL  69

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVS-IRSVFGPKYDGKY  1203
             +TAMLTAP E  RP+YAAKDI PFY+ +GPKIFPQ  G      V+ +R++ G KYDGKY
Sbjct  70    LTAMLTAPSEQNRPMYAAKDIVPFYIRHGPKIFPQLRGMLANSVVNLVRALMGTKYDGKY  129

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  ++K+ LKD +L  TLTNV IPTFDIK LQP IFS++Q    P ++A L+D+ IGTSA
Sbjct  130   LHKVIKENLKDTKLHQTLTNVAIPTFDIKKLQPTIFSSFQVAASPDLDAQLADIAIGTSA  189

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTY PAHYFK    P + G      KE+N+IDGGVAANNPTLVAIS++TK I   NPD 
Sbjct  190   APTYFPAHYFK---NPDEHGTL----KEFNLIDGGVAANNPTLVAISEMTKHIL-KNPDF  241

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
              PI P+D +RFLVISIGTG+  +E+KYN+K A+KWGI+SWL     TPL++ +  A  DM
Sbjct  242   CPINPLDYTRFLVISIGTGSKKSEHKYNAKMASKWGIISWLYDNGDTPLLDCYGRAIGDM  301

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD H S VFQAL   E++YLRI+              +L G  +S+D+ T+EN E LV  
Sbjct  302   VDYHISVVFQAL-QSEDNYLRIE------------DDTLQGDVTSIDLTTKENFENLVRA  348

Query  482   GEKLLKKPVSRVNLETGVSEPIPH--SGTNEDALKRLAKF  369
             GE LLKKPVSR+NL+TG+ EPI +  +GTNE+ALKR AK 
Sbjct  349   GETLLKKPVSRINLDTGLYEPIENGSAGTNEEALKRFAKM  388



>ref|XP_004152794.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
 ref|XP_004160047.1| PREDICTED: patatin group A-3-like [Cucumis sativus]
Length=416

 Score =   437 bits (1124),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 236/399 (59%), Positives = 299/399 (75%), Gaps = 24/399 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGGIRGIIP  IL +LE++LQ+LDG++ R+ADYFDVI+GTSTGGL
Sbjct  9     QPPTYGNLITILSIDGGGIRGIIPGTILNFLESELQKLDGKEVRVADYFDVIAGTSTGGL  68

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGW-FGEIWVSIRSVFGPKYDGKY  1203
             VTAM++APD+N RPL++AKDI  FYL++ PKIFPQ   W  G I   ++ + GPKYDGKY
Sbjct  69    VTAMISAPDQNNRPLFSAKDINQFYLDHCPKIFPQNRIWPIGRI---VKLLSGPKYDGKY  125

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             LR L+K++L D +L  TLTNVVIPTFDIK LQP IFS+Y+ K  P ++AYLSD+CI TSA
Sbjct  126   LRKLVKEKLGDTKLHQTLTNVVIPTFDIKLLQPTIFSSYEMKNTPSLDAYLSDICISTSA  185

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLP+H FK ++   +        +E+N+IDGGVAANNPTLVAI +VTK++   NPD 
Sbjct  186   APTYLPSHSFKTEDTAAKTT------REFNLIDGGVAANNPTLVAIGEVTKEVIKQNPDF  239

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             F IKPMD  RFLVIS+GTG    E +Y ++ AA+WG+L WL +  STP+I+VF +ASSDM
Sbjct  240   FAIKPMDYRRFLVISLGTGAPKAEKRYTAELAAEWGMLDWLTNGGSTPIIDVFSQASSDM  299

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD H S +FQAL  CE++YLRIQ              +L+G  SS+DVAT++NL  LV++
Sbjct  300   VDFHLSVIFQAL-HCEDNYLRIQ------------DDTLSGDLSSVDVATQKNLNDLVKV  346

Query  482   GEKLLKKPVSRVNLETGVSEPIP-HSGTNEDALKRLAKF  369
             GE LLKKPVSRVNL+TGV E  P +S TN+ AL R AK 
Sbjct  347   GESLLKKPVSRVNLQTGVFEDCPSNSETNDQALTRFAKL  385



>ref|XP_002869007.1| PLA IVA/PLP1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45266.1| PLA IVA/PLP1 [Arabidopsis lyrata subsp. lyrata]
Length=411

 Score =   436 bits (1122),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 221/392 (56%), Positives = 286/392 (73%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G++VT+LS+DGGG+RGII  VILAYLE QLQELDGE+ RLADYFDVI+GTSTGGLVTAML
Sbjct  16    GSLVTILSLDGGGVRGIIAGVILAYLEKQLQELDGENVRLADYFDVIAGTSTGGLVTAML  75

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             TAPD  GRP YAAKDI PFYL + PKIFPQ  G    +    + + GPKY G YLR+L+ 
Sbjct  76    TAPDGTGRPRYAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPKLLSGPKYSGNYLRTLVG  135

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
               L + +L  TLTN+VIPTFDIK LQP  FS+YQA   P +N  +SD+C+GTSAAPT+LP
Sbjct  136   TLLGETKLHQTLTNIVIPTFDIKTLQPTFFSSYQALADPSLNVKVSDICLGTSAAPTFLP  195

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AHYF I++    +G T    +E+N++DGGV ANNPTLVAI+ V+KQI  NNPD+  +KP+
Sbjct  196   AHYFSIED---SQGKT----REFNLVDGGVTANNPTLVAITAVSKQIVKNNPDMGTLKPL  248

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
                +FLVISIGTG+A  E KY++K+AAKWGI+SWL    STP++++ ME+S D+V  H+S
Sbjct  249   GFDKFLVISIGTGSAKKEEKYSAKKAAKWGIISWLYEDGSTPILDITMESSRDIVHYHSS  308

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              +F+AL + E+ YLRI               +L G  S+MD+AT+ NLE L +IGEK+L 
Sbjct  309   VLFKAL-ESEDKYLRID------------DDTLEGDVSNMDLATKSNLENLKKIGEKMLT  355

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
               V+++N++TG  EPI  + TN++ LKR AK 
Sbjct  356   NRVAQMNIDTGAYEPITENITNDEQLKRFAKI  387



>ref|XP_011038242.1| PREDICTED: patatin-like protein 2 [Populus euphratica]
Length=403

 Score =   436 bits (1121),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 238/391 (61%), Positives = 294/391 (75%), Gaps = 21/391 (5%)
 Frame = -3

Query  1541  NIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAMLT  1362
             N +T+LSIDGGGIRGIIP  ILA+LE++LQ+LDG  ARLADYFDVISGTSTGGLVTAML 
Sbjct  18    NQITILSIDGGGIRGIIPGSILAFLESELQKLDGAAARLADYFDVISGTSTGGLVTAMLA  77

Query  1361  APDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLKK  1182
             AP++  RPL+AAKDI  FYL N PKIFPQ G  F      ++++ GPKYDGK+L S++K+
Sbjct  78    APNKQNRPLFAAKDINDFYLENCPKIFPQDGSPFASAANLVKTLRGPKYDGKFLHSIVKE  137

Query  1181  ELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLPA  1002
             +L +I+L  TLTN+VIPTFDIK LQP IFSTYQ K  P  +  LSD+CIGTSAAPTYLPA
Sbjct  138   KLGNIQLHQTLTNIVIPTFDIKRLQPTIFSTYQVKNNPSTDTLLSDICIGTSAAPTYLPA  197

Query  1001  HYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPMD  822
             HYF+ ++   +        +E+N+IDGGVAANNPTLVAIS+V+K I    PD + + PM+
Sbjct  198   HYFETKDPSGK-------VREFNLIDGGVAANNPTLVAISEVSKAINREGPDSYHMNPME  250

Query  821   LSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNSA  642
               RFLV+S+GTGTA +E KY+++EAA+WG+L WL    STPL++VF +AS DMVD H S 
Sbjct  251   YGRFLVLSLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTPLVDVFTQASGDMVDFHIST  310

Query  641   VFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLKK  462
             VFQAL   EN YLRIQ              +LTG  SS+DVAT+ENLE LV++G +LLKK
Sbjct  311   VFQALSSEEN-YLRIQ------------DDTLTGKLSSVDVATKENLENLVKVGVELLKK  357

Query  461   PVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             PVSRVNL TGV EPI +  TNE+AL++LAK 
Sbjct  358   PVSRVNLATGVFEPI-NKMTNEEALRKLAKL  387



>emb|CAN62059.1| hypothetical protein VITISV_024099 [Vitis vinifera]
Length=397

 Score =   436 bits (1121),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 224/398 (56%), Positives = 288/398 (72%), Gaps = 26/398 (7%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G +VTVLSIDGGG+RGIIP  +LA+LE++ QELDG+DAR+ADYFDVI+GTSTGGLVTAML
Sbjct  8     GRMVTVLSIDGGGVRGIIPGTLLAFLESKFQELDGDDARIADYFDVIAGTSTGGLVTAML  67

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVS-----IRSVFGPKYDGKY  1203
             TAP+++ RP +AAKDI  FYL++ P+IFPQ +   FG+  +S     I +V GPKY+GKY
Sbjct  68    TAPNKDNRPXFAAKDINSFYLDHCPEIFPQNRRISFGKSTISRFGSLIDAVRGPKYNGKY  127

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L+SL    L  + L  TLTNVVIPTFDIK LQPVIF T +AK     NA LSD+CI TSA
Sbjct  128   LQSLAVDLLDKVYLKQTLTNVVIPTFDIKLLQPVIFXTDEAKVNVAKNARLSDICISTSA  187

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLPAHYF+ +E        N   + +N+IDGGVAANNPTLVA+S ++K+I  +N   
Sbjct  188   APTYLPAHYFETKEA-------NGKTRSFNLIDGGVAANNPTLVAMSHISKEILMDNTQF  240

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
               +KPMD    LV+S+GTG   +E KY++ EA++WG+  W  +  +TPL+++F  ASSDM
Sbjct  241   IEMKPMDSKSMLVLSLGTGAPKHEEKYSAAEASRWGLHRWAYNNGATPLLDIFSHASSDM  300

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VD+H S VFQ+LG CE +YLRIQ              +LTG +SS+DVAT ENL++L EI
Sbjct  301   VDIHVSTVFQSLG-CEKNYLRIQ------------DDTLTGEESSVDVATTENLQRLGEI  347

Query  482   GEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             G++LL KP+SRVNLETG  E +   GTN++AL + AK 
Sbjct  348   GKELLXKPLSRVNLETGRHEQLEGEGTNQEALTQFAKL  385



>ref|XP_008241509.1| PREDICTED: patatin-like protein 3 [Prunus mume]
Length=405

 Score =   436 bits (1121),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 235/393 (60%), Positives = 291/393 (74%), Gaps = 21/393 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             GN++TVLSIDGGGIRGIIP V+LAYLE+QLQELDGEDARLADYFDVISGTSTGGL+  ML
Sbjct  17    GNLITVLSIDGGGIRGIIPGVLLAYLESQLQELDGEDARLADYFDVISGTSTGGLIATML  76

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
              AP++N RPLYAAKDI PFYL+N PKIFPQ  G   +I   ++ + GPKYDGKYL  L++
Sbjct  77    AAPNDNNRPLYAAKDIVPFYLDNCPKIFPQPRGLCAQIVELVKVLTGPKYDGKYLHKLIR  136

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
               + D RL  TLTNVVIPTFD+K L PVIFS+YQ    P +NA LSD+CIGTSAAPT  P
Sbjct  137   NIVGDKRLDQTLTNVVIPTFDVKKLLPVIFSSYQVTSRPVLNAKLSDICIGTSAAPTLFP  196

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
             AHYF   E   Q+G     PKE+N+IDGGVAANNP  VAIS+V K+  + NPD   IKPM
Sbjct  197   AHYF---ENNDQQG----EPKEFNLIDGGVAANNPASVAISEVIKETKNQNPDFMEIKPM  249

Query  824   DL-SRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHN  648
             +L  R L++S+GTG+  +E KYN+K+A+KWG++ WL    S+PL+E F EAS+ MVD HN
Sbjct  250   ELYDRLLLVSLGTGSDRSELKYNAKKASKWGLIGWLYEDGSSPLLECFDEASACMVDYHN  309

Query  647   SAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLL  468
             S VFQAL   EN YLRI+            + +L G  +S D AT+ENLE LVE+G +LL
Sbjct  310   SVVFQALHSEEN-YLRIE------------EDTLKGNLASADKATQENLENLVEVGNQLL  356

Query  467   KKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +KP+S ++L+TG+ EP+ + GTN+ AL+R AK 
Sbjct  357   QKPISTMDLDTGLYEPVENGGTNQQALQRFAKL  389



>ref|XP_008444643.1| PREDICTED: patatin-like protein 2 [Cucumis melo]
Length=416

 Score =   436 bits (1122),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 296/399 (74%), Gaps = 24/399 (6%)
 Frame = -3

Query  1559  QAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGL  1380
             Q  T GN++T+LSIDGGGIRGIIP  IL +LE++LQ+LDG++ RLADYFDVI+GTSTGGL
Sbjct  9     QPPTYGNLITILSIDGGGIRGIIPGTILNFLESELQKLDGKEVRLADYFDVIAGTSTGGL  68

Query  1379  VTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGW-FGEIWVSIRSVFGPKYDGKY  1203
             VTAM+ APD+N RPL++AKDI  FYL++ PKIFPQ   W  G I   ++ + GPKYDGKY
Sbjct  69    VTAMIAAPDQNNRPLFSAKDINQFYLDHCPKIFPQNRTWPLGRI---VKLLSGPKYDGKY  125

Query  1202  LRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSA  1023
             L  L+K++L D +L  TLTNVVIPTFDIK LQP IFS+Y+ K  P +NAYLSD+CI TSA
Sbjct  126   LHKLVKEKLGDTKLHQTLTNVVIPTFDIKLLQPTIFSSYEMKNTPSLNAYLSDICISTSA  185

Query  1022  APTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDL  843
             APTYLP+H FK ++   +E       +E+N+IDGGVAANNPTLVAI +VTK++    PD 
Sbjct  186   APTYLPSHRFKTEDTAAKET------REFNLIDGGVAANNPTLVAIGEVTKEVIKQTPDF  239

Query  842   FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDM  663
             F IKPMD  RFLVIS+GTG    E +Y ++ AA+WG+L WL +  STP+I+VF +ASSDM
Sbjct  240   FAIKPMDYRRFLVISLGTGAPKAEKRYTAELAAEWGMLDWLTNGGSTPIIDVFSQASSDM  299

Query  662   VDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEI  483
             VDLH S +FQAL  CE +YLRIQ              +L+G  SS+DVATE+NL  LV++
Sbjct  300   VDLHLSVIFQAL-HCEENYLRIQ------------DDTLSGDLSSVDVATEKNLNDLVKV  346

Query  482   GEKLLKKPVSRVNLETGVSEPIP-HSGTNEDALKRLAKF  369
             GE LLKK VSRVNL+TG+ E  P +S TN+ AL R AK 
Sbjct  347   GESLLKKQVSRVNLQTGIFEDCPSNSETNDQALTRFAKL  385



>ref|NP_001151190.1| LOC100284823 [Zea mays]
 gb|ACG41923.1| patatin T5 precursor [Zea mays]
Length=410

 Score =   436 bits (1121),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 212/392 (54%), Positives = 279/392 (71%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++T+LSIDGGGIRG+IPA I+AYLE +LQELDG DAR+ADYFDVI+GTSTG L+ +ML
Sbjct  22    GKLITILSIDGGGIRGLIPATIIAYLEAKLQELDGPDARIADYFDVIAGTSTGALLASML  81

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVFGPKYDGKYLRSLL  1188
              APDEN RPL+AAKD+  FYL NGPKIFPQ K G    +   +  V GPKYDG +L   +
Sbjct  82    AAPDENNRPLFAAKDLTTFYLENGPKIFPQKKAGLLTPLRNLLGLVRGPKYDGVFLHDKI  141

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             K    D+R+ DT+TNV++P FD+K LQP+IFSTY+AK     NA+LSD+CI TSAAPTY 
Sbjct  142   KSLTHDVRVADTVTNVIVPAFDVKYLQPIIFSTYEAKTDALKNAHLSDICISTSAAPTYF  201

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKP  828
             PAH+F      K E     PP+EY+++DGGVAANNPT+VA+S +TK++   NP+     P
Sbjct  202   PAHFF------KTEATDGRPPREYHLVDGGVAANNPTMVAMSMLTKEVHRRNPNFNAGSP  255

Query  827   MDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHN  648
              + + +L+IS+GTG+A    KY +++ AKWG++ WL +   TP+I++F  ASSDMVD+H 
Sbjct  256   TEYTNYLIISVGTGSAKQAEKYTAEQCAKWGLIQWLYNGGFTPIIDIFSHASSDMVDIHA  315

Query  647   SAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLL  468
             S +FQAL  CE  YLRIQ              +LTG  SS+D+AT+EN+E L+ IG++LL
Sbjct  316   SILFQAL-HCEKKYLRIQ------------DDTLTGNASSVDIATKENMESLISIGQELL  362

Query  467   KKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             KKPV+RVN++TG+ E     GTN  +L   AK
Sbjct  363   KKPVARVNIDTGLYESCDGEGTNAQSLADFAK  394



>ref|XP_006411935.1| hypothetical protein EUTSA_v10025343mg [Eutrema salsugineum]
 gb|ESQ53388.1| hypothetical protein EUTSA_v10025343mg [Eutrema salsugineum]
Length=408

 Score =   436 bits (1121),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 221/391 (57%), Positives = 283/391 (72%), Gaps = 20/391 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             GN+VT+LS+DGGG+RGII  VILAYLE QLQELDGED RLADYFDV++GTSTGGLVTAML
Sbjct  16    GNLVTILSLDGGGVRGIIAGVILAYLEKQLQELDGEDVRLADYFDVVAGTSTGGLVTAML  75

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             T PDE GRP +AAKDI PFYL + PKIFPQ  G F  +    + + GPKYDGKYL++LL 
Sbjct  76    TVPDETGRPHFAAKDIVPFYLEHTPKIFPQPEGLFALLPKLPKLLSGPKYDGKYLKNLLS  135

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             K L + RL  TLTNVVI TFDIK LQP IFS+YQ    P ++  LSD+C+GTSAAPTY P
Sbjct  136   KLLGEKRLHQTLTNVVITTFDIKKLQPTIFSSYQTLTDPSLDVKLSDICLGTSAAPTYFP  195

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
              H+F  ++    +G T     E++++DG V+ANNPTLVA++ V+KQI  +NPD+  +KP+
Sbjct  196   PHFFSNED---SQGKTT----EFHLVDGAVSANNPTLVAMTAVSKQILKHNPDMGKLKPL  248

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
                +FLVISIGTGTA  E  Y++K+AAKWGI+SWL    STP++++ ME+S DM+  H+S
Sbjct  249   GYDKFLVISIGTGTAKKEENYSAKKAAKWGIISWLYDDGSTPILDITMESSRDMIHFHSS  308

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              +F+AL   E+ YLRI               +L G +S MD+AT+ NL+ LV+IGEK+LK
Sbjct  309   VLFKAL-QSEDKYLRID------------DDTLEGDESYMDLATKPNLDNLVKIGEKVLK  355

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
               V  +N++TGV EPI  + TN+  LKR AK
Sbjct  356   NRVMHMNIDTGVYEPILENITNDQELKRFAK  386



>gb|ACN25198.1| unknown [Zea mays]
 gb|AFW60363.1| patatin T5 [Zea mays]
Length=410

 Score =   436 bits (1120),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 211/392 (54%), Positives = 279/392 (71%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++T+LSIDGGGIRG+IPA I+AYLE +LQELDG DAR+ADYFDVI+GTSTG L+ +ML
Sbjct  22    GKLITILSIDGGGIRGLIPATIIAYLEAKLQELDGPDARIADYFDVIAGTSTGALLASML  81

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVFGPKYDGKYLRSLL  1188
              APDEN RPL+AAKD+  FYL NGPKIFPQ K G    +   +  V GPKYDG +L   +
Sbjct  82    AAPDENNRPLFAAKDLTTFYLENGPKIFPQKKAGLLTPLRNLLGLVRGPKYDGVFLHDKI  141

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             K    D+R+ DT+TNV++P FD+K+LQP+IFSTY+AK     NA+LSD+CI TSAAPTY 
Sbjct  142   KSLTHDVRVADTVTNVIVPAFDVKSLQPIIFSTYEAKTDTLKNAHLSDICISTSAAPTYF  201

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKP  828
             PAH+F      K E     PP+EY+++DGGVAANNPT+VA+S +TK++   NP+     P
Sbjct  202   PAHFF------KTEATDGRPPREYHLVDGGVAANNPTMVAMSMLTKEVHRRNPNFNAGSP  255

Query  827   MDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHN  648
              + + +L+IS+GTG+A    KY +++ AKWG++ WL +   TP+I++F  ASSDMVD+H 
Sbjct  256   TEYTNYLIISVGTGSAKQAEKYTAEQCAKWGLIQWLYNGGFTPIIDIFSHASSDMVDIHA  315

Query  647   SAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLL  468
             S +FQAL  CE  YLRIQ              +LTG  SS+D+AT+EN+E L+ IG++LL
Sbjct  316   SILFQAL-HCEKKYLRIQ------------DDTLTGNASSVDIATKENMESLISIGQELL  362

Query  467   KKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
              KPV+RVN++TG+ E     GTN  +L   AK
Sbjct  363   NKPVARVNIDTGLYESCEGEGTNAQSLADFAK  394



>ref|XP_004291132.1| PREDICTED: patatin group A-3-like [Fragaria vesca subsp. vesca]
Length=407

 Score =   435 bits (1119),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 242/407 (59%), Positives = 304/407 (75%), Gaps = 23/407 (6%)
 Frame = -3

Query  1583  IERKPS-QTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             +ER  S   Q  T GN++TVLSIDGGGIRGIIP  ILA+LE++LQ+LDGEDARLADYFDV
Sbjct  1     MERTSSFAMQPPTFGNLITVLSIDGGGIRGIIPGTILAFLESELQKLDGEDARLADYFDV  60

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGW-FGEIWVSIRSV  1230
             ISGTSTGGLVTAMLTAP+EN RPL++AKDIK FYL + PKIFPQK GW F      I+++
Sbjct  61    ISGTSTGGLVTAMLTAPNENNRPLFSAKDIKDFYLTHSPKIFPQKSGWLFPRARKIIKAL  120

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  L++++L D +L  TLTNVVIP FDIK+LQP IFS+++ K  P  +A L
Sbjct  121   AGPKYDGKYLHGLVREKLGDKKLNQTLTNVVIPAFDIKSLQPAIFSSFEVKNKPTFDALL  180

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+CI TSAAPTYLPAH+FK        G+ N   +E+++IDGG+AANNPTLVAI +VTK
Sbjct  181   SDICIATSAAPTYLPAHFFKTN------GL-NGEVREFHLIDGGLAANNPTLVAIGEVTK  233

Query  869   QIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIE  690
             +I   + D FPIKPMD  RFLVIS+GTG++    KYN+  A+KWG+L+WL   +STPLI+
Sbjct  234   EIIKGSSDFFPIKPMDYGRFLVISLGTGSSKAGLKYNAHVASKWGVLNWLTSGASTPLID  293

Query  689   VFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATE  510
              F +AS+DMVDLH S VF+AL   EN+YLRIQ              +L+G  SS+D+AT+
Sbjct  294   AFSQASADMVDLHLSGVFKAL-HSENNYLRIQ------------DDTLSGDVSSVDIATQ  340

Query  509   ENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             +NL++L+++G+ LLK+PVSRVNLETG  E   +  TN  AL R AK 
Sbjct  341   KNLDRLLKVGDGLLKQPVSRVNLETGKFEACNYE-TNAMALIRFAKL  386



>ref|XP_010432097.1| PREDICTED: patatin-like protein 1 [Camelina sativa]
Length=414

 Score =   436 bits (1120),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 220/392 (56%), Positives = 282/392 (72%), Gaps = 20/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G++VT+LS+DGGG+RG+I  VILAYLE QLQELDGEDARLADYFDVI+GTSTGGLVTAML
Sbjct  16    GSLVTILSLDGGGVRGVIAGVILAYLEKQLQELDGEDARLADYFDVIAGTSTGGLVTAML  75

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             T PDE GRP +AAKDI PFYL + PKIFPQ  G    +    + + GPKY GKYLR+LL 
Sbjct  76    TVPDETGRPHFAAKDIVPFYLEHCPKIFPQPAGVLALLPKLPKLLSGPKYSGKYLRNLLS  135

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             K L + +L  TLTNVVIPT+DIK LQP IFS+YQA   P +N  +SD+C+GTS+APT+ P
Sbjct  136   KLLGETKLHQTLTNVVIPTYDIKKLQPTIFSSYQALADPSLNVKVSDICVGTSSAPTFFP  195

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
              HYF  ++    +G T     E+N++DG + ANNPTLVA++ V+KQI  NNPD+  IKP+
Sbjct  196   PHYFSNED---SQGKTT----EFNLVDGAITANNPTLVAMTAVSKQIVKNNPDMGDIKPL  248

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
                +FLVISIGTG+   E KY++K+AAKWGI+SWL    STP++++ ME+S DM+  H+S
Sbjct  249   GYDQFLVISIGTGSTKREEKYSAKKAAKWGIISWLYDNGSTPILDITMESSRDMIHYHSS  308

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              VF+AL   E+ YLRI               +L G  S MD+AT+ NLE LV+IGEK+L 
Sbjct  309   VVFKAL-QSEDKYLRID------------DDTLDGDVSLMDLATKSNLENLVKIGEKILS  355

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
               V  +N++TGV EP+P +  N++ LKR AK 
Sbjct  356   NRVVHMNIDTGVYEPVPENINNDEQLKRYAKI  387



>ref|XP_011038244.1| PREDICTED: patatin-like protein 2 isoform X2 [Populus euphratica]
Length=403

 Score =   435 bits (1119),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 243/410 (59%), Positives = 300/410 (73%), Gaps = 25/410 (6%)
 Frame = -3

Query  1592  MVKIE--RKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLAD  1419
             MV ++  R P Q  AH  GN +TVLSIDGGGIRGIIP  ILA+LE++LQ+LDG DARLAD
Sbjct  1     MVNMQTPRSPLQRPAH--GNQITVLSIDGGGIRGIIPGTILAFLESELQKLDGPDARLAD  58

Query  1418  YFDVISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSI  1239
             YFDVISGTSTGGLVTAML AP++  RPL+AAKDI  FYL N PKIFPQ    F      +
Sbjct  59    YFDVISGTSTGGLVTAMLAAPNKQNRPLFAAKDINEFYLENCPKIFPQDSSKFASAANLV  118

Query  1238  RSVFGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMN  1059
             +++ GPKYDGK+L  ++K++L D  L  TLTN+VIPTFDIK LQP IFS+   K  P  +
Sbjct  119   KTLRGPKYDGKFLHGIVKEKLGDTWLQQTLTNIVIPTFDIKRLQPTIFSSCNVKNNPSTD  178

Query  1058  AYLSDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQ  879
             A LSD+CIGTSAAPTYLPAHYF+ ++   +        +E+N+IDGGVAANNPTLVAIS+
Sbjct  179   ALLSDICIGTSAAPTYLPAHYFETKDPSGK-------VREFNLIDGGVAANNPTLVAISE  231

Query  878   VTKQIFDNNPDLFPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTP  699
             V++ I    PD + + PM+  RFLV+S+GTGTA +E KY+++EAA+WG+L WL    STP
Sbjct  232   VSQAINREGPDSYHMNPMEYGRFLVLSLGTGTAKSEEKYDAEEAAEWGVLGWLTSDHSTP  291

Query  698   LIEVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDV  519
             L++VF +AS DMVD H S VFQAL   EN YLRIQ              +LTGT SS+DV
Sbjct  292   LVDVFTQASGDMVDFHISTVFQALNSEEN-YLRIQ------------DDTLTGTLSSVDV  338

Query  518   ATEENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             AT ENLE L ++GE+LLKKPVSRVNL TG+ EPI +  TNE+AL++LAK 
Sbjct  339   ATNENLENLGKVGEELLKKPVSRVNLATGIFEPI-NKMTNEEALRKLAKL  387



>ref|XP_009370177.1| PREDICTED: patatin-like protein 2 [Pyrus x bretschneideri]
Length=416

 Score =   436 bits (1120),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 235/406 (58%), Positives = 299/406 (74%), Gaps = 23/406 (6%)
 Frame = -3

Query  1586  KIERKPSQTQAHTGGNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDV  1407
             ++ER  S  Q+ T GN+VTVLSIDGGGIRGIIP  IL++LE++LQ+LDGE  RLADYFDV
Sbjct  7     QMERARSFLQSPTYGNLVTVLSIDGGGIRGIIPGTILSFLESELQKLDGEGVRLADYFDV  66

Query  1406  ISGTSTGGLVTAMLTAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGG-WFGEIWVSIRSV  1230
             I+GTSTGGLVTAMLT PDE+ RPL++AKDI  FYL + PKIFPQ     FG+    ++++
Sbjct  67    IAGTSTGGLVTAMLTTPDEHDRPLFSAKDINAFYLEHCPKIFPQNSAPLFGKAVDMVKAM  126

Query  1229  FGPKYDGKYLRSLLKKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYL  1050
              GPKYDGKYL  ++K++L D RL DTLTNV+IPTFDIK LQP IFS+Y+AK+   +NA L
Sbjct  127   TGPKYDGKYLHEIVKEKLGDKRLNDTLTNVIIPTFDIKQLQPTIFSSYEAKKKSSINALL  186

Query  1049  SDVCIGTSAAPTYLPAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTK  870
             SD+CI TSAAPTYLPAH+F+ +    +        +E+N+IDG VAANNP LVAI +VT+
Sbjct  187   SDICIATSAAPTYLPAHHFETKTSTGE-------TREFNLIDGAVAANNPALVAIGEVTR  239

Query  869   QIFDNNPDL-FPIKPMDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLI  693
             ++   N D  F ++P D  RFLV+S+GTG+   E KY++ + AKWG+ +WL    S PL+
Sbjct  240   EVHQGNSDFSFSMRPTDYGRFLVVSLGTGSPKCEEKYHANDVAKWGLAAWLTSGGSCPLV  299

Query  692   EVFMEASSDMVDLHNSAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVAT  513
             +VF +AS+DMVD H + VFQAL +CE SYLRIQ              +L  T SSMD+AT
Sbjct  300   DVFNQASNDMVDFHLATVFQAL-NCEKSYLRIQ------------DDTLEKTVSSMDIAT  346

Query  512   EENLEKLVEIGEKLLKKPVSRVNLETGVSEPIPHSGTNEDALKRLA  375
             EENL  L+++GEKLLKKPVSRVNL+TGV EP  H  TNE+AL R+A
Sbjct  347   EENLNNLIKVGEKLLKKPVSRVNLDTGVFEP-AHQSTNEEALVRIA  391



>ref|XP_006660213.1| PREDICTED: patatin-3-Kuras 1-like, partial [Oryza brachyantha]
Length=412

 Score =   435 bits (1119),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 222/392 (57%), Positives = 286/392 (73%), Gaps = 23/392 (6%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G+IVTVLSIDGGG+RGIIP  ILA+LE +LQE+DG +AR+ADYFDV++GTSTGG+VTAML
Sbjct  28    GSIVTVLSIDGGGVRGIIPGTILAFLEEKLQEIDGPEARIADYFDVVAGTSTGGVVTAML  87

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQKGGWFGEIWVSIRSVFGPKYDGKYLRSLLK  1185
             TAPD+ GRPL+AAK I  FYL + PKIFP +    G I  S+ S  GPKYDGKYL S+++
Sbjct  88    TAPDDQGRPLFAAKGINDFYLEHSPKIFPPRRSNLGLIK-SLMS--GPKYDGKYLHSVVQ  144

Query  1184  KELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYLP  1005
             K L D R+  TLTNVVIPTFDIK LQP+ FS + A+     NA LSDVCI TSAAPTYLP
Sbjct  145   KLLGDKRVNQTLTNVVIPTFDIKLLQPITFSRFDAQNDESKNALLSDVCISTSAAPTYLP  204

Query  1004  AHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKPM  825
              H F+ ++   ++G +    + +N+IDGGVAANNPTL+A++ V+KQI   N D FPIKP 
Sbjct  205   GHRFETKD---KDGNS----RAFNLIDGGVAANNPTLLAMTHVSKQILLGNKDFFPIKPT  257

Query  824   DLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHNS  645
             D  +F+++S+GTG+A  E KY++ +++KWGIL WL H  STPLI+ F +AS+D+VD+H S
Sbjct  258   DYGKFMILSLGTGSAKIEQKYDATQSSKWGILDWLYHDGSTPLIDSFSQASADLVDIHAS  317

Query  644   AVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLLK  465
              +FQAL  C+ SYLRIQ               LTG  +S+DV+T ENL +LV++G  LLK
Sbjct  318   VLFQAL-RCQRSYLRIQ------------DDELTGDAASVDVSTPENLRRLVDVGRALLK  364

Query  464   KPVSRVNLETGVSEPIPHSGTNEDALKRLAKF  369
             KP  +VN+ETG +EP    GTNE+ LK  A+ 
Sbjct  365   KPACKVNVETGRNEPDMDRGTNEEELKHFAEM  396



>tpg|DAA42306.1| TPA: patatin T5 [Zea mays]
Length=407

 Score =   435 bits (1118),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 210/392 (54%), Positives = 281/392 (72%), Gaps = 21/392 (5%)
 Frame = -3

Query  1544  GNIVTVLSIDGGGIRGIIPAVILAYLETQLQELDGEDARLADYFDVISGTSTGGLVTAML  1365
             G ++T+LSIDGGGIRG+IPA I+A+LE +LQELDG DAR+ADYFDVI+GTSTG L+T+ML
Sbjct  20    GKLITILSIDGGGIRGLIPATIIAHLEAKLQELDGPDARIADYFDVIAGTSTGALLTSML  79

Query  1364  TAPDENGRPLYAAKDIKPFYLNNGPKIFPQ-KGGWFGEIWVSIRSVFGPKYDGKYLRSLL  1188
              APD+N RPL+AAKD+  FYL NGPKIFPQ K G+   +   +  V GPKYDG +L   +
Sbjct  80    AAPDQNNRPLFAAKDLNTFYLENGPKIFPQKKAGFLTPVANLLGLVRGPKYDGVFLHDKI  139

Query  1187  KKELKDIRLTDTLTNVVIPTFDIKNLQPVIFSTYQAKRCPKMNAYLSDVCIGTSAAPTYL  1008
             K    D+R+ DT+TNV++P FD+K LQP+IFSTY+AK     NA+LSD+CI TSAAPTY 
Sbjct  140   KSLTHDVRVADTVTNVIVPAFDVKYLQPIIFSTYEAKNDTLKNAHLSDICISTSAAPTYF  199

Query  1007  PAHYFKIQEGPKQEGITNHPPKEYNVIDGGVAANNPTLVAISQVTKQIFDNNPDLFPIKP  828
             PAH+FK +        T+   +E++++DGGVAANNPT+VA+S +TK++   NPD    +P
Sbjct  200   PAHFFKTEA-------TDGRSREFHLVDGGVAANNPTMVAMSMLTKEVLRRNPDFNAGRP  252

Query  827   MDLSRFLVISIGTGTAGNEYKYNSKEAAKWGILSWLLHKSSTPLIEVFMEASSDMVDLHN  648
              + + +L+IS+GTG+A    KY + + AKWG+  WL +   TP+I++F  ASSDMVD+H 
Sbjct  253   TEYTNYLIISVGTGSAKQAEKYTAPQCAKWGLFQWLYNGGFTPIIDIFSHASSDMVDIHA  312

Query  647   SAVFQALGDCENSYLRIQVPASIPIPIHSFQTSLTGTQSSMDVATEENLEKLVEIGEKLL  468
             + +FQAL  CE +YLRIQ              +L G  SS+D+AT+EN+E L+ IG+ LL
Sbjct  313   AVLFQAL-HCEKNYLRIQ------------DDTLIGNTSSVDIATKENMESLIGIGQDLL  359

Query  467   KKPVSRVNLETGVSEPIPHSGTNEDALKRLAK  372
             KKPV+RVN++TGV EP    GTN +AL   AK
Sbjct  360   KKPVARVNIDTGVYEPCSGEGTNAEALAHFAK  391



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5074203830354