BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23669_g1_i1 len=1003 path=[419:0-260 680:261-416 836:417-455
3866:456-473 3011:474-521 997:522-531 1007:532-612 3733:613-629
4027:630-650 3770:651-723 3257:724-800 861:801-843 904:844-880
1270:881-1002]

Length=1003
                                                                      Score     E

ref|XP_009794563.1|  PREDICTED: TMV resistance protein N-like           221   7e-68   
gb|AAL07542.1|  resistance gene analog NBS7                             214   1e-63   Helianthus annuus
ref|XP_009630491.1|  PREDICTED: uncharacterized protein LOC104120435    228   7e-63   
ref|XP_004243783.1|  PREDICTED: TMV resistance protein N-like           224   4e-62   
ref|XP_006348979.1|  PREDICTED: TMV resistance protein N-like           221   2e-61   
gb|AAP44392.1|  nematode resistance-like protein                        220   1e-60   Solanum tuberosum [potatoes]
ref|XP_006350421.1|  PREDICTED: TMV resistance protein N-like           218   2e-60   
gb|AAP44393.1|  nematode resistance-like protein                        219   2e-60   Solanum tuberosum [potatoes]
gb|AAP44390.1|  nematode resistance protein                             218   7e-60   Solanum tuberosum [potatoes]
ref|XP_004237584.1|  PREDICTED: TMV resistance protein N-like           218   1e-59   
gb|AAP44391.1|  nematode resistance-like protein                        216   2e-59   Solanum tuberosum [potatoes]
ref|XP_011015316.1|  PREDICTED: TMV resistance protein N-like           199   3e-59   
gb|AAL07541.1|  resistance gene analog NBS6                             202   2e-58   Helianthus annuus
gb|AAL07536.1|  resistance gene analog NBS1                             202   4e-58   Helianthus annuus
ref|XP_004237202.1|  PREDICTED: TMV resistance protein N-like           213   1e-57   
gb|AAL07540.1|  resistance gene analog NBS5                             199   1e-57   Helianthus annuus
ref|XP_002325743.2|  hypothetical protein POPTR_0019s00880g             195   1e-57   Populus trichocarpa [western balsam poplar]
emb|CAN64588.1|  hypothetical protein VITISV_008452                     199   1e-57   Vitis vinifera
ref|XP_006360469.1|  PREDICTED: TMV resistance protein N-like           212   2e-57   
ref|XP_008359477.1|  PREDICTED: TMV resistance protein N-like           196   2e-57   
ref|XP_009794566.1|  PREDICTED: TMV resistance protein N-like iso...    211   2e-57   
ref|XP_009794564.1|  PREDICTED: TMV resistance protein N-like iso...    211   2e-57   
emb|CDP04904.1|  unnamed protein product                                211   4e-57   
gb|AAL07544.1|  resistance gene analog NBS9                             197   1e-56   Helianthus annuus
ref|XP_006364843.1|  PREDICTED: TMV resistance protein N-like           209   2e-56   
gb|AAL07543.1|  resistance gene analog NBS8                             194   4e-56   Helianthus annuus
gb|AAL07539.1|  resistance gene analog NBS4                             194   1e-55   Helianthus annuus
emb|CDP07826.1|  unnamed protein product                                206   2e-55   
ref|XP_004233763.1|  PREDICTED: TMV resistance protein N-like           205   3e-55   
gb|AAN73010.1|  NBS-LRR resistance protein RAS5-1                       197   4e-55   Helianthus annuus
emb|CAN61899.1|  hypothetical protein VITISV_029813                     188   7e-55   Vitis vinifera
ref|XP_010665436.1|  PREDICTED: TMV resistance protein N-like           193   7e-55   
ref|XP_006371051.1|  hypothetical protein POPTR_0019s02990g             189   1e-54   
ref|XP_007199954.1|  hypothetical protein PRUPE_ppa1027179mg            203   1e-54   
ref|XP_006373535.1|  hypothetical protein POPTR_0017s14605g             187   1e-54   
ref|XP_006373440.1|  hypothetical protein POPTR_0017s13775g             187   1e-54   
gb|ABK96264.1|  unknown                                                 191   2e-54   Populus trichocarpa x Populus deltoides
ref|XP_009366532.1|  PREDICTED: TMV resistance protein N-like           199   2e-54   
ref|XP_006373435.1|  hypothetical protein POPTR_0017s13755g             187   2e-54   
gb|AEI27416.1|  TIR_3                                                   202   2e-54   
emb|CAC95120.1|  TIR/NBS/LRR protein                                    188   2e-54   Populus deltoides
ref|XP_006380156.1|  hypothetical protein POPTR_0008s22420g             187   3e-54   
emb|CDP20523.1|  unnamed protein product                                202   3e-54   
ref|XP_006388458.1|  hypothetical protein POPTR_0182s00230g             186   4e-54   
gb|AAL07535.1|  resistance gene analog PU3                              199   4e-54   Helianthus annuus
ref|XP_006373432.1|  hypothetical protein POPTR_0017s13740g             186   5e-54   
ref|XP_004289883.1|  PREDICTED: TMV resistance protein N-like           187   5e-54   
emb|CAN62709.1|  hypothetical protein VITISV_035615                     185   7e-54   Vitis vinifera
ref|XP_010057031.1|  PREDICTED: TMV resistance protein N-like           185   7e-54   
ref|XP_009803658.1|  PREDICTED: TMV resistance protein N-like           201   8e-54   
gb|AAL07537.1|  resistance gene analog NBS2                             187   1e-53   Helianthus annuus
ref|XP_009622249.1|  PREDICTED: TMV resistance protein N-like           200   2e-53   
ref|XP_011044953.1|  PREDICTED: TMV resistance protein N-like           195   2e-53   
ref|XP_007201658.1|  hypothetical protein PRUPE_ppa022091mg             200   2e-53   
ref|XP_006376197.1|  hypothetical protein POPTR_0013s10750g             184   2e-53   
gb|KGN59547.1|  hypothetical protein Csa_3G824920                       199   2e-53   
ref|XP_004310272.1|  PREDICTED: TMV resistance protein N-like           201   3e-53   
ref|XP_010646556.1|  PREDICTED: putative disease resistance prote...    196   3e-53   
gb|KDO36130.1|  hypothetical protein CISIN_1g045860mg                   184   3e-53   
ref|XP_004310257.1|  PREDICTED: TMV resistance protein N-like           195   3e-53   
ref|XP_006389203.1|  hypothetical protein POPTR_0035s00240g             184   3e-53   
ref|XP_010657879.1|  PREDICTED: TMV resistance protein N-like           183   4e-53   
ref|XP_006389148.1|  hypothetical protein POPTR_0043s00285g             184   4e-53   
ref|XP_010645942.1|  PREDICTED: TMV resistance protein N-like           188   4e-53   
ref|XP_010041655.1|  PREDICTED: TMV resistance protein N-like           183   6e-53   
emb|CAC95127.1|  part I of G08 TIR/NBS/LRR protein                      185   6e-53   Populus deltoides
ref|XP_004159650.1|  PREDICTED: TMV resistance protein N-like           197   6e-53   
ref|XP_010103728.1|  TMV resistance protein N                           184   7e-53   
ref|XP_004136800.1|  PREDICTED: TMV resistance protein N-like           197   7e-53   
gb|KDO40203.1|  hypothetical protein CISIN_1g047667mg                   182   8e-53   
ref|XP_007221062.1|  hypothetical protein PRUPE_ppa016235mg             185   8e-53   
ref|XP_010665217.1|  PREDICTED: TMV resistance protein N-like           193   9e-53   
ref|XP_009343054.1|  PREDICTED: TMV resistance protein N-like           198   1e-52   
gb|ABF81466.1|  TIR-NBS type disease resistance protein                 198   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_006386003.1|  hypothetical protein POPTR_0003s19910g             198   1e-52   
ref|XP_011044910.1|  PREDICTED: TMV resistance protein N-like           195   1e-52   
emb|CAN82451.1|  hypothetical protein VITISV_003325                     182   1e-52   Vitis vinifera
ref|XP_010263414.1|  PREDICTED: TMV resistance protein N-like           197   1e-52   
ref|XP_006371043.1|  hypothetical protein POPTR_0019s029202g            185   2e-52   
ref|XP_006441742.1|  hypothetical protein CICLE_v10024129mg             184   2e-52   
gb|KCW59373.1|  hypothetical protein EUGRSUZ_H020741                    188   2e-52   
gb|KCW59383.1|  hypothetical protein EUGRSUZ_H02089                     183   2e-52   
ref|XP_009348253.1|  PREDICTED: TMV resistance protein N-like           197   2e-52   
ref|XP_010665186.1|  PREDICTED: TMV resistance protein N-like iso...    197   3e-52   
ref|XP_006370854.1|  hypothetical protein POPTR_0019s00940g             182   3e-52   
emb|CAN75332.1|  hypothetical protein VITISV_004838                     183   3e-52   Vitis vinifera
ref|XP_010657773.1|  PREDICTED: TMV resistance protein N-like iso...    181   4e-52   
ref|XP_010058762.1|  PREDICTED: TMV resistance protein N-like           188   4e-52   
ref|XP_009348251.1|  PREDICTED: TMV resistance protein N-like iso...    197   4e-52   
ref|XP_009348249.1|  PREDICTED: TMV resistance protein N-like iso...    197   4e-52   
ref|XP_009348250.1|  PREDICTED: TMV resistance protein N-like iso...    197   4e-52   
gb|KDO39318.1|  hypothetical protein CISIN_1g031151mg                   181   4e-52   
ref|XP_010665187.1|  PREDICTED: TMV resistance protein N-like iso...    197   4e-52   
emb|CBI23852.3|  unnamed protein product                                188   4e-52   
gb|KCW59343.1|  hypothetical protein EUGRSUZ_H020322                    182   4e-52   
ref|XP_010058830.1|  PREDICTED: TMV resistance protein N-like           184   5e-52   
ref|XP_004136801.1|  PREDICTED: TMV resistance protein N-like           187   5e-52   
ref|XP_004159649.1|  PREDICTED: TMV resistance protein N-like           187   5e-52   
ref|XP_010665433.1|  PREDICTED: TMV resistance protein N-like           183   6e-52   
ref|XP_008361342.1|  PREDICTED: TMV resistance protein N-like iso...    196   6e-52   
gb|KDO36805.1|  hypothetical protein CISIN_1g031401mg                   180   6e-52   
ref|XP_010056818.1|  PREDICTED: TMV resistance protein N-like           180   6e-52   
ref|XP_010070519.1|  PREDICTED: TMV resistance protein N-like           182   7e-52   
ref|XP_006388700.1|  hypothetical protein POPTR_0117s00220g             191   7e-52   
emb|CAN76376.1|  hypothetical protein VITISV_041939                     185   8e-52   Vitis vinifera
ref|XP_006492482.1|  PREDICTED: TMV resistance protein N-like           180   8e-52   
ref|XP_010243120.1|  PREDICTED: TMV resistance protein N-like           195   8e-52   
ref|XP_003634551.1|  PREDICTED: TMV resistance protein N-like           182   9e-52   
ref|XP_008353720.1|  PREDICTED: TMV resistance protein N-like           180   1e-51   
gb|KDO38417.1|  hypothetical protein CISIN_1g036738mg                   186   1e-51   
ref|XP_008236673.1|  PREDICTED: TMV resistance protein N-like           182   1e-51   
ref|XP_008361338.1|  PREDICTED: TMV resistance protein N-like iso...    196   1e-51   
ref|XP_008350156.1|  PREDICTED: TMV resistance protein N-like           195   1e-51   
gb|KCW73592.1|  hypothetical protein EUGRSUZ_E02152                     194   1e-51   
ref|XP_010058765.1|  PREDICTED: TMV resistance protein N-like           179   1e-51   
ref|XP_006495109.1|  PREDICTED: TMV resistance protein N-like           182   2e-51   
emb|CAN61853.1|  hypothetical protein VITISV_027841                     195   2e-51   Vitis vinifera
ref|XP_010056751.1|  PREDICTED: TMV resistance protein N-like iso...    194   2e-51   
emb|CAN66817.1|  hypothetical protein VITISV_034310                     187   2e-51   Vitis vinifera
gb|KCW73642.1|  hypothetical protein EUGRSUZ_E02219                     192   2e-51   
ref|XP_010056755.1|  PREDICTED: TMV resistance protein N-like iso...    194   2e-51   
ref|XP_010070517.1|  PREDICTED: TMV resistance protein N-like           189   2e-51   
ref|XP_011001266.1|  PREDICTED: TMV resistance protein N-like           194   2e-51   
ref|XP_010665235.1|  PREDICTED: TMV resistance protein N-like           194   2e-51   
ref|XP_006494061.1|  PREDICTED: TMV resistance protein N-like           187   2e-51   
ref|XP_010044029.1|  PREDICTED: TMV resistance protein N-like           191   2e-51   
ref|XP_004310267.1|  PREDICTED: TMV resistance protein N-like           179   2e-51   
ref|XP_010665437.1|  PREDICTED: TMV resistance protein N-like           179   3e-51   
gb|KCW59126.1|  hypothetical protein EUGRSUZ_H01748                     181   3e-51   
ref|XP_010058821.1|  PREDICTED: TMV resistance protein N-like           178   3e-51   
ref|XP_006495365.1|  PREDICTED: TMV resistance protein N-like           178   3e-51   
ref|XP_010058800.1|  PREDICTED: TMV resistance protein N-like           192   3e-51   
ref|XP_006495387.1|  PREDICTED: TMV resistance protein N-like           180   4e-51   
ref|XP_006370843.1|  hypothetical protein POPTR_0019s00720g             188   4e-51   
ref|XP_008443388.1|  PREDICTED: TMV resistance protein N                193   5e-51   
ref|XP_008371224.1|  PREDICTED: TMV resistance protein N-like           178   5e-51   
ref|XP_002524855.1|  ATP binding protein, putative                      190   5e-51   Ricinus communis
ref|XP_007224475.1|  hypothetical protein PRUPE_ppa022336mg             191   5e-51   
ref|XP_008236760.1|  PREDICTED: TMV resistance protein N-like           178   5e-51   
ref|XP_010059172.1|  PREDICTED: TMV resistance protein N-like           181   5e-51   
ref|XP_004310258.1|  PREDICTED: TMV resistance protein N-like           189   7e-51   
ref|XP_010245185.1|  PREDICTED: TMV resistance protein N-like           192   7e-51   
ref|XP_006442201.1|  hypothetical protein CICLE_v10021500mg             182   7e-51   
emb|CBI23856.3|  unnamed protein product                                181   8e-51   
ref|XP_011012884.1|  PREDICTED: TMV resistance protein N-like           191   8e-51   
ref|XP_010070629.1|  PREDICTED: toll/interleukin-1 receptor-like ...    182   8e-51   
gb|KHN27791.1|  TMV resistance protein N                                177   8e-51   
ref|XP_010058776.1|  PREDICTED: TMV resistance protein N-like           178   9e-51   
ref|XP_011012882.1|  PREDICTED: TMV resistance protein N-like           192   1e-50   
gb|KCW59360.1|  hypothetical protein EUGRSUZ_H02058                     187   1e-50   
ref|XP_011011963.1|  PREDICTED: TMV resistance protein N-like iso...    192   1e-50   
ref|XP_010104209.1|  TMV resistance protein N                           193   1e-50   
ref|XP_006492809.1|  PREDICTED: vesicle-associated protein 1-4-like     183   1e-50   
ref|XP_004289198.1|  PREDICTED: TMV resistance protein N-like           187   1e-50   
ref|XP_006385995.1|  hypothetical protein POPTR_0003s19850g             192   2e-50   
ref|XP_006371055.1|  hypothetical protein POPTR_0019s03015g             186   2e-50   
gb|ABF81468.1|  TIR-NBS-LRR type disease resistance protein             191   2e-50   Populus trichocarpa [western balsam poplar]
emb|CDP14589.1|  unnamed protein product                                186   2e-50   
ref|XP_006441740.1|  hypothetical protein CICLE_v100235051mg            176   2e-50   
ref|XP_006376071.1|  hypothetical protein POPTR_0013s088501g            179   2e-50   
ref|XP_004292155.1|  PREDICTED: TMV resistance protein N-like           192   2e-50   
gb|KCW74410.1|  hypothetical protein EUGRSUZ_E03094                     176   2e-50   
gb|KCW59364.1|  hypothetical protein EUGRSUZ_H02067                     187   2e-50   
ref|XP_010041148.1|  PREDICTED: TMV resistance protein N-like           176   2e-50   
gb|ABF81437.1|  TIR-NBS-LRR-TIR type disease resistance protein         191   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_010263322.1|  PREDICTED: TMV resistance protein N-like           177   2e-50   
ref|XP_006376076.1|  hypothetical protein POPTR_0013s08890g             176   3e-50   
gb|KCW73580.1|  hypothetical protein EUGRSUZ_E02138                     189   3e-50   
gb|KCW73653.1|  hypothetical protein EUGRSUZ_E02234                     189   3e-50   
ref|XP_010026443.1|  PREDICTED: TMV resistance protein N-like           187   4e-50   
ref|XP_010644028.1|  PREDICTED: uncharacterized protein LOC100261885    192   4e-50   
ref|XP_002304785.2|  hypothetical protein POPTR_0003s19950g             191   4e-50   Populus trichocarpa [western balsam poplar]
ref|XP_010058787.1|  PREDICTED: TMV resistance protein N-like           184   4e-50   
emb|CBI40962.3|  unnamed protein product                                191   4e-50   
gb|KGN59549.1|  hypothetical protein Csa_3G824940                       187   4e-50   
gb|KCW59177.1|  hypothetical protein EUGRSUZ_H01824                     176   5e-50   
emb|CAD36200.1|  TIR-NBS disease resistance protein                     186   5e-50   Populus trichocarpa [western balsam poplar]
ref|XP_011011962.1|  PREDICTED: TMV resistance protein N-like           180   5e-50   
emb|CBI23894.3|  unnamed protein product                                177   5e-50   
ref|XP_003634573.1|  PREDICTED: probable disease resistance prote...    187   5e-50   
ref|XP_010665371.1|  PREDICTED: TMV resistance protein N-like           190   5e-50   
ref|XP_010650303.1|  PREDICTED: toll/interleukin-1 receptor-like ...    176   6e-50   
ref|XP_010058913.1|  PREDICTED: TMV resistance protein N-like           175   6e-50   
gb|ABF81464.1|  TIR-NBS-LRR type disease resistance protein             191   6e-50   Populus trichocarpa [western balsam poplar]
gb|KCW74568.1|  hypothetical protein EUGRSUZ_E03285                     185   6e-50   
gb|KDO36672.1|  hypothetical protein CISIN_1g035646mg                   186   6e-50   
ref|XP_010059269.1|  PREDICTED: TMV resistance protein N-like           185   6e-50   
ref|XP_010026312.1|  PREDICTED: TMV resistance protein N-like           188   7e-50   
ref|XP_010646047.1|  PREDICTED: TMV resistance protein N-like           176   7e-50   
ref|XP_002325273.2|  hypothetical protein POPTR_0019s01200g             187   8e-50   Populus trichocarpa [western balsam poplar]
ref|XP_010059096.1|  PREDICTED: TMV resistance protein N-like           175   8e-50   
emb|CBI39196.3|  unnamed protein product                                187   9e-50   
ref|XP_010057039.1|  PREDICTED: TMV resistance protein N-like           189   9e-50   
ref|XP_008349077.1|  PREDICTED: TMV resistance protein N-like           175   9e-50   
ref|XP_006388454.1|  hypothetical protein POPTR_0182s00200g             187   1e-49   
ref|XP_010059181.1|  PREDICTED: TMV resistance protein N-like           174   1e-49   
ref|XP_003635135.2|  PREDICTED: uncharacterized protein LOC100853815    191   1e-49   
ref|XP_006371047.1|  hypothetical protein POPTR_0019s02950g             186   1e-49   
ref|XP_010070567.1|  PREDICTED: TMV resistance protein N-like           175   1e-49   
ref|XP_006370866.1|  hypothetical protein POPTR_0019s01210g             184   1e-49   
ref|XP_006389211.1|  hypothetical protein POPTR_0035s00320g             174   1e-49   
ref|XP_010058773.1|  PREDICTED: TMV resistance protein N-like           174   1e-49   
ref|XP_010657780.1|  PREDICTED: TMV resistance protein N-like iso...    189   1e-49   
ref|XP_010056575.1|  PREDICTED: TMV resistance protein N-like           184   1e-49   
ref|XP_007216844.1|  hypothetical protein PRUPE_ppa022061mg             174   1e-49   
ref|XP_010665222.1|  PREDICTED: toll/interleukin-1 receptor-like ...    179   1e-49   
ref|XP_006356453.1|  PREDICTED: TMV resistance protein N-like           189   1e-49   
ref|XP_006495021.1|  PREDICTED: TMV resistance protein N-like           183   1e-49   
ref|XP_009354958.1|  PREDICTED: TMV resistance protein N-like           177   2e-49   
ref|XP_011013492.1|  PREDICTED: TMV resistance protein N-like iso...    187   2e-49   
ref|XP_010645944.1|  PREDICTED: TMV resistance protein N-like           174   2e-49   
ref|XP_011015315.1|  PREDICTED: TMV resistance protein N-like           189   2e-49   
gb|KCW74399.1|  hypothetical protein EUGRSUZ_E03080                     186   2e-49   
gb|KCW59442.1|  hypothetical protein EUGRSUZ_H02176                     175   2e-49   
gb|AAY43787.1|  disease resistance protein                              182   2e-49   (Populus tomentosa x Populus bolleana) x Populus tomentosa var. truncata
ref|XP_004301464.1|  PREDICTED: TMV resistance protein N-like           188   2e-49   
ref|XP_010665364.1|  PREDICTED: TMV resistance protein N-like           188   2e-49   
ref|XP_011013491.1|  PREDICTED: TMV resistance protein N-like iso...    187   2e-49   
gb|KCW88424.1|  hypothetical protein EUGRSUZ_A00810                     185   2e-49   
gb|KDP34368.1|  hypothetical protein JCGZ_11251                         187   2e-49   
emb|CBI17021.3|  unnamed protein product                                174   2e-49   
ref|XP_010657779.1|  PREDICTED: TMV resistance protein N-like iso...    189   2e-49   
ref|XP_010657777.1|  PREDICTED: TMV resistance protein N-like iso...    189   2e-49   
ref|XP_009366896.1|  PREDICTED: TMV resistance protein N-like           189   2e-49   
gb|KCW73986.1|  hypothetical protein EUGRSUZ_E02599                     187   2e-49   
ref|XP_010657833.1|  PREDICTED: TMV resistance protein N-like iso...    188   2e-49   
emb|CBI39287.3|  unnamed protein product                                188   2e-49   
ref|XP_010059178.1|  PREDICTED: TMV resistance protein N-like           187   3e-49   
ref|XP_011001241.1|  PREDICTED: TMV resistance protein N-like           187   3e-49   
ref|XP_008231763.1|  PREDICTED: TMV resistance protein N-like           184   3e-49   
ref|XP_006387577.1|  hypothetical protein POPTR_0822s002001g            173   3e-49   
ref|XP_010026474.1|  PREDICTED: TMV resistance protein N-like           174   3e-49   
ref|XP_006370902.1|  hypothetical protein POPTR_0019s01570g             186   3e-49   
ref|XP_010657832.1|  PREDICTED: TMV resistance protein N-like iso...    187   3e-49   
ref|XP_010057293.1|  PREDICTED: TMV resistance protein N-like iso...    186   3e-49   
ref|XP_004228809.1|  PREDICTED: TMV resistance protein N-like           188   3e-49   
ref|XP_011001242.1|  PREDICTED: TMV resistance protein N-like           188   3e-49   
ref|XP_011013490.1|  PREDICTED: TMV resistance protein N-like iso...    187   3e-49   
ref|XP_009374162.1|  PREDICTED: TMV resistance protein N-like           185   3e-49   
ref|XP_010058828.1|  PREDICTED: TMV resistance protein N-like           176   4e-49   
ref|XP_011014417.1|  PREDICTED: TMV resistance protein N-like           186   4e-49   
gb|KCW74573.1|  hypothetical protein EUGRSUZ_E032912                    180   4e-49   
gb|KCW59235.1|  hypothetical protein EUGRSUZ_H01903                     173   4e-49   
ref|XP_006380260.1|  hypothetical protein POPTR_0007s00620g             182   4e-49   
gb|KCW73687.1|  hypothetical protein EUGRSUZ_E02290                     181   4e-49   
ref|XP_008232097.1|  PREDICTED: TMV resistance protein N-like           186   4e-49   
gb|KCW74266.1|  hypothetical protein EUGRSUZ_E02914                     182   4e-49   
ref|XP_006370864.1|  hypothetical protein POPTR_0019s01170g             187   4e-49   
ref|XP_008364204.1|  PREDICTED: TMV resistance protein N-like           177   4e-49   
ref|XP_010070448.1|  PREDICTED: TMV resistance protein N-like iso...    173   4e-49   
ref|XP_009791999.1|  PREDICTED: TMV resistance protein N-like           178   4e-49   
gb|AES89794.2|  disease resistance protein (TIR-NBS-LRR class)          187   4e-49   
ref|XP_007220725.1|  hypothetical protein PRUPE_ppa022940mg             187   4e-49   
ref|XP_010070522.1|  PREDICTED: TMV resistance protein N-like           182   4e-49   
ref|XP_003633382.1|  PREDICTED: TMV resistance protein N-like iso...    181   5e-49   
gb|KCW59424.1|  hypothetical protein EUGRSUZ_H02148                     174   5e-49   
ref|XP_010256443.1|  PREDICTED: TMV resistance protein N-like iso...    187   5e-49   
ref|XP_006495323.1|  PREDICTED: putative disease resistance prote...    179   5e-49   
ref|XP_010657829.1|  PREDICTED: TMV resistance protein N-like iso...    187   5e-49   
ref|XP_003607597.1|  NBS resistance protein                             187   5e-49   
ref|XP_010256441.1|  PREDICTED: TMV resistance protein N-like iso...    187   5e-49   
ref|XP_004289200.1|  PREDICTED: TMV resistance protein N-like           174   6e-49   
ref|XP_006441871.1|  hypothetical protein CICLE_v10024379mg             187   6e-49   
ref|XP_010070447.1|  PREDICTED: TMV resistance protein N-like iso...    172   6e-49   
ref|XP_011013488.1|  PREDICTED: TMV resistance protein N-like iso...    187   6e-49   
ref|XP_011013487.1|  PREDICTED: TMV resistance protein N-like iso...    187   6e-49   
ref|XP_006385250.1|  hypothetical protein POPTR_0003s02110g             187   6e-49   
ref|XP_011013489.1|  PREDICTED: TMV resistance protein N-like iso...    187   6e-49   
emb|CAN71926.1|  hypothetical protein VITISV_006195                     173   7e-49   Vitis vinifera
ref|XP_010026368.1|  PREDICTED: TMV resistance protein N-like           184   7e-49   
gb|AGC24026.1|  TIR-NB-LRR type resistance protein RGA2                 187   7e-49   
gb|AEI27415.1|  TIR_2                                                   186   7e-49   
ref|XP_010665311.1|  PREDICTED: TMV resistance protein N-like           172   8e-49   
ref|XP_006441745.1|  hypothetical protein CICLE_v10024519mg             174   8e-49   
ref|XP_006389335.1|  hypothetical protein POPTR_0030s00570g             186   9e-49   
gb|KCW50665.1|  hypothetical protein EUGRSUZ_J00352                     172   9e-49   
ref|XP_006373533.1|  hypothetical protein POPTR_0017s14600g             180   1e-48   
gb|KCW73586.1|  hypothetical protein EUGRSUZ_E02144                     185   1e-48   
ref|XP_006442158.1|  hypothetical protein CICLE_v10018611mg             186   1e-48   
ref|XP_010242716.1|  PREDICTED: TMV resistance protein N-like iso...    186   1e-48   
ref|XP_008339368.1|  PREDICTED: TMV resistance protein N-like           177   1e-48   
ref|XP_010242715.1|  PREDICTED: TMV resistance protein N-like iso...    186   1e-48   
ref|XP_010026496.1|  PREDICTED: TMV resistance protein N-like           174   1e-48   
ref|XP_008237531.1|  PREDICTED: TMV resistance protein N-like           186   1e-48   
ref|XP_010242717.1|  PREDICTED: TMV resistance protein N-like iso...    186   1e-48   
ref|XP_006371058.1|  hypothetical protein POPTR_0019s03040g             181   1e-48   
ref|XP_010025789.1|  PREDICTED: TMV resistance protein N-like           186   1e-48   
ref|XP_010645912.1|  PREDICTED: TMV resistance protein N-like iso...    184   1e-48   
ref|XP_008351765.1|  PREDICTED: TMV resistance protein N-like           175   1e-48   
ref|XP_010057287.1|  PREDICTED: TMV resistance protein N-like iso...    186   1e-48   
ref|XP_006478451.1|  PREDICTED: TMV resistance protein N-like iso...    186   1e-48   
ref|XP_009353817.1|  PREDICTED: TMV resistance protein N-like           173   1e-48   
ref|XP_009628589.1|  PREDICTED: TMV resistance protein N-like iso...    186   1e-48   
ref|XP_006478449.1|  PREDICTED: TMV resistance protein N-like iso...    186   1e-48   
gb|ABF81465.1|  TIR-NBS-LRR type disease resistance protein             186   1e-48   
gb|ABF81440.1|  TIR-NBS-LRR-TIR type disease resistance protein         186   1e-48   
emb|CAN63551.1|  hypothetical protein VITISV_032106                     185   2e-48   
ref|XP_006442155.1|  hypothetical protein CICLE_v10024504mg             184   2e-48   
gb|KCW73657.1|  hypothetical protein EUGRSUZ_E02243                     175   2e-48   
gb|ABF81419.1|  TIR-NBS-LRR type disease resistance protein             186   2e-48   
ref|XP_009628590.1|  PREDICTED: TMV resistance protein N-like iso...    186   2e-48   
gb|KCW73943.1|  hypothetical protein EUGRSUZ_E02532                     180   2e-48   
ref|XP_006478373.1|  PREDICTED: TMV resistance protein N-like           186   2e-48   
ref|XP_010026444.1|  PREDICTED: putative disease resistance prote...    176   2e-48   
ref|XP_010087987.1|  TMV resistance protein N                           186   2e-48   
ref|XP_006385577.1|  hypothetical protein POPTR_0003s08250g             186   2e-48   
gb|AGC24028.1|  TIR-NB-LRR type resistance protein RPV1                 186   2e-48   
gb|KCW59127.1|  hypothetical protein EUGRSUZ_H01749                     175   2e-48   
gb|AGC24029.1|  TIR-NB-LRR type resistance protein RGA9                 186   2e-48   
gb|KCW59142.1|  hypothetical protein EUGRSUZ_H017722                    174   2e-48   
gb|KCW73973.1|  hypothetical protein EUGRSUZ_E02576                     173   2e-48   
ref|XP_010056815.1|  PREDICTED: TMV resistance protein N-like           185   2e-48   
ref|XP_006442216.1|  hypothetical protein CICLE_v10023982mg             184   2e-48   
ref|XP_010057292.1|  PREDICTED: TMV resistance protein N-like iso...    185   2e-48   
gb|KHN15600.1|  TMV resistance protein N                                176   2e-48   
ref|NP_001237768.1|  TIR-NBS-LRR type disease resistance protein        176   2e-48   
gb|KCW74403.1|  hypothetical protein EUGRSUZ_E03084                     185   2e-48   
ref|XP_009790280.1|  PREDICTED: TMV resistance protein N-like           183   2e-48   
ref|XP_010049483.1|  PREDICTED: TMV resistance protein N-like iso...    176   2e-48   
gb|KDO45460.1|  hypothetical protein CISIN_1g001889mg                   185   2e-48   
ref|XP_010058768.1|  PREDICTED: TMV resistance protein N-like           177   2e-48   
emb|CAC95124.1|  TIR/NBS/LRR protein                                    185   2e-48   
ref|XP_010644041.1|  PREDICTED: uncharacterized protein LOC104877471    186   2e-48   
gb|KCW73616.1|  hypothetical protein EUGRSUZ_E02189                     184   2e-48   
gb|ABB82024.1|  TIR-NBS disease resistance-like protein                 185   2e-48   
ref|XP_010058805.1|  PREDICTED: TMV resistance protein N-like           181   3e-48   
gb|KCW74404.1|  hypothetical protein EUGRSUZ_E03085                     182   3e-48   
ref|XP_003607596.1|  Tir-nbs-lrr resistance protein                     185   3e-48   
gb|ADL36719.1|  HD domain class transcription factor                    172   3e-48   
ref|XP_002325276.2|  hypothetical protein POPTR_0019s01160g             183   3e-48   
gb|ABM55688.1|  TIR-NBS class disease resistance protein                180   3e-48   
ref|XP_002276075.2|  PREDICTED: TMV resistance protein N-like iso...    185   3e-48   
gb|AGC24025.1|  TIR-NB-LRR type resistance protein RGA1                 185   3e-48   
ref|XP_011046323.1|  PREDICTED: TMV resistance protein N-like iso...    185   3e-48   
ref|XP_006599705.1|  PREDICTED: TMV resistance protein N-like iso...    172   3e-48   
ref|XP_011046325.1|  PREDICTED: TMV resistance protein N-like iso...    185   3e-48   
ref|XP_010650378.1|  PREDICTED: toll/interleukin-1 receptor-like ...    171   3e-48   
ref|XP_006441719.1|  hypothetical protein CICLE_v10018572mg             185   3e-48   
gb|KCW59096.1|  hypothetical protein EUGRSUZ_H01711                     182   3e-48   
gb|KCW59403.1|  hypothetical protein EUGRSUZ_H02116                     172   3e-48   
gb|KCW59429.1|  hypothetical protein EUGRSUZ_H02155                     171   4e-48   
ref|XP_010051443.1|  PREDICTED: uncharacterized protein LOC104440170    177   4e-48   
ref|XP_006385998.1|  hypothetical protein POPTR_0003s19870g             185   4e-48   
ref|XP_008343950.1|  PREDICTED: TMV resistance protein N-like           171   4e-48   
ref|XP_010026339.1|  PREDICTED: TMV resistance protein N-like           171   4e-48   
ref|XP_010665198.1|  PREDICTED: TMV resistance protein N-like iso...    182   4e-48   
gb|ABB82025.1|  TIR-NBS disease resistance-like protein                 182   4e-48   
gb|KEH32989.1|  disease resistance protein (TIR-NBS-LRR class), p...    185   4e-48   
ref|XP_006371054.1|  hypothetical protein POPTR_0019s03010g             183   4e-48   
gb|ABM55687.1|  TIR-NBS-LRR class disease resistance protein            182   4e-48   
ref|XP_010646175.1|  PREDICTED: TMV resistance protein N-like           180   4e-48   
ref|XP_007224218.1|  hypothetical protein PRUPE_ppa017550mg             182   4e-48   
ref|XP_010243470.1|  PREDICTED: TMV resistance protein N-like iso...    184   5e-48   
ref|XP_006442148.1|  hypothetical protein CICLE_v10018528mg             185   5e-48   
gb|KCW59447.1|  hypothetical protein EUGRSUZ_H02184                     171   5e-48   
ref|XP_006494031.1|  PREDICTED: TMV resistance protein N-like           171   5e-48   
ref|XP_008378061.1|  PREDICTED: TMV resistance protein N-like           176   5e-48   
ref|XP_006442149.1|  hypothetical protein CICLE_v10018528mg             184   5e-48   
gb|KCW73638.1|  hypothetical protein EUGRSUZ_E02212                     181   5e-48   
ref|XP_010025786.1|  PREDICTED: TMV resistance protein N-like           181   5e-48   
gb|KEH32988.1|  disease resistance protein (TIR-NBS-LRR class), p...    185   5e-48   
ref|XP_010058786.1|  PREDICTED: TMV resistance protein N-like           184   5e-48   
ref|XP_010059273.1|  PREDICTED: TMV resistance protein N-like           180   5e-48   
ref|XP_011011965.1|  PREDICTED: TMV resistance protein N-like iso...    184   6e-48   
ref|XP_010644030.1|  PREDICTED: uncharacterized protein LOC100253289    186   6e-48   
ref|XP_007036639.1|  Leucine-rich repeat-containing protein, puta...    172   6e-48   
ref|XP_006478256.1|  PREDICTED: TMV resistance protein N-like iso...    184   6e-48   
emb|CAN73697.1|  hypothetical protein VITISV_038484                     182   6e-48   
ref|XP_002273047.2|  PREDICTED: TMV resistance protein N-like           184   6e-48   
ref|XP_006370852.1|  hypothetical protein POPTR_0019s00910g             169   6e-48   
ref|XP_006441623.1|  hypothetical protein CICLE_v10023891mg             184   6e-48   
ref|XP_008237366.1|  PREDICTED: TMV resistance protein N-like           184   6e-48   
ref|XP_006478374.1|  PREDICTED: TMV resistance protein N-like           184   7e-48   
gb|KDO51715.1|  hypothetical protein CISIN_1g001277mg                   184   7e-48   
gb|KEH15762.1|  disease resistance protein (TIR-NBS-LRR class)          170   7e-48   
gb|KCW59434.1|  hypothetical protein EUGRSUZ_H02164                     181   7e-48   
ref|XP_010059168.1|  PREDICTED: TMV resistance protein N-like           179   7e-48   
ref|XP_009802254.1|  PREDICTED: toll/interleukin-1 receptor-like ...    173   7e-48   
gb|KCW73676.1|  hypothetical protein EUGRSUZ_E02272                     182   7e-48   
ref|XP_010665418.1|  PREDICTED: TMV resistance protein N-like           184   7e-48   
ref|XP_010070572.1|  PREDICTED: TMV resistance protein N-like           174   8e-48   
ref|XP_010070399.1|  PREDICTED: TMV resistance protein N-like           182   8e-48   
ref|XP_010645907.1|  PREDICTED: TMV resistance protein N-like           184   8e-48   
ref|XP_008391293.1|  PREDICTED: uncharacterized protein LOC103453534    181   8e-48   
ref|XP_010026363.1|  PREDICTED: TMV resistance protein N-like           180   8e-48   
ref|XP_006342676.1|  PREDICTED: TMV resistance protein N-like           169   8e-48   
ref|XP_011003906.1|  PREDICTED: TMV resistance protein N-like iso...    184   8e-48   
ref|XP_006361823.1|  PREDICTED: TMV resistance protein N-like           171   8e-48   
gb|ABF81460.1|  TIR-NBS type disease resistance protein                 181   8e-48   
ref|XP_006478257.1|  PREDICTED: TMV resistance protein N-like iso...    182   8e-48   
ref|XP_010058743.1|  PREDICTED: TMV resistance protein N-like           181   9e-48   
ref|XP_010026453.1|  PREDICTED: TMV resistance protein N-like           182   9e-48   
gb|KDO44262.1|  hypothetical protein CISIN_1g0051912mg                  180   9e-48   
ref|XP_008236758.1|  PREDICTED: TMV resistance protein N-like           183   9e-48   
ref|XP_008219411.1|  PREDICTED: TMV resistance protein N-like           183   9e-48   
ref|XP_007134525.1|  hypothetical protein PHAVU_010G054800g             171   9e-48   
ref|XP_010665212.1|  PREDICTED: toll/interleukin-1 receptor-like ...    170   9e-48   
gb|KCW73650.1|  hypothetical protein EUGRSUZ_E02229                     181   1e-47   
gb|AAM89998.1|AF403250_1  disease resistance-like protein GS0-1         169   1e-47   
ref|XP_010058804.1|  PREDICTED: toll/interleukin-1 receptor-like ...    171   1e-47   
gb|KCW59362.1|  hypothetical protein EUGRSUZ_H02061                     178   1e-47   
ref|XP_007134526.1|  hypothetical protein PHAVU_010G054800g             170   1e-47   
ref|XP_011021443.1|  PREDICTED: TMV resistance protein N-like           184   1e-47   
ref|XP_006389222.1|  hypothetical protein POPTR_0035s00400g             184   1e-47   
gb|AGF69193.1|  TMV resistance protein N-like protein 7                 184   1e-47   
ref|XP_011013099.1|  PREDICTED: TMV resistance protein N-like iso...    183   1e-47   
gb|KCW59155.1|  hypothetical protein EUGRSUZ_H01785                     172   1e-47   
ref|XP_011021441.1|  PREDICTED: TMV resistance protein N-like           183   1e-47   
ref|XP_009366856.1|  PREDICTED: TMV resistance protein N-like           184   1e-47   
gb|KCW59180.1|  hypothetical protein EUGRSUZ_H01829                     179   1e-47   
emb|CAN83385.1|  hypothetical protein VITISV_004581                     183   1e-47   
ref|XP_007207681.1|  hypothetical protein PRUPE_ppa023596mg             182   1e-47   
ref|XP_011013098.1|  PREDICTED: TMV resistance protein N-like iso...    183   1e-47   
ref|XP_008227564.1|  PREDICTED: TMV resistance protein N-like           172   1e-47   
ref|XP_006442208.1|  hypothetical protein CICLE_v10018544mg             183   1e-47   
ref|XP_006478252.1|  PREDICTED: TMV resistance protein N-like iso...    183   1e-47   
ref|XP_010040600.1|  PREDICTED: TMV resistance protein N-like           171   1e-47   
ref|XP_010650374.1|  PREDICTED: TMV resistance protein N-like           180   1e-47   
ref|XP_010058910.1|  PREDICTED: TMV resistance protein N-like           178   1e-47   
ref|XP_004296085.1|  PREDICTED: TMV resistance protein N-like           172   1e-47   
ref|XP_010665419.1|  PREDICTED: TMV resistance protein N-like           183   1e-47   
ref|XP_006367169.1|  PREDICTED: TMV resistance protein N-like iso...    169   1e-47   
ref|XP_010034174.1|  PREDICTED: TMV resistance protein N-like           176   2e-47   
ref|XP_010059085.1|  PREDICTED: TMV resistance protein N-like           182   2e-47   
gb|KCW44198.1|  hypothetical protein EUGRSUZ_L02373                     182   2e-47   
ref|XP_006371227.1|  hypothetical protein POPTR_0019s06300g             181   2e-47   
gb|AGC24027.1|  TIR-NB-LRR type resistance protein RGA4                 183   2e-47   
gb|KCW59329.1|  hypothetical protein EUGRSUZ_H02019                     181   2e-47   
ref|XP_003539655.1|  PREDICTED: TMV resistance protein N-like           182   2e-47   
ref|XP_009613117.1|  PREDICTED: TMV resistance protein N-like iso...    176   2e-47   
gb|KCW59093.1|  hypothetical protein EUGRSUZ_H01707                     180   2e-47   
ref|XP_007199372.1|  hypothetical protein PRUPE_ppa025472mg             183   2e-47   
gb|ABC55465.1|  TIR-NBS disease resistance-like protein                 180   2e-47   
gb|KDO41339.1|  hypothetical protein CISIN_1g0441472mg                  169   2e-47   
ref|XP_006380263.1|  hypothetical protein POPTR_0007s00680g             175   2e-47   
ref|XP_007199382.1|  hypothetical protein PRUPE_ppa025692mg             183   2e-47   
gb|ABF81417.1|  TIR-NBS-LRR type disease resistance protein             184   2e-47   
ref|XP_006388459.1|  hypothetical protein POPTR_0182s00240g             182   2e-47   
ref|XP_008237367.1|  PREDICTED: TMV resistance protein N                182   2e-47   
ref|XP_007214356.1|  hypothetical protein PRUPE_ppb025535mg             171   2e-47   
ref|XP_010058809.1|  PREDICTED: TMV resistance protein N-like           173   2e-47   
ref|XP_010665188.1|  PREDICTED: TMV resistance protein N-like iso...    182   2e-47   
gb|KEH30741.1|  disease resistance protein (TIR-NBS-LRR class), p...    182   2e-47   
gb|KHG30618.1|  TMV resistance N                                        183   2e-47   
ref|XP_010645905.1|  PREDICTED: TMV resistance protein N-like           182   2e-47   
ref|XP_006441733.1|  hypothetical protein CICLE_v10024511mg             182   2e-47   
ref|XP_002514805.1|  ATP binding protein, putative                      182   2e-47   
ref|XP_006371041.1|  hypothetical protein POPTR_0019s02900g             182   2e-47   
ref|XP_008237474.1|  PREDICTED: TMV resistance protein N-like iso...    182   2e-47   
gb|ABB82029.1|  TIR-NBS disease resistance-like protein                 182   2e-47   
ref|XP_010040614.1|  PREDICTED: TMV resistance protein N-like           183   2e-47   
ref|XP_010657771.1|  PREDICTED: TMV resistance protein N-like iso...    183   2e-47   
ref|XP_008219354.1|  PREDICTED: TMV resistance protein N-like           182   3e-47   
ref|XP_008237566.1|  PREDICTED: TMV resistance protein N-like           180   3e-47   
ref|XP_010058832.1|  PREDICTED: TMV resistance protein N-like           168   3e-47   
gb|KCW45053.1|  hypothetical protein EUGRSUZ_L01349                     182   3e-47   
ref|XP_010026450.1|  PREDICTED: TMV resistance protein N-like           168   3e-47   
emb|CAN72303.1|  hypothetical protein VITISV_009715                     182   3e-47   
ref|XP_006360963.1|  PREDICTED: TMV resistance protein N-like           178   3e-47   
ref|XP_008237473.1|  PREDICTED: TMV resistance protein N-like iso...    182   3e-47   
ref|XP_009613120.1|  PREDICTED: TMV resistance protein N-like iso...    183   3e-47   
gb|KDO40658.1|  hypothetical protein CISIN_1g009845mg                   177   3e-47   
gb|KCW73565.1|  hypothetical protein EUGRSUZ_E02103                     181   3e-47   
ref|XP_006592479.1|  PREDICTED: TMV resistance protein N-like iso...    182   3e-47   
ref|XP_010058783.1|  PREDICTED: TMV resistance protein N-like           176   3e-47   
ref|XP_010059270.1|  PREDICTED: TMV resistance protein N-like           178   3e-47   
ref|XP_009353023.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    183   3e-47   
ref|XP_007219240.1|  hypothetical protein PRUPE_ppa017503mg             182   3e-47   
ref|XP_010657770.1|  PREDICTED: TMV resistance protein N-like iso...    182   3e-47   
emb|CAN76615.1|  hypothetical protein VITISV_040107                     182   3e-47   
ref|XP_010058796.1|  PREDICTED: TMV resistance protein N-like           168   3e-47   
ref|XP_006592480.1|  PREDICTED: TMV resistance protein N-like iso...    182   4e-47   
ref|XP_011004905.1|  PREDICTED: TMV resistance protein N-like           180   4e-47   
ref|XP_010646831.1|  PREDICTED: TMV resistance protein N-like           169   4e-47   
ref|XP_008245719.1|  PREDICTED: TMV resistance protein N-like           182   4e-47   
ref|XP_009803029.1|  PREDICTED: TMV resistance protein N-like iso...    182   4e-47   
ref|XP_010058916.1|  PREDICTED: TMV resistance protein N-like           182   4e-47   
ref|XP_010070578.1|  PREDICTED: TMV resistance protein N-like iso...    177   4e-47   
gb|KEH15216.1|  disease resistance protein (TIR-NBS-LRR class)          168   4e-47   
gb|ABB82026.1|  TIR-NBS disease resistance-like protein                 181   4e-47   
gb|KCW59085.1|  hypothetical protein EUGRSUZ_H01702                     181   4e-47   
ref|XP_010058909.1|  PREDICTED: TMV resistance protein N-like           179   4e-47   
ref|XP_010243474.1|  PREDICTED: TMV resistance protein N-like iso...    181   5e-47   
ref|XP_003526343.1|  PREDICTED: TMV resistance protein N-like           182   5e-47   
ref|XP_010243473.1|  PREDICTED: TMV resistance protein N-like iso...    181   5e-47   
ref|XP_009803027.1|  PREDICTED: TMV resistance protein N-like iso...    182   5e-47   
ref|XP_009803028.1|  PREDICTED: TMV resistance protein N-like iso...    182   5e-47   
gb|KHN26393.1|  TMV resistance protein N                                182   5e-47   
ref|XP_007220687.1|  hypothetical protein PRUPE_ppa021903mg             181   5e-47   
ref|XP_008245035.1|  PREDICTED: TMV resistance protein N-like           182   5e-47   
ref|XP_006494860.1|  PREDICTED: TMV resistance protein N-like           181   5e-47   
ref|XP_010059182.1|  PREDICTED: TMV resistance protein N-like           176   5e-47   
gb|KDO40286.1|  hypothetical protein CISIN_1g000802mg                   182   5e-47   
ref|XP_007199069.1|  hypothetical protein PRUPE_ppa018765mg             182   5e-47   
ref|XP_010243472.1|  PREDICTED: TMV resistance protein N-like iso...    181   5e-47   
ref|XP_002319855.2|  hypothetical protein POPTR_0013s10710g             178   5e-47   
ref|XP_008380658.1|  PREDICTED: TMV resistance protein N-like           168   5e-47   
gb|KCW74567.1|  hypothetical protein EUGRSUZ_E03284                     180   5e-47   
ref|XP_002325898.2|  hypothetical protein POPTR_0019s07880g             181   5e-47   
ref|XP_002518711.1|  leucine-rich repeat containing protein, puta...    181   6e-47   



>ref|XP_009794563.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=166

 Score =   221 bits (564),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 125/152 (82%), Gaps = 3/152 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGEDVRK FVDHLY A+QQ+GI+TFKDDEKLERGKSISP L +AIEES +A+
Sbjct  18   SYDVFLSFRGEDVRKTFVDHLYVALQQKGIHTFKDDEKLERGKSISPDLTRAIEESRIAL  77

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS++YA+S+WCL+EL+KIMEC K KGQ V+P+FY VDPSTVRKQK  +GEAF  HE  
Sbjct  78   IIFSKNYANSTWCLDELMKIMECNKQKGQIVLPVFYDVDPSTVRKQKSSFGEAFSSHE--  135

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
              +   K++KWR  L + +NLSGWDL NT N 
Sbjct  136  -ARGCFKLQKWRAALVEAANLSGWDLPNTANA  166



>gb|AAL07542.1| resistance gene analog NBS7 [Helianthus annuus]
Length=259

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D RK+FVDHLYTA++QRGIYT+KDDE L RG+SI PAL KAI+ES +AV+
Sbjct  22   YDVFLSFRGDDTRKSFVDHLYTALEQRGIYTYKDDETLPRGESIGPALLKAIQESRVAVI  81

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS++YADSSWCL+EL  IMECM  +GQ V+PIFY VDPS VRKQK KYGEAF  HE+  
Sbjct  82   VFSKNYADSSWCLDELAHIMECMDTRGQIVMPIFYHVDPSDVRKQKGKYGEAFTKHER--  139

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNNTEN  430
             +   KV+ WRK LE    LSGW +N+ EN
Sbjct  140  -ENKLKVESWRKALEKAGKLSGWVINDIEN  168



>ref|XP_009630491.1| PREDICTED: uncharacterized protein LOC104120435 [Nicotiana tomentosiformis]
Length=1980

 Score =   228 bits (582),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 1/151 (1%)
 Frame = -2

Query  882   TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             +YDVFLSFRGEDVRK FVDHLY A+QQRGI+TFKDDEKLERGKSISP L +AIEE+ +A+
Sbjct  1176  SYDVFLSFRGEDVRKTFVDHLYVALQQRGIHTFKDDEKLERGKSISPDLIRAIEEARIAL  1235

Query  702   VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
             ++FS++YADS WCL+EL+KIMEC K KGQ V+P+FY VDPSTVRKQK  +GEAF  HE S
Sbjct  1236  IIFSKNYADSKWCLDELMKIMECNKQKGQIVLPVFYDVDPSTVRKQKSSFGEAFSNHEIS  1295

Query  522   FEKEGEKVKKWRKVLEDVSNLSGWDLNNTEN  430
               K+  KV+KWR  LE+ +NLSGWDL NT N
Sbjct  1296  CFKDN-KVEKWRAALEEAANLSGWDLPNTAN  1325


 Score =   221 bits (564),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGEDVRK FVDHLY A+QQ+GI+TFKDDEKLERGKSISP L +AIEES +A+
Sbjct  17   SYDVFLSFRGEDVRKKFVDHLYVALQQKGIHTFKDDEKLERGKSISPNLMRAIEESRIAL  76

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS++YA+S WCL+ELVKIMEC  +KGQ V P+FY VDPSTVRKQK  +GEAF  HE  
Sbjct  77   IIFSKNYANSRWCLDELVKIMECKNLKGQIVFPVFYDVDPSTVRKQKSSFGEAFSNHEAR  136

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
               +  K++KWR  LE+ +NLSG DL NT N 
Sbjct  137  GCIKDNKLQKWRAALEEAANLSGCDLRNTANA  168



>ref|XP_004243783.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1147

 Score =   224 bits (572),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGEDVRK FVDHLY A++Q+ IYTFKDDEKLE+GK ISP LE +IEES +A+
Sbjct  17   SYDVFLSFRGEDVRKTFVDHLYLALEQKCIYTFKDDEKLEKGKFISPELESSIEESRIAL  76

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS++YADS+WCL+EL KIMEC  VKGQ VVP+FY VDPSTVRKQK  +GEAF  HE  
Sbjct  77   IIFSKNYADSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKMIFGEAFSKHEAR  136

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            F++  +KV+KWR  LE+ +N+SGWD+ NT NG
Sbjct  137  FQE--DKVQKWRAALEEAANISGWDMPNTSNG  166



>ref|XP_006348979.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=995

 Score =   221 bits (564),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 126/152 (83%), Gaps = 2/152 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSF+GED+RK FVDHLY A+QQ+ I TFKDDEKLE+GK ISP LE +IEES +A+
Sbjct  17   SYDVFLSFKGEDIRKTFVDHLYLALQQKCINTFKDDEKLEKGKFISPELESSIEESRIAL  76

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS++YA+S+WCL+EL KIMEC  VKGQ VVP+FY VDPSTVRKQK  +GEAF  HE  
Sbjct  77   IIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKTIFGEAFSKHEAR  136

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            F++  +KV+KWR  LE+ +N+SGWDL NT NG
Sbjct  137  FQE--DKVQKWRAALEEAANISGWDLPNTANG  166



>gb|AAP44392.1| nematode resistance-like protein [Solanum tuberosum]
Length=1136

 Score =   220 bits (560),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGEDVRK FVDHLY A+QQ+ I TFKDDEKLE+GK ISP L  +IEES +A+
Sbjct  17   SYDVFLSFRGEDVRKTFVDHLYLALQQKCINTFKDDEKLEKGKFISPELMSSIEESRIAL  76

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS++YA+S+WCL+EL KIMEC  VKGQ VVP+FY VDPSTVRKQK  +GEAF  HE  
Sbjct  77   IIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEAR  136

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            F++  +KV+KWR  LE+ +N+SGWDL NT NG
Sbjct  137  FQE--DKVQKWRAALEEAANISGWDLPNTSNG  166



>ref|XP_006350421.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=862

 Score =   218 bits (555),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGEDVRKNFVDHLYTA+QQRGI+TFKDDEKLERGKSISP+L KAIEES +++
Sbjct  21   TYDVFLSFRGEDVRKNFVDHLYTALQQRGIHTFKDDEKLERGKSISPSLFKAIEESMISI  80

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS++YA SSWCL+ELVKI +CMK++GQ V+P+FY VDPS VRKQK   GE F  HE  
Sbjct  81   IIFSQNYASSSWCLDELVKITQCMKLRGQIVLPVFYDVDPSVVRKQKANVGEFFAKHELD  140

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            F+ + E+VK+WR  + + +N+SGWDL N  NG
Sbjct  141  FKDDEERVKRWRTAMTEAANVSGWDLPNIANG  172



>gb|AAP44393.1| nematode resistance-like protein [Solanum tuberosum]
Length=1136

 Score =   219 bits (559),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGEDVRK FVDHLY A+QQ+ I TFKDDEKLE+GK ISP L  +IEES +A+
Sbjct  17   SYDVFLSFRGEDVRKTFVDHLYLALQQKCINTFKDDEKLEKGKFISPELVSSIEESRIAL  76

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS++YA+S+WCL+EL KIMEC  VKGQ VVP+FY VDPSTVRKQK  +GEAF  HE  
Sbjct  77   IIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEAR  136

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            F++  +KV+KWR  LE+ +N+SGWDL NT NG
Sbjct  137  FQE--DKVQKWRAALEEAANISGWDLPNTSNG  166



>gb|AAP44390.1| nematode resistance protein [Solanum tuberosum]
Length=1136

 Score =   218 bits (555),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGEDVRK FVDHLY A++Q+ I TFKDDEKLE+GK ISP L  +IEES +A+
Sbjct  17   SYDVFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIAL  76

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS++YA+S+WCL+EL KIMEC  VKGQ VVP+FY VDPSTVRKQK  +GEAF  HE  
Sbjct  77   IIFSKNYANSTWCLDELTKIMECKNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSKHEAR  136

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            F++  +KV+KWR  LE+ +N+SGWDL NT NG
Sbjct  137  FQE--DKVQKWRAALEEAANISGWDLPNTANG  166



>ref|XP_004237584.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1154

 Score =   218 bits (554),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGEDVRKNFVDHLYTA+QQRGI+TFKDDEKLERGKSISP+L KAIEES +++
Sbjct  17   TYDVFLSFRGEDVRKNFVDHLYTALQQRGIHTFKDDEKLERGKSISPSLFKAIEESMISI  76

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS++YA SSWCL+ELVKI +CMK++GQ V+P+FY VDPS VRKQK   GE F  HE  
Sbjct  77   IIFSQNYAASSWCLDELVKITQCMKLRGQIVLPVFYDVDPSVVRKQKANVGEFFARHELD  136

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            F+ + E+VK+WR  + + +N+SGWDL N  NG
Sbjct  137  FKDDEERVKRWRTAMTEAANVSGWDLPNIANG  168



>gb|AAP44391.1| nematode resistance-like protein [Solanum tuberosum]
Length=1121

 Score =   216 bits (551),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGE+VRK FVDHLY A++Q+ I TFKDDEKLE+GK ISP L  +IEES +A+
Sbjct  17   SYDVFLSFRGENVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELMSSIEESRIAL  76

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS++YA+S+WCL+EL KI+EC  VKGQ VVP+FY VDPSTVR+QK  +GEAF  HE  
Sbjct  77   IIFSKNYANSTWCLDELTKIIECKNVKGQIVVPVFYDVDPSTVRRQKNIFGEAFSKHEAR  136

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            FE+  +KVKKWR  LE+ +N+SGWDL NT NG
Sbjct  137  FEE--DKVKKWRAALEEAANISGWDLPNTSNG  166



>ref|XP_011015316.1| PREDICTED: TMV resistance protein N-like, partial [Populus euphratica]
Length=173

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 114/152 (75%), Gaps = 0/152 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRG+D RKNF DHLYTA+ Q GI+TF+DD +L RG+ ISP L KAIE S +++
Sbjct  22   NYDVFLSFRGKDTRKNFTDHLYTALIQAGIHTFRDDNELPRGEEISPQLLKAIEGSRISI  81

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFS+HYA S WCL+ELVKI+EC +   Q V+PIFY  +PS VRKQ   Y +AF+ HE+ 
Sbjct  82   VVFSKHYASSRWCLDELVKILECRQKIDQVVLPIFYDTEPSDVRKQTGSYAKAFDEHEER  141

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            F++E EKV KWR  L +  NLSGW LNN  NG
Sbjct  142  FKEETEKVNKWRGALAEAGNLSGWGLNNEANG  173



>gb|AAL07541.1| resistance gene analog NBS6 [Helianthus annuus]
Length=303

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 115/146 (79%), Gaps = 3/146 (2%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            ++VFLSFRGEDVRKNFVDHLY  + Q+GI T+KDDE L RG+ I PAL KAI+ES +A+V
Sbjct  45   HEVFLSFRGEDVRKNFVDHLYKDLVQQGIQTYKDDETLPRGERIGPALLKAIQESRIALV  104

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFSE+YADSSWCL+EL  IMECM  +GQ V+PIFY VDPS VRKQK KYG+AF  H++  
Sbjct  105  VFSENYADSSWCLDELAHIMECMDTRGQIVIPIFYFVDPSDVRKQKGKYGKAFRKHKR--  162

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLN  442
             +  +KV+ WRK LE   NLSGW +N
Sbjct  163  -ENKQKVESWRKALEKAGNLSGWVIN  187



>gb|AAL07536.1| resistance gene analog NBS1 [Helianthus annuus]
Length=339

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 115/146 (79%), Gaps = 3/146 (2%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            ++VFLSFRGEDVRKNFVDHLY  + Q+GI T+KDDE L RG+ I PAL KAI+ES +A+V
Sbjct  81   HEVFLSFRGEDVRKNFVDHLYKDLVQQGIQTYKDDETLPRGERIGPALLKAIQESRIALV  140

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFSE+YADSSWCL+EL  IMECM  +GQ V+PIFY VDPS VRKQK KYG+AF  H++  
Sbjct  141  VFSENYADSSWCLDELAHIMECMDTRGQIVIPIFYFVDPSDVRKQKGKYGKAFRKHKR--  198

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLN  442
             +  +KV+ WRK LE   NLSGW +N
Sbjct  199  -ENKQKVESWRKALEKAGNLSGWVIN  223



>ref|XP_004237202.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1251

 Score =   213 bits (541),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 122/152 (80%), Gaps = 5/152 (3%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRG+DVRK FVDHLY A+QQ+GI TFKDD+KLE+G SISP L +AIEES +A+
Sbjct  22   SYDVFLSFRGKDVRKTFVDHLYVALQQKGINTFKDDDKLEKGDSISPGLARAIEESRIAL  81

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS++YA+SSWCL+E+VKIMEC KVK Q V+PIFY VDPSTVRKQK  + EAF  +E  
Sbjct  82   IIFSKNYAESSWCLDEVVKIMECKKVKKQIVIPIFYDVDPSTVRKQKSSFEEAFNKYEDC  141

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
                  KV+KWR  LE+ +NLSGWDL NT N 
Sbjct  142  I-----KVQKWRGALEEAANLSGWDLPNTSNA  168



>gb|AAL07540.1| resistance gene analog NBS5 [Helianthus annuus]
Length=285

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            ++VFLSFRGED RKNFVDHLY  + Q+GI T+KDDE L RG+SI PAL KAI+ES +AV+
Sbjct  47   HEVFLSFRGEDTRKNFVDHLYKDLVQQGIQTYKDDETLRRGESIRPALLKAIQESRIAVI  106

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFSE+YADSSWCL+EL +I+ECM   GQ V+PIFY VDPS VRKQ  KYG+AF  H+K  
Sbjct  107  VFSENYADSSWCLDELQQIIECMDTNGQIVIPIFYHVDPSDVRKQNGKYGKAFRKHKK--  164

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLN  442
             +  +KV+ WRK LE   NLSGW +N
Sbjct  165  -ENKQKVESWRKALEKAGNLSGWVIN  189



>ref|XP_002325743.2| hypothetical protein POPTR_0019s00880g, partial [Populus trichocarpa]
 gb|EEF00125.2| hypothetical protein POPTR_0019s00880g, partial [Populus trichocarpa]
Length=163

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRG+D RKNF DHLYTA+ Q GI+TF+DD +L RG+ ISP L KAIE S +++
Sbjct  4    NYDVFLSFRGKDTRKNFTDHLYTALIQAGIHTFRDDNELPRGEEISPQLVKAIEGSRISI  63

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFS+ YA S WCL+ELVKI+EC +   Q V+PIFY  +PS VRKQ   Y +AF+ HE+ 
Sbjct  64   VVFSKQYASSRWCLDELVKIVECRQKIDQVVLPIFYDTEPSDVRKQTGSYAKAFDEHEEH  123

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            F++E EKV KWR  L +  NLSGW LNN  NG
Sbjct  124  FKEEMEKVNKWRGALAEAGNLSGWGLNNEANG  155



>emb|CAN64588.1| hypothetical protein VITISV_008452 [Vitis vinifera]
Length=259

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 120/163 (74%), Gaps = 2/163 (1%)
 Frame = -2

Query  918  MEQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPA  739
            M  PS  SS    YDVFLSFRGED R +F DHLY+A++  G++TF+DDE+LERG  I+P 
Sbjct  98   MASPS-TSSHEGIYDVFLSFRGEDTRYHFTDHLYSALRDNGVHTFRDDEELERGDVIAPG  156

Query  738  LEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKE  559
            L KAIE+S +++VVFSE YA S WCL+ELVKI+ECM  + Q V+P+FY VDPS VRKQ  
Sbjct  157  LLKAIEQSRISIVVFSEKYAQSRWCLDELVKIIECMTERKQIVLPVFYHVDPSHVRKQMG  216

Query  558  KYGEAFEGHEKSFE-KEGEKVKKWRKVLEDVSNLSGWDLNNTE  433
             YGEAF  HEK  + K+ EK++KWR  L + SNLSGW L + +
Sbjct  217  SYGEAFADHEKDADLKKREKIQKWRTALTETSNLSGWHLRDNQ  259



>ref|XP_006360469.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1239

 Score =   212 bits (539),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 120/152 (79%), Gaps = 5/152 (3%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGEDVRK FVDHLY A+QQ+GI TFKD EKLE+G SISP L +AIEES +++
Sbjct  23   SYDVFLSFRGEDVRKTFVDHLYVALQQKGINTFKDSEKLEKGNSISPGLMRAIEESRISL  82

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS++YA+S WCL+E+ KIMEC  VKGQ V+P+FY VDPSTVRKQK  + EAF  +E  
Sbjct  83   IIFSKNYANSRWCLDEVAKIMECKNVKGQIVIPVFYDVDPSTVRKQKSSFEEAFNNYEDC  142

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            F     KV+KWR  LE+ +NLSGWDL NT N 
Sbjct  143  F-----KVQKWRGALEEAANLSGWDLPNTSNA  169



>ref|XP_008359477.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=199

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 111/148 (75%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYD+FLSFRGED R NF DHLY A+  +GI TF+DD KL RGKSI+P L KAIEES  AV
Sbjct  14   TYDIFLSFRGEDTRMNFTDHLYAALDLKGIMTFRDDLKLGRGKSIAPELLKAIEESRFAV  73

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            V+FS +YA S+WCL+ L KI ECMK  GQTV P+FY VDPS VR+Q   +G+AF  HE+S
Sbjct  74   VIFSRNYASSAWCLDGLSKICECMKELGQTVFPVFYDVDPSEVRRQTGSFGKAFAAHEES  133

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F+   EKV++WR    +++NLSGW + +
Sbjct  134  FKGNVEKVQRWRAATTEIANLSGWHVQD  161



>ref|XP_009794566.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
sylvestris]
Length=1107

 Score =   211 bits (537),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 119/152 (78%), Gaps = 3/152 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGEDVRK FVDHLY A+QQ+GI+TFKDDE LE+GKSISP L +AIEES +A+
Sbjct  15   SYDVFLSFRGEDVRKTFVDHLYVALQQKGIHTFKDDENLEKGKSISPDLMRAIEESRIAL  74

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS +YA+S WCL+ELVKIMEC  + GQ V P+FY VDPSTVRKQK  +GEAF  HE  
Sbjct  75   IIFSRNYANSIWCLDELVKIMECKNLNGQIVFPVFYDVDPSTVRKQKSSFGEAFSSHEA-  133

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
                  K++KWR  LE+ +NLSG DL NT N 
Sbjct  134  --HGCFKLQKWRAALEEAANLSGCDLPNTANA  163



>ref|XP_009794564.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009794565.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
sylvestris]
Length=1156

 Score =   211 bits (537),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 119/152 (78%), Gaps = 3/152 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGEDVRK FVDHLY A+QQ+GI+TFKDDE LE+GKSISP L +AIEES +A+
Sbjct  15   SYDVFLSFRGEDVRKTFVDHLYVALQQKGIHTFKDDENLEKGKSISPDLMRAIEESRIAL  74

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS +YA+S WCL+ELVKIMEC  + GQ V P+FY VDPSTVRKQK  +GEAF  HE  
Sbjct  75   IIFSRNYANSIWCLDELVKIMECKNLNGQIVFPVFYDVDPSTVRKQKSSFGEAFSSHE--  132

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
                  K++KWR  LE+ +NLSG DL NT N 
Sbjct  133  -AHGCFKLQKWRAALEEAANLSGCDLPNTANA  163



>emb|CDP04904.1| unnamed protein product [Coffea canephora]
Length=1201

 Score =   211 bits (536),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 135/182 (74%), Gaps = 3/182 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGEDVRKNFVD LY+++QQ+ IYTFKDDEKLERG+SISPAL +AI+ES +AV
Sbjct  27   TYDVFLSFRGEDVRKNFVDFLYSSLQQKEIYTFKDDEKLERGRSISPALIQAIKESRIAV  86

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FSE+YA SSWCL+EL +I++C  V GQTV+P+FY VDPS VR+QK  +G AF  HE  
Sbjct  87   IIFSENYATSSWCLDELAEIIDCNHVLGQTVLPVFYYVDPSVVRRQKGSFGRAFVKHEDE  146

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*IFNSNPLHPTRGDHGFGSERSVPVLET  343
             E + E+++KWR  L + + +SGWD+ NT +G    S  +    GD     ER + V E 
Sbjct  147  IE-DKERIQKWRAALTEAAAISGWDVPNTADG--HESKCIQEIVGDVMVKLERVIAVEEK  203

Query  342  DE  337
            ++
Sbjct  204  NQ  205



>gb|AAL07544.1| resistance gene analog NBS9 [Helianthus annuus]
Length=304

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 109/143 (76%), Gaps = 3/143 (2%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            ++VFLSFRGED RKNFVDHLY  + Q+GI T+KDDE L RG+ I PAL KAI+ES  AVV
Sbjct  46   HEVFLSFRGEDTRKNFVDHLYKDLVQQGIQTYKDDETLPRGERIGPALLKAIQESHFAVV  105

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFSE+YADSSWCL+EL  IMEC+  +GQ V+PIFY VDPS VRKQ  KYG+AF  HE+  
Sbjct  106  VFSENYADSSWCLDELAHIMECVDTRGQIVIPIFYHVDPSDVRKQNGKYGKAFTKHER--  163

Query  519  EKEGEKVKKWRKVLEDVSNLSGW  451
             K  +KV+ WR  LE   NLSGW
Sbjct  164  -KNKQKVESWRNALEKAGNLSGW  185



>ref|XP_006364843.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1230

 Score =   209 bits (531),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 128/154 (83%), Gaps = 2/154 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGED RK+FVDHLYT+++++GI+TF+DD++L RGKSISP L  AIE+S  AV
Sbjct  19   SYDVFLSFRGEDTRKSFVDHLYTSLREKGIHTFRDDKELSRGKSISPELLNAIEKSRFAV  78

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            V+FS++YADSSWCLEEL KI+EC + +GQT++P+FY VDPS VRKQKE YG+AF  HE++
Sbjct  79   VIFSKNYADSSWCLEELTKIVECNQQRGQTLIPVFYSVDPSVVRKQKESYGDAFAKHEEN  138

Query  522  FE--KEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             +   E  K+++WR  L+D +N+SG+D+ + E+G
Sbjct  139  LKGSDERNKIQRWRDALKDAANISGFDVQHMEDG  172



>gb|AAL07543.1| resistance gene analog NBS8 [Helianthus annuus]
Length=251

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 116/150 (77%), Gaps = 3/150 (2%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            ++VFLSFRGED RKNFVDHLY  + Q+GI T+KDDE L RG+ I PAL KAI+ES +A+V
Sbjct  44   HEVFLSFRGEDARKNFVDHLYEDLVQQGIQTYKDDETLPRGERIGPALLKAIQESRIALV  103

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS++YADSS CL+EL  IMEC+  +GQ V+P+FY VDPS VRKQ  KYG+AF  HE+  
Sbjct  104  VFSQNYADSSSCLDELAHIMECVDTRGQIVMPVFYFVDPSDVRKQNGKYGKAFSKHER--  161

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNNTEN  430
             K  +KV+ WRK LE   NLSGW +++T+N
Sbjct  162  -KNKQKVESWRKALEKADNLSGWVISDTQN  190



>gb|AAL07539.1| resistance gene analog NBS4 [Helianthus annuus]
Length=279

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 111/147 (76%), Gaps = 3/147 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             +DVFLSFRGED R +FVDHLY A+ Q+GI T+KDDE L RG+ I P L KAI+ES +A+
Sbjct  21   NHDVFLSFRGEDTRNSFVDHLYVALAQQGILTYKDDETLPRGERIGPTLLKAIQESRIAL  80

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFSE+YADSSWCL+EL  IMEC+  +GQ V PIFY VDPS VRKQK KYG+AF  H++ 
Sbjct  81   VVFSENYADSSWCLDELAHIMECVDTRGQIVEPIFYFVDPSDVRKQKGKYGKAFRKHKR-  139

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLN  442
              +   KV+ WRK LE   NLSGW +N
Sbjct  140  --ENKHKVESWRKALEKAGNLSGWVIN  164



>emb|CDP07826.1| unnamed protein product [Coffea canephora]
Length=1159

 Score =   206 bits (523),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 125/152 (82%), Gaps = 1/152 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGEDVRKNFVD LY+++QQ+GIYTFKDDEKLERG+SIS AL +AI+ES +AV
Sbjct  20   TYDVFLSFRGEDVRKNFVDFLYSSLQQKGIYTFKDDEKLERGRSISSALLQAIKESRIAV  79

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FSE+YA SSWCL+EL +I+ C +  GQT++P+FY VDPS VRKQK  +G+AF  HE  
Sbjct  80   IIFSENYAASSWCLDELAEIIYCNQALGQTILPVFYYVDPSVVRKQKGSFGQAFVKHEDE  139

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             E + E++++WR  L + +++SGWD+ +T +G
Sbjct  140  IE-DKERIRRWRAALAEAASISGWDVPSTADG  170



>ref|XP_004233763.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1228

 Score =   205 bits (522),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 124/154 (81%), Gaps = 2/154 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGED RK+FVDHLYT +  +GI+ F+DD++L RGKSISP L KAIE+S  AV
Sbjct  17   SYDVFLSFRGEDTRKSFVDHLYTTLHDKGIHAFRDDKELSRGKSISPELVKAIEKSRFAV  76

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            V+FS++YADSSWCLEEL KI+EC K +GQT++P+FY VDPS VRKQK  YG+AF  HE++
Sbjct  77   VIFSKNYADSSWCLEELTKIVECNKQRGQTLIPVFYSVDPSVVRKQKGSYGDAFAKHEEN  136

Query  522  FEKEGE--KVKKWRKVLEDVSNLSGWDLNNTENG  427
             +   E  K+++WR  L+D +N+SG+D+ + E+G
Sbjct  137  LKGSDESYKIQRWRDALKDAANISGFDVQHMEDG  170



>gb|AAN73010.1| NBS-LRR resistance protein RAS5-1 [Helianthus annuus]
Length=448

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            +DVFLSFRGED R +FVDHLY A+ Q+GI  +KDDE L RG+ I PAL KAI+ES +AVV
Sbjct  84   HDVFLSFRGEDTRNSFVDHLYAALAQQGIQAYKDDETLPRGERIGPALLKAIQESRIAVV  143

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS++YADSSWCL+EL  IMECM  +GQ V+PIFY VDPS VRKQK KYG+AF   ++  
Sbjct  144  VFSQNYADSSWCLDELAHIMECMDTRGQIVIPIFYFVDPSDVRKQKGKYGKAFRKRKR--  201

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLN  442
             +  +KV+ WRK LE   NLSGW +N
Sbjct  202  -ENRQKVESWRKALEKAGNLSGWVIN  226



>emb|CAN61899.1| hypothetical protein VITISV_029813 [Vitis vinifera]
Length=167

 Score =   188 bits (478),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 115/147 (78%), Gaps = 4/147 (3%)
 Frame = -2

Query  885  STYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMA  706
            STYDVFLSFRGED R NF DHLY+A+ +RGI+TF+DD KL RG++I+P L KAIEES  +
Sbjct  22   STYDVFLSFRGEDTRYNFTDHLYSALGRRGIHTFRDD-KLRRGEAIAPELLKAIEESRSS  80

Query  705  VVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            V+VFSE+YA S WCL+ELVKIMEC K     V PIFY VDPS VRKQ+  +GEAF G+E+
Sbjct  81   VIVFSENYAHSRWCLDELVKIMECQKDPAHVVFPIFYHVDPSHVRKQEGSFGEAFAGYEE  140

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDL  445
            +++   +K+ +WR+ L + +NLSGW +
Sbjct  141  NWK---DKIPRWRRALTEAANLSGWHI  164



>ref|XP_010665436.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=312

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 117/160 (73%), Gaps = 1/160 (1%)
 Frame = -2

Query  918  MEQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPA  739
            M  PSF SS  S YDVFLSFRGED R  F  HLY A+ ++G+ TF DD K+ RG+SISP 
Sbjct  22   MAAPSFASSQWS-YDVFLSFRGEDTRFTFAAHLYEALDRKGVNTFFDDHKIRRGESISPT  80

Query  738  LEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKE  559
            L +AIE S  ++++ S++YA S+WCLEELVKI+EC K  GQ V+P+FY VDPS VRK K+
Sbjct  81   LVRAIEGSRSSIIILSQNYASSTWCLEELVKILECRKTMGQLVLPVFYNVDPSDVRKHKQ  140

Query  558  KYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             +G+A   HEK+ ++  +KVK WR+ L +V+NL+GW+  N
Sbjct  141  SFGKALVKHEKTLKQNMDKVKNWREALSEVANLAGWNSQN  180



>ref|XP_006371051.1| hypothetical protein POPTR_0019s02990g, partial [Populus trichocarpa]
 gb|ERP48848.1| hypothetical protein POPTR_0019s02990g, partial [Populus trichocarpa]
Length=212

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 114/153 (75%), Gaps = 3/153 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRGED RK F DHLY A+ Q GI+TF+DD++L RG+ IS  L KAI ES +++
Sbjct  14   AYDVFLSFRGEDTRKTFTDHLYAALDQAGIHTFRDDDELPRGEEISEHLLKAIRESKISI  73

Query  702  VVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            VVFS+ YA S WCL ELV+I++C + K GQ V+PIFY +DPS VRKQ   + EAF+ HE+
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEE  133

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             FE+  + VK+WRK LED  NLSGW LN+  NG
Sbjct  134  RFEE--KLVKEWRKALEDAGNLSGWSLNDMANG  164



>ref|XP_007199954.1| hypothetical protein PRUPE_ppa1027179mg, partial [Prunus persica]
 gb|EMJ01153.1| hypothetical protein PRUPE_ppa1027179mg, partial [Prunus persica]
Length=1081

 Score =   203 bits (516),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED R NF D LYT++ Q+GI+TF+DDE+LERGK I+P L KAIE S   +
Sbjct  26   TYDVFLSFRGEDTRTNFTDFLYTSLIQKGIFTFRDDEELERGKPIAPKLLKAIEASRYVI  85

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            V+ S +YA+S+WCL+ELVK +ECM + GQT++P+FY VDPS VRKQK  +GEAF  HE++
Sbjct  86   VILSRNYANSTWCLDELVKAVECMNLMGQTILPVFYHVDPSEVRKQKADFGEAFSKHEET  145

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F+   + V++WR  L  VSNLSGW L++
Sbjct  146  FKDNKQNVQRWRDALTQVSNLSGWHLHD  173



>ref|XP_006373535.1| hypothetical protein POPTR_0017s14605g [Populus trichocarpa]
 gb|ERP51332.1| hypothetical protein POPTR_0017s14605g [Populus trichocarpa]
Length=169

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D R NF  HLY+ ++QRGI  + DD +LERGK+I  AL KAIEES  +V+
Sbjct  22   YDVFLSFRGKDTRNNFTSHLYSNLKQRGIDVYMDDRELERGKTIETALWKAIEESRFSVI  81

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FS  YA S WCL+ELVKI++CMK  GQTV+P+FY VDPS V ++K KY EAF  HE++F
Sbjct  82   IFSRDYASSPWCLDELVKIVQCMKEMGQTVLPVFYDVDPSEVIERKRKYEEAFVEHEQNF  141

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++  E+V+ W+  L  V+NLSGWD+ N
Sbjct  142  KENLEQVRNWKDCLSTVANLSGWDIRN  168



>ref|XP_006373440.1| hypothetical protein POPTR_0017s13775g [Populus trichocarpa]
 gb|ERP51237.1| hypothetical protein POPTR_0017s13775g [Populus trichocarpa]
Length=169

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D R NF  HLY+ ++QRGI  + DD +LERGK+I PAL KAIEES  +V+
Sbjct  22   YDVFLSFRGKDTRNNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVI  81

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FS  YA S WCL+ELVKI++CMK  G TV+P+FY VDPS V +QK +Y +AF  HE++F
Sbjct  82   IFSRDYASSPWCLDELVKIVQCMKETGHTVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNF  141

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++  EKV+ W+  L  V+NLSGWD+ N
Sbjct  142  KENLEKVQIWKDCLSTVTNLSGWDVRN  168



>gb|ABK96264.1| unknown [Populus trichocarpa x Populus deltoides]
Length=289

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D RKNF  HLY+ ++QRGI  + DD +LERGK+I PAL KAIEES  +V+
Sbjct  22   YDVFLSFRGKDTRKNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVI  81

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FS  YA S WCL+ELVKI++CMK  G TV+P+FY VDPS V +QK +Y +AF  HE++F
Sbjct  82   IFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVAEQKGQYEKAFVEHEQNF  141

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++  EKV+ W+  L  V+NLSGWD+ N
Sbjct  142  KENLEKVRNWKDCLSTVTNLSGWDIRN  168



>ref|XP_009366532.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=637

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED RKNF DHLY A+  +GI TF+DD KL RGKSI+P L KAIEES  AV
Sbjct  14   TYDVFLSFRGEDTRKNFTDHLYAALDLKGIMTFRDDLKLGRGKSIAPELLKAIEESRFAV  73

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFS +YA S+WCL+EL KI +CMK  GQTV P+FY VDPS VRKQ   +G+AF  HE+S
Sbjct  74   VVFSRNYASSAWCLDELSKICKCMKELGQTVFPVFYDVDPSVVRKQTGSFGKAFATHEES  133

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F+   EKV++WR    +++NLSGW + +
Sbjct  134  FKGNVEKVQRWRAATTEIANLSGWHVQD  161



>ref|XP_006373435.1| hypothetical protein POPTR_0017s13755g [Populus trichocarpa]
 gb|ERP51232.1| hypothetical protein POPTR_0017s13755g [Populus trichocarpa]
Length=171

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D R NF  HLY  + QRGI  + DD  LERGK+I PAL KAIEES  +V+
Sbjct  24   YDVFLSFRGKDTRNNFTSHLYYNLAQRGIDVYMDDRGLERGKTIEPALWKAIEESRFSVI  83

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FS  YA S WCL+ELVKI++CMK  G TV+PIFY VDPS V +QK +Y +AF  HE++F
Sbjct  84   IFSREYASSPWCLDELVKIVQCMKETGHTVLPIFYDVDPSEVAEQKGQYEKAFVEHEQNF  143

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++  EKV+ W+  L  V+NLSGWD+ N
Sbjct  144  KENLEKVRNWKDCLSTVANLSGWDVRN  170



>gb|AEI27416.1| TIR_3 [Helianthus annuus]
Length=1111

 Score =   202 bits (515),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 116/151 (77%), Gaps = 3/151 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             ++VFLSFRGED RKNFVDHLY  + Q+GI+T+KDD+ L RG+SI PAL KAI+ES +A+
Sbjct  76   NHEVFLSFRGEDTRKNFVDHLYKDLVQQGIHTYKDDQTLPRGESIGPALLKAIQESRIAL  135

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFS++YADSSWCL+EL   MEC+   GQ V+PIFY VDPS VRKQK KYG+A   HE+ 
Sbjct  136  VVFSQNYADSSWCLDELAHTMECVDTNGQIVIPIFYHVDPSDVRKQKGKYGKALSKHER-  194

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTEN  430
              K  +KV+ WR  LE   NLSGW +NNTEN
Sbjct  195  --KNKQKVESWRNALEKAGNLSGWVINNTEN  223



>emb|CAC95120.1| TIR/NBS/LRR protein [Populus deltoides]
Length=216

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 121/166 (73%), Gaps = 4/166 (2%)
 Frame = -2

Query  918  MEQP-SFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISP  742
            M +P S  S    TYDVFLSFRGED R  F DHLYTA+ Q GI+TF+DD++L RG+ IS 
Sbjct  37   MTEPESSRSRPEGTYDVFLSFRGEDTRHTFTDHLYTALIQAGIHTFRDDDELPRGEEISD  96

Query  741  ALEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQ  565
             L +AI+ES +++VVFS+ YA S WCL ELV+I++C + K GQ V+PIFY +DPS VRKQ
Sbjct  97   HLIRAIQESKISIVVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQ  156

Query  564  KEKYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
               + EAF  HE+ FE+  + VK+WRK LE+  NLSGW+LN+  NG
Sbjct  157  NGSFAEAFVKHEERFEE--KLVKEWRKALEEAGNLSGWNLNDMANG  200



>ref|XP_006380156.1| hypothetical protein POPTR_0008s22420g, partial [Populus trichocarpa]
 gb|ERP57953.1| hypothetical protein POPTR_0008s22420g, partial [Populus trichocarpa]
Length=174

 Score =   187 bits (474),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED RK+F DHLYTA+  RG+ TF+DD++LERG  IS  L +AI++S  +V+
Sbjct  14   YDVFLSFRGEDTRKSFTDHLYTALCHRGVITFRDDQELERGNEISRELLQAIQDSRFSVI  73

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS +Y  S+WCL ELVKI+ECMK   QTV+P+FY VDPS VR Q  +  +AF  HE+ F
Sbjct  74   VFSRNYTSSTWCLNELVKIVECMKQGRQTVIPVFYDVDPSEVRNQTGRLQQAFADHEEVF  133

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            +   EKV+ WR  ++ V+NLSGWDL +
Sbjct  134  KDNIEKVQTWRIAMKLVANLSGWDLQD  160



>emb|CDP20523.1| unnamed protein product [Coffea canephora]
Length=1150

 Score =   202 bits (514),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGEDVRK  VDHLY+A++Q+GI+TFKDDEKLERG+SISP L +AI+ES +AV
Sbjct  25   TYDVFLSFRGEDVRKGIVDHLYSALEQKGIHTFKDDEKLERGRSISPTLLQAIKESRIAV  84

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FSE+YA SSWCL+EL +I++C  V GQTV+P+FY VDPS VR+QK  +  AF  HE  
Sbjct  85   IIFSENYATSSWCLDELAEIIDCKHVLGQTVLPVFYYVDPSVVRRQKGSFDRAFVKHEDE  144

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             E + E+++KWR  L + +++SGWD+  T +G
Sbjct  145  IE-DKERIQKWRAALTEAASISGWDVPKTADG  175



>ref|XP_006388458.1| hypothetical protein POPTR_0182s00230g [Populus trichocarpa]
 gb|ERP47372.1| hypothetical protein POPTR_0182s00230g [Populus trichocarpa]
Length=169

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 109/153 (71%), Gaps = 2/153 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED RKNF DHLY A +  GI TF+DD +L RG+ IS  L +AI++S ++V+
Sbjct  17   YDVFLSFRGEDTRKNFTDHLYFAFKDAGINTFRDDNELRRGEDISTELLQAIQKSRISVI  76

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS +YA+S WCLEELVKIMEC +   Q V PIFY VDPS VRKQ   + EAF GHE+ F
Sbjct  77   VFSRNYANSRWCLEELVKIMECRRSCRQLVFPIFYDVDPSDVRKQTGSFAEAFAGHEERF  136

Query  519  --EKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
              + +  KV  WR  L + +NLSGWDL N  +G
Sbjct  137  VLQTDKGKVATWRMALTEAANLSGWDLRNVADG  169



>gb|AAL07535.1| resistance gene analog PU3 [Helianthus annuus]
Length=770

 Score =   199 bits (507),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 114/147 (78%), Gaps = 3/147 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             +DVFLSFRGED R +FVDHLY A+ Q+GI T+KDD+ L RG+ I PAL KAI+ES +AV
Sbjct  82   NHDVFLSFRGEDTRNSFVDHLYAALVQQGIQTYKDDQTLPRGERIGPALLKAIQESRIAV  141

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFS++YADSSWCL+EL  IMECM  +GQ V+PIFY VDPS VRKQK KYG+AF  H++ 
Sbjct  142  VVFSQNYADSSWCLDELAHIMECMDTRGQIVIPIFYFVDPSDVRKQKGKYGKAFRKHKR-  200

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLN  442
              +  +KV+ WRK LE   NLSGW +N
Sbjct  201  --ENKQKVESWRKALEKAGNLSGWVIN  225



>ref|XP_006373432.1| hypothetical protein POPTR_0017s13740g [Populus trichocarpa]
 gb|ERP51229.1| hypothetical protein POPTR_0017s13740g [Populus trichocarpa]
Length=169

 Score =   186 bits (472),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D R NF  HLY+ + QRGI  + DD +LERGK+I  AL KA+EES  +V+
Sbjct  22   YDVFLSFRGKDTRNNFTSHLYSNLAQRGIDVYMDDSELERGKTIETALWKAVEESRFSVI  81

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FS  YA S WCL+ELVKI++CMK  GQTV+P+FY VDPS V K+K +Y +AF  HE++F
Sbjct  82   IFSRDYASSPWCLDELVKIVQCMKEMGQTVLPVFYDVDPSEVAKRKGQYEKAFVEHEQNF  141

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++  EKV+ W+  L  V+NLSGWD+ N
Sbjct  142  KENLEKVRNWKDCLSTVANLSGWDIRN  168



>ref|XP_004289883.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=193

 Score =   187 bits (474),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 114/144 (79%), Gaps = 1/144 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D RK F DHLYTA++ +G+ TF+DD +L++GK+ISP L  AI+ES  A++
Sbjct  21   YDVFLSFRGDDTRKTFTDHLYTALEHQGMITFRDDPELKKGKAISPELFSAIKESRFALI  80

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            + S++YA S+WCL+ELV+I+ECMK + +TV+PIFY +DPS VRKQ   +GEAF  HE+ F
Sbjct  81   ILSQNYASSTWCLDELVRILECMKAR-ETVLPIFYDIDPSDVRKQTGSFGEAFTHHEERF  139

Query  519  EKEGEKVKKWRKVLEDVSNLSGWD  448
              + EKV++WR  L +V++ SGW+
Sbjct  140  RDDKEKVRRWRDALTEVASFSGWN  163



>emb|CAN62709.1| hypothetical protein VITISV_035615 [Vitis vinifera]
Length=164

 Score =   185 bits (470),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED  K+F DHL+ A+ QRG+ TF DD KL RG+ ISPAL KAIEES  +V+
Sbjct  16   YDVFLSFRGEDTGKSFTDHLHRALFQRGVKTFMDD-KLSRGQEISPALVKAIEESRFSVI  74

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFSE+YA S+WCLEELVKI++C KV G   +P+FY VDPS VRKQ   + +AF  HE+ +
Sbjct  75   VFSENYASSTWCLEELVKIIDCTKVMGHAALPVFYNVDPSHVRKQTGSFAQAFAKHEEVY  134

Query  519  EKEGEKVKKWRKVLEDVSNLSGWD  448
            +++ EKV KWR  L + +N+SGWD
Sbjct  135  KEQMEKVIKWRVALTEAANISGWD  158



>ref|XP_010057031.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=158

 Score =   185 bits (470),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRG D+R NF+ HLY A+   G+YTF+D E+L++G  ISP L KAIEES +A+
Sbjct  10   IYDVFLSFRGADLRNNFIGHLYQALHHNGVYTFRDSEELKKGDQISPVLMKAIEESCIAI  69

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE YA S WCLEEL KI+EC + K   V+P+FY VDPS VR+ ++ Y  +   HE  
Sbjct  70   IVFSEDYASSRWCLEELAKIIECKEQKNLIVLPVFYKVDPSEVREGRKSYQRSLAKHEFK  129

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F K+ EKVK+W+K L D  NLSGW LN+
Sbjct  130  FRKDSEKVKRWKKALFDAGNLSGWHLND  157



>ref|XP_009803658.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1237

 Score =   201 bits (512),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 126/158 (80%), Gaps = 3/158 (2%)
 Frame = -2

Query  897  SSCGS-TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIE  721
            +SC   +YDVFLSFRGED RK+FVDHLYT + ++GI+ F+DD +L RGK ISP L  AIE
Sbjct  19   TSCRQWSYDVFLSFRGEDTRKSFVDHLYTTLHEKGIHAFRDDIELRRGKFISPELRNAIE  78

Query  720  ESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAF  541
            +S  AVV+FS++YA+SSWCLEEL KI++C K +GQT++P+FY VDPS VRKQK  Y EAF
Sbjct  79   KSRFAVVIFSQNYANSSWCLEELTKIVDCTKHRGQTLMPVFYSVDPSVVRKQKGSYQEAF  138

Query  540  EGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
              HEK+FE+  +K+K+WR  L++ +N+SG+D+ + E+G
Sbjct  139  AEHEKNFEE--KKIKEWRDALKEAANISGYDVQHMEDG  174



>gb|AAL07537.1| resistance gene analog NBS2 [Helianthus annuus]
Length=226

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 107/143 (75%), Gaps = 3/143 (2%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            ++VFLSFRGED R+NFVDHLY  + Q+GI T+KDDE L RG+ I PAL KAI+ES +AVV
Sbjct  37   HEVFLSFRGEDTRRNFVDHLYKDLAQQGIQTYKDDETLPRGERIGPALLKAIQESHIAVV  96

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS++YADSSWCL+EL  IMECM    Q V+P+FY V+PS VR QK KYG+A   HE+  
Sbjct  97   VFSQNYADSSWCLDELAHIMECMDPSEQIVMPVFYHVNPSDVRNQKGKYGKALSKHER--  154

Query  519  EKEGEKVKKWRKVLEDVSNLSGW  451
             K  +KV+ WR  LE   NLSGW
Sbjct  155  -KNKQKVESWRNALEKAGNLSGW  176



>ref|XP_009622249.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1238

 Score =   200 bits (509),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGED RK+FVDHLYT + ++GI+ F+DD +L RGK ISP L  AIE+S  AV
Sbjct  27   SYDVFLSFRGEDTRKSFVDHLYTTLHEKGIHAFRDDIELRRGKFISPELLNAIEKSRFAV  86

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            V+FS++YA+SSWCLEEL KI++C K +GQT++P+FYGVDPS VRKQK  Y EAF  HEK+
Sbjct  87   VIFSKNYANSSWCLEELRKIVDCTKHRGQTLIPVFYGVDPSVVRKQKGSYEEAFAEHEKN  146

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            F++  +K+K+WR  L++ +N+SG+D+ + E+G
Sbjct  147  FDE--KKIKEWRDALKEAANISGYDVQHMEDG  176



>ref|XP_011044953.1| PREDICTED: TMV resistance protein N-like, partial [Populus euphratica]
Length=542

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = -2

Query  918  MEQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPA  739
            M   S  S  G  YDVFLSFRGED RKNF DHLYTA+ Q GI+TF+DD +L +G+ IS  
Sbjct  1    MFMSSSSSRLGWHYDVFLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDNELRKGEEISSH  60

Query  738  LEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKE  559
            L KAI+ES +++VVFS+ YA S+WCL+EL +I++C +  GQ V+P+FY +DPS +RKQK 
Sbjct  61   LLKAIQESKISIVVFSKGYASSTWCLDELSEILDCRQTAGQIVLPVFYDIDPSDIRKQKR  120

Query  558  KYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             + EAF+ HE+ F++E EKV+KWRK L +   L+G+DL++  NG
Sbjct  121  SFAEAFDRHEELFKEEMEKVQKWRKALVEAGRLTGFDLHSIANG  164



>ref|XP_007201658.1| hypothetical protein PRUPE_ppa022091mg [Prunus persica]
 gb|EMJ02857.1| hypothetical protein PRUPE_ppa022091mg [Prunus persica]
Length=1105

 Score =   200 bits (508),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED R NF D LYT++ Q+GI+TF+DDE+LERGK I+P L KAIE S   +
Sbjct  22   TYDVFLSFRGEDTRTNFTDFLYTSLIQKGIFTFRDDEELERGKPIAPKLSKAIEASRYVI  81

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            V+ S +Y +S+WCL+ELVK +ECM + GQT++P+FY VDPS VRKQK  +GEAF  HE++
Sbjct  82   VILSPNYVNSTWCLDELVKAVECMNLMGQTILPVFYHVDPSEVRKQKADFGEAFPKHEEA  141

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F+     V++WR  L  VSNLSGW L++
Sbjct  142  FKDNERNVQRWRDALNQVSNLSGWHLHD  169



>ref|XP_006376197.1| hypothetical protein POPTR_0013s10750g [Populus trichocarpa]
 gb|ERP53994.1| hypothetical protein POPTR_0013s10750g [Populus trichocarpa]
Length=177

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 113/155 (73%), Gaps = 8/155 (5%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D R NF  HLY+ ++QRGI  + DD +LERGK+I PAL KAIEES  +V+
Sbjct  22   YDVFLSFRGKDTRNNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVI  81

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPI--------FYGVDPSTVRKQKEKYGEA  544
            +FS  YA S WCL+ELVKI++CMK  GQTV+P+        FY VDPS V ++K KY EA
Sbjct  82   IFSRDYASSPWCLDELVKIVQCMKEMGQTVLPVFYDVDPSEFYDVDPSEVIERKRKYEEA  141

Query  543  FEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F  HE++F++  EKV+ W+  L  V+NLSGWD+ N
Sbjct  142  FVEHEQNFKENLEKVRNWKDCLSTVANLSGWDVRN  176



>gb|KGN59547.1| hypothetical protein Csa_3G824920 [Cucumis sativus]
Length=1135

 Score =   199 bits (507),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 95/152 (63%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED RKNF DHLY A +  GI  F+DD +LERG+ IS  LE+AIE S +AV
Sbjct  13   TYDVFLSFRGEDTRKNFTDHLYYAFKDAGINVFRDDPELERGEDISSELERAIEGSKVAV  72

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFSE YA+S WCLEELVKIMEC +   Q V PIFY VDPS VRKQK+++ EAF  HE  
Sbjct  73   VVFSERYAESGWCLEELVKIMECRRTLRQLVFPIFYNVDPSYVRKQKDEFEEAFVKHEVR  132

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            + ++ ++V KWR  L + +NLSGWDL N  NG
Sbjct  133  YFRDIDRVLKWRMALTEAANLSGWDLRNIANG  164



>ref|XP_004310272.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=1668

 Score =   201 bits (510),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = -2

Query  909  PSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEK  730
            PS   S   TYDVFLSFRGED RKNF DHLYTA+ Q+GI+TF+DDE+LERG+SI+P L K
Sbjct  75   PSSPRSGKLTYDVFLSFRGEDTRKNFTDHLYTALLQKGIHTFRDDEELERGESIAPNLLK  134

Query  729  AIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQK-EKY  553
            AIEES   +VVFS +YADS+WCL+E+ K+ +CMK  G  V+P+FY VDPS VR Q  E +
Sbjct  135  AIEESRYVIVVFSPNYADSAWCLDEVAKVADCMKEMGTKVLPVFYHVDPSEVRTQTGEHF  194

Query  552  GEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            G+AFE H+K ++KE  KV++W+  L  V NLSGW L +
Sbjct  195  GKAFEKHQKRYKKEPTKVQRWKDALFQVGNLSGWHLQD  232



>ref|XP_010646556.1| PREDICTED: putative disease resistance protein At4g11170 [Vitis 
vinifera]
Length=684

 Score =   196 bits (499),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGED R NF  HLY A+ +RGI TF DD+KL RG++ISPAL KAIE S  ++
Sbjct  11   SYDVFLSFRGEDTRNNFTAHLYDALCRRGINTFIDDDKLGRGEAISPALFKAIERSMYSI  70

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +V SE+YA S WCLEELVKI+ECMK KGQ V+PIFY VDPS VRKQ+ K GEA   H+++
Sbjct  71   IVLSENYASSRWCLEELVKIVECMKSKGQRVLPIFYNVDPSDVRKQRGKIGEALAKHQEN  130

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             E   E+VK WR+ L  VSNLSGWD  N
Sbjct  131  LENL-ERVKVWREALTQVSNLSGWDSRN  157



>gb|KDO36130.1| hypothetical protein CISIN_1g045860mg [Citrus sinensis]
Length=160

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 119/161 (74%), Gaps = 3/161 (2%)
 Frame = -2

Query  918  MEQPSFVS-SCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISP  742
            M   SF + SCG  YD FLSFRGED RK F+ +LYTA+  +GIY F+DD++LE+G SISP
Sbjct  1    MATTSFQNISCGK-YDAFLSFRGEDTRKGFIGYLYTALNNKGIYVFRDDKQLEKGGSISP  59

Query  741  ALEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQK  562
             L KAI+ES ++++V S++YA S+WCL+EL+KI EC   + Q + PIFYGV+P+ VRKQ 
Sbjct  60   NLLKAIDESRISIIVLSKNYASSTWCLDELLKITECKNREDQ-IFPIFYGVEPTVVRKQT  118

Query  561  EKYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
              +GEAF  HE+ F    EKV+KWR  L+ V+N+SGW+L +
Sbjct  119  ASFGEAFAEHEEFFRDNIEKVQKWRHALKVVANISGWELKD  159



>ref|XP_004310257.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=605

 Score =   195 bits (496),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 117/149 (79%), Gaps = 1/149 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED RKNF DHLYTA+ Q+GI+TF+DDE+L RG+SI+P L KAIEES   +
Sbjct  91   TYDVFLSFRGEDTRKNFTDHLYTALWQKGIHTFRDDEELVRGESIAPNLLKAIEESRYVI  150

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQK-EKYGEAFEGHEK  526
            VVFS +YADS+WCL+E+ ++ +CMK  G  V+P+FY VDPS VR+Q  E +G+AFE H+K
Sbjct  151  VVFSPNYADSAWCLDEVAEVADCMKEMGTKVLPVFYHVDPSEVRRQTGEHFGKAFEKHQK  210

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             ++KE  KV++W+  L  V NLSGW L +
Sbjct  211  RYKKEPNKVQRWKDALFQVGNLSGWHLQD  239



>ref|XP_006389203.1| hypothetical protein POPTR_0035s00240g [Populus trichocarpa]
 gb|ERP48117.1| hypothetical protein POPTR_0035s00240g [Populus trichocarpa]
Length=177

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 112/155 (72%), Gaps = 8/155 (5%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            +DVFLSFRG+D R NF  HLY+ + QRGI  + DD KLERGK+I PAL KAIEES  +V+
Sbjct  22   HDVFLSFRGKDTRNNFTSHLYSNLTQRGIDVYMDDRKLERGKTIEPALWKAIEESRFSVI  81

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPI--------FYGVDPSTVRKQKEKYGEA  544
            +FS  YA S WCL+ELVKI++CMK  GQTV+P+        FY VDPS V ++K KY EA
Sbjct  82   IFSRDYASSPWCLDELVKIVQCMKEMGQTVLPVFYDVDPSEFYDVDPSEVIERKRKYEEA  141

Query  543  FEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F  HE++F++  EKV+ W+  L  V+NLSGWD+ N
Sbjct  142  FVEHEQNFKENLEKVRNWKDCLSTVANLSGWDIRN  176



>ref|XP_010657879.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=153

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 112/145 (77%), Gaps = 4/145 (3%)
 Frame = -2

Query  885  STYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMA  706
            STYDVFLSFRGED R NF DHLY+A+ +RGI TF+DD KL RG+ I+P L KAIEES  +
Sbjct  8    STYDVFLSFRGEDTRYNFTDHLYSALGRRGIRTFRDD-KLRRGEVIAPELLKAIEESRSS  66

Query  705  VVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            V+VFSE+YA S WCL+ELVKIMEC K  G  V PIFY VDPS VRKQ+  +GEAF  +E+
Sbjct  67   VIVFSENYARSRWCLDELVKIMECQKDLGHAVFPIFYHVDPSHVRKQEGSFGEAFARYEE  126

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGW  451
            +++   +K+ +WR+ L + +NLSGW
Sbjct  127  NWK---DKIPRWRRALTEAANLSGW  148



>ref|XP_006389148.1| hypothetical protein POPTR_0043s00285g [Populus trichocarpa]
 gb|ERP48062.1| hypothetical protein POPTR_0043s00285g [Populus trichocarpa]
Length=169

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D R NF  HLY+ ++QRGI  + DD +LERGK+I PAL KAIEES  +V+
Sbjct  22   YDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVI  81

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FS  YA S WCL+ELVKI++CMK  G TV+P+FY VDPS V +QK +Y +AF   E++F
Sbjct  82   IFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVAEQKGQYEKAFVEQEQNF  141

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++  EKV+ W+  L  V+NLSGWD+ +
Sbjct  142  KENLEKVRNWKDCLSTVANLSGWDVRD  168



>ref|XP_010645942.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=306

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED R NF  HLY  ++ +GI TF DD+KL+RG+ ISPAL  AIE S  +++
Sbjct  110  YDVFLSFRGEDTRNNFTAHLYKELRTKGINTFIDDDKLDRGQVISPALVAAIENSMFSII  169

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            V SE+YA S WCLEELVKI+EC + +GQ V+PIFY VDPS VRK   K+GEA   HE++F
Sbjct  170  VLSENYASSRWCLEELVKILECKESRGQRVLPIFYNVDPSDVRKHMGKFGEALAKHEENF  229

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++   +V+ WR  L  V+NLSGWD  N
Sbjct  230  KENMGRVQIWRDALTQVANLSGWDSRN  256



>ref|XP_010041655.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=160

 Score =   183 bits (464),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 108/148 (73%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRG DVR +F+ HLYTA+ Q GIYT+ D+E+L++G+ ISPAL KAIEES +A+
Sbjct  12   SYDVFLSFRGPDVRNHFLGHLYTALDQTGIYTYIDNEELKKGEQISPALMKAIEESRIAI  71

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFSE YA S WCLEE+ K+MEC   +   V P+FY V+P  VR Q++ Y EA   HE  
Sbjct  72   VVFSEDYASSPWCLEEVAKVMECRGERKLMVFPVFYKVEPREVRGQRQSYAEAMAKHEVK  131

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F K+ EKVK+WRK L D  +LSGW   +
Sbjct  132  FGKDSEKVKRWRKALFDAGSLSGWHFTD  159



>emb|CAC95127.1| part I of G08 TIR/NBS/LRR protein [Populus deltoides]
Length=226

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 113/152 (74%), Gaps = 3/152 (2%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED RK F DHLYTA+ Q GIYTF+DD++L RG+ IS  L +AI+ES +++V
Sbjct  15   YDVFLSFRGEDTRKTFTDHLYTALVQAGIYTFRDDDELPRGEEISYHLLRAIQESKISIV  74

Query  699  VFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VFS+ YA S WCL ELV+I++C   K GQ V+PIFY +DPS VRKQ   + EAF  HE+ 
Sbjct  75   VFSKGYASSRWCLNELVEILKCKNGKTGQIVLPIFYDIDPSYVRKQNGSFAEAFVKHEER  134

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            FE+    VK+WRK L +  NLSGW+LN+  NG
Sbjct  135  FEE--TLVKEWRKALAEAGNLSGWNLNDMANG  164



>ref|XP_004159650.1| PREDICTED: TMV resistance protein N-like [Cucumis sativus]
Length=936

 Score =   197 bits (501),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED RKNF DHLY A +  GI  F+DD +LERG+ IS  LE+AIE S +AV
Sbjct  13   TYDVFLSFRGEDTRKNFTDHLYYAFKDAGINVFRDDPELERGEDISSELERAIEGSKVAV  72

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFSE YA+S WCLEELVKIMEC +   Q V PIFY VDPS VRKQK ++ EAF  HE  
Sbjct  73   VVFSERYAESGWCLEELVKIMECRRTLRQLVFPIFYNVDPSCVRKQKGEFEEAFVKHEVR  132

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            + ++ ++V KWR  L + +NLSGWDL N  NG
Sbjct  133  YFRDIDRVLKWRMALTEAANLSGWDLRNIANG  164



>ref|XP_010103728.1| TMV resistance protein N [Morus notabilis]
 gb|EXB96870.1| TMV resistance protein N [Morus notabilis]
Length=181

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 112/159 (70%), Gaps = 2/159 (1%)
 Frame = -2

Query  909  PSFVSS--CGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPAL  736
            P  V +  C   YDVFL+FRGED RKNF+ HL  A+ ++GI TF DD+++ERG  ISP L
Sbjct  15   PDLVPNHDCSRKYDVFLNFRGEDTRKNFMGHLRVALSEKGIETFIDDDQIERGHFISPQL  74

Query  735  EKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEK  556
             +AIE SS AVV+ S +YA S+WCL+ELVKI++ MK KGQTV+PIFY VDPS VRKQ   
Sbjct  75   LQAIENSSCAVVILSPNYAFSTWCLDELVKILDSMKTKGQTVIPIFYHVDPSDVRKQTGT  134

Query  555  YGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            +G+A   HE     + E+V  W+  L +++NL+G DL N
Sbjct  135  FGDAIAKHEMCLNDDFERVNNWKIALAELTNLAGLDLKN  173



>ref|XP_004136800.1| PREDICTED: TMV resistance protein N-like [Cucumis sativus]
Length=996

 Score =   197 bits (502),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED RKNF DHLY A +  GI  F+DD +LERG+ IS  LE+AIE S +AV
Sbjct  13   TYDVFLSFRGEDTRKNFTDHLYYAFKDAGINVFRDDPELERGEDISSELERAIEGSKVAV  72

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFSE YA+S WCLEELVKIMEC +   Q V PIFY VDPS VRKQK ++ EAF  HE  
Sbjct  73   VVFSERYAESGWCLEELVKIMECRRTLRQLVFPIFYNVDPSCVRKQKGEFEEAFVKHEVR  132

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            + ++ ++V KWR  L + +NLSGWDL N  NG
Sbjct  133  YFRDIDRVLKWRMALTEAANLSGWDLRNIANG  164



>gb|KDO40203.1| hypothetical protein CISIN_1g047667mg [Citrus sinensis]
Length=160

 Score =   182 bits (463),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 112/147 (76%), Gaps = 1/147 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED RK+F  HLY A++ +GIY F+DD++LE+G SISP L KAIEES ++++
Sbjct  14   YDVFLSFRGEDTRKSFTGHLYAALKNKGIYVFRDDKELEKGGSISPELLKAIEESRISII  73

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            V S++YA S+WCL+EL KI+EC   K Q ++PIFY V+P+ VRKQ   +GEAF  HE++F
Sbjct  74   VLSKNYASSTWCLDELAKIVECKNRKDQ-ILPIFYDVEPTVVRKQTASFGEAFAKHEEAF  132

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
                EKV+ WR  L+ V+N SGW+L +
Sbjct  133  RNNVEKVQTWRDALKTVANKSGWELKD  159



>ref|XP_007221062.1| hypothetical protein PRUPE_ppa016235mg [Prunus persica]
 gb|EMJ22261.1| hypothetical protein PRUPE_ppa016235mg [Prunus persica]
Length=237

 Score =   185 bits (470),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 111/143 (78%), Gaps = 1/143 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLS+RGED RK F+DHLYTA+ ++GI+TF DDE L RG+ ISPAL  AIEES ++V
Sbjct  32   TYDVFLSYRGEDTRKTFIDHLYTALDRQGIHTFIDDE-LPRGEEISPALLNAIEESKISV  90

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE+YA SSWCL+ELVKI+E  K K Q V+PIFY VDPS VR Q+  +G+A   HE  
Sbjct  91   IVFSENYASSSWCLDELVKILEYKKSKQQLVMPIFYKVDPSDVRNQRSSFGDALVDHEHK  150

Query  522  FEKEGEKVKKWRKVLEDVSNLSG  454
            F+ + EKV +WR+ L + +NLSG
Sbjct  151  FKDDMEKVLEWRRALTEAANLSG  173



>ref|XP_010665217.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=532

 Score =   193 bits (490),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 121/164 (74%), Gaps = 2/164 (1%)
 Frame = -2

Query  918  MEQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPA  739
            M  PS  S+    YDVFLSFRGED R +F DHLY+A+   G++TF+DDE+LERG  I+P 
Sbjct  1    MASPS-TSTHEGIYDVFLSFRGEDTRYHFTDHLYSALIDNGVHTFRDDEELERGGVIAPE  59

Query  738  LEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKE  559
            L  AIE+S +++VVFSE+YA S WCL+ELVKI+ECM  + Q V+P+FY VDPS VRKQ  
Sbjct  60   LFNAIEQSRISIVVFSENYAQSRWCLDELVKIIECMTGRTQIVLPVFYHVDPSHVRKQMG  119

Query  558  KYGEAFEGHEKSFE-KEGEKVKKWRKVLEDVSNLSGWDLNNTEN  430
             YGEAF  HEK  + K+ EK++KWR  L + SNLSGW L++ ++
Sbjct  120  SYGEAFAYHEKDADLKKREKIQKWRTALTETSNLSGWHLHDHQS  163



>ref|XP_009343054.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1239

 Score =   198 bits (503),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED RKNF DHLY A+  +GI TF+DD KL RGKSI+P L KAIEE+  AV
Sbjct  14   TYDVFLSFRGEDTRKNFTDHLYAALDLKGIMTFRDDLKLGRGKSIAPELLKAIEEARFAV  73

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFS +YA S+WCL+EL KI +CMK  GQTV P+FY VDPS VRKQ   +G+AF  HE+S
Sbjct  74   VVFSRNYASSAWCLDELGKICQCMKELGQTVFPVFYDVDPSEVRKQTGSFGKAFATHEES  133

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F+   EKV++WR    +++NLSGW + +
Sbjct  134  FKGNVEKVQRWRAATTEIANLSGWHVQD  161



>gb|ABF81466.1| TIR-NBS type disease resistance protein [Populus trichocarpa]
Length=1432

 Score =   198 bits (504),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 93/154 (60%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -2

Query  888  GSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSM  709
            G  YDVFLSFRGED RKNF DHLYTA+ Q GI+TF+DDEKL RG+ IS  L KAI+ES +
Sbjct  83   GWVYDVFLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDEKLRRGEEISFQLSKAIQESKI  142

Query  708  AVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHE  529
            ++VVFSE YA S+WCL EL KI++C    GQ V+P+FY +DPS +RKQ     EAF  HE
Sbjct  143  SIVVFSEGYASSTWCLGELQKILDCRHTTGQIVLPVFYDIDPSDIRKQTGSLAEAFGKHE  202

Query  528  KSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            +SF++E EKV+KWRK L + +NLSG D  +  NG
Sbjct  203  ESFKEEMEKVQKWRKALLEAANLSGLDRRSIANG  236



>ref|XP_006386003.1| hypothetical protein POPTR_0003s19910g, partial [Populus trichocarpa]
 gb|ERP63800.1| hypothetical protein POPTR_0003s19910g, partial [Populus trichocarpa]
Length=1354

 Score =   198 bits (504),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 93/154 (60%), Positives = 115/154 (75%), Gaps = 0/154 (0%)
 Frame = -2

Query  888  GSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSM  709
            G  YDVFLSFRGED RKNF DHLYTA+ Q GI+TF+DDEKL RG+ IS  L KAI+ES +
Sbjct  12   GWVYDVFLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDEKLRRGEEISFQLSKAIQESKI  71

Query  708  AVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHE  529
            ++VVFSE YA S+WCL EL KI++C    GQ V+P+FY +DPS +RKQ     EAF  HE
Sbjct  72   SIVVFSEGYASSTWCLGELQKILDCRHTTGQIVLPVFYDIDPSDIRKQTGSLAEAFGKHE  131

Query  528  KSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            +SF++E EKV+KWRK L + +NLSG D  +  NG
Sbjct  132  ESFKEEMEKVQKWRKALLEAANLSGLDRRSIANG  165



>ref|XP_011044910.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=787

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 122/164 (74%), Gaps = 0/164 (0%)
 Frame = -2

Query  918  MEQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPA  739
            M   S  S  G  YDVFLSFRGED RKNF DHLYTA+ Q GI+TF+DD +L +G+ IS  
Sbjct  1    MFMSSSSSRLGWHYDVFLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDNELRKGEEISSH  60

Query  738  LEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKE  559
            L KAI+ES +++VVFS+ YA S+WCL+EL +I++C +  GQ V+P+FY +DPS +RKQK 
Sbjct  61   LLKAIQESKISIVVFSKGYASSTWCLDELSEILDCSQTAGQIVLPVFYDIDPSDIRKQKR  120

Query  558  KYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             + EAF+ HE+ F++E EKV+KWRK L +   L+G+DL++  NG
Sbjct  121  SFAEAFDRHEERFKEEMEKVQKWRKALVEAGRLTGFDLHSIANG  164



>emb|CAN82451.1| hypothetical protein VITISV_003325 [Vitis vinifera]
Length=162

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 112/150 (75%), Gaps = 1/150 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFL+FRG D R +F DHLY+ +++  + TF+DDE+LERG  I+P L KAIE+S +++V
Sbjct  13   YDVFLNFRGADTRYHFTDHLYSELRKNDVRTFRDDEELERGDVIAPGLLKAIEQSRISIV  72

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFSE+YA S WCL+ELVKI+EC   + Q V+P+FY VDPS VRKQ   YGEAF  HEK  
Sbjct  73   VFSENYAQSRWCLDELVKIIECRTEREQIVLPVFYHVDPSHVRKQMGSYGEAFADHEKDA  132

Query  519  E-KEGEKVKKWRKVLEDVSNLSGWDLNNTE  433
            + K+ EK++KWR  L + SNLSGW L + +
Sbjct  133  DLKKREKIQKWRTALTETSNLSGWRLLDNQ  162



>ref|XP_010263414.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1134

 Score =   197 bits (502),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 89/165 (54%), Positives = 120/165 (73%), Gaps = 2/165 (1%)
 Frame = -2

Query  915  EQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPAL  736
            ++ SF +     YDVFLSFRGED RK+F DHLY A+ QRGI+TF+DDEKL+RG+ I+  L
Sbjct  3    QEASFSNDPRWNYDVFLSFRGEDTRKSFTDHLYNALVQRGIHTFRDDEKLKRGEDIASEL  62

Query  735  EKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEK  556
             K IEES ++++VFS +YA S WC++ELVKI+EC K+ GQ V+P+FY V PS VRKQ   
Sbjct  63   HKTIEESRISIIVFSRNYASSRWCMDELVKILECRKMMGQLVLPVFYDVHPSDVRKQTGS  122

Query  555  YGEAFEGHEKSFEKEG--EKVKKWRKVLEDVSNLSGWDLNNTENG  427
            + EAF  HE+ F   G   KV+KW++ L + +++SGWDL +  NG
Sbjct  123  FAEAFAKHEEHFRAAGTERKVQKWKEALVEAADVSGWDLQSVTNG  167



>ref|XP_006371043.1| hypothetical protein POPTR_0019s029202g, partial [Populus trichocarpa]
 gb|ERP48840.1| hypothetical protein POPTR_0019s029202g, partial [Populus trichocarpa]
Length=270

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 114/153 (75%), Gaps = 3/153 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRGED RK F DHLYTA+ Q GI+TF+DD++L RG+ IS  L +A++ES +++
Sbjct  14   AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLRAVQESKISI  73

Query  702  VVFSEHYADSSWCLEELVKIMEC-MKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            VVFS+ YA S WCL ELV I++C  K +GQ  +PIFY +DPS VRKQ   + EAF  HE+
Sbjct  74   VVFSKGYASSRWCLNELVAILKCKRKKRGQIALPIFYDIDPSDVRKQNGSFAEAFVKHEE  133

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             FE+  + VK+WRK LE+  NLSGW+LN+  NG
Sbjct  134  RFEE--KLVKEWRKALEEAGNLSGWNLNDMANG  164



>ref|XP_006441742.1| hypothetical protein CICLE_v10024129mg [Citrus clementina]
 gb|ESR54982.1| hypothetical protein CICLE_v10024129mg [Citrus clementina]
Length=238

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 123/175 (70%), Gaps = 1/175 (1%)
 Frame = -2

Query  918  MEQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPA  739
            M   S  + C  TYDVFLSFRG D RK+F+ HLY A+  +GIY FKDD++LE+G+SISP 
Sbjct  1    MTSVSNQNVCHWTYDVFLSFRGADTRKSFISHLYAALNGKGIYVFKDDKELEKGESISPR  60

Query  738  LEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVV-PIFYGVDPSTVRKQK  562
            L KAIE S +A++VFS++YA S+WCL+ELV I++C     Q +V PIFY V+P+ VR Q 
Sbjct  61   LLKAIEASRIAIIVFSKNYASSTWCLDELVHILDCKNKNAQRMVYPIFYDVEPTVVRNQT  120

Query  561  EKYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*IFNSNPLHP  397
              + EAF  H + F+K  EKV+KWR+ L++V+ +SGW+L    N   F S+ ++P
Sbjct  121  GNFQEAFAKHVEVFKKSIEKVQKWREALKEVATISGWELKEYRNESKFISDIVNP  175



>gb|KCW59373.1| hypothetical protein EUGRSUZ_H020741, partial [Eucalyptus grandis]
Length=383

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = -2

Query  897  SSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEE  718
            S     YDVFLSFRG DVR NF+ HLYTA+ Q+GIYT+ D E+L++G+ I+PAL KAIE+
Sbjct  72   SDLKGNYDVFLSFRGTDVRNNFLGHLYTALAQKGIYTYVDSEELQKGEQITPALVKAIED  131

Query  717  SSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFE  538
            S +A++VFS+ YA S WCLEE+ KIMEC + +G TV P+FY V+P  VR  +  Y EA  
Sbjct  132  SRIAIIVFSKDYASSPWCLEEVEKIMECKEQRGLTVFPVFYKVEPKEVRTPRGSYQEALV  191

Query  537  GHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTE  433
             HE  F ++ EKVK+W+K L D  +LSGWDLN+ +
Sbjct  192  KHESKFGRDSEKVKRWKKALYDAGSLSGWDLNDKD  226



>gb|KCW59383.1| hypothetical protein EUGRSUZ_H02089 [Eucalyptus grandis]
Length=219

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             Y VFLSFRG DVR NF+ HLY A+ Q+GIYT+ D E+L +G+ I+PAL KAIE+S +A+
Sbjct  71   NYHVFLSFRGTDVRNNFLGHLYAALDQKGIYTYIDSEELRKGEQITPALIKAIEDSHIAI  130

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FSE YA S WCLEE+ KIMEC + +G TV P+FY VDP  VR  +++Y +A   HEK 
Sbjct  131  IIFSEDYASSPWCLEEVEKIMECNEQRGLTVFPVFYKVDPGEVRTPRKRYRKAMVKHEKK  190

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F ++ EKVK+W+K L D  +LSGWDL +
Sbjct  191  FGRDSEKVKRWKKSLYDAGSLSGWDLKD  218



>ref|XP_009348253.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1292

 Score =   197 bits (501),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED R+NF DHLY A+ ++GI TF+D E+LERGK+ISP + K IEES   +
Sbjct  20   TYDVFLSFRGEDTRRNFTDHLYAALNRKGILTFRDGEELERGKAISPTVLKGIEESRFVL  79

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            V+ S +YA+S+WCL++L K +ECMKV GQT++P+FY VDPS VRKQ   +G AF  HE++
Sbjct  80   VILSRNYANSAWCLDQLAKAVECMKVMGQTILPVFYDVDPSEVRKQTGYFGTAFSKHEEA  139

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F++  EK+++WR  L  V+NLSGW L +
Sbjct  140  FKENVEKLQRWRTALLQVANLSGWHLQD  167



>ref|XP_010665186.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
Length=1745

 Score =   197 bits (502),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 95/164 (58%), Positives = 121/164 (74%), Gaps = 2/164 (1%)
 Frame = -2

Query  918  MEQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPA  739
            M  PS  SS    YDVFLSFRGED R +F DHLY+A++  G++TF+DDE+LERG  I+P 
Sbjct  1    MASPS-TSSHEGIYDVFLSFRGEDTRYHFTDHLYSALRDNGVHTFRDDEELERGDVIAPG  59

Query  738  LEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKE  559
            L KAIE+S +++VVFSE YA S WCL+ELVKI+ECM  + Q V+P+FY VDPS VRKQ  
Sbjct  60   LLKAIEQSRISIVVFSEKYAQSRWCLDELVKIIECMTERKQIVLPVFYHVDPSHVRKQMG  119

Query  558  KYGEAFEGHEKSFE-KEGEKVKKWRKVLEDVSNLSGWDLNNTEN  430
             YGEAF  HEK  + K+ EK++KWR  L + SNLSGW L + ++
Sbjct  120  SYGEAFADHEKDADLKKREKIQKWRTALTETSNLSGWHLRDNQS  163



>ref|XP_006370854.1| hypothetical protein POPTR_0019s00940g [Populus trichocarpa]
 gb|ERP48651.1| hypothetical protein POPTR_0019s00940g [Populus trichocarpa]
Length=183

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 109/155 (70%), Gaps = 5/155 (3%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRGED RKNF DHLYTA+         DD +L RG+ ISP L KAIE S +++
Sbjct  22   NYDVFLSFRGEDTRKNFTDHLYTALG-----NVWDDNELPRGEEISPQLLKAIEGSRISI  76

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFS+HYA S WCL+ELVKI+EC +  GQ V+PIFY  +PS VRKQ   Y +AF+ HE+ 
Sbjct  77   VVFSKHYASSRWCLDELVKIIECRQKIGQVVLPIFYDTEPSDVRKQTGSYAKAFDEHEER  136

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*IF  418
            F++E EKV KWR  L    NLSG+ LNN  NG IF
Sbjct  137  FKEEMEKVNKWRGALAQAGNLSGFGLNNEANGYIF  171



>emb|CAN75332.1| hypothetical protein VITISV_004838 [Vitis vinifera]
Length=215

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            Y+VFLSFRGED RK+F DHL+ A+ + GI TF DD+ L RG+ IS AL +AIEES  +++
Sbjct  69   YEVFLSFRGEDTRKSFTDHLHEALHRCGINTFIDDQ-LRRGEQISSALLQAIEESRFSII  127

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FSEHYA SSWCL+EL KI+EC+KV G T  P+FY VDPS VRKQ   YG AF  HEK +
Sbjct  128  IFSEHYASSSWCLDELTKILECVKVGGHTAFPVFYNVDPSHVRKQTGSYGVAFTKHEKVY  187

Query  519  EKEGEKVKKWRKVLEDVSNLSGWD  448
                EKV KWR+ L   S LSGWD
Sbjct  188  RDNMEKVLKWREALTVASGLSGWD  211



>ref|XP_010657773.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
Length=169

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            Y+VFLSFRGED RK+F DHL+ A+ + GI TF DD+ L RG+ IS AL +AIEES ++++
Sbjct  21   YEVFLSFRGEDTRKSFTDHLHEALCRYGINTFIDDQ-LRRGEQISSALLQAIEESRLSII  79

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FSEHYA SSWCL+EL KI+EC+KV G T  P+FY VDPS VRKQ   YG AF  HE+ +
Sbjct  80   IFSEHYASSSWCLDELTKILECVKVGGHTAFPVFYNVDPSHVRKQTGSYGVAFTKHEQVY  139

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNNTE  433
                EKV KWR+ L   S LSGWD  + E
Sbjct  140  RDNMEKVLKWREALTVASGLSGWDSRDRE  168



>ref|XP_010058762.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=412

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 114/160 (71%), Gaps = 3/160 (2%)
 Frame = -2

Query  918  MEQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPA  739
            M+ PS      S YDVFLSFRG +VRK+F+ HLY A+ Q GIYTF+D E+L +G  IS  
Sbjct  1    MDSPS---KPKSIYDVFLSFRGTNVRKSFLSHLYRALDQNGIYTFQDSEELRKGDQISTT  57

Query  738  LEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKE  559
            L KAIEES +A+++FSE YA S WCLEE+ KIMEC + K  TV+P+FY VDP  VR+ +E
Sbjct  58   LMKAIEESCIAIIIFSEDYASSWWCLEEMAKIMECREQKDLTVLPVFYKVDPREVREGRE  117

Query  558  KYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             Y +A + HE  F K+ EKVKKW+K L D  NLSGW LN+
Sbjct  118  SYRKALDKHEDKFRKDPEKVKKWKKALFDAGNLSGWHLND  157



>ref|XP_009348251.1| PREDICTED: TMV resistance protein N-like isoform X3 [Pyrus x 
bretschneideri]
Length=1653

 Score =   197 bits (501),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED R+NF DHLY A+ ++GI TF+D E+LERGK+ISP + K IEES   +
Sbjct  20   TYDVFLSFRGEDTRRNFTDHLYAALNRKGILTFRDGEELERGKAISPTVLKGIEESRFVL  79

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            V+ S +YA+S+WCL++L K +ECMKV GQT++P+FY VDPS VRKQ   +G AF  HE++
Sbjct  80   VILSRNYANSAWCLDQLAKAVECMKVMGQTILPVFYDVDPSEVRKQTGYFGTAFSKHEEA  139

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F++  EK+++WR  L  V+NLSGW L +
Sbjct  140  FKENVEKLQRWRTALLQVANLSGWHLQD  167



>ref|XP_009348249.1| PREDICTED: TMV resistance protein N-like isoform X1 [Pyrus x 
bretschneideri]
Length=1663

 Score =   197 bits (501),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED R+NF DHLY A+ ++GI TF+D E+LERGK+ISP + K IEES   +
Sbjct  20   TYDVFLSFRGEDTRRNFTDHLYAALNRKGILTFRDGEELERGKAISPTVLKGIEESRFVL  79

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            V+ S +YA+S+WCL++L K +ECMKV GQT++P+FY VDPS VRKQ   +G AF  HE++
Sbjct  80   VILSRNYANSAWCLDQLAKAVECMKVMGQTILPVFYDVDPSEVRKQTGYFGTAFSKHEEA  139

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F++  EK+++WR  L  V+NLSGW L +
Sbjct  140  FKENVEKLQRWRTALLQVANLSGWHLQD  167



>ref|XP_009348250.1| PREDICTED: TMV resistance protein N-like isoform X2 [Pyrus x 
bretschneideri]
Length=1663

 Score =   197 bits (501),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED R+NF DHLY A+ ++GI TF+D E+LERGK+ISP + K IEES   +
Sbjct  20   TYDVFLSFRGEDTRRNFTDHLYAALNRKGILTFRDGEELERGKAISPTVLKGIEESRFVL  79

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            V+ S +YA+S+WCL++L K +ECMKV GQT++P+FY VDPS VRKQ   +G AF  HE++
Sbjct  80   VILSRNYANSAWCLDQLAKAVECMKVMGQTILPVFYDVDPSEVRKQTGYFGTAFSKHEEA  139

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F++  EK+++WR  L  V+NLSGW L +
Sbjct  140  FKENVEKLQRWRTALLQVANLSGWHLQD  167



>gb|KDO39318.1| hypothetical protein CISIN_1g031151mg [Citrus sinensis]
Length=165

 Score =   181 bits (459),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 104/147 (71%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED R NF  HLY A+ ++ I TF DDE+L RG  ISPAL  AI+ S ++VV
Sbjct  17   YDVFLSFRGEDTRDNFTSHLYAALCRKKIKTFIDDEELRRGDEISPALLNAIQGSKISVV  76

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FS+ YA S WCL ELV+I+EC    GQ VVP+F+ VDPS +RKQ   + +AF  HEK F
Sbjct  77   IFSQDYASSKWCLNELVEILECKSKNGQIVVPVFHRVDPSDIRKQNGSFRDAFVKHEKQF  136

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++  EKV+KWR  L   SNLSGWD  N
Sbjct  137  KRTPEKVQKWRVALTQASNLSGWDSRN  163



>ref|XP_010665187.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
Length=1720

 Score =   197 bits (501),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 95/164 (58%), Positives = 121/164 (74%), Gaps = 2/164 (1%)
 Frame = -2

Query  918  MEQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPA  739
            M  PS  SS    YDVFLSFRGED R +F DHLY+A++  G++TF+DDE+LERG  I+P 
Sbjct  1    MASPS-TSSHEGIYDVFLSFRGEDTRYHFTDHLYSALRDNGVHTFRDDEELERGDVIAPG  59

Query  738  LEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKE  559
            L KAIE+S +++VVFSE YA S WCL+ELVKI+ECM  + Q V+P+FY VDPS VRKQ  
Sbjct  60   LLKAIEQSRISIVVFSEKYAQSRWCLDELVKIIECMTERKQIVLPVFYHVDPSHVRKQMG  119

Query  558  KYGEAFEGHEKSFE-KEGEKVKKWRKVLEDVSNLSGWDLNNTEN  430
             YGEAF  HEK  + K+ EK++KWR  L + SNLSGW L + ++
Sbjct  120  SYGEAFADHEKDADLKKREKIQKWRTALTETSNLSGWHLRDNQS  163



>emb|CBI23852.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 108/147 (73%), Gaps = 1/147 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            Y+VFLSFRGED RKNF DHL+ A+++ GI+ F DD+ L RG+ IS AL +AIEES  +++
Sbjct  84   YEVFLSFRGEDTRKNFTDHLHEALRRNGIHAFIDDQ-LRRGEQISSALLRAIEESRFSII  142

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FSEHYA SSWCL+EL KI+EC+KV G T  P+FY VDPS VRKQ   YG AF  HE+ +
Sbjct  143  IFSEHYASSSWCLDELTKILECVKVGGHTAFPVFYNVDPSHVRKQTGSYGVAFTKHEQVY  202

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
                EKV KWR+ L  VS LSGWD  N
Sbjct  203  RDNMEKVSKWREALTAVSGLSGWDSRN  229



>gb|KCW59343.1| hypothetical protein EUGRSUZ_H020322, partial [Eucalyptus grandis]
Length=220

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 108/144 (75%), Gaps = 0/144 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRG DVR +F+ HLY A+ Q GI T+ D+E+L +G+ ISPAL KAIEES +A+
Sbjct  72   SYDVFLSFRGPDVRNHFLSHLYAALDQVGISTYIDNEELRKGEQISPALMKAIEESQIAI  131

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFSE+YA S+WCLEE+ KIMEC + KG  V+P+FY V+P  VR QK+ YG+A   HE  
Sbjct  132  VVFSENYASSTWCLEEISKIMECKEKKGLKVLPVFYKVEPREVRGQKQSYGKAMGEHEIK  191

Query  522  FEKEGEKVKKWRKVLEDVSNLSGW  451
            F K  E+VK+W+K L D   LSGW
Sbjct  192  FGKNSEQVKRWKKALYDAGGLSGW  215



>ref|XP_010058830.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=273

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 108/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG D+R NFV HLY A+ Q GIYTF+D E+L++G  IS  L KAI+ES +A++
Sbjct  40   YDVFLSFRGTDMRNNFVGHLYHALHQNGIYTFRDSEELKKGDQIS-MLMKAIKESCIAII  98

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS  YA S+WCLEEL KIMEC + KG TV+P+FY VDP  VR  +E Y  A   HE  F
Sbjct  99   VFSNDYASSTWCLEELAKIMECKEQKGLTVLPVFYKVDPKEVRGGRESYRRALAKHEPKF  158

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNNTE  433
            EK+ +KVK+WRK L D  NLS W LN+ +
Sbjct  159  EKDSKKVKRWRKALFDAGNLSRWHLNDGD  187



>ref|XP_004136801.1| PREDICTED: TMV resistance protein N-like [Cucumis sativus]
Length=381

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED RKNF DHLY A++  GI  F+DD +L+RG+ IS  LE+AIE S +AV
Sbjct  13   TYDVFLSFRGEDTRKNFTDHLYYALKDAGINVFRDDPELQRGEDISSGLERAIEGSKVAV  72

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE YA+S WCLEELVKIMEC +   Q V+P+FY VDPS VRKQK ++ EAF  HEK 
Sbjct  73   IVFSERYAESGWCLEELVKIMECRRTLRQMVLPVFYNVDPSCVRKQKGEFEEAFVKHEKG  132

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
              K+ +KV++WR  L + +N++G  L    NG
Sbjct  133  --KDIDKVRRWRMALTEAANVAGLGLTQNANG  162



>ref|XP_004159649.1| PREDICTED: TMV resistance protein N-like [Cucumis sativus]
Length=380

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED RKNF DHLY A++  GI  F+DD +L+RG+ IS  LE+AIE S +AV
Sbjct  13   TYDVFLSFRGEDTRKNFTDHLYYALKDAGINVFRDDPELQRGEDISSGLERAIEGSKVAV  72

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE YA+S WCLEELVKIMEC +   Q V+P+FY VDPS VRKQK ++ EAF  HEK 
Sbjct  73   IVFSERYAESGWCLEELVKIMECRRTLRQMVLPVFYNVDPSCVRKQKGEFEEAFVKHEKG  132

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
              K+ +KV++WR  L + +N++G  L    NG
Sbjct  133  --KDIDKVRRWRMALTEAANVAGLGLTQNANG  162



>ref|XP_010665433.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=242

 Score =   183 bits (464),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 111/157 (71%), Gaps = 1/157 (1%)
 Frame = -2

Query  918  MEQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPA  739
            M  PSF SS    YDVFLSFRGED R  F  HLY A+ +RG+ TF DD ++ RG+SISP 
Sbjct  1    MAAPSFASS-QWIYDVFLSFRGEDTRLGFAAHLYEALCRRGVNTFFDDYEIRRGESISPT  59

Query  738  LEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKE  559
            L KAIE S  ++++ S++YA S+WCLEELVKI+EC     Q V+PIFY VDPS VRK + 
Sbjct  60   LVKAIEGSRCSIIILSQNYASSTWCLEELVKILECSNTMRQLVLPIFYNVDPSVVRKHER  119

Query  558  KYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWD  448
             +GEA   HEK+ +++  KVK W K L +V+NL+GW+
Sbjct  120  TFGEALVKHEKTLKQDMNKVKNWSKALSEVANLAGWN  156



>ref|XP_008361342.1| PREDICTED: TMV resistance protein N-like isoform X2 [Malus domestica]
Length=1232

 Score =   196 bits (498),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED R+NF DHLY A+ ++GI+TF+DDE+LERGK+IS  + K IEES   +
Sbjct  20   TYDVFLSFRGEDTRRNFSDHLYAALNRKGIFTFRDDEELERGKAISXTVLKGIEESRFVL  79

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            V+ S +YA+S+WCL++L K +ECMKV GQT++P+FY VDPS VRKQ   +G AF  HE++
Sbjct  80   VILSRNYANSAWCLDQLAKAVECMKVMGQTILPVFYDVDPSEVRKQTGYFGIAFSKHEEA  139

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F++  EK+++WR  L  V+NLSGW L +
Sbjct  140  FKENIEKLQRWRTALLQVANLSGWXLQD  167



>gb|KDO36805.1| hypothetical protein CISIN_1g031401mg [Citrus sinensis]
Length=160

 Score =   180 bits (457),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 115/160 (72%), Gaps = 1/160 (1%)
 Frame = -2

Query  918  MEQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPA  739
            M   SF +     YD FLSFRGED RK F+ HLYTA+  +GIY F+DD++LE+G SISP 
Sbjct  1    MASTSFQNVSHGEYDAFLSFRGEDTRKRFIGHLYTALNNKGIYVFRDDKQLEKGGSISPN  60

Query  738  LEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKE  559
            L K IEES ++++V S++YA S+WCL+EL+KI+EC   + Q + PIFY V+P+ VRKQ  
Sbjct  61   LLKTIEESRISIIVLSKNYASSTWCLDELLKIVECKNREDQ-IFPIFYEVEPTVVRKQTA  119

Query  558  KYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             +GEAF  +E+ F    EKV+KWR  L+ V+N+SGW+L +
Sbjct  120  SFGEAFAKYEEFFRDNIEKVQKWRYALKVVANISGWELKD  159



>ref|XP_010056818.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=158

 Score =   180 bits (457),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRG D+R NF+ HLY A+ Q GIYTF+D E+L++G  ISP L KAIEES +A+
Sbjct  10   IYDVFLSFRGVDLRNNFIGHLYQALHQIGIYTFRDSEELKKGDQISPVLMKAIEESYIAI  69

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFS +YA S WCLEE+ KI+EC + K   V+P+FY VDP  VR  ++ Y  A   HE  
Sbjct  70   IVFSMNYASSMWCLEEVAKIIECKEQKNLIVLPVFYKVDPREVRGVRKSYQRALAKHESK  129

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F K+ EKVK+W++ L +  NLSGW LN+
Sbjct  130  FGKDSEKVKRWKEALSNAGNLSGWHLND  157



>ref|XP_010070519.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=231

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG DVR +F+ HLY A+ Q GI T+ D+E+L +G+ ISPAL KAIEES +A+V
Sbjct  73   YDVFLSFRGPDVRNHFLSHLYAALDQVGISTYIDNEELRKGEQISPALMKAIEESQIAIV  132

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFSE+YA S+WCLEE+ KIMEC + KG  V+P+FY V+P  VR QK+ YG+A   HE  F
Sbjct  133  VFSENYASSTWCLEEISKIMECKEKKGLMVLPVFYKVEPREVRGQKQSYGKAMGEHEVKF  192

Query  519  EKEGEKVKKWRKVLEDVSNLSGW  451
             K  E+VK+W+K L D   LSGW
Sbjct  193  GKNSEQVKRWKKALYDAGGLSGW  215



>ref|XP_006388700.1| hypothetical protein POPTR_0117s00220g, partial [Populus trichocarpa]
 gb|ERP47614.1| hypothetical protein POPTR_0117s00220g, partial [Populus trichocarpa]
Length=560

 Score =   191 bits (484),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            +DVFLSFRG+D R NF  HLY+ ++QRGI  + DD +LERGK+I PAL KAIEES  +V+
Sbjct  22   HDVFLSFRGKDTRNNFTSHLYSNLKQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVI  81

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FS  YA S WCL+ELVKI++CMK KGQTV+P+FY VDPS V +QK KY +AF  HEK F
Sbjct  82   IFSRDYASSPWCLDELVKIVQCMKEKGQTVLPVFYDVDPSEVAEQKGKYKKAFVKHEKDF  141

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++  ++V+ W+  L  V+NLSGWD+ N
Sbjct  142  KENLDRVRSWKDCLSTVANLSGWDIRN  168



>emb|CAN76376.1| hypothetical protein VITISV_041939 [Vitis vinifera]
Length=322

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 111/147 (76%), Gaps = 4/147 (3%)
 Frame = -2

Query  885  STYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMA  706
            STYDVFLSFRGED R NF DHLY  +  RGI TF+DD KL RG++I+P L KAIEES  +
Sbjct  22   STYDVFLSFRGEDTRYNFTDHLYKTLVNRGIRTFRDD-KLRRGEAIAPELLKAIEESRSS  80

Query  705  VVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            V+VFSE+YA S WCL+ELVKIMEC K  G  V PIFY VDPS VRKQ+  +GEAF G+E+
Sbjct  81   VIVFSENYAGSRWCLDELVKIMECHKDLGHAVFPIFYHVDPSHVRKQEGSFGEAFAGYEE  140

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDL  445
            +++   +K+ +WR  L + +NLSGW L
Sbjct  141  NWK---DKIPRWRTALTEAANLSGWHL  164



>ref|XP_006492482.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=164

 Score =   180 bits (457),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 111/147 (76%), Gaps = 2/147 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YD FLSFRG D RK+F+ HLY A+  +GIY FKDD++LERG SISP L KAIE+S ++++
Sbjct  14   YDAFLSFRGADTRKSFISHLYAALNGKGIYVFKDDKELERGASISPGLLKAIEDSRISII  73

Query  699  VFSEHYADSSWCLEELVKIMECMKVKG--QTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            VFS++YA S+WCL+ELVKI++C       Q + PIFY V+P+ VRKQ   + EAF  HE+
Sbjct  74   VFSQNYASSTWCLDELVKIVQCKNKNDHQQMIFPIFYDVEPTVVRKQTGSFREAFSKHEE  133

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDL  445
            ++ +  EKVK WR  L++V+N+SGW+L
Sbjct  134  AYRENLEKVKNWRDALKEVANISGWEL  160



>ref|XP_010243120.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1134

 Score =   195 bits (496),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 117/168 (70%), Gaps = 4/168 (2%)
 Frame = -2

Query  918  MEQPSFVSSCGS--TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSIS  745
            M Q    SSC S   YDVFLSFRGED RKNF DHLYTA+ QRGI TF+DDE L RG+ I+
Sbjct  2    MTQGGSSSSCNSRWNYDVFLSFRGEDTRKNFTDHLYTALVQRGINTFRDDEALRRGEEIT  61

Query  744  PALEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQ  565
            P LEKAIEES +A+ V S +YA S WCLEELVKI+EC K KGQ V+P+FY VD S VR+Q
Sbjct  62   PDLEKAIEESRIAIAVLSRNYASSRWCLEELVKILECRKTKGQWVIPLFYDVDSSDVREQ  121

Query  564  KEKYGEAFEGHE--KSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
               + EAF  HE      +  EKV++WR+ L  V++LSG DL    +G
Sbjct  122  TGSFAEAFARHETRSDLGEITEKVRRWREALAQVADLSGLDLKQVADG  169



>ref|XP_003634551.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=233

 Score =   182 bits (462),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED  K+F DHL+ A+ QRG+ TF DD KL RG+ ISPAL KAIEES  +V+
Sbjct  85   YDVFLSFRGEDTGKSFTDHLHRALCQRGVKTFMDD-KLSRGQEISPALVKAIEESRFSVI  143

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFSE+YA S+WCLEELVKI++C K  G   +P+FY V+PS VRKQ   + +AF  HE+ +
Sbjct  144  VFSENYASSTWCLEELVKIIDCTKAMGHAALPVFYNVEPSHVRKQTGSFAQAFAKHEEVY  203

Query  519  EKEGEKVKKWRKVLEDVSNLSGWD  448
            +++ EKV KWR  L + +N+SGWD
Sbjct  204  KEQMEKVIKWRVALTEAANISGWD  227



>ref|XP_008353720.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=169

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 110/148 (74%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFR ED  +NF DHLYT++ Q+G++ F+D E+LER K ISP L KAIEES   +
Sbjct  21   TYDVFLSFRSEDTHRNFTDHLYTSLNQKGVFAFRDAEQLEREKPISPELLKAIEESRYVI  80

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VV S +YA S+ CL+EL K +ECMKV GQ ++P+FY VDPS V+KQ   +G+AF  HE++
Sbjct  81   VVLSRNYAYSTCCLDELAKSVECMKVMGQALLPVFYDVDPSEVQKQMGNFGKAFSKHEET  140

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F+   EKV+KWR  L +V++L GW + +
Sbjct  141  FKDNTEKVQKWRDALTEVADLYGWHVQD  168



>gb|KDO38417.1| hypothetical protein CISIN_1g036738mg, partial [Citrus sinensis]
Length=364

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 114/152 (75%), Gaps = 1/152 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRG D RKNF+ HLY A+  +GIY FKDDE+LE+G+SISP L KAIE S +A+
Sbjct  13   TYDVFLSFRGADTRKNFISHLYAALNGKGIYVFKDDEELEKGESISPRLLKAIEASRIAI  72

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVV-PIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            +VFS++YA S+WCL+ELV I++C     Q +V PIFY V+P+ VR Q   + EAF  H +
Sbjct  73   IVFSKNYASSTWCLDELVHILDCKNKNAQRMVYPIFYDVEPTVVRNQTGNFQEAFAKHVE  132

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTEN  430
             F+K  EKV+KWR+ L++V+N+SGW+L    N
Sbjct  133  VFKKSIEKVQKWREALKEVANISGWELKEYRN  164



>ref|XP_008236673.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=220

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED RKNF  HLY+ + Q+GI TF DD+ L RG+ IS AL KAIEES +++
Sbjct  47   TYDVFLSFRGEDTRKNFTGHLYSNLVQKGIKTFIDDD-LSRGEEISLALLKAIEESMVSI  105

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFSE+YA S WCL+ELVKI+EC + K Q V P+FY VDPS VR Q+  +G+A  GHE  
Sbjct  106  VVFSENYAASKWCLDELVKILECKESKNQMVFPVFYKVDPSDVRNQRGSFGQALAGHESK  165

Query  522  FEKEGEKVKKWRKVLEDVSNLSGW  451
                 EKV +WR  L   +NLSGW
Sbjct  166  LRDNMEKVLRWRTTLTRAANLSGW  189



>ref|XP_008361338.1| PREDICTED: TMV resistance protein N-like isoform X1 [Malus domestica]
Length=1647

 Score =   196 bits (497),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED R+NF DHLY A+ ++GI+TF+DDE+LERGK+IS  + K IEES   +
Sbjct  20   TYDVFLSFRGEDTRRNFSDHLYAALNRKGIFTFRDDEELERGKAISXTVLKGIEESRFVL  79

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            V+ S +YA+S+WCL++L K +ECMKV GQT++P+FY VDPS VRKQ   +G AF  HE++
Sbjct  80   VILSRNYANSAWCLDQLAKAVECMKVMGQTILPVFYDVDPSEVRKQTGYFGIAFSKHEEA  139

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F++  EK+++WR  L  V+NLSGW L +
Sbjct  140  FKENIEKLQRWRTALLQVANLSGWXLQD  167



>ref|XP_008350156.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=1272

 Score =   195 bits (496),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 111/148 (75%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYD+FLSFRGED R NF DHLY A+  +GI TF+DD KL RGKSI+P L KAIEES  AV
Sbjct  69   TYDIFLSFRGEDTRMNFTDHLYAALDLKGIMTFRDDLKLGRGKSIAPELLKAIEESRFAV  128

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            V+FS +YA S+WCL+ L KI ECMK  GQTV P+FY VDPS VR+Q   +G+AF  HE+S
Sbjct  129  VIFSRNYASSAWCLDGLSKICECMKELGQTVFPVFYDVDPSEVRRQTGSFGKAFAAHEES  188

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F+   EKV++WR    +++NLSGW + +
Sbjct  189  FKGNVEKVQRWRAATTEIANLSGWHVQD  216



>gb|KCW73592.1| hypothetical protein EUGRSUZ_E02152 [Eucalyptus grandis]
Length=1066

 Score =   194 bits (494),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 128/194 (66%), Gaps = 15/194 (8%)
 Frame = -2

Query  885  STYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMA  706
            S YDVFLSFRG DVRK+F+ HLY A+ Q GIYTF+D E+L +G  IS AL KAIEES +A
Sbjct  9    SIYDVFLSFRGTDVRKSFLSHLYQALDQNGIYTFRDSEELRKGDQISAALMKAIEESCIA  68

Query  705  VVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            +++FSE YA S WCLEE+ KIMEC + K  TV+P+FY VDP  VR+ +E Y +A + HE 
Sbjct  69   IIIFSEDYASSWWCLEEMAKIMECKEQKDLTVLPVFYKVDPREVREGRESYKKALDKHED  128

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*I-----------FNSNPLHPTRGDHG  379
             F+K+ EKVKKW+K L D  NLSGW LN+ +   +            N  PL+ T+  H 
Sbjct  129  KFKKDMEKVKKWKKALFDAGNLSGWHLNDEDESELILQIVKVIITHLNLTPLYVTK--HL  186

Query  378  FGSERSVPVLETDE  337
             G E   PVL+  E
Sbjct  187  VGIES--PVLKLKE  198



>ref|XP_010058765.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=158

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 103/147 (70%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            +DVFLSFRG +VR NF+ HLY A+ Q GI TF D E+L +G  ISPAL KAI++S +A++
Sbjct  11   HDVFLSFRGTNVRNNFLGHLYKALNQNGISTFVDSEELRKGDQISPALMKAIKQSCVAII  70

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FSE YA S WCLEEL K+MEC + K   V+P+FY VDP  VR  +E YG A   HE  F
Sbjct  71   IFSEDYASSQWCLEELAKLMECKEQKDLIVLPVFYKVDPRAVRGGRESYGRALTKHESKF  130

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             K  EKVK W+K L D  +LSGW LN+
Sbjct  131  GKNSEKVKIWKKALLDAGSLSGWHLND  157



>ref|XP_006495109.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=255

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YD FLSFRG D RK+F+ HLY A+  +GIY FKDD++LERG SISP L KAIE+S ++++
Sbjct  14   YDAFLSFRGADTRKSFISHLYAALNGKGIYVFKDDKELERGASISPGLLKAIEDSRISII  73

Query  699  VFSEHYADSSWCLEELVKIMECMKVKG--QTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            VFS++YA S+WCL+ELVKI++C       Q + PIFY V+P+ VRKQ   + EAF  HE+
Sbjct  74   VFSQNYASSTWCLDELVKIVQCKNKNDHQQMIFPIFYDVEPTVVRKQTGSFREAFSKHEE  133

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTEN  430
            +F +  EKVK WR  L++V+N+SGW+L    N
Sbjct  134  AFRENLEKVKNWRDALKEVANISGWELKEYRN  165



>emb|CAN61853.1| hypothetical protein VITISV_027841 [Vitis vinifera]
Length=1244

 Score =   195 bits (495),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 89/147 (61%), Positives = 113/147 (77%), Gaps = 1/147 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED R++F DHLY A+ ++G+ TF+DDE+LERGK I+P L KAIEES ++VV
Sbjct  17   YDVFLSFRGEDTRRSFTDHLYAALVEKGVRTFRDDEELERGKEIAPELLKAIEESRISVV  76

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS++YA S WC++ELVKI+ECMK KGQTV+P+FY VDP+ VRKQ   + EAF  H +  
Sbjct  77   VFSKNYARSGWCMDELVKIIECMKAKGQTVLPVFYDVDPTHVRKQTGSFMEAFASHGEDT  136

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            E   E+ K+WR  L   +NLSGW L N
Sbjct  137  EVI-ERAKRWRAALTQAANLSGWHLQN  162



>ref|XP_010056751.1| PREDICTED: TMV resistance protein N-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010056752.1| PREDICTED: TMV resistance protein N-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010056753.1| PREDICTED: TMV resistance protein N-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010056754.1| PREDICTED: TMV resistance protein N-like isoform X1 [Eucalyptus 
grandis]
Length=1161

 Score =   194 bits (494),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 128/194 (66%), Gaps = 15/194 (8%)
 Frame = -2

Query  885  STYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMA  706
            S YDVFLSFRG DVRK+F+ HLY A+ Q GIYTF+D E+L +G  IS AL KAIEES +A
Sbjct  9    SIYDVFLSFRGTDVRKSFLSHLYQALDQNGIYTFRDSEELRKGDQISAALMKAIEESCIA  68

Query  705  VVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            +++FSE YA S WCLEE+ KIMEC + K  TV+P+FY VDP  VR+ +E Y +A + HE 
Sbjct  69   IIIFSEDYASSWWCLEEMAKIMECKEQKDLTVLPVFYKVDPREVREGRESYKKALDKHED  128

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*I-----------FNSNPLHPTRGDHG  379
             F+K+ EKVKKW+K L D  NLSGW LN+ +   +            N  PL+ T+  H 
Sbjct  129  KFKKDMEKVKKWKKALFDAGNLSGWHLNDEDESELILQIVKVIITHLNLTPLYVTK--HL  186

Query  378  FGSERSVPVLETDE  337
             G E   PVL+  E
Sbjct  187  VGIES--PVLKLKE  198



>emb|CAN66817.1| hypothetical protein VITISV_034310 [Vitis vinifera]
Length=435

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 108/147 (73%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED R NF  HLY  ++ +GI TF DD+KL+RG+ ISPAL  AIE S  +++
Sbjct  110  YDVFLSFRGEDTRNNFTAHLYKELRTKGINTFIDDDKLDRGQVISPALVAAIENSMFSII  169

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            V SE+YA S WCLEELVKI+EC + +GQ V+PIFY VDPS VRK   K+GEA   HE++F
Sbjct  170  VLSENYASSRWCLEELVKILECKESRGQRVLPIFYNVDPSDVRKHMGKFGEALAKHEENF  229

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++   +V+ WR  L  V+NLSGWD  N
Sbjct  230  KENMGRVQIWRDALTQVANLSGWDSRN  256



>gb|KCW73642.1| hypothetical protein EUGRSUZ_E02219 [Eucalyptus grandis]
Length=809

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 122/185 (66%), Gaps = 13/185 (7%)
 Frame = -2

Query  888  GSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSM  709
             S YDVFLSFRG DVRK+F+ HLY A+ Q GIYTF+D E+L +G  IS AL +AIE+S +
Sbjct  8    NSIYDVFLSFRGTDVRKSFLSHLYQALDQNGIYTFQDSEELRKGDQISAALMEAIEKSCI  67

Query  708  AVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHE  529
            A+++FSE YA S WCLEEL KIMEC + K  T++P+FY VDP  VR+ +E Y  A + HE
Sbjct  68   AIIIFSEDYASSWWCLEELAKIMECKEQKDLTILPVFYKVDPREVREGRESYRRALDKHE  127

Query  528  KSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*I-----------FNSNPLHPTRGDH  382
              FEK+ EKVK+W+K L D  NLSGW LN+ E   +            +  PLH T+  H
Sbjct  128  SKFEKDPEKVKRWKKALFDAGNLSGWHLNDGEESKLILQIVKEISTHLDLTPLHVTK--H  185

Query  381  GFGSE  367
              G E
Sbjct  186  LVGIE  190



>ref|XP_010056755.1| PREDICTED: TMV resistance protein N-like isoform X2 [Eucalyptus 
grandis]
Length=1156

 Score =   194 bits (493),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 128/194 (66%), Gaps = 15/194 (8%)
 Frame = -2

Query  885  STYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMA  706
            S YDVFLSFRG DVRK+F+ HLY A+ Q GIYTF+D E+L +G  IS AL KAIEES +A
Sbjct  9    SIYDVFLSFRGTDVRKSFLSHLYQALDQNGIYTFRDSEELRKGDQISAALMKAIEESCIA  68

Query  705  VVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            +++FSE YA S WCLEE+ KIMEC + K  TV+P+FY VDP  VR+ +E Y +A + HE 
Sbjct  69   IIIFSEDYASSWWCLEEMAKIMECKEQKDLTVLPVFYKVDPREVREGRESYKKALDKHED  128

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*I-----------FNSNPLHPTRGDHG  379
             F+K+ EKVKKW+K L D  NLSGW LN+ +   +            N  PL+ T+  H 
Sbjct  129  KFKKDMEKVKKWKKALFDAGNLSGWHLNDEDESELILQIVKVIITHLNLTPLYVTK--HL  186

Query  378  FGSERSVPVLETDE  337
             G E   PVL+  E
Sbjct  187  VGIES--PVLKLKE  198



>ref|XP_010070517.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
 gb|KCW59328.1| hypothetical protein EUGRSUZ_H02017 [Eucalyptus grandis]
Length=541

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG DVRKNF+DHLY A+ Q GI+T+ D E+L +G+ ISPAL KAIEES +A+V
Sbjct  28   YDVFLSFRGPDVRKNFLDHLYVALDQAGIFTYIDSEELRKGEQISPALMKAIEESQIAIV  87

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFSE YA SSWCLEEL KIMEC + KG  V P+FY V+P  VR Q++ YGEA   HE  F
Sbjct  88   VFSEDYASSSWCLEELTKIMECREQKGLKVFPVFYKVEPREVRWQRQSYGEAMAKHEVKF  147

Query  519  EKEGEKVKKWRKVLEDVSNLSG  454
             K+ EKV +W+K L D  NLSG
Sbjct  148  GKDSEKVNRWKKALCDAGNLSG  169



>ref|XP_011001266.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1140

 Score =   194 bits (493),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 89/152 (59%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRG D R NF DHLY A+ Q GIYTF+D  +L  GK ISP L +AI ES ++V
Sbjct  21   TYDVFLSFRGADTRNNFTDHLYAALDQAGIYTFRDGNELPPGKEISPQLSRAIRESRISV  80

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFS+ YA S WCL+ELVKI+EC    GQ +VPIFY +DPS VRKQK   GEA +  E+ 
Sbjct  81   VVFSKGYASSRWCLDELVKILECRHAMGQLLVPIFYDIDPSYVRKQKWNVGEALKRKEED  140

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            FE E E++K+WR+ L++  N+SGW L +  NG
Sbjct  141  FEIEMERLKRWREALDEAGNISGWILKDMANG  172



>ref|XP_010665235.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665237.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1276

 Score =   194 bits (494),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 89/147 (61%), Positives = 113/147 (77%), Gaps = 1/147 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED R++F DHLY A+ ++G+ TF+DDE+LERGK I+P L KAIEES ++VV
Sbjct  17   YDVFLSFRGEDTRRSFTDHLYAALVEKGVRTFRDDEELERGKEIAPELLKAIEESRISVV  76

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS++YA S WC++ELVKI+ECMK KGQTV+P+FY VDP+ VRKQ   + EAF  H +  
Sbjct  77   VFSKNYARSGWCMDELVKIIECMKAKGQTVLPVFYDVDPTHVRKQTGSFMEAFASHGEDT  136

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            E   E+ K+WR  L   +NLSGW L N
Sbjct  137  EVI-ERAKRWRAALTQAANLSGWHLQN  162



>ref|XP_006494061.1| PREDICTED: TMV resistance protein N-like, partial [Citrus sinensis]
Length=452

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 112/162 (69%), Gaps = 6/162 (4%)
 Frame = -2

Query  906  SFVSSCGST------YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSIS  745
            S VSSC S       YDVFLSFRGED R NF  HLY A+ ++ + TF D+E+LE G  IS
Sbjct  3    SLVSSCSSCIATQYKYDVFLSFRGEDTRDNFTSHLYAALCRKKVETFIDEEELEIGDEIS  62

Query  744  PALEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQ  565
            PAL  AI  S +AV++FS+HYA S WCL ELV+I++  K+ GQ V+P+FY V+PS VRKQ
Sbjct  63   PALLMAINASKIAVIIFSKHYASSKWCLNELVEILQSQKINGQMVIPVFYHVNPSYVRKQ  122

Query  564  KEKYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
               +GEAF  HE  F +  EKV+KWR VL + SNLSGWD  N
Sbjct  123  TGSFGEAFAEHESRFREMPEKVQKWRDVLTEASNLSGWDSMN  164



>ref|XP_010044029.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=631

 Score =   191 bits (484),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 125/196 (64%), Gaps = 13/196 (7%)
 Frame = -2

Query  897  SSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEE  718
            S   + YDVFLSFRG DVRK+F+ H YTA+ Q+GIY++ D E+L +G  I PAL KAIEE
Sbjct  5    SDLKANYDVFLSFRGTDVRKSFLSHFYTALAQKGIYSYVDSEELRKGDCIKPALMKAIEE  64

Query  717  SSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFE  538
            S +A+++FSE YA S WCLEE+ KIMEC + +G TV P+FY VDP  VR  ++ Y +A  
Sbjct  65   SCIAIIIFSEDYASSPWCLEEVEKIMECKEQRGLTVFPVFYKVDPREVRTPRKSYRKAMV  124

Query  537  GHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*IFN-----------SNPLHPTR  391
             HE+ F ++ EKVK+W+K L D  +LSGWDL + +   + N             PLH  +
Sbjct  125  KHERKFGRDSEKVKRWKKALLDAGSLSGWDLKDKDEADLINRIVREISMQLDRKPLHVAK  184

Query  390  GDHGFGSERSVPVLET  343
              H  G  R V  LE+
Sbjct  185  --HPVGIHRQVVKLES  198



>ref|XP_004310267.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=170

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRG D R NF DHLYTA+   GI TF+DDE+L RG+SI P L KAIEES   +
Sbjct  21   TYDVFLSFRGTDTRNNFTDHLYTALIHNGIRTFRDDEELVRGESIGPNLLKAIEESRYVI  80

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKY-GEAFEGHEK  526
            VV S +YA+SS+CL+E+ KI++C K KGQ V+P+FY VDPS VR+Q   Y  EAFE H+ 
Sbjct  81   VVVSRNYANSSFCLDEIAKIVDCKKEKGQKVLPVFYDVDPSEVRRQTWDYFVEAFEKHQN  140

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             F+     VK+WR  L +V +LSGW L N
Sbjct  141  RFQGNPGTVKRWRDALSEVGDLSGWHLQN  169



>ref|XP_010665437.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=163

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            Y VFLSFRGED R NF  HLY A+ Q+GI TF DD+KL  G+ ISP L  AI+ S  +++
Sbjct  16   YAVFLSFRGEDTRNNFTSHLYKALDQKGIETFMDDKKLRTGEEISPILVGAIQRSRCSII  75

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            V SE+YA S WCLEELV+I+EC + K Q VVPIFY VDPS VR Q   +GEA   HE++ 
Sbjct  76   VLSENYASSKWCLEELVEILECKRTKNQRVVPIFYNVDPSHVRNQTGSFGEALSKHEENL  135

Query  519  EKEGEKVKKWRKVLEDVSNLSG  454
            + +GEK++KWR+ L  V+NLSG
Sbjct  136  KIKGEKLRKWREALTQVANLSG  157



>gb|KCW59126.1| hypothetical protein EUGRSUZ_H01748 [Eucalyptus grandis]
Length=243

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             Y VFLSFRG DVR NF+ HLY A+ Q+GIYT+ D E+L +G+ I+PAL KAIE+S +A+
Sbjct  95   NYHVFLSFRGTDVRNNFLGHLYAALDQKGIYTYIDSEELRKGEQITPALIKAIEDSHIAI  154

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FSE YA S WCLEE+ KIMEC + +G TV P+FY VDP  VR  + +Y +A   HE+ 
Sbjct  155  IIFSEDYASSPWCLEEVEKIMECNEQRGLTVFPVFYKVDPGEVRTPRNRYRKAMVKHERK  214

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F ++ EKVK+W+K L D  +LSGWDL +
Sbjct  215  FGRDLEKVKRWKKSLYDAGSLSGWDLKD  242



>ref|XP_010058821.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=158

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = -2

Query  885  STYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMA  706
            S Y+VFLSFRG D+R  F+ HLY A+   GIYTF D E+L +G  I P L KAIEES +A
Sbjct  9    SNYEVFLSFRGTDLRNTFLSHLYKALHHNGIYTFIDSEELRKGNQILPTLMKAIEESLIA  68

Query  705  VVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            ++VFS+ YA S WCLEEL+KIMEC + K  TV+P+FY VDP  VR+  + YG+A   HE 
Sbjct  69   IIVFSKDYASSRWCLEELMKIMECKEQKDLTVLPVFYKVDPREVRRGSKSYGKALAKHET  128

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             F K+ EKVK W+K L D  +LSGW  N+
Sbjct  129  KFGKDSEKVKLWKKALFDAGSLSGWHFND  157



>ref|XP_006495365.1| PREDICTED: TMV resistance protein N-like, partial [Citrus sinensis]
Length=159

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YD FLSFRGED R+ F+ HLYTA+  +GIY F+DD++LE+G SISP L KAIEES ++++
Sbjct  14   YDAFLSFRGEDTRQTFISHLYTALNDKGIYVFRDDKQLEKGGSISPNLLKAIEESRISII  73

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            V S +YA S+WCL+ELVKI+E  K +   + PIFY V+P+ VRKQ   +GEAF  HE+ F
Sbjct  74   VLSRNYASSTWCLDELVKIVE-YKNREDQIFPIFYDVEPTVVRKQTTSFGEAFTKHEEFF  132

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
                EKV+KWR  L+ V+N+SGW+L +
Sbjct  133  RDNIEKVQKWRHALKVVANISGWELKD  159



>ref|XP_010058800.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=864

 Score =   192 bits (487),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 122/185 (66%), Gaps = 13/185 (7%)
 Frame = -2

Query  888  GSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSM  709
             S YDVFLSFRG DVRK+F+ HLY A+ Q GIYTF+D E+L +G  IS AL +AIE+S +
Sbjct  8    NSIYDVFLSFRGTDVRKSFLSHLYQALDQNGIYTFQDSEELRKGDQISAALMEAIEKSCI  67

Query  708  AVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHE  529
            A+++FSE YA S WCLEEL KIMEC + K  T++P+FY VDP  VR+ +E Y  A + HE
Sbjct  68   AIIIFSEDYASSWWCLEELAKIMECKEQKDLTILPVFYKVDPREVREGRESYRRALDKHE  127

Query  528  KSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*I-----------FNSNPLHPTRGDH  382
              FEK+ EKVK+W+K L D  NLSGW LN+ E   +            +  PLH T+  H
Sbjct  128  SKFEKDPEKVKRWKKALFDAGNLSGWHLNDGEESKLILQIVKEISTHLDLTPLHVTK--H  185

Query  381  GFGSE  367
              G E
Sbjct  186  LVGIE  190



>ref|XP_006495387.1| PREDICTED: TMV resistance protein N-like, partial [Citrus sinensis]
Length=205

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 110/156 (71%), Gaps = 4/156 (3%)
 Frame = -2

Query  897  SSCGST---YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKA  727
            SSC +    YDVF+SFRGED R NF  HL  A+ ++ I TF D E+L+RG  ISPAL  A
Sbjct  5    SSCLAAQCKYDVFVSFRGEDTRDNFTSHLVAALCRKKIKTFID-EQLDRGDDISPALLDA  63

Query  726  IEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGE  547
            IE S ++V++FSE+YA S WCL+ELVKI+EC     Q VVP+FY VDPS VRKQ   +G+
Sbjct  64   IERSKISVIIFSENYASSKWCLDELVKILECKNKNAQMVVPVFYHVDPSDVRKQTGSFGD  123

Query  546  AFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            AF  HEK F+   EKV+KWR VL + SNLSGWD  N
Sbjct  124  AFVKHEKQFKGIPEKVQKWRVVLTEASNLSGWDSMN  159



>ref|XP_006370843.1| hypothetical protein POPTR_0019s00720g [Populus trichocarpa]
 gb|ERP48640.1| hypothetical protein POPTR_0019s00720g [Populus trichocarpa]
Length=532

 Score =   188 bits (478),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 120/166 (72%), Gaps = 5/166 (3%)
 Frame = -2

Query  918  MEQP-SFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISP  742
            M +P S  S     YDVFLSFRGED RKNF DHLYTA+ Q GIYTF+D  ++ RG+ IS 
Sbjct  1    MTEPESSRSRPNGAYDVFLSFRGEDNRKNFTDHLYTALVQAGIYTFRDHNEIPRGEEISK  60

Query  741  ALEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQ  565
             L KAI+ES +++VVFS+ YA S WCL ELV+I+EC   K GQ V+P+FY +DPS VRKQ
Sbjct  61   HLLKAIQESKISIVVFSKGYASSRWCLNELVEILECKNRKTGQIVLPVFYDIDPSDVRKQ  120

Query  564  KEKYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
               + +AF+ HE  F+   EKVK+WRK LE+  NLSGW+L++ ENG
Sbjct  121  TGSFVKAFDKHEDCFK---EKVKEWRKALEETGNLSGWNLSDMENG  163



>ref|XP_008443388.1| PREDICTED: TMV resistance protein N [Cucumis melo]
Length=1139

 Score =   193 bits (490),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 92/152 (61%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED RKNF DHLY A +  GI  F+DD  LERG+ IS  L +AIE S +AV
Sbjct  13   TYDVFLSFRGEDTRKNFTDHLYYAFKDAGINVFRDDPGLERGEDISSELVRAIEGSKVAV  72

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFSE YA+S WCLEELVKIMEC +   Q V P+FY VDPS+VR QK ++ EAF  HE  
Sbjct  73   VVFSERYAESGWCLEELVKIMECRRTLRQLVFPVFYNVDPSSVRNQKGEFEEAFVKHEVR  132

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            + ++ +KV KWR  L + +NLSGWDL N  +G
Sbjct  133  YFRDIDKVLKWRMALTEAANLSGWDLRNIADG  164



>ref|XP_008371224.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=169

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 108/148 (73%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRG D R NFVDHLYT++  +G++ F+  E+LER   ISP L KAIEES   +
Sbjct  21   TYDVFLSFRGVDTRINFVDHLYTSLNHKGVFAFRGAEQLERENPISPELLKAIEESRYVI  80

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VV S +YA S+ CL+EL K +ECMKV GQT++P+FY VDPS VRKQ   + +AF  HE++
Sbjct  81   VVLSRNYAYSTCCLDELAKSVECMKVMGQTILPVFYDVDPSEVRKQMGNFRKAFSKHEEA  140

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F+   EKV+KWR  L +V++L GW L +
Sbjct  141  FKDNTEKVRKWRDALTEVADLYGWHLQD  168



>ref|XP_002524855.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF37479.1| ATP binding protein, putative [Ricinus communis]
Length=673

 Score =   190 bits (482),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 113/165 (68%), Gaps = 7/165 (4%)
 Frame = -2

Query  909  PSFVSSCGS----TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISP  742
            PSF S C      +YDVFLSFRGED RKNF DHLY A+ Q GI+ F+DD+ L RG  IS 
Sbjct  10   PSF-SYCRRPHQWSYDVFLSFRGEDTRKNFTDHLYNALLQAGIHAFRDDKHLSRGNHISS  68

Query  741  ALEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQK  562
             L KAI+ES +++VVFS+ YA S WCL+ELVKIM+C    GQ VVPIFY V PS VRKQ 
Sbjct  69   ELLKAIQESKVSIVVFSKGYASSRWCLDELVKIMQCKNTAGQIVVPIFYDVSPSDVRKQT  128

Query  561  EKYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
              + EA + HE+  E+  EKV  WR  L + +NLSGWDL N  NG
Sbjct  129  GSFAEALQRHEQFSER--EKVNDWRNALLEAANLSGWDLQNVANG  171



>ref|XP_007224475.1| hypothetical protein PRUPE_ppa022336mg [Prunus persica]
 gb|EMJ25674.1| hypothetical protein PRUPE_ppa022336mg [Prunus persica]
Length=888

 Score =   191 bits (486),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 110/151 (73%), Gaps = 0/151 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED RKNF  HLY A+++ GI  F DD +L RG+ I+  L +AI+ S ++V+
Sbjct  17   YDVFLSFRGEDTRKNFTGHLYMALKEAGINAFIDDNELRRGEDITAELVQAIQGSRISVI  76

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS  YADS WCLEELVKIMEC +   Q V+PIFY VDPS VRKQ   +G+AFE HE+ F
Sbjct  77   VFSRRYADSGWCLEELVKIMECRRTVRQMVLPIFYDVDPSDVRKQNGCFGQAFEKHEERF  136

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
              E +KV +WR  L + +NLSGWDL NT +G
Sbjct  137  LLEVDKVLRWRSALTEAANLSGWDLRNTADG  167



>ref|XP_008236760.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=171

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED R NF DHL++++ ++GI TF D+++LERG  ISP L KAI+ S +++
Sbjct  23   TYDVFLSFRGEDTRYNFTDHLHSSLDRKGINTFIDNDELERGTDISPVLLKAIQGSMISL  82

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FSE+YA S+WCL+EL  I++C ++K Q V PIFY VDPS VR Q+  +GEA   HE +
Sbjct  83   IIFSENYASSTWCLDELAHIIQCRELKQQLVFPIFYKVDPSHVRHQRGSFGEAIANHECN  142

Query  522  FEKEGEKVKKWRKVLEDVSNLSGW  451
            F+ +  KV +W+  L +V+NLSGW
Sbjct  143  FKNDMNKVLRWKAALVEVANLSGW  166



>ref|XP_010059172.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=242

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 107/153 (70%), Gaps = 0/153 (0%)
 Frame = -2

Query  897  SSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEE  718
            S+    Y VFLSFRG DVR  F+ HLY A+ Q+GIYTF D E+L +G+ ISP L +AIEE
Sbjct  85   SNMKRNYHVFLSFRGTDVRHGFLSHLYAALDQKGIYTFVDSEELRKGEEISPTLMRAIEE  144

Query  717  SSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFE  538
            S +A++VFSE Y  S WCLEEL+KIMEC K     VVP+FY V+P  VR  +E+YG A  
Sbjct  145  SRIAIIVFSEDYTSSPWCLEELLKIMECKKRNDLIVVPVFYKVEPREVRGGRERYGRAMT  204

Query  537  GHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             HE  F K+ +KVK+W+K L +  +LSGW LN+
Sbjct  205  KHESKFGKDLQKVKRWKKALFEAGSLSGWPLND  237



>ref|XP_004310258.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=592

 Score =   189 bits (479),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 115/149 (77%), Gaps = 1/149 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRG D R NF DHL+TA+ Q+GI+TF+DDE+L RG+SI+P L KAIEES   +
Sbjct  18   TYDVFLSFRGTDTRTNFTDHLFTALLQKGIHTFRDDEELVRGESIAPNLLKAIEESRYVI  77

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQK-EKYGEAFEGHEK  526
            VVFS +YADS+WCL+E+ K+ +CMK  GQ V+P+FY VDPS VR+Q  + +G+AFE H+ 
Sbjct  78   VVFSPNYADSAWCLDEIAKVADCMKETGQKVLPVFYLVDPSEVRRQTGDHFGKAFEKHQD  137

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             ++ E +KV++W+  L  V NLSGW L +
Sbjct  138  RYKAEPDKVQRWKDALFLVGNLSGWHLQD  166



>ref|XP_010245185.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=1120

 Score =   192 bits (489),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 86/151 (57%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED RKNF DHLYTA+ Q+G+YTF+DDE+L +G+ IS  L KAIEES ++++
Sbjct  34   YDVFLSFRGEDTRKNFTDHLYTALVQKGVYTFRDDEELRKGEEISSELLKAIEESRISII  93

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS +YA SSWCL+ELV+I+EC +   Q V+P+F+ VDPS VRKQ   +G+ F   ++ F
Sbjct  94   VFSRNYASSSWCLDELVRILECRRKIDQKVLPVFFDVDPSDVRKQTGDFGKGFTKLKERF  153

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
              E  KV +W   L++ +NLSGWDL N  NG
Sbjct  154  TLETMKVLRWETSLQEAANLSGWDLRNVANG  184



>ref|XP_006442201.1| hypothetical protein CICLE_v10021500mg [Citrus clementina]
 gb|ESR55441.1| hypothetical protein CICLE_v10021500mg [Citrus clementina]
Length=287

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = -2

Query  897  SSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEE  718
            SSC   YDVFLSFRGED R NF  HLY A  Q+ I T+ DDE++ RG+ ISPA+ KAI+ 
Sbjct  7    SSC--KYDVFLSFRGEDTRCNFTSHLYAAFCQKKIKTYIDDEEISRGEKISPAISKAIQG  64

Query  717  SSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFE  538
            S +++++FS+ YA S WCL ELVKI++C K+ GQ V+P+FY VDPS VRKQ   + + F 
Sbjct  65   SKVSIIIFSKDYASSDWCLNELVKILDCKKINGQIVIPVFYHVDPSDVRKQNGSFRDPFV  124

Query  537  GHEKSFEKEGEKVKKWRKVLEDVSNLSGWD  448
             HEK F+   EK++KWR  L + SNLSGWD
Sbjct  125  EHEKQFKNMPEKIQKWRAALTEESNLSGWD  154



>emb|CBI23856.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   181 bits (459),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 106/144 (74%), Gaps = 1/144 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            Y+VFLSFRGED RK+F DHL+ A+ + GI TF DD+ L RG+ IS AL +AIEES ++++
Sbjct  79   YEVFLSFRGEDTRKSFTDHLHEALCRYGINTFIDDQ-LRRGEQISSALLQAIEESRLSII  137

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FSEHYA SSWCL+EL KI+EC+KV G T  P+FY VDPS VRKQ   YG AF  HE+ +
Sbjct  138  IFSEHYASSSWCLDELTKILECVKVGGHTAFPVFYNVDPSHVRKQTGSYGVAFTKHEQVY  197

Query  519  EKEGEKVKKWRKVLEDVSNLSGWD  448
                EKV KWR+ L   S LSGWD
Sbjct  198  RDNMEKVLKWREALTVASGLSGWD  221



>ref|XP_011012884.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=867

 Score =   191 bits (484),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 117/154 (76%), Gaps = 0/154 (0%)
 Frame = -2

Query  888  GSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSM  709
            G  YDVFLSFRGED RKNF DHLYTA+ Q GI+TF+DD +L +G+ IS  L KAI+ES +
Sbjct  13   GWPYDVFLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDNELRKGEEISSHLLKAIQESKI  72

Query  708  AVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHE  529
            ++VVFS+ YA S+WCL+EL +I++C +  GQ V+P+FY +DPS +RKQK  + EAF+ HE
Sbjct  73   SIVVFSKGYASSTWCLDELSEILDCRQTAGQIVLPVFYDIDPSDIRKQKRSFAEAFDRHE  132

Query  528  KSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            + F++E EKV+KWR  L +   L G+DL++  NG
Sbjct  133  ELFKEEMEKVQKWRTALLEAGILCGFDLHSIANG  166



>ref|XP_010070629.1| PREDICTED: toll/interleukin-1 receptor-like protein [Eucalyptus 
grandis]
Length=306

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 110/150 (73%), Gaps = 0/150 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             Y VFLSFRG D+R NF+ HLY A+ Q+GIYT+ D E+L +G+ I+PAL KAIE+S +A+
Sbjct  47   NYHVFLSFRGTDIRNNFLGHLYAALDQKGIYTYVDSEELRKGERITPALIKAIEDSRIAI  106

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FSE YA SSWCLEE+ KIMEC + +G TV P+FY V+P  VR  +  Y E+   H+  
Sbjct  107  IIFSEDYASSSWCLEEVEKIMECKEQRGLTVFPVFYKVEPKEVRTPRGSYRESMVKHDNK  166

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTE  433
            F ++ EKVK+W+K L D  +LSGWDLN+ +
Sbjct  167  FGRDSEKVKRWKKALYDAGSLSGWDLNDKD  196



>gb|KHN27791.1| TMV resistance protein N [Glycine soja]
Length=169

 Score =   177 bits (450),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 113/150 (75%), Gaps = 3/150 (2%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            Y+VF+SFRG+D R NF DHL+ A+Q++GI TF+DD KL++G+ I  +L +AIE S + V+
Sbjct  19   YEVFVSFRGKDTRNNFTDHLFGALQRKGILTFRDDTKLKKGERILSSLMQAIEGSQIFVI  78

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS++YA S+WCL EL KI++C+ V G+ V+PIFY VDPS VRKQ   YG+AF  HE+ F
Sbjct  79   VFSKNYASSTWCLRELEKILDCVIVPGKRVLPIFYDVDPSEVRKQTGDYGKAFTKHEERF  138

Query  519  EKEGEK---VKKWRKVLEDVSNLSGWDLNN  439
            + + EK   VK+WR+ L  V+N SGWD+ N
Sbjct  139  KDDVEKMEEVKRWRRALTQVANFSGWDMMN  168



>ref|XP_010058776.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=191

 Score =   178 bits (452),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 114/183 (62%), Gaps = 11/183 (6%)
 Frame = -2

Query  885  STYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMA  706
            S Y+VFLSFRG DVR  F+ HLY A+   GIYTF D E+L +G    PAL KAIEES +A
Sbjct  9    SNYEVFLSFRGTDVRNTFLGHLYKALHHNGIYTFIDSEELRKGDQTLPALMKAIEESFVA  68

Query  705  VVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            ++VFS+ YA S WCLEEL+KIMEC + K  TV+P+FY VDP  VR+  + YG+A   HE 
Sbjct  69   IIVFSKDYASSRWCLEELMKIMECKEQKDLTVLPVFYKVDPREVRQGSKSYGKALAKHES  128

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNN-----------TENG*IFNSNPLHPTRGDHG  379
             F K+ EKV++W+K L D  +LSGW  N+            E   + +  PLH  +   G
Sbjct  129  KFGKDSEKVERWKKALFDAGSLSGWHFNDGDESELIERIVKEISTLLDRTPLHVAKHPVG  188

Query  378  FGS  370
              S
Sbjct  189  INS  191



>ref|XP_011012882.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1103

 Score =   192 bits (487),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 117/154 (76%), Gaps = 0/154 (0%)
 Frame = -2

Query  888  GSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSM  709
            G  YDVFLSFRGED RKNF DHLYTA+Q  GI+TF+DD +L +G+ IS  L KAI+ES +
Sbjct  16   GWHYDVFLSFRGEDTRKNFTDHLYTALQNAGIHTFRDDNELPKGEEISSHLLKAIKESKI  75

Query  708  AVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHE  529
            ++VVFS+ YA S+WCL+EL +I++C +  GQ V+P+FY +DPS +RKQ   + EAF+ HE
Sbjct  76   SIVVFSKGYASSTWCLDELSEILDCRQTAGQIVLPVFYDIDPSDIRKQTGSFAEAFDRHE  135

Query  528  KSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            + F++E EKV+KWRK L +   LSG DL++  NG
Sbjct  136  ERFKEEMEKVQKWRKALVEAGRLSGLDLHSIANG  169



>gb|KCW59360.1| hypothetical protein EUGRSUZ_H02058 [Eucalyptus grandis]
Length=547

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 123/196 (63%), Gaps = 13/196 (7%)
 Frame = -2

Query  897  SSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEE  718
            S     YDVFLSFRG DVR NF+ HLY A+ Q+GIYT+ D E+L++G  I PAL KAIEE
Sbjct  29   SELKGNYDVFLSFRGMDVRNNFLGHLYAALDQKGIYTYIDSEELQKGDCIKPALMKAIEE  88

Query  717  SSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFE  538
            S +A+++FSE YA S WCLEE+ KIMEC + +G TV P+FY VDP  VR  +  Y +A +
Sbjct  89   SCIAIIIFSEDYASSPWCLEEVEKIMECKEQRGLTVFPVFYKVDPREVRTPRGSYRKAIK  148

Query  537  GHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*IFNS-----------NPLHPTR  391
            GHE+ + ++ EKVK+W+K L D  +LSGWDL +     + N              LH  +
Sbjct  149  GHERKYGRDSEKVKRWKKALFDTGSLSGWDLKDKVEADLINKIVREISMRLDRKLLHVAK  208

Query  390  GDHGFGSERSVPVLET  343
              H  G  R V  LE+
Sbjct  209  --HPVGIHRQVVKLES  222



>ref|XP_011011963.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
 ref|XP_011011964.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1270

 Score =   192 bits (488),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            +DVFLSFRG+D R NF  HLY+ + QRGI  + DD +LERGK+I PAL KAIEES  +V+
Sbjct  22   HDVFLSFRGKDTRNNFTSHLYSNLAQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVI  81

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FS  YA S WCL+ELVKI++CMK  GQTV+P+FY VDPS V ++K KY EAF  HE++F
Sbjct  82   IFSRDYASSPWCLDELVKIVQCMKEMGQTVLPVFYDVDPSEVTERKRKYEEAFGEHEQNF  141

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++  EKV+KW+  L  V+NLSGWD+ N
Sbjct  142  KENLEKVRKWKDCLSTVANLSGWDVRN  168


 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 63/105 (60%), Gaps = 1/105 (1%)
 Frame = -2

Query  765   ERGKSISPALEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECM-KVKGQTVVPIFYGV  589
             E+  +I   L +AIEES M++++FS   A   WC +ELVKI+  M +++  TV P+ Y V
Sbjct  1163  EKVMAIRSRLFEAIEESGMSIIIFSRDCASLPWCFDELVKIVGYMDEMRSDTVFPVSYDV  1222

Query  588   DPSTVRKQKEKYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSG  454
             + S +  Q E Y   F+ +E++  +  EKV++W  +L +V   SG
Sbjct  1223  EQSKMDDQTESYTIVFDKNEENLRENEEKVQRWTNILSEVEISSG  1267



>ref|XP_010104209.1| TMV resistance protein N [Morus notabilis]
 gb|EXC47698.1| TMV resistance protein N [Morus notabilis]
Length=2037

 Score =   193 bits (490),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -2

Query  876  DVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVVV  697
            DVFLSFRGED R+ F DHLY  ++++GI  F+DDEKLERGK I+P L ++IEES  AVV+
Sbjct  20   DVFLSFRGEDTRRGFTDHLYNTLKRKGIDVFRDDEKLERGKDIAPELLRSIEESRFAVVI  79

Query  696  FSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSFE  517
            FS  YA S+WCL+EL KI EC K   QTV+P+F+GVDPS VRKQK ++  AFE HE+ F+
Sbjct  80   FSRDYASSTWCLDELQKIAECKKSMEQTVLPVFHGVDPSNVRKQKGEFLAAFEKHEQDFK  139

Query  516  KEGEKVKKWRKVLEDVSNLSGWDLNN  439
                KVKKWRK L D++++SGWDL N
Sbjct  140  DNMGKVKKWRKALTDLASVSGWDLTN  165



>ref|XP_006492809.1| PREDICTED: vesicle-associated protein 1-4-like [Citrus sinensis]
Length=354

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 107/150 (71%), Gaps = 2/150 (1%)
 Frame = -2

Query  897  SSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEE  718
            SSC   YDVFLSFRGED R NF  HLY A  Q+ I TF DDE++ RG+  SPA+ KAI+ 
Sbjct  7    SSC--KYDVFLSFRGEDTRCNFTIHLYAAFCQKKIKTFIDDEEISRGEKFSPAISKAIQG  64

Query  717  SSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFE  538
            S +++++FS+ YA S WCL ELVKI+ C K+ GQ V+PIFY VDPS VRKQ   +G+ F 
Sbjct  65   SKVSIIIFSKDYASSDWCLNELVKILYCKKINGQIVIPIFYHVDPSDVRKQNGSFGDPFV  124

Query  537  GHEKSFEKEGEKVKKWRKVLEDVSNLSGWD  448
             HEK F+   EK++KWR  L + SNLSGWD
Sbjct  125  EHEKQFKNMPEKIQKWRAALTEASNLSGWD  154



>ref|XP_004289198.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=564

 Score =   187 bits (476),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            +DVFLSFRGED R NF DHLY A  Q+GI  F+D EKL RGKSISP L KAIEES  AV 
Sbjct  27   HDVFLSFRGEDTRNNFTDHLYYAFNQKGINAFRDTEKLPRGKSISPELLKAIEESKFAVT  86

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            V S +YA SSWCL+EL  I+EC +V+G  V+PIFY V+PS +RKQ   YG+AF  HE  F
Sbjct  87   VLSTNYATSSWCLDELAHILECKEVRGLEVLPIFYHVEPSEIRKQTGNYGKAFAKHETDF  146

Query  519  EKEGEKVKKWRKVLEDVSNLSGW  451
            E   EKV  WR+ L++V++LSGW
Sbjct  147  EDNMEKVDNWRQALKEVASLSGW  169



>ref|XP_006385995.1| hypothetical protein POPTR_0003s19850g, partial [Populus trichocarpa]
 gb|ERP63792.1| hypothetical protein POPTR_0003s19850g, partial [Populus trichocarpa]
Length=1354

 Score =   192 bits (488),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 87/154 (56%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  888  GSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSM  709
            G  YDVFLSFRGED RKNF DHL+TA+Q+ GI TF+DD++L  G+ IS  L KAI+ES +
Sbjct  14   GWVYDVFLSFRGEDTRKNFTDHLFTALQKAGIRTFRDDDELRIGEEISFQLPKAIQESKI  73

Query  708  AVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHE  529
            ++VVFS+ YA S+WCL+EL KI++C +  GQ V+P+FY +DPS +RKQ   + EAF+ HE
Sbjct  74   SIVVFSKGYASSTWCLDELEKILDCRQPTGQIVLPVFYDIDPSDIRKQTGSFAEAFDRHE  133

Query  528  KSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            + F++E EKV+KWRK L + +N+SG DL +  NG
Sbjct  134  ERFKEEMEKVQKWRKALVEAANISGLDLRSFANG  167



>ref|XP_006371055.1| hypothetical protein POPTR_0019s03015g [Populus trichocarpa]
 gb|ERP48852.1| hypothetical protein POPTR_0019s03015g [Populus trichocarpa]
Length=512

 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 116/154 (75%), Gaps = 4/154 (3%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRGED RK FVDHLYTA+ Q GI+TF+DD++L RG+ IS  L +AI ES +++
Sbjct  14   AYDVFLSFRGEDTRKTFVDHLYTALVQAGIHTFRDDDELPRGEEISEHLLEAIRESKISI  73

Query  702  VVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            VVFS+ YA S WCL ELV+I++C + K GQ V+PIFY +DPS VRKQ   + EAF+ HE+
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEE  133

Query  525  SFEKEGEK-VKKWRKVLEDVSNLSGWDLNNTENG  427
              E+  EK VK+WRK LED  NLSGW LN+  NG
Sbjct  134  --ERFEEKLVKEWRKALEDAGNLSGWSLNDMANG  165



>gb|ABF81468.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=1021

 Score =   191 bits (484),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = -2

Query  888  GSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSM  709
            G  YDVFLSFRGED RKNF DHL+TA+Q+ GI TF+DD++L  G+ IS  L KAI+ES +
Sbjct  36   GWVYDVFLSFRGEDTRKNFTDHLFTALQKAGIRTFRDDDELRIGEEISFQLPKAIQESKI  95

Query  708  AVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHE  529
            ++VVFS+ YA S+WCL+EL KI++C +  GQ V+P+FY +DPS +RKQ   + EAF+ HE
Sbjct  96   SIVVFSKGYASSTWCLDELEKILDCRQPTGQIVLPVFYDIDPSDIRKQTGSFAEAFDRHE  155

Query  528  KSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            + F++E EKV+KWRK L + +N+SG DL +  NG
Sbjct  156  ERFKEEMEKVQKWRKALVEAANISGLDLRSFANG  189



>emb|CDP14589.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 114/148 (77%), Gaps = 2/148 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED R+NFV +L+ A+  +GIYT+KDD++LE+GKSISP L +AI+ES  +V
Sbjct  37   TYDVFLSFRGEDTRRNFVAYLFQALCNKGIYTYKDDQRLEKGKSISPELLQAIQESLFSV  96

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++FS+ YA  +WCLEELVKIMEC ++ GQ V+PIFY VDPS VRKQ+  + +AF  HE+ 
Sbjct  97   IIFSKGYASLTWCLEELVKIMECHQIIGQFVLPIFYDVDPSDVRKQRNSFADAFAKHER-  155

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             ++  EKV+KW++ L   + LSGW   N
Sbjct  156  -DQSPEKVQKWKEALSQAAGLSGWHSCN  182



>ref|XP_006441740.1| hypothetical protein CICLE_v100235051mg, partial [Citrus clementina]
 gb|ESR54980.1| hypothetical protein CICLE_v100235051mg, partial [Citrus clementina]
Length=163

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 111/147 (76%), Gaps = 2/147 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YD FLSFRG D RK+F+ HLY A+  +GIY FKDD++LERG SISP L KAIE+S ++++
Sbjct  14   YDAFLSFRGADTRKSFISHLYAALNGKGIYLFKDDKELERGASISPGLLKAIEDSRISII  73

Query  699  VFSEHYADSSWCLEELVKIMECMKVKG--QTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            VFS++YA S+W L+ELVKI++C       Q V P+FY V+P+ VRKQ   + EAF  HE+
Sbjct  74   VFSQNYASSTWYLDELVKIVQCKNKNDHQQMVFPVFYDVEPTVVRKQMGSFREAFSKHEE  133

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDL  445
            +F++  EKVK WR  L++V+N+SGW+L
Sbjct  134  AFKENLEKVKNWRDALKEVANISGWEL  160



>ref|XP_006376071.1| hypothetical protein POPTR_0013s088501g, partial [Populus trichocarpa]
 gb|ERP53868.1| hypothetical protein POPTR_0013s088501g, partial [Populus trichocarpa]
Length=234

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 106/149 (71%), Gaps = 0/149 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D R NF  HLY+ + QRGI  + DD  LERGK+I PAL KAIE+S  ++V
Sbjct  2    YDVFLSFRGKDTRNNFTSHLYSNLVQRGIDVYMDDRGLERGKTIEPALWKAIEDSRFSIV  61

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS  YA S WCL+ELVKI++CMK  G TV+P+FY VDPS V  QK  Y +AF  H++  
Sbjct  62   VFSRDYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQKGNYKKAFIEHKEKL  121

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNNTE  433
             +  ++VK W   L  V+NLSGWD+ N++
Sbjct  122  SENLDRVKCWSDCLSTVANLSGWDVRNSD  150



>ref|XP_004292155.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=1648

 Score =   192 bits (488),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 111/147 (76%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG D R +F D LY  ++Q+GI TF+D+E+LERGK I+P L KAIEES   +V
Sbjct  23   YDVFLSFRGTDTRNSFTDFLYNTLKQKGINTFRDNEELERGKEIAPELLKAIEESRYVIV  82

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            V SE+YADSSWCL+E+ K++ECMK+ GQTVVP+FY VDP  VR+QK  + +AF  HE   
Sbjct  83   VLSENYADSSWCLDEVAKVVECMKLMGQTVVPVFYHVDPFEVRRQKGSFEKAFAKHEIRL  142

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            +   EKVK+WR  L DV+NLSGW L +
Sbjct  143  KDNPEKVKRWRSALTDVANLSGWHLKD  169



>gb|KCW74410.1| hypothetical protein EUGRSUZ_E03094 [Eucalyptus grandis]
Length=169

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 106/152 (70%), Gaps = 0/152 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             Y VFLSFRG DVR+ F+ HLY A+ Q+GI+TF D E+L +G  IS AL +AIEES +A+
Sbjct  4    NYHVFLSFRGTDVRQGFLSHLYAALDQKGIFTFVDSEELRKGDEISMALMRAIEESHVAI  63

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSEHY  S WCLEEL+KIMEC +  G  V P+FY V+P  VR+ ++ Y  A + HE  
Sbjct  64   IVFSEHYTSSRWCLEELLKIMECKEQNGLKVFPVFYKVEPREVREGRDSYKRAMDNHESK  123

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
              K+ EKVK W+K L +  +LSGW+LN+   G
Sbjct  124  LGKDSEKVKSWKKALSEAGSLSGWELNDRSMG  155



>gb|KCW59364.1| hypothetical protein EUGRSUZ_H02067 [Eucalyptus grandis]
Length=621

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 125/196 (64%), Gaps = 13/196 (7%)
 Frame = -2

Query  897  SSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEE  718
            S     YDVFLSFRG DVR NF+ HLYTA+ Q+GIYT+ D E+L++G+ I+PAL KAIE+
Sbjct  5    SDLKGNYDVFLSFRGTDVRNNFLGHLYTALDQKGIYTYIDSEELQKGEQITPALIKAIED  64

Query  717  SSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFE  538
            S +A+++FSE YA S+WCLEE+ +IMEC + +   V P+FY VDP  VR  +E Y +A  
Sbjct  65   SRIAIIIFSEDYASSTWCLEEVAQIMECKEQRDLVVFPVFYKVDPREVRTPRESYRKAMV  124

Query  537  GHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*IFN-----------SNPLHPTR  391
             HE+ F ++ EKVKKW+K L D  +LSGWDL + +   +               PLH  +
Sbjct  125  KHERKFGRDSEKVKKWKKALFDAGSLSGWDLKDKDEADLIKRIVQEISMQLPRTPLHVAK  184

Query  390  GDHGFGSERSVPVLET  343
              H  G  R V  L++
Sbjct  185  --HPVGIHRQVVKLKS  198



>ref|XP_010041148.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=161

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 105/147 (71%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSF G DVRKNF+ HLY A+ Q G++T+ D++++ +G+ I   L KAIEES +A++
Sbjct  14   YDVFLSFSGIDVRKNFLSHLYMALDQNGLFTYVDNKEMRKGQQIWLELMKAIEESHVAII  73

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FS++YA S WCLEE+ KIMECMK K   V+P+FY V+P  VRK +  YG A   HE  F
Sbjct  74   IFSKNYASSRWCLEEVAKIMECMKQKDLIVLPVFYNVEPREVRKWRGSYGRAMAKHEAEF  133

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             K   KVK+W+K L D SNLSGW  +N
Sbjct  134  GKHSHKVKRWKKTLVDASNLSGWHFDN  160



>gb|ABF81437.1| TIR-NBS-LRR-TIR type disease resistance protein [Populus trichocarpa]
Length=1289

 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D R NF  HLY+ + QRGI  + DD +LERGK+I PAL KAIEES  +V+
Sbjct  143  YDVFLSFRGKDTRNNFTSHLYSNLAQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVI  202

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FS  YA S WCL+ELVKI++CMK  GQTV+PIFY VDPS V +QK +Y +AF  HE++F
Sbjct  203  IFSREYASSPWCLDELVKIVQCMKETGQTVLPIFYDVDPSEVAEQKGQYEKAFVEHEQNF  262

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++  EKV+ W+  L  V+NLSGWD+ N
Sbjct  263  KENLEKVRNWKDCLSTVANLSGWDVRN  289


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 58/105 (55%), Gaps = 1/105 (1%)
 Frame = -2

Query  765   ERGKSISPALEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECM-KVKGQTVVPIFYGV  589
             E+  +I   L +AIEES +++++F+   A   WC EELVKI+  M +++   V P+   V
Sbjct  1148  EKVMAIRSRLFEAIEESGLSIIIFARDCASLPWCFEELVKIVGFMDEMRSDIVFPVSRDV  1207

Query  588   DPSTVRKQKEKYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSG  454
               S +  Q E Y   F+ +E++  +  EK ++W  +L  V   SG
Sbjct  1208  KQSKIDDQTESYTIVFDKNEENLRENEEKGQRWMDILTKVEISSG  1252



>ref|XP_010263322.1| PREDICTED: TMV resistance protein N-like [Nelumbo nucifera]
Length=177

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 104/152 (68%), Gaps = 2/152 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             + VFLSFRGED R +F DHLY A+ +RGI TF+DDE+L RG+ IS  L KAIE S +A+
Sbjct  19   VWKVFLSFRGEDTRGSFTDHLYEALNRRGIRTFRDDEELRRGEEISSELLKAIEGSKVAI  78

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFS +YA S W L+ELVKIM+C +  G  V+P+FY +DPS VR Q     EAF GHE  
Sbjct  79   IVFSRNYASSRWWLDELVKIMDCSRTNGMLVLPVFYDIDPSDVRNQSGTVAEAFAGHEMR  138

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            F  + EK + W++ L   +NLSGWDL    NG
Sbjct  139  F--QSEKTEGWKRALRHAANLSGWDLQTLANG  168



>ref|XP_006376076.1| hypothetical protein POPTR_0013s08890g [Populus trichocarpa]
 gb|ERP53873.1| hypothetical protein POPTR_0013s08890g [Populus trichocarpa]
Length=168

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 104/147 (71%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D R NF  HLY+ ++QRGI  + DD  LERGK+I PAL +AIE+S  ++V
Sbjct  21   YDVFLSFRGKDTRNNFTSHLYSNLEQRGIDVYMDDSGLERGKTIEPALWQAIEDSRFSIV  80

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS  YA SSWCL+ELVKI++CMK  G TV+P+FY VDPS V  Q   Y +AF  H++  
Sbjct  81   VFSRDYASSSWCLDELVKIVQCMKEMGHTVLPVFYDVDPSEVADQTGDYKKAFIEHKEKH  140

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
                +KVK W   L  V+NLSGWD+ N
Sbjct  141  SGNLDKVKCWSDCLSTVANLSGWDVRN  167



>gb|KCW73580.1| hypothetical protein EUGRSUZ_E02138 [Eucalyptus grandis]
Length=824

 Score =   189 bits (479),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 110/149 (74%), Gaps = 0/149 (0%)
 Frame = -2

Query  885  STYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMA  706
            S YDVFLSFRG +VRK+F+ HLY A+ Q GIYTF+D E+L +G  IS  L KAIEES +A
Sbjct  9    SIYDVFLSFRGTNVRKSFLSHLYRALDQNGIYTFQDSEELRKGDQISTTLMKAIEESCIA  68

Query  705  VVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            +++FSE YA S WCLEE+ KIMEC + K  TV+P+FY VDP  VR+ +E Y +A + HE 
Sbjct  69   IIIFSEDYASSWWCLEEMAKIMECREQKDLTVLPVFYKVDPREVREGRESYRKALDKHED  128

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             F K+ EKVKKW+K L D  NLSGW LN+
Sbjct  129  KFRKDPEKVKKWKKALFDAGNLSGWHLND  157



>gb|KCW73653.1| hypothetical protein EUGRSUZ_E02234, partial [Eucalyptus grandis]
Length=830

 Score =   189 bits (479),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 123/196 (63%), Gaps = 15/196 (8%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG D+R NF+ HLY A+ + GIYTF+D E+L++G  ISP L KAIEES +A+V
Sbjct  11   YDVFLSFRGADLRNNFIGHLYQALYRIGIYTFRDSEELKKGDQISPVLMKAIEESCIAIV  70

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS++YA S WCL+ELVKI+EC + K  TV+P+FY VDP  VR  K  Y  A   HE  F
Sbjct  71   VFSKNYASSRWCLKELVKIIECKEQKNLTVLPVFYKVDPREVRGCKNSYQRALAKHESKF  130

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*IFN-----------SNPLHPTRGDHGFG  373
             KE E VK+W+K L D  NLSGW LN+ +   +               PLH  +   G  
Sbjct  131  GKESENVKRWKKALSDAGNLSGWHLNDGDESELIQEIVEKISTYLAQTPLHVAKHPVGID  190

Query  372  SE----RSVPVLETDE  337
            S     +S+  LE+D+
Sbjct  191  SRVVKLKSMLNLESDD  206



>ref|XP_010026443.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=600

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 113/161 (70%), Gaps = 0/161 (0%)
 Frame = -2

Query  897  SSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEE  718
            S     YDVFLSFRG DVR NF+ HLY A+ Q+GIYT+ D E+L++G  I PAL KAIEE
Sbjct  65   SELKGNYDVFLSFRGMDVRNNFLGHLYAALDQKGIYTYIDSEELQKGDCIKPALMKAIEE  124

Query  717  SSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFE  538
            S +A+++FSE YA S WCLEE+ KIMEC + +G TV P+FY VDP  VR  +  Y +A +
Sbjct  125  SCIAIIIFSEDYASSPWCLEEVEKIMECKEQRGLTVFPVFYKVDPREVRTPRGSYRKAIK  184

Query  537  GHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*IFN  415
            GHE+ + ++ EKVK+W+K L D  +LSGWDL +     + N
Sbjct  185  GHERKYGRDSEKVKRWKKALFDTGSLSGWDLKDKVEADLIN  225



>ref|XP_010644028.1| PREDICTED: uncharacterized protein LOC100261885 [Vitis vinifera]
Length=2956

 Score =   192 bits (488),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 94/149 (63%), Positives = 111/149 (74%), Gaps = 2/149 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED R+NF DHLY A+   GI TF+DDE+L RG+ I+P L KAIEES  A+V
Sbjct  14   YDVFLSFRGEDTRRNFTDHLYKALIHSGIRTFRDDEELRRGEEIAPELLKAIEESRSAIV  73

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVV-PIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VFSE YA S WCLEELVKIM+C + + Q VV PIFY VDPS VR Q E YGEAF  HEK+
Sbjct  74   VFSETYARSKWCLEELVKIMKCKEEREQMVVIPIFYHVDPSEVRNQTEIYGEAFTHHEKN  133

Query  522  FEKE-GEKVKKWRKVLEDVSNLSGWDLNN  439
             E+E  EK++KW+  L   SNL+G+D  N
Sbjct  134  AEEERKEKIRKWKTALRQASNLAGYDATN  162



>ref|XP_002304785.2| hypothetical protein POPTR_0003s19950g [Populus trichocarpa]
 gb|EEE79764.2| hypothetical protein POPTR_0003s19950g [Populus trichocarpa]
Length=1384

 Score =   191 bits (485),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 87/154 (56%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -2

Query  888  GSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSM  709
            G  YDVFLSFRGED RKNF DHLYTA+    I+ F+DD++L RG+ IS  L KAI+ES +
Sbjct  15   GWGYDVFLSFRGEDTRKNFTDHLYTALHHARIHAFRDDDELRRGEEISLQLLKAIQESKI  74

Query  708  AVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHE  529
            ++VVFS+ YA S+WCL EL KI++C    GQ V+P+FY +DPS +RKQ   + EAF+ HE
Sbjct  75   SIVVFSKGYASSTWCLAELEKILDCRHTTGQIVLPVFYDIDPSDIRKQTGSFAEAFDRHE  134

Query  528  KSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            + F++E EKV+KWRK L + +NLSG DL +  NG
Sbjct  135  ERFKEEMEKVQKWRKALMEAANLSGLDLRSFANG  168



>ref|XP_010058787.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
 gb|KCW73617.1| hypothetical protein EUGRSUZ_E02190 [Eucalyptus grandis]
Length=454

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG DVR + + HLY A+ Q GIYTF+D E+L +G  IS  L KAIEES +A++
Sbjct  12   YDVFLSFRGTDVRNSLISHLYQALDQNGIYTFRDSEELRKGDQISATLMKAIEESCIAII  71

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFSE+YA S WCLEE  KIMEC + K  TV+P+FY VDP  VR+ ++ Y EA + HE  F
Sbjct  72   VFSENYASSWWCLEETAKIMECKEQKDLTVLPVFYKVDPREVREGRKSYREALDKHEDKF  131

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            + + EKVKKW+K L D  NLSGW LN+
Sbjct  132  KNDLEKVKKWKKALFDAGNLSGWHLND  158



>emb|CBI40962.3| unnamed protein product [Vitis vinifera]
Length=1284

 Score =   191 bits (484),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 91/147 (62%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED R NF  HLY A+ Q+GIYTF DD+KLERG+ IS AL +AIE S  +++
Sbjct  25   YDVFLSFRGEDTRNNFTAHLYHALCQKGIYTFIDDDKLERGEVISSALVEAIENSMFSII  84

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            V SE+YA S WCLEELVKI+EC + KGQTV+PIFY VDP+ VRKQ+ K+GEA   H+K+ 
Sbjct  85   VLSENYASSRWCLEELVKILECKENKGQTVLPIFYHVDPADVRKQRGKFGEALAKHKKNM  144

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            E   E+VK W+  L  V+ LSGWD  N
Sbjct  145  ENM-ERVKIWKDALTKVAYLSGWDSQN  170



>gb|KGN59549.1| hypothetical protein Csa_3G824940 [Cucumis sativus]
Length=631

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 112/152 (74%), Gaps = 2/152 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED RKNF DHLY A++  GI  F+DD +L+RG+ IS  LE+AIE S +AV
Sbjct  53   TYDVFLSFRGEDTRKNFTDHLYYALKDAGINVFRDDPELQRGEDISSGLERAIEGSKVAV  112

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE YA+S WCLEELVKIMEC +   Q V+P+FY VDPS VRKQK ++ EAF  HEK 
Sbjct  113  IVFSERYAESGWCLEELVKIMECRRTLRQMVLPVFYNVDPSCVRKQKGEFEEAFVKHEKG  172

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
              K+ +KV++WR  L + +N++G  L    NG
Sbjct  173  --KDIDKVRRWRMALTEAANVAGLGLTQNANG  202



>gb|KCW59177.1| hypothetical protein EUGRSUZ_H01824 [Eucalyptus grandis]
Length=163

 Score =   176 bits (445),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 105/148 (71%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRG +VR NF+ HLYTA+ Q G++T+ D E+L +G+ ISPAL KAIEES + +
Sbjct  15   NYDVFLSFRGINVRNNFLSHLYTALDQNGLFTYLDSEELRKGEQISPALMKAIEESQVVI  74

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE YA S WCLEE+ KIMEC   K   V+P+FY V+P  VR  +E YG A   HE  
Sbjct  75   IVFSEDYASSPWCLEEVAKIMECKIQKDLIVLPVFYKVEPREVRGGRESYGRAMVKHESK  134

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F KE EKV++W++ L D  +LS W LN+
Sbjct  135  FGKESEKVRRWKEALFDAGSLSRWHLND  162



>emb|CAD36200.1| TIR-NBS disease resistance protein [Populus trichocarpa]
Length=567

 Score =   186 bits (472),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 115/153 (75%), Gaps = 3/153 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRGED RK F DHLYTA+ Q GI+TF+DD++L RG+ IS  L +A++ES +++
Sbjct  14   AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLRAVQESKISI  73

Query  702  VVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            VVFS+ YA S WCL ELV+I++C   K GQ V+PIFY +DPS VRKQ   + EAF  HE+
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSYVRKQNGSFAEAFVKHEE  133

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             FE+  + VK+WRK LE+  NLSGW+LN+  NG
Sbjct  134  CFEE--KLVKEWRKALEEAGNLSGWNLNDMANG  164



>ref|XP_011011962.1| PREDICTED: TMV resistance protein N-like, partial [Populus euphratica]
Length=295

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 108/147 (73%), Gaps = 6/147 (4%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D R NF  HLY+ + QRGI  + DD +LERGK+I PAL KAIEES+ +V+
Sbjct  10   YDVFLSFRGKDTRNNFTSHLYSNLAQRGIDVYMDDRELERGKTIEPALWKAIEESTFSVI  69

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FS HYA S WCL+ELVKI++CMK  G TV+P+FY VDPS      E Y +AF  HE++F
Sbjct  70   IFSRHYASSPWCLDELVKIVQCMKEMGHTVLPVFYDVDPS------ETYEKAFVDHEQNF  123

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++   KV+ W+  L  V++LSGWDL N
Sbjct  124  KENLAKVRNWKDCLFTVASLSGWDLRN  150



>emb|CBI23894.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 111/147 (76%), Gaps = 5/147 (3%)
 Frame = -2

Query  885  STYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMA  706
            STYDVFLSFRGED R NF DHLY A+  RGI TF+DD KL RG++I+P L KAIEES  +
Sbjct  22   STYDVFLSFRGEDTRYNFTDHLYKALVNRGIRTFRDD-KLRRGEAIAPELLKAIEESRSS  80

Query  705  VVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            V+VFSE+YA S WCL+ELVKIMEC K  G  V PIFY VDPS VR Q+  +G+AF G+E+
Sbjct  81   VIVFSENYAGSRWCLDELVKIMECHKDLGH-VFPIFYHVDPSHVRNQEGSFGKAFAGYEE  139

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDL  445
            +++   +K+ +WR  L + +NLSGW +
Sbjct  140  NWK---DKIPRWRTALTEAANLSGWHI  163



>ref|XP_003634573.1| PREDICTED: probable disease resistance protein At1g52660 [Vitis 
vinifera]
Length=632

 Score =   187 bits (474),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGED R  F  HLY A+ +RG+ TF DD K+ RG+SISP L KAIE S  ++
Sbjct  388  SYDVFLSFRGEDTRFTFAAHLYVALHRRGVNTFFDDHKIRRGESISPTLVKAIEGSRSSI  447

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++ S++YA SSWCLEELVKI+EC K  GQ V+PIFY VDPS VR+ K  +GEA   HE +
Sbjct  448  ILLSQNYAGSSWCLEELVKILECRKTMGQLVLPIFYNVDPSDVRRHKGSFGEALVKHENT  507

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             + + +KVK WR+ L +V+NL+GW+  N
Sbjct  508  LKHDIDKVKNWREALSEVANLAGWNSQN  535



>ref|XP_010665371.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1136

 Score =   190 bits (483),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGED R NF  HLY  ++ +GI TF DD+KLERG+ ISPAL  AIE S  ++
Sbjct  14   SYDVFLSFRGEDTRNNFTAHLYQELRTKGINTFIDDDKLERGRLISPALVTAIENSMFSI  73

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +V SE+YA S WCLEEL KI+ECMK +GQ V+PIFY VDPS V+KQ+ K+G A   HEK+
Sbjct  74   IVLSENYASSKWCLEELAKILECMKTRGQRVLPIFYNVDPSDVKKQRGKFGAALAEHEKN  133

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
              +  E+V+ W+  L  V+NLSGW+  N
Sbjct  134  LTENMERVQIWKDALTQVANLSGWESRN  161



>ref|XP_010650303.1| PREDICTED: toll/interleukin-1 receptor-like protein [Vitis vinifera]
Length=169

 Score =   176 bits (445),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 106/143 (74%), Gaps = 1/143 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             +DVFLSFRGED R NF DHLY  + +RGI+TF+DD  LERG+ I P L KAIEES  ++
Sbjct  21   NFDVFLSFRGEDTRFNFTDHLYENLIRRGIHTFRDD-SLERGEEIEPELLKAIEESRFSL  79

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE+YA S WCL+ELVKIM+C K   QTVVPIFY VDPS VR Q  K+GEAF  +++ 
Sbjct  80   IVFSENYAGSRWCLDELVKIMKCRKEMKQTVVPIFYHVDPSHVRNQTGKFGEAFSNYKED  139

Query  522  FEKEGEKVKKWRKVLEDVSNLSG  454
             E+  EKV+ WR  L + +N+SG
Sbjct  140  SEEMKEKVRSWRSALTEATNISG  162



>ref|XP_010058913.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=158

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 104/148 (70%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRG D+R NF+ HLY A+ + G+YTF+D E+L++G  ISP L  AIEES +A+
Sbjct  10   IYDVFLSFRGVDLRNNFIGHLYQALHRDGVYTFRDSEELKKGDQISPVLMNAIEESCIAI  69

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE YA S WCLEEL KI+EC + K   V+P+FY VDP  VR  ++ Y  +   HE  
Sbjct  70   IVFSEDYASSRWCLEELAKIIECKEQKNLIVLPVFYKVDPREVRGGRKSYQRSLARHEFK  129

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
              K+ EKVK+++K L D  NLSGW LN+
Sbjct  130  LGKDSEKVKRYKKALSDAGNLSGWHLND  157



>gb|ABF81464.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=1617

 Score =   191 bits (484),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 87/154 (56%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = -2

Query  888  GSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSM  709
            G  YDVFLSFRGED RKNF DHLYTA+    I+ F+DD++L RG+ IS  L KAI+ES +
Sbjct  253  GWGYDVFLSFRGEDTRKNFTDHLYTALHHARIHAFRDDDELRRGEEISLQLLKAIQESKI  312

Query  708  AVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHE  529
            ++VVFS+ YA S+WCL EL KI++C    GQ V+P+FY +DPS +RKQ   + EAF+ HE
Sbjct  313  SIVVFSKGYASSTWCLAELEKILDCRHTTGQIVLPVFYDIDPSDIRKQTGSFAEAFDRHE  372

Query  528  KSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            + F++E EKV+KWRK L + +NLSG DL +  NG
Sbjct  373  ERFKEEMEKVQKWRKALMEAANLSGLDLRSFANG  406



>gb|KCW74568.1| hypothetical protein EUGRSUZ_E03285, partial [Eucalyptus grandis]
Length=523

 Score =   185 bits (469),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 119/182 (65%), Gaps = 11/182 (6%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             + VFLSFRG DVR+ F+ HLY A+ Q+GIYTF D E+L +G+ ISPAL +AIEES +A+
Sbjct  4    NFHVFLSFRGTDVRQGFLSHLYAALDQKGIYTFVDSEELRKGEEISPALMRAIEESHVAI  63

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE+YA S WCLEEL+KIMEC +  G  V P+FY V+P  VR+ +E Y  A + HE  
Sbjct  64   IVFSENYASSRWCLEELLKIMECKEQNGLKVFPVFYKVEPREVREGRESYKRAMDNHESK  123

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*I-----------FNSNPLHPTRGDHGF  376
            F K+ EKVK+W+K L +  +LSGW+LN+ +   +            N  PLH  +   G 
Sbjct  124  FGKDSEKVKRWKKALSEAGSLSGWELNDRDEADLIQCIVKELSIRINQTPLHVAKYPVGI  183

Query  375  GS  370
             S
Sbjct  184  DS  185



>gb|KDO36672.1| hypothetical protein CISIN_1g035646mg, partial [Citrus sinensis]
Length=584

 Score =   186 bits (472),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED RKNF DHLY+A+ ++GI  F+DD++LERG+SISP L KAIEES +++V
Sbjct  19   YDVFLSFRGEDTRKNFTDHLYSALDEKGIIVFRDDKELERGESISPGLFKAIEESKISIV  78

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVV-PIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VFS  YA S+WCL+ELV I+EC     Q +V PIFY V+P+ VRKQ E + EAF  +E+ 
Sbjct  79   VFSRSYAFSTWCLDELVHILECKNTNNQQMVYPIFYDVEPAVVRKQTETFQEAFAQYEEV  138

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F +  EKV+KWR  L +V+N+SGW+L +
Sbjct  139  FSENIEKVQKWRDALREVANISGWELKD  166



>ref|XP_010059269.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=535

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 119/182 (65%), Gaps = 11/182 (6%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             + VFLSFRG DVR+ F+ HLY A+ Q+GIYTF D E+L +G+ ISPAL +AIEES +A+
Sbjct  4    NFHVFLSFRGTDVRQGFLSHLYAALDQKGIYTFVDSEELRKGEEISPALMRAIEESHVAI  63

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE+YA S WCLEEL+KIMEC +  G  V P+FY V+P  VR+ +E Y  A + HE  
Sbjct  64   IVFSENYASSRWCLEELLKIMECKEQNGLKVFPVFYKVEPREVREGRESYKRAMDNHESK  123

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*I-----------FNSNPLHPTRGDHGF  376
            F K+ EKVK+W+K L +  +LSGW+LN+ +   +            N  PLH  +   G 
Sbjct  124  FGKDSEKVKRWKKALSEAGSLSGWELNDRDEADLIQCIVKELSIRINQTPLHVAKYPVGI  183

Query  375  GS  370
             S
Sbjct  184  DS  185



>ref|XP_010026312.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=875

 Score =   188 bits (477),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 123/196 (63%), Gaps = 13/196 (7%)
 Frame = -2

Query  897  SSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEE  718
            S+    Y VFLSFRG DVR NF+ HLY A+ Q+GIYT+ D E+L +G+ I+PAL KAIE+
Sbjct  29   SNLKGNYHVFLSFRGTDVRNNFLGHLYAALDQKGIYTYIDSEELRKGEQITPALIKAIED  88

Query  717  SSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFE  538
            S +A+++FSE YA S WCLEE+ KIMEC + +G TV P+FY VDP  VR  + +Y EA +
Sbjct  89   SHIAIIIFSEDYASSPWCLEEVEKIMECKEQRGLTVFPVFYKVDPREVRTPRNRYREAMK  148

Query  537  GHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*IFN-----------SNPLHPTR  391
             HE  F +  EKVK+W+K L D   LSGWDL + +   + N             PLH  +
Sbjct  149  KHESKFGRYSEKVKRWKKALLDAGRLSGWDLKDKDEADLINRIVQEISMQLDRKPLHVAK  208

Query  390  GDHGFGSERSVPVLET  343
              H  G  R V  LE+
Sbjct  209  --HPVGIHRQVVKLES  222



>ref|XP_010646047.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=205

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 113/162 (70%), Gaps = 4/162 (2%)
 Frame = -2

Query  918  MEQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPA  739
            M   S  S+ G TYDVFLSFRGED R NF  HLYT + ++GI TF+DD KL RG+ I+P 
Sbjct  8    MASDSSPSNLGWTYDVFLSFRGEDTRNNFTSHLYTDLVRKGIRTFRDD-KLPRGEKIAPE  66

Query  738  LEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKE  559
            L  AIE+S  +++VFS+ YADS WCL+EL KIMEC +   Q V+PIFY VDPS VRKQ  
Sbjct  67   LLNAIEKSRSSIIVFSKTYADSRWCLDELAKIMECRQEYRQKVLPIFYHVDPSDVRKQTG  126

Query  558  KYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTE  433
            ++GEAF  HE++++    KV+ WR+ L +  N+SGW +   E
Sbjct  127  RFGEAFTRHEENWKN---KVQSWREALTEAGNISGWHVKEGE  165



>ref|XP_002325273.2| hypothetical protein POPTR_0019s01200g [Populus trichocarpa]
 gb|EEE99654.2| hypothetical protein POPTR_0019s01200g [Populus trichocarpa]
Length=766

 Score =   187 bits (475),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRGED RK F DHLYTA+ Q GI  F+DD+ L RG+ IS  L +AI+ES +++
Sbjct  51   AYDVFLSFRGEDTRKTFTDHLYTALVQAGIRAFRDDDDLPRGEEISDHLLRAIQESKISI  110

Query  702  VVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            VVFS+ YA S WCL ELV+I+EC K K GQ V+PIFY +DPS VRKQ   + +AF+ HEK
Sbjct  111  VVFSKGYASSRWCLNELVEILECKKRKTGQIVLPIFYDIDPSDVRKQTGSFAKAFDKHEK  170

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             FE+  + VK+WRK LED +NLSG  LNN  NG
Sbjct  171  RFEE--KLVKEWRKALEDAANLSGRSLNNMANG  201



>ref|XP_010059096.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=158

 Score =   175 bits (443),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 104/148 (70%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             Y+VFLSFRG D+R  F+ HLY A+   GIYTF D E+L +G    P L +AIEES +A+
Sbjct  10   NYEVFLSFRGTDLRNTFLGHLYKALYHNGIYTFIDSEELRKGDQTLPTLMQAIEESCIAI  69

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFS+ YA S WCLEE++KIMEC K K  TV+P+FY VDP  VR+  + YG+A   HE +
Sbjct  70   IVFSKDYASSQWCLEEVMKIMECKKQKDLTVLPVFYKVDPREVRQGSKSYGKALAKHEST  129

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F K+ EKVK+W+K L D  +LSGW  N+
Sbjct  130  FGKDSEKVKQWKKALFDAGSLSGWHFND  157



>emb|CBI39196.3| unnamed protein product [Vitis vinifera]
Length=696

 Score =   187 bits (474),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGED R  F  HLY A+ +RG+ TF DD K+ RG+SISP L KAIE S  ++
Sbjct  452  SYDVFLSFRGEDTRFTFAAHLYVALHRRGVNTFFDDHKIRRGESISPTLVKAIEGSRSSI  511

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            ++ S++YA SSWCLEELVKI+EC K  GQ V+PIFY VDPS VR+ K  +GEA   HE +
Sbjct  512  ILLSQNYAGSSWCLEELVKILECRKTMGQLVLPIFYNVDPSDVRRHKGSFGEALVKHENT  571

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             + + +KVK WR+ L +V+NL+GW+  N
Sbjct  572  LKHDIDKVKNWREALSEVANLAGWNSQN  599



>ref|XP_010057039.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
 gb|KCW73995.1| hypothetical protein EUGRSUZ_E02612 [Eucalyptus grandis]
Length=1145

 Score =   189 bits (481),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 123/187 (66%), Gaps = 13/187 (7%)
 Frame = -2

Query  885  STYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMA  706
            S YDVFLSFRG DVRK+F+ HLY A+ Q GIYTF+D E+L +G  IS  L KAIEES +A
Sbjct  9    SIYDVFLSFRGSDVRKSFLSHLYQALDQNGIYTFQDSEELRKGDQISATLMKAIEESCIA  68

Query  705  VVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            +++FSE YA S WCLEE+ KIMEC + K  TV+P+FY VDP  VR+ +E Y +A + HE 
Sbjct  69   IIIFSEDYASSWWCLEEMAKIMECKEQKELTVLPVFYKVDPREVREGRESYRKALDKHED  128

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*I-----------FNSNPLHPTRGDHG  379
             F+K+ EKVKKW+K L D  NLSGW LN+ +   +            N  PL+ T+  H 
Sbjct  129  KFKKDLEKVKKWKKTLFDAGNLSGWHLNDEDESKLILQIVKEISTHLNLTPLYVTK--HL  186

Query  378  FGSERSV  358
             G E  V
Sbjct  187  VGIESPV  193



>ref|XP_008349077.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=171

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 102/147 (69%), Gaps = 0/147 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED R NF DHLY A+ + GI TF D  +L  G+ ISP L KAI++S ++V
Sbjct  18   TYDVFLSFRGEDTRTNFTDHLYHALVRHGINTFIDHRELPTGEEISPTLLKAIDKSRISV  77

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFS++YA S WCL+ELV I+EC K KG    PIFY VDPS VR Q   YG AF  H + 
Sbjct  78   IVFSKNYASSRWCLDELVHILECRKSKGXMTRPIFYKVDPSDVRHQTNSYGAAFADHTRK  137

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLN  442
            ++ + EKV++WR  L + +NL G  LN
Sbjct  138  YKNDLEKVQRWRTALTEAANLKGATLN  164



>ref|XP_006388454.1| hypothetical protein POPTR_0182s00200g [Populus trichocarpa]
 gb|ERP47368.1| hypothetical protein POPTR_0182s00200g [Populus trichocarpa]
Length=721

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 109/153 (71%), Gaps = 2/153 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED RKNF DHLY A++  GI TF+DD  L RG+ IS  L +AI++S ++V+
Sbjct  21   YDVFLSFRGEDARKNFTDHLYFALKDAGINTFRDDNGLRRGEDISTELLQAIQKSRISVI  80

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS +YA+S WCLEELVKIMEC +   Q V PIFY VDPS VRKQ   + EAF GHE+ F
Sbjct  81   VFSRNYANSRWCLEELVKIMECRRSFRQLVFPIFYDVDPSDVRKQTGSFAEAFAGHEERF  140

Query  519  --EKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
              + +  KV  WR  L + +NLSGWDL N  +G
Sbjct  141  VLQTDKGKVATWRMALTEAANLSGWDLRNVADG  173



>ref|XP_010059181.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=152

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 107/149 (72%), Gaps = 0/149 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             + +FL FRG DVR+ F+ HLY A+ Q+GIYTF D E+L +G+ ISPAL +AIEES +A+
Sbjct  4    NFHLFLIFRGIDVRQGFLSHLYAALDQKGIYTFVDSEELRKGEEISPALMRAIEESHVAI  63

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE YA S WCLEEL+KIMEC +  G  V P+FY V+P  VR+ ++ Y  A + HE  
Sbjct  64   IVFSEDYASSRWCLEELLKIMECKEKDGLKVFPVFYKVEPREVREGRDNYKRAMDNHESK  123

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNT  436
              K+ EKVK+W+K L +  +LSGW+LN+ 
Sbjct  124  LGKDSEKVKRWKKALSEAGSLSGWELNDM  152



>ref|XP_003635135.2| PREDICTED: uncharacterized protein LOC100853815 [Vitis vinifera]
Length=2622

 Score =   191 bits (484),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 91/147 (62%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED R NF  HLY A+ Q+GIYTF DD+KLERG+ IS AL +AIE S  +++
Sbjct  25   YDVFLSFRGEDTRNNFTAHLYHALCQKGIYTFIDDDKLERGEVISSALVEAIENSMFSII  84

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            V SE+YA S WCLEELVKI+EC + KGQTV+PIFY VDP+ VRKQ+ K+GEA   H+K+ 
Sbjct  85   VLSENYASSRWCLEELVKILECKENKGQTVLPIFYHVDPADVRKQRGKFGEALAKHKKNM  144

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            E   E+VK W+  L  V+ LSGWD  N
Sbjct  145  ENM-ERVKIWKDALTKVAYLSGWDSQN  170


 Score =   187 bits (474),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 90/148 (61%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = -2

Query  882   TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             +Y+VFLSFRGED R  F  HLY A+++RGI TF DD  L+RG+ ISPAL +AIE S  ++
Sbjct  1322  SYEVFLSFRGEDTRHGFTAHLYDALRRRGINTFIDDADLKRGRVISPALVQAIENSMFSI  1381

Query  702   VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
             VV SE+YA S WCLEELVKI+ECM     TV PIFY VDPS VRKQK  +GEAF  HEK+
Sbjct  1382  VVLSENYASSRWCLEELVKILECMNAGSLTVFPIFYKVDPSDVRKQKGSFGEAFVEHEKN  1441

Query  522   FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
                  E+VK WR+ L  V+NLSGWD  N
Sbjct  1442  ---SNERVKTWREALTQVANLSGWDSRN  1466



>ref|XP_006371047.1| hypothetical protein POPTR_0019s02950g [Populus trichocarpa]
 gb|ERP48844.1| hypothetical protein POPTR_0019s02950g [Populus trichocarpa]
Length=678

 Score =   186 bits (472),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 115/153 (75%), Gaps = 3/153 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRGED RK F DHLYTA+ Q GI+TF+DD++L RG+ IS  L +AI+ES +++
Sbjct  42   AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLRAIQESKISI  101

Query  702  VVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            VVFS+ YA S WCL ELV+I++C   K GQ V+PIFY +DPS VRKQ   + EAF  HE+
Sbjct  102  VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSYVRKQDGSFAEAFVKHEE  161

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             FE+  + VK+WRK LE+  NLSGW+LN+  NG
Sbjct  162  RFEE--KLVKEWRKALEEAGNLSGWNLNDMANG  192



>ref|XP_010070567.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=182

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            +DVFLSFRG+DVR+ F+  L+  +  RGI  + D E L  G  ISPAL KAIEES +AV+
Sbjct  28   FDVFLSFRGDDVRRGFLADLHRCLLHRGINAYIDSEDLRPGDQISPALTKAIEESRIAVL  87

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFSE+YA S WCL+ELVK+MEC ++KGQ V+P+FYGV+P  VR  +E +G+A   HE+  
Sbjct  88   VFSENYASSRWCLDELVKVMECKELKGQLVLPVFYGVEPREVRGHRESFGKALARHEEKL  147

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNNTE  433
             K+ E+V KWR+ L + +NLSGW  ++ E
Sbjct  148  GKDSERVGKWRQALIEAANLSGWHYDHGE  176



>ref|XP_006370866.1| hypothetical protein POPTR_0019s01210g [Populus trichocarpa]
 gb|ABB82032.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
 gb|ERP48663.1| hypothetical protein POPTR_0019s01210g [Populus trichocarpa]
Length=509

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 114/153 (75%), Gaps = 3/153 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRGED RK F DHLYTA+ Q GI+TF+DD++L RG+ IS  L +AI+ES +++
Sbjct  14   AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLRAIQESKISI  73

Query  702  VVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            VVFS+ YA S WCL ELV+I++C   K GQ V+PIFY +DPS VRKQ   + E F+ HE+
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSDVRKQTGSFAEPFDKHEE  133

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             FE+  + VK+WRK LE+   LSGW+LN+  NG
Sbjct  134  RFEE--KLVKEWRKALEEAGKLSGWNLNDMANG  164



>ref|XP_006389211.1| hypothetical protein POPTR_0035s00320g [Populus trichocarpa]
 gb|ERP48125.1| hypothetical protein POPTR_0035s00320g [Populus trichocarpa]
Length=163

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 106/147 (72%), Gaps = 6/147 (4%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFR +D R NF  HLY+ ++QRG+  + DD +LERGK+I PAL KAIEES  +V+
Sbjct  22   YDVFLSFRDKDTRNNFTSHLYSNLKQRGVDVYMDDRELERGKTIEPALWKAIEESRFSVI  81

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FS  YA S WCL+ELVKI +CMK  G TV+P+FY VDPS      E Y +AF  HE++F
Sbjct  82   IFSRDYASSPWCLDELVKIAQCMKEMGHTVLPVFYDVDPS------ETYEKAFFEHEQNF  135

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++  EKV+ W+  L  V+NLSGWD+ N
Sbjct  136  KENLEKVQIWKDCLSTVTNLSGWDVRN  162



>ref|XP_010058773.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=158

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 102/145 (70%), Gaps = 0/145 (0%)
 Frame = -2

Query  885  STYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMA  706
            S Y+VFLSFRG D+R  F+ HLY A+   GIYTF D E+L +G    PAL KAIEES +A
Sbjct  9    SNYEVFLSFRGTDLRNTFLGHLYKALYHNGIYTFVDSEELTKGDQTLPALMKAIEESCVA  68

Query  705  VVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            ++VFS+ YA S WCLEE+ KIMEC K K  TV+P+FY VDP  VR+  + YG+A   HE 
Sbjct  69   IIVFSKDYASSQWCLEEVKKIMECKKQKDLTVLPVFYKVDPREVRRGNKSYGKALAKHES  128

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGW  451
             F K+ EKVK+W+K L D  +LSGW
Sbjct  129  KFGKDSEKVKRWKKALFDAGSLSGW  153



>ref|XP_010657780.1| PREDICTED: TMV resistance protein N-like isoform X3 [Vitis vinifera]
Length=1152

 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 108/147 (73%), Gaps = 1/147 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            Y+VFLSFRGED RKNF DHL+ A+++ GI+ F DD+ L RG+ IS AL +AIEES  +++
Sbjct  21   YEVFLSFRGEDTRKNFTDHLHEALRRNGIHAFIDDQ-LRRGEQISSALLRAIEESRFSII  79

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FSEHYA SSWCL+EL KI+EC+KV G T  P+FY VDPS VRKQ   YG AF  HE+ +
Sbjct  80   IFSEHYASSSWCLDELTKILECVKVGGHTAFPVFYNVDPSHVRKQTGSYGVAFTKHEQVY  139

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
                EKV KWR+ L  VS LSGWD  N
Sbjct  140  RDNMEKVSKWREALTAVSGLSGWDSRN  166



>ref|XP_010056575.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=540

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 108/150 (72%), Gaps = 0/150 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRG D+R NF+ HLY A+ + G+YTF+D E+L++G  ISP L KAIEES +A+
Sbjct  10   IYDVFLSFRGADLRNNFIGHLYQALHRDGVYTFRDSEELKKGDQISPVLMKAIEESCIAI  69

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE YA S WCLEEL KI+EC + K   V+P+FY VDP  VR+ ++ Y  +   HE  
Sbjct  70   IVFSEDYASSRWCLEELAKIIECKEQKNLIVLPVFYKVDPREVREGRKSYQRSLAKHEFK  129

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTE  433
            F K+ EKVK+W+K L D  NLSGW LN+ +
Sbjct  130  FGKDSEKVKRWKKALSDAGNLSGWHLNDGD  159



>ref|XP_007216844.1| hypothetical protein PRUPE_ppa022061mg, partial [Prunus persica]
 gb|EMJ18043.1| hypothetical protein PRUPE_ppa022061mg, partial [Prunus persica]
Length=163

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D  K F DHLYTA++  GI TFKDD +L++GK ISP L  AIEES  A++
Sbjct  18   YDVFLSFRGDDTWKRFTDHLYTALESHGIITFKDDPELQKGKPISPELFSAIEESKFALI  77

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            + SE+YA S+WCL+EL++I+E M+ + +TV+PIFY VDPS VRKQ   + +AF  HE++F
Sbjct  78   LLSENYASSTWCLDELLQILEFMEAR-ETVLPIFYNVDPSDVRKQTGSFTQAFIKHEENF  136

Query  519  EKEGEKVKKWRKVLEDVSNLSGWD  448
            + + +KV++WR  L  V+N SGWD
Sbjct  137  KDDKKKVQRWRYGLTKVANFSGWD  160



>ref|XP_010665222.1| PREDICTED: toll/interleukin-1 receptor-like protein [Vitis vinifera]
Length=318

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 106/146 (73%), Gaps = 1/146 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFR ED R  F DHLY A++ R I TF+DD KL+RG+ I+P L K IEES +++
Sbjct  19   NYDVFLSFRAEDTRYKFTDHLYAALRNRSIRTFRDD-KLKRGEEIAPELLKVIEESRLSI  77

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFSE+YA S WCL+ELVKIMEC +   Q VVPIFY VDPS +RKQK  +G+AF  +E+ 
Sbjct  78   VVFSENYASSRWCLDELVKIMECRQKIRQIVVPIFYHVDPSDLRKQKGSFGKAFASYERH  137

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDL  445
                 EK+++WR  L + SNLSGW L
Sbjct  138  GRDSKEKIQRWRAALTEASNLSGWRL  163



>ref|XP_006356453.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1324

 Score =   189 bits (480),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 116/159 (73%), Gaps = 2/159 (1%)
 Frame = -2

Query  897  SSCGSTY--DVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAI  724
            S+C   +  DVFLSFRGED RK FV HLY A++Q+GI+TFKDDE+LERGKSISP L KAI
Sbjct  3    STCTQNWKNDVFLSFRGEDTRKTFVGHLYYALKQKGIHTFKDDERLERGKSISPELVKAI  62

Query  723  EESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEA  544
            EES  A+VVFS++YA S+WCL+EL KIMEC K  GQTV+PIFY VDPS V KQ E + ++
Sbjct  63   EESRFAIVVFSKNYASSTWCLDELGKIMECKKDFGQTVIPIFYDVDPSHVTKQSESFAKS  122

Query  543  FEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            F  HE++ + + EKV  WR        ++G+DL    +G
Sbjct  123  FATHEENLKDDVEKVLCWRDAFRQAGKIAGYDLPKGYDG  161



>ref|XP_006495021.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=499

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = -2

Query  918  MEQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPA  739
            M   SF +     YD FLSFRGED RK F+ +LYTA+  +GIY F+DD++LE+G SISP 
Sbjct  1    MASTSFQNVSHGEYDAFLSFRGEDTRKGFIGYLYTALNNKGIYVFRDDKQLEKGGSISPN  60

Query  738  LEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKE  559
            L KAI+ES ++++V S++YA S+WCL+EL+KI +C K +   + PIFYGV+P+ VRKQ  
Sbjct  61   LLKAIDESRISIIVLSKNYASSTWCLDELLKIAKC-KNREDQIFPIFYGVEPTVVRKQTA  119

Query  558  KYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNT  436
             +GEAF  HE+ F    EKV+KWR  L+ V+N+SGW+L ++
Sbjct  120  SFGEAFAKHEEFFRDNIEKVQKWRHALKVVANISGWELKDS  160



>ref|XP_009354958.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=272

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRG+D R NF  HL++ + Q+GI TF DDE L RG+ ISPAL KAIE S MA+
Sbjct  98   TYDVFLSFRGDDTRFNFTGHLHSYLVQKGIVTFIDDE-LRRGEEISPALVKAIEGSKMAI  156

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE+YA S+WCL+ELVKI+EC ++  Q V PIFY V+PS VRKQ+  +G A   H   
Sbjct  157  IVFSENYASSTWCLDELVKILECRELNQQRVCPIFYKVNPSDVRKQRGNFGRALADHAFK  216

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F+   EKV++WR  L + +NLSGW  ++
Sbjct  217  FKDNMEKVERWRTALTEAANLSGWHFSD  244



>ref|XP_011013492.1| PREDICTED: TMV resistance protein N-like isoform X6 [Populus 
euphratica]
Length=935

 Score =   187 bits (476),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRGED RK F DHLYTA+ Q GI+TF+DD+ L RG+ IS  L +AI ES +++
Sbjct  14   AYDVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDALPRGEEISHHLLRAIRESKISI  73

Query  702  VVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            VVFS+ YA S WCL ELV+I++C   K GQ V+PIFY +DPS VRKQ   + EAF+ HE+
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEE  133

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             FE+  + VK+WRK LED  NLSGW LN+  NG
Sbjct  134  RFEE--KLVKEWRKALEDAGNLSGWSLNDMANG  164



>ref|XP_010645944.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=162

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 103/147 (70%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED R NF  HL   +  +GI TF D+EKLERG+++S AL  AIE S  +++
Sbjct  15   YDVFLSFRGEDTRNNFTAHLCEELHTKGINTFIDEEKLERGQAVSAALVSAIENSMFSII  74

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            V SE+YA S WCLEELVKI++CMK  G  V+PIFY VDPS VR    K+GEA   HE++ 
Sbjct  75   VLSENYASSRWCLEELVKIIQCMKNSGHRVLPIFYNVDPSDVRNHMGKFGEALAKHEENS  134

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            ++  E+V+ W+  L  V+N SGWD  N
Sbjct  135  KEGMERVQIWKDALTQVTNFSGWDSRN  161



>ref|XP_011015315.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1140

 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRG+D RKNF DHLYTA+ Q GI+TF+DD +L RG+ ISP L KAIE S +++
Sbjct  22   NYDVFLSFRGKDTRKNFTDHLYTALIQAGIHTFRDDNELPRGEEISPQLLKAIEGSRISI  81

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFS++YA S WCL+ELVKI+EC +   Q V+PIFY  +PS VRKQ   Y +AF+  E+ 
Sbjct  82   VVFSKNYASSRWCLDELVKIIECKQNIDQVVLPIFYDTEPSDVRKQTGSYAKAFDELEER  141

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            F++E EKV KWR  L    NLSG+ LNN  NG
Sbjct  142  FKEEMEKVNKWRGALAQAGNLSGFGLNNEANG  173



>gb|KCW74399.1| hypothetical protein EUGRSUZ_E03080 [Eucalyptus grandis]
Length=721

 Score =   186 bits (472),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 107/149 (72%), Gaps = 0/149 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            Y VFLSFRG DVR  F+ HLY ++ QRGIYTF D E+L +G+ ISP L +AIE+S +A++
Sbjct  12   YHVFLSFRGTDVRHGFLSHLYASLDQRGIYTFVDREELRKGEEISPTLMRAIEQSRVAII  71

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FSE YA S WCLEEL+KIMEC +  G  V P+FY V+P  VR+ +E Y  A + HE  F
Sbjct  72   IFSEDYASSPWCLEELLKIMECKEQNGLIVFPVFYKVEPREVRRGRESYKRAMDSHESKF  131

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNNTE  433
             K+ EKVK+W++ L D  NLSGWD N+ E
Sbjct  132  GKDSEKVKRWKRALLDAGNLSGWDFNDRE  160



>gb|KCW59442.1| hypothetical protein EUGRSUZ_H02176 [Eucalyptus grandis]
Length=196

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRG DVR  F+ HLYTA+ Q GI ++ D+E L++G+ ISPAL +AIEES +A+
Sbjct  12   SYDVFLSFRGTDVRNYFLGHLYTALDQSGINSYMDNEDLKKGEQISPALMEAIEESQIAI  71

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFS+ YA S WCLEE+ KIMEC + +G  V P+FY V+P  VR Q++ Y EA   HE  
Sbjct  72   VVFSKDYASSPWCLEEVAKIMECKEQRGLMVFPVFYKVEPREVRGQRQGYAEAMAKHEVK  131

Query  522  FEKEGEKVKKWRKVLEDVSNLSGW  451
            F ++ EKVK+W+K L DV ++SGW
Sbjct  132  FGEDSEKVKRWKKALLDVGSMSGW  155



>gb|AAY43787.1| disease resistance protein [(Populus tomentosa x Populus bolleana) 
x Populus tomentosa var. truncata]
Length=428

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 119/174 (68%), Gaps = 17/174 (10%)
 Frame = -2

Query  906  SFVSSCGST------------YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLE  763
            SFVS+   T            YDVFLSFRGED RK F DHLYTA+ Q GI TF+DD++L 
Sbjct  31   SFVSTAAKTEPESSRSRPEGAYDVFLSFRGEDTRKTFTDHLYTALVQAGIRTFRDDDELP  90

Query  762  RGKSISPALEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVD  586
            RG+ IS  L +AIEES +++VVFS+ YA S WCL ELV+I++C   K GQ V+PIF+ +D
Sbjct  91   RGEEISHHLLRAIEESRISIVVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFFDID  150

Query  585  PSTVRKQKEKYGEAFEGHEKSFEKEGEK-VKKWRKVLEDVSNLSGWDLNNTENG  427
            PS VRKQ   + EAF  HE   E+  EK V++WRK L++  NLSGW+LN+  NG
Sbjct  151  PSDVRKQTASFAEAFVKHE---ERSQEKLVQEWRKALKEAGNLSGWNLNDMANG  201



>ref|XP_004301464.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=1124

 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 106/151 (70%), Gaps = 0/151 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED R  F  HLY A++Q G+  F DD +L RG+ I+  L +AI+ S +AV+
Sbjct  22   YDVFLSFRGEDTRNTFTGHLYAALKQAGVNAFIDDNELRRGEDITAELVRAIQGSRIAVI  81

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS+ YADSSWCLEELVKIMEC +   Q V P+F  VDPS VR+Q   + EAF  HE+  
Sbjct  82   VFSKRYADSSWCLEELVKIMECRRTLRQMVFPVFVDVDPSNVRRQIGSFAEAFRKHEQRL  141

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
              E EKV +WR  L + +NLSGWDLNNT NG
Sbjct  142  VLEKEKVLRWRAALTEAANLSGWDLNNTANG  172



>ref|XP_010665364.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665365.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665366.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665367.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665368.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665369.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665370.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1110

 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 106/147 (72%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED R NF  HLY  ++ +GI TF DD+KLERG+ ISPAL  AIE S  +++
Sbjct  16   YDVFLSFRGEDTRNNFTAHLYQELRTKGINTFIDDDKLERGRVISPALVTAIENSMFSII  75

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            V SE+YA S WCLEEL KI+ECMK +GQ V+PIFY VDPS VR  + K+G A   HEK+ 
Sbjct  76   VLSENYASSKWCLEELAKILECMKTRGQRVLPIFYNVDPSDVRNHRGKFGAALAEHEKNL  135

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             +  E+V+ W+  L  V+NLSGW+  N
Sbjct  136  TENMERVQIWKDALTQVANLSGWESRN  162



>ref|XP_011013491.1| PREDICTED: TMV resistance protein N-like isoform X5 [Populus 
euphratica]
Length=948

 Score =   187 bits (476),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRGED RK F DHLYTA+ Q GI+TF+DD+ L RG+ IS  L +AI ES +++
Sbjct  14   AYDVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDALPRGEEISHHLLRAIRESKISI  73

Query  702  VVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            VVFS+ YA S WCL ELV+I++C   K GQ V+PIFY +DPS VRKQ   + EAF+ HE+
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEE  133

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             FE+  + VK+WRK LED  NLSGW LN+  NG
Sbjct  134  RFEE--KLVKEWRKALEDAGNLSGWSLNDMANG  164



>gb|KCW88424.1| hypothetical protein EUGRSUZ_A00810 [Eucalyptus grandis]
Length=636

 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = -2

Query  897  SSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEE  718
            S   + YDVFLSFRG DVRK+F+ H YTA+ Q+GIY++ D E+L +G  I PAL KAIEE
Sbjct  5    SDLKANYDVFLSFRGTDVRKSFLSHFYTALAQKGIYSYVDSEELRKGDCIKPALMKAIEE  64

Query  717  SSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFE  538
            S +A+++FSE YA S WCLEE+ KIMEC + +G TV P+FY VDP  VR  ++ Y +A  
Sbjct  65   SCIAIIIFSEDYASSPWCLEEVEKIMECKEQRGLTVFPVFYKVDPREVRTPRKSYRKAMV  124

Query  537  GHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTE  433
             HE+ F ++ EKVK+W+K L D  +LSGWDL + +
Sbjct  125  KHERKFGRDSEKVKRWKKALLDAGSLSGWDLKDNK  159



>gb|KDP34368.1| hypothetical protein JCGZ_11251 [Jatropha curcas]
Length=912

 Score =   187 bits (475),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = -2

Query  876  DVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVVV  697
            DVFLSFRGED RK+F DH+YTA+ + GI TF+DD++L RG+ IS AL KAI++S ++++V
Sbjct  17   DVFLSFRGEDTRKSFTDHVYTALVRSGIRTFRDDDELRRGEDISSALIKAIQQSRISLIV  76

Query  696  FSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSFE  517
            FS+ YA S WCL+E+ +I+ C    GQ V+PIFY VDPS VR+Q   + +AF+ HEK F 
Sbjct  77   FSKRYASSRWCLDEVTEIINCKNTIGQIVIPIFYDVDPSDVRRQTGPFQQAFDRHEKRFR  136

Query  516  KEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            +E EKVKKWR  LED   LSG+ L N ENG
Sbjct  137  EEMEKVKKWRVALEDAGKLSGFALQNMENG  166



>emb|CBI17021.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 105/146 (72%), Gaps = 1/146 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             +DVFLSFRGED R  F DHLY A+  +GI TF+DD KL+RG+ I+P L K IEES +++
Sbjct  16   NHDVFLSFRGEDTRYKFTDHLYAALVNKGIRTFRDD-KLKRGEEIAPLLLKVIEESRLSI  74

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFSE+YA S WCL+ELVKIMEC +   Q +VPIFY VDPS +R QK  + ++F  HE+ 
Sbjct  75   VVFSENYASSRWCLDELVKIMECRQKIRQILVPIFYHVDPSDLRTQKGSFEKSFASHERH  134

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDL  445
                 EK+++WR  L + SNLSGW L
Sbjct  135  GRDSKEKIQRWRAALTEASNLSGWHL  160



>ref|XP_010657779.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
Length=1268

 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 108/147 (73%), Gaps = 1/147 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            Y+VFLSFRGED RKNF DHL+ A+++ GI+ F DD+ L RG+ IS AL +AIEES  +++
Sbjct  21   YEVFLSFRGEDTRKNFTDHLHEALRRNGIHAFIDDQ-LRRGEQISSALLRAIEESRFSII  79

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FSEHYA SSWCL+EL KI+EC+KV G T  P+FY VDPS VRKQ   YG AF  HE+ +
Sbjct  80   IFSEHYASSSWCLDELTKILECVKVGGHTAFPVFYNVDPSHVRKQTGSYGVAFTKHEQVY  139

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
                EKV KWR+ L  VS LSGWD  N
Sbjct  140  RDNMEKVSKWREALTAVSGLSGWDSRN  166



>ref|XP_010657777.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
 ref|XP_010657778.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
Length=1269

 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 108/147 (73%), Gaps = 1/147 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            Y+VFLSFRGED RKNF DHL+ A+++ GI+ F DD+ L RG+ IS AL +AIEES  +++
Sbjct  21   YEVFLSFRGEDTRKNFTDHLHEALRRNGIHAFIDDQ-LRRGEQISSALLRAIEESRFSII  79

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FSEHYA SSWCL+EL KI+EC+KV G T  P+FY VDPS VRKQ   YG AF  HE+ +
Sbjct  80   IFSEHYASSSWCLDELTKILECVKVGGHTAFPVFYNVDPSHVRKQTGSYGVAFTKHEQVY  139

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
                EKV KWR+ L  VS LSGWD  N
Sbjct  140  RDNMEKVSKWREALTAVSGLSGWDSRN  166



>ref|XP_009366896.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=1645

 Score =   189 bits (480),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLSFRGED R+NF DHLY A+ ++GI TF+D E+LERGK+ISP + K IEES   +
Sbjct  20   TYDVFLSFRGEDTRRNFTDHLYAALNRKGILTFRDGEELERGKAISPTVLKGIEESRFVL  79

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            V+ S +YA+S+WCL++L K +E MKV GQT++P+FY V PS VRKQ   +G AF  HE++
Sbjct  80   VILSRNYANSAWCLDQLAKAVERMKVMGQTILPVFYDVHPSEVRKQTGYFGTAFSKHEEA  139

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F++  EK+++WR  L  V+NLSGW L +
Sbjct  140  FKENIEKLQRWRTALLQVANLSGWHLQD  167



>gb|KCW73986.1| hypothetical protein EUGRSUZ_E02599, partial [Eucalyptus grandis]
Length=888

 Score =   187 bits (474),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG D+R NF+ HLY A+   G+YTF+D E+L++G  ISP L KAIEES +A++
Sbjct  11   YDVFLSFRGADLRNNFIGHLYQALHHNGVYTFRDSEELKKGDQISPVLMKAIEESCIAII  70

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFSE YA S WCLEEL KI+EC + K   V+P+FY VDPS VR+ ++ Y  +   HE  F
Sbjct  71   VFSEDYASSRWCLEELAKIIECKEQKNLIVLPVFYKVDPSEVREGRKSYQRSLAKHEFKF  130

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             K+ EKVK+W+K L D  NLSGW LN+
Sbjct  131  RKDSEKVKRWKKALFDAGNLSGWHLND  157



>ref|XP_010657833.1| PREDICTED: TMV resistance protein N-like isoform X3 [Vitis vinifera]
Length=1075

 Score =   188 bits (477),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 115/147 (78%), Gaps = 4/147 (3%)
 Frame = -2

Query  885  STYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMA  706
            STYDVFLSFRGED R NF DHLY+A+ +RGI+TF+DD KL RG++I+P L KAIEES  +
Sbjct  22   STYDVFLSFRGEDTRYNFTDHLYSALGRRGIHTFRDD-KLRRGEAIAPELLKAIEESRSS  80

Query  705  VVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            V+VFSE+YA S WCL+ELVKIMEC K     V PIFY VDPS VRKQ+  +GEAF G+E+
Sbjct  81   VIVFSENYAHSRWCLDELVKIMECQKDPAHVVFPIFYHVDPSHVRKQEGSFGEAFAGYEE  140

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDL  445
            +++   +K+ +WR+ L + +NLSGW +
Sbjct  141  NWK---DKIPRWRRALTEAANLSGWHI  164



>emb|CBI39287.3| unnamed protein product [Vitis vinifera]
Length=1166

 Score =   188 bits (478),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 85/148 (57%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +YDVFLSFRGED R NF  HLY  ++ +GI TF DD+KLERG+ ISPAL  AIE S  ++
Sbjct  70   SYDVFLSFRGEDTRNNFTAHLYQELRTKGINTFIDDDKLERGRVISPALVTAIENSMFSI  129

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +V SE+YA S WCLEEL KI+ECMK +GQ V+PIFY VDPS VR  + K+G A   HEK+
Sbjct  130  IVLSENYASSKWCLEELAKILECMKTRGQRVLPIFYNVDPSDVRNHRGKFGAALAEHEKN  189

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
              +  E+V+ W+  L  V+NLSGW+  N
Sbjct  190  LTENMERVQIWKDALTQVANLSGWESRN  217



>ref|XP_010059178.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=1019

 Score =   187 bits (476),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 86/155 (55%), Positives = 109/155 (70%), Gaps = 0/155 (0%)
 Frame = -2

Query  897  SSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEE  718
            S+    Y VFLSFRG DVR+ F+ HLY A+ Q+GIYTF D EKL +G+ ISP L +AIEE
Sbjct  85   SNMKRNYHVFLSFRGTDVRQGFLSHLYAALDQQGIYTFVDSEKLRKGEEISPTLMRAIEE  144

Query  717  SSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFE  538
            S +A++VFSE YA S WCLEE VKIMEC +  G  V P+FY V+P  VR  +E YG A  
Sbjct  145  SRIAIIVFSEGYASSPWCLEEAVKIMECKERNGLIVFPVFYKVEPREVRGGRESYGRAMA  204

Query  537  GHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTE  433
             HE  F K+ +KVK+W+K L +  NLSGW+LN+ +
Sbjct  205  KHESKFGKDSKKVKRWKKGLFEAGNLSGWELNDRD  239



>ref|XP_011001241.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=933

 Score =   187 bits (474),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 124/178 (70%), Gaps = 17/178 (10%)
 Frame = -2

Query  918  MEQP-SFVSSCGST------------YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKD  778
            + +P SFVS+   T            YDVFLSFRGED RKNF DHLYTA+ Q GI+TF+D
Sbjct  26   LRKPVSFVSTAAMTEPESSRSRPKGAYDVFLSFRGEDNRKNFTDHLYTALVQAGIHTFRD  85

Query  777  DEKLERGKSISPALEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPI  601
              ++ RG+ IS  L KAI+ES + +VVFS+ YA S WCL ELV+I+EC K K GQ ++P+
Sbjct  86   HNEIPRGEEISKHLLKAIQESKIYIVVFSKGYASSRWCLNELVEILECKKRKTGQIILPV  145

Query  600  FYGVDPSTVRKQKEKYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
            FY + PS VRKQ   + +AF+ HE+ F+K   KVK+WRK LE+  NLSGW+LN+ ENG
Sbjct  146  FYDIHPSEVRKQTGSFAKAFDRHEERFKK---KVKEWRKALEEAGNLSGWNLNDMENG  200



>ref|XP_008231763.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=562

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 124/183 (68%), Gaps = 13/183 (7%)
 Frame = -2

Query  912  QPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALE  733
            QP   S   S YDVFLSFRG D R NF DHL  A+  +GI+TF DD++L RG+ ISPAL 
Sbjct  38   QPDSSSPSSSPYDVFLSFRGADTRTNFTDHLRNALVGKGIHTFIDDDELRRGEEISPALV  97

Query  732  KAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKY  553
            KAIEES ++V+VFSE YA S WCL+ELVKI++C + K Q V+PIFY VDPS VRKQ   +
Sbjct  98   KAIEESRISVIVFSEKYASSRWCLDELVKILQCKQSKQQVVLPIFYKVDPSDVRKQTNSF  157

Query  552  GEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWD----------LNNTENG*IFNSNPL  403
            G+AF+G  +S  K+ ++++ WRK L + +NLSGW           +NN  +G IF+  P 
Sbjct  158  GDAFKGLIRSEFKDDKQIQGWRKALTEAANLSGWHFEEGAYEATFINNIVDG-IFSKLP-  215

Query  402  HPT  394
             PT
Sbjct  216  -PT  217



>ref|XP_006387577.1| hypothetical protein POPTR_0822s002001g, partial [Populus trichocarpa]
 gb|ERP46491.1| hypothetical protein POPTR_0822s002001g, partial [Populus trichocarpa]
Length=159

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 100/134 (75%), Gaps = 0/134 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D R NF  HLY+ + QRGI  + DD +LERGK+I PAL KAIEES  +V+
Sbjct  24   YDVFLSFRGQDTRNNFTSHLYSNLAQRGIDVYMDDRELERGKTIEPALWKAIEESRFSVI  83

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            +FS  YA S WCL+ELVKI++CMK  GQTV+P+FY VDPS V  +K KY EAF  HE +F
Sbjct  84   IFSRDYASSPWCLDELVKIVQCMKEMGQTVLPVFYDVDPSEVTDRKRKYEEAFGEHELNF  143

Query  519  EKEGEKVKKWRKVL  478
            ++  EKV+ W+  L
Sbjct  144  KENLEKVRNWKDCL  157



>ref|XP_010026474.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=174

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 103/143 (72%), Gaps = 0/143 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG DVR  F+ HLYTA+ Q GI T+ D E L++G+ ISPAL +AIEES +A+V
Sbjct  16   YDVFLSFRGTDVRNYFLGHLYTALVQSGINTYMDSEDLKKGEKISPALMEAIEESQIAIV  75

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS+ YA S WCLEE+ KIMEC + +G  V P+FY V+P  VR Q++ Y EA   HE  F
Sbjct  76   VFSKDYASSPWCLEEVAKIMECKEQRGLMVFPVFYKVEPREVRGQRQGYAEAMNKHEVKF  135

Query  519  EKEGEKVKKWRKVLEDVSNLSGW  451
              + EKVK+W+K L D  +LSGW
Sbjct  136  GTDSEKVKRWKKALLDAGSLSGW  158



>ref|XP_006370902.1| hypothetical protein POPTR_0019s01570g, partial [Populus trichocarpa]
 gb|ERP48699.1| hypothetical protein POPTR_0019s01570g, partial [Populus trichocarpa]
Length=886

 Score =   186 bits (473),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 110/153 (72%), Gaps = 2/153 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRGED RKNF DHLY A +  GI TF+DD +L RG+ IS  L +AI++S ++V+
Sbjct  17   YDVFLSFRGEDTRKNFTDHLYFAFKDAGINTFRDDNELRRGEDISTELLQAIQKSRISVI  76

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFSE+YA+S WCLEELVKIMEC +   Q V PIFY VDPS VRKQ   + +AF GHE+ F
Sbjct  77   VFSENYANSRWCLEELVKIMECRRSCRQLVFPIFYDVDPSDVRKQTGSFAKAFAGHEERF  136

Query  519  --EKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
              + +  KV  WR  L + +NLSGWDL N  +G
Sbjct  137  VLQTDKGKVATWRMALTEAANLSGWDLRNVADG  169



>ref|XP_010657832.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
Length=1099

 Score =   187 bits (476),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 115/147 (78%), Gaps = 4/147 (3%)
 Frame = -2

Query  885  STYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMA  706
            STYDVFLSFRGED R NF DHLY+A+ +RGI+TF+DD KL RG++I+P L KAIEES  +
Sbjct  22   STYDVFLSFRGEDTRYNFTDHLYSALGRRGIHTFRDD-KLRRGEAIAPELLKAIEESRSS  80

Query  705  VVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            V+VFSE+YA S WCL+ELVKIMEC K     V PIFY VDPS VRKQ+  +GEAF G+E+
Sbjct  81   VIVFSENYAHSRWCLDELVKIMECQKDPAHVVFPIFYHVDPSHVRKQEGSFGEAFAGYEE  140

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDL  445
            +++   +K+ +WR+ L + +NLSGW +
Sbjct  141  NWK---DKIPRWRRALTEAANLSGWHI  164



>ref|XP_010057293.1| PREDICTED: TMV resistance protein N-like isoform X2 [Eucalyptus 
grandis]
Length=836

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 118/188 (63%), Gaps = 11/188 (6%)
 Frame = -2

Query  897  SSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEE  718
            S+    Y VFLSFRG DVR+ F+ HLY A+ Q+GIYTF D E+L +G+ ISP L KAIEE
Sbjct  5    SNMKRNYHVFLSFRGTDVRQGFLSHLYAALGQKGIYTFVDSEELRKGEEISPTLMKAIEE  64

Query  717  SSMAVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFE  538
            S +A++VFSE YA S WCLEE VKIMEC +  G  V P+FY V+P  VR  +E YG A  
Sbjct  65   SRIAIIVFSEDYASSPWCLEEAVKIMECKERMGLIVFPVFYKVEPREVRGGRESYGRAMA  124

Query  537  GHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*I-----------FNSNPLHPTR  391
             HE  F K+ EKVK+W+K L + S+LSGW+LN+     +            N  PLH  +
Sbjct  125  KHESKFGKDSEKVKRWKKALFEASSLSGWELNDRNEAELIQCIVKELSIHLNRTPLHVAK  184

Query  390  GDHGFGSE  367
               G  S+
Sbjct  185  YPVGIDSQ  192



>ref|XP_004228809.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1326

 Score =   188 bits (478),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 113/150 (75%), Gaps = 0/150 (0%)
 Frame = -2

Query  876  DVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVVV  697
            DVFLSFRG+D RK FV HL  A++Q+GI+TFKDDE+LERGK+ISP L KAIEES  A+VV
Sbjct  12   DVFLSFRGKDTRKTFVGHLNYALKQKGIHTFKDDERLERGKTISPELVKAIEESRFAIVV  71

Query  696  FSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSFE  517
            FS++YA S+WCL+ELVKIMEC K  GQTV+PIFY VDPS V KQ E + ++F  HE++ +
Sbjct  72   FSKNYASSTWCLDELVKIMECKKELGQTVIPIFYDVDPSHVTKQSETFAKSFAIHEENLK  131

Query  516  KEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             + EKV  WR        ++G+DL N  +G
Sbjct  132  DDVEKVLCWRDAFRQAGKIAGYDLPNGYDG  161



>ref|XP_011001242.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
 ref|XP_011001243.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1169

 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 120/166 (72%), Gaps = 5/166 (3%)
 Frame = -2

Query  918  MEQP-SFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISP  742
            M +P S  S     YDVFLSFRGED RKNF DHLYTA+ Q GIYTF+D  ++ RG+ IS 
Sbjct  38   MTEPESSRSRPNGAYDVFLSFRGEDNRKNFTDHLYTALVQAGIYTFRDHNEIPRGEEISK  97

Query  741  ALEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQ  565
             L KAI+ES +++VVFS+ YA S WCL ELV+I+EC   K GQ V+P+FY +DPS VRKQ
Sbjct  98   HLLKAIQESKISIVVFSKGYASSRWCLNELVEILECKNRKTGQIVLPVFYDIDPSDVRKQ  157

Query  564  KEKYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
               + +AF+ HE  F+   EKVK+WRK LE+  NLSGW+L++ ENG
Sbjct  158  TGSFVKAFDKHEDCFK---EKVKEWRKALEEAGNLSGWNLSDMENG  200



>ref|XP_011013490.1| PREDICTED: TMV resistance protein N-like isoform X4 [Populus 
euphratica]
Length=975

 Score =   187 bits (475),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRGED RK F DHLYTA+ Q GI+TF+DD+ L RG+ IS  L +AI ES +++
Sbjct  14   AYDVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDALPRGEEISHHLLRAIRESKISI  73

Query  702  VVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            VVFS+ YA S WCL ELV+I++C   K GQ V+PIFY +DPS VRKQ   + EAF+ HE+
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEE  133

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             FE+  + VK+WRK LED  NLSGW LN+  NG
Sbjct  134  RFEE--KLVKEWRKALEDAGNLSGWSLNDMANG  164



>ref|XP_009374162.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=748

 Score =   185 bits (470),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 113/144 (78%), Gaps = 1/144 (1%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG+D R+ F DHLY+A+++ GI TFKDD +L++GKSISP L  AI+ES  A++
Sbjct  18   YDVFLSFRGDDTRRGFTDHLYSALERHGILTFKDDPELQKGKSISPELFSAIQESRFALI  77

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            V S++YA S+WCL+EL+KI+ECM+ + +TV+PIFY VDPS VRKQK  + EAF  HE++ 
Sbjct  78   VLSKNYASSTWCLDELLKILECMEAR-KTVLPIFYEVDPSDVRKQKGSFAEAFTKHEENL  136

Query  519  EKEGEKVKKWRKVLEDVSNLSGWD  448
            + +  KV+ WR  L  V+NLSGWD
Sbjct  137  KNDLMKVQSWRDALTTVANLSGWD  160



>ref|XP_010058828.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=232

 Score =   176 bits (445),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG D+R NF+ HLY  + Q G++TF D E+L +G  IS AL K IEES +A++
Sbjct  11   YDVFLSFRGTDLRNNFIGHLYNGLDQNGVFTFIDSEELRKGDQISQALMKTIEESCIAII  70

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS+ YA S WCLEEL KIMEC + K   V+P+FY VDP  VR  +E YG A   HE  F
Sbjct  71   VFSDDYASSRWCLEELAKIMECKEQKDLIVLPVFYKVDPREVRGGRESYGRALAKHEFKF  130

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNNTE  433
             K  ++VK+W+K L D  NLSGW L + +
Sbjct  131  GKNSKEVKRWKKALFDAGNLSGWHLGDGD  159



>ref|XP_011014417.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=901

 Score =   186 bits (473),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 114/153 (75%), Gaps = 3/153 (2%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             YDVFLSFRG+D RK F DHLYTA+ Q GI+TF+DD+ L RG+ IS  L +AI ES +++
Sbjct  42   AYDVFLSFRGKDNRKTFTDHLYTALVQAGIHTFRDDDALPRGEEISHHLLRAIRESKISI  101

Query  702  VVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEK  526
            VVFS+ YA S WCL ELV+I++C + K  Q V+PIFY +DPS VRKQ   + EAF+ HE+
Sbjct  102  VVFSKGYASSRWCLNELVEILKCKRKKTSQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEE  161

Query  525  SFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
             FE+  + VK+WRK LED  NLSGW LN+ ENG
Sbjct  162  RFEE--KLVKEWRKALEDAGNLSGWSLNDMENG  192



>gb|KCW74573.1| hypothetical protein EUGRSUZ_E032912, partial [Eucalyptus grandis]
Length=383

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 116/182 (64%), Gaps = 11/182 (6%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
             Y VFLSFRG DVR+ F+ HLY A+ QRGIYTF D E+L +G+ IS  L +AIEES +A+
Sbjct  4    NYHVFLSFRGTDVRQGFLSHLYAALDQRGIYTFVDSEELRKGEEISWTLMRAIEESHIAI  63

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE YA S WCLEEL+KIMEC +  G  V P+FY V+P  VR+ +E Y  A + HE  
Sbjct  64   IVFSEDYASSRWCLEELLKIMECKEKNGLMVFPVFYEVEPREVREGRENYKRAMDNHEYK  123

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*I-----------FNSNPLHPTRGDHGF  376
            F K+ EKVK+W+K L +  +LSGW+LN+ +   +            N  PLH  +   G 
Sbjct  124  FGKDSEKVKRWKKALFETGSLSGWELNDRDEADLIQCIVKELSIHLNRTPLHVAKYPVGI  183

Query  375  GS  370
             S
Sbjct  184  DS  185



>gb|KCW59235.1| hypothetical protein EUGRSUZ_H01903, partial [Eucalyptus grandis]
Length=158

 Score =   173 bits (438),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 105/148 (71%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +Y VFLSFRG DVR  F+ HLYTA+ Q GI T+KDDE+L +G+ IS  L+KAIEES +A+
Sbjct  11   SYHVFLSFRGPDVRNYFLGHLYTALNQAGINTYKDDEELRKGEHISTELQKAIEESRIAI  70

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFSEHYA S+WCL+EL KIMEC + +   V P+FY V+P  VR  +E Y +    HE  
Sbjct  71   VVFSEHYASSTWCLKELGKIMECKEQRHLMVYPVFYKVEPCEVRTPRESYLQDMAKHEDK  130

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F K+ EKVK+W+K L D  +LSGW   +
Sbjct  131  FGKDSEKVKRWKKALLDAGSLSGWHFTD  158



>ref|XP_006380260.1| hypothetical protein POPTR_0007s00620g, partial [Populus trichocarpa]
 gb|ERP58057.1| hypothetical protein POPTR_0007s00620g, partial [Populus trichocarpa]
Length=470

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 115/165 (70%), Gaps = 4/165 (2%)
 Frame = -2

Query  918  MEQPSFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPA  739
            +E  S  S     YDVFLSFRGED RK F DHL+TA+ Q GI+TF+DD++L RG+ IS  
Sbjct  30   IEPDSSRSRPQVAYDVFLSFRGEDTRKTFTDHLHTALVQAGIHTFQDDDELPRGEEISDH  89

Query  738  LEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQK  562
            L KAI ES ++ VVFS+ YA S WCL ELV+I++C K K GQ  +PIFY +DPS VRKQ 
Sbjct  90   LLKAIRESKISTVVFSKGYASSRWCLNELVEILKCRKRKTGQIALPIFYDIDPSDVRKQT  149

Query  561  EKYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
              + EAF  HE   E+  EKVK+WR+ LE+  NLSGW+L +  NG
Sbjct  150  GSFAEAFVKHE---ERSKEKVKEWRETLEEAGNLSGWNLKDMANG  191



>gb|KCW73687.1| hypothetical protein EUGRSUZ_E02290 [Eucalyptus grandis]
Length=430

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 106/147 (72%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG D+R NF+ HLY A+ Q GIYTF+D E+L++G  ISP L KAIEES +A++
Sbjct  11   YDVFLSFRGVDLRNNFIGHLYQALHQIGIYTFRDSEELKKGDQISPVLMKAIEESYIAII  70

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFS +YA S WCLEE+ KI+EC + K   V+P+FY VDP  VR  ++ Y  A   HE  F
Sbjct  71   VFSMNYASSMWCLEEVAKIIECKEQKNLIVLPVFYKVDPREVRGVRKSYQRALAKHESKF  130

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             K+ EKVK+W++ L +  NLSGW LN+
Sbjct  131  GKDSEKVKRWKEALSNAGNLSGWHLND  157



>ref|XP_008232097.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=845

 Score =   186 bits (471),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            TYDVFLS+RGED RK F+DHLYTA+ ++GI+TF DDE L RG+ ISPAL  AIEES ++V
Sbjct  25   TYDVFLSYRGEDTRKTFIDHLYTALDRQGIHTFIDDE-LPRGEEISPALLNAIEESKISV  83

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            +VFSE+YA SSWCL+ELVKI+E  K K Q V+PIFY VDPS VR Q+  +G+A   HE+ 
Sbjct  84   IVFSENYASSSWCLDELVKILEYKKSKQQLVMPIFYKVDPSDVRNQRSSFGDALADHERK  143

Query  522  FEKEGEKVKKWRKVLEDVSNLSG  454
            F+ + EKV +WR+ L + +NLSG
Sbjct  144  FKDDMEKVLEWRRALTEAANLSG  166



>gb|KCW74266.1| hypothetical protein EUGRSUZ_E02914 [Eucalyptus grandis]
Length=518

 Score =   182 bits (463),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = -2

Query  879  YDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAVV  700
            YDVFLSFRG D+R NF+ HLY A+ + GIYTF+D E+L++G  ISP L KAIEES +A++
Sbjct  11   YDVFLSFRGVDLRNNFIGHLYQALHRIGIYTFRDSEELKKGDQISPVLMKAIEESCIAII  70

Query  699  VFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKSF  520
            VFSE+YA S WCLEEL KI+EC + K   V+P+FY VDP  VR  ++ Y  A   H+  F
Sbjct  71   VFSENYASSRWCLEELAKIIECKEQKNLIVLPVFYKVDPKEVRGGRKSYQRALAKHKSKF  130

Query  519  EKEGEKVKKWRKVLEDVSNLSGWDLNN  439
             K+ EKVK+W++ L D  NLSGW LN+
Sbjct  131  GKDSEKVKRWKEALFDAGNLSGWHLND  157



>ref|XP_006370864.1| hypothetical protein POPTR_0019s01170g [Populus trichocarpa]
 gb|ERP48661.1| hypothetical protein POPTR_0019s01170g [Populus trichocarpa]
Length=1058

 Score =   187 bits (475),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 119/166 (72%), Gaps = 4/166 (2%)
 Frame = -2

Query  918  MEQP-SFVSSCGSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISP  742
            M +P S  SS    YDVFLSFRGED RK F DHLY A+ Q GI  F+DD++L RG+ IS 
Sbjct  38   MTEPGSSRSSPEGAYDVFLSFRGEDTRKTFTDHLYAALDQAGIRAFRDDDELPRGEEISD  97

Query  741  ALEKAIEESSMAVVVFSEHYADSSWCLEELVKIMECMKVK-GQTVVPIFYGVDPSTVRKQ  565
             L +AI+ES +++VVFS+ YA S WCL ELV+I+EC K K GQ V+PIFY +DPS VRKQ
Sbjct  98   HLLRAIQESKISIVVFSKGYASSRWCLNELVEILECKKRKTGQIVLPIFYDIDPSDVRKQ  157

Query  564  KEKYGEAFEGHEKSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG  427
               + EAF  HE+ FE+  + VK+WRK LE+  NLSGW+LN+  NG
Sbjct  158  NGSFAEAFVKHEERFEE--KLVKEWRKALEEAGNLSGWNLNDMANG  201



>ref|XP_008364204.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=288

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 117/163 (72%), Gaps = 5/163 (3%)
 Frame = -2

Query  888  GSTYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSM  709
            GS YDVF+SFRG D RKNF  HLY A+ + GI  F DDE+L++G+ ++ A E+AI+ S +
Sbjct  111  GSLYDVFISFRGGDTRKNFTGHLYEALTKAGINAFIDDEELKKGEELTTAFERAIQGSKI  170

Query  708  AVVVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHE  529
            +++VFS  YA+SSWCLEELVKIMEC + +GQ V+PIFY VDPS VRKQ   +G++F  H 
Sbjct  171  SIIVFSRRYANSSWCLEELVKIMECRRNRGQLVLPIFYDVDPSHVRKQTGSFGQSFLDH-  229

Query  528  KSFEKEGEKVKKWRKVLEDVSNLSGWDLNNTENG*IFNSNPLH  400
                 + +KV++WR  L + SNLSG DL NT +G +  S+ ++
Sbjct  230  ----IDEKKVERWRTALFEASNLSGGDLQNTFDGYLLISSLMN  268



>ref|XP_010070448.1| PREDICTED: TMV resistance protein N-like isoform X2 [Eucalyptus 
grandis]
Length=160

 Score =   173 bits (438),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 105/148 (71%), Gaps = 0/148 (0%)
 Frame = -2

Query  882  TYDVFLSFRGEDVRKNFVDHLYTAMQQRGIYTFKDDEKLERGKSISPALEKAIEESSMAV  703
            +Y VFLSFRG DVR  F+ HLYTA+ Q GI T+KDDE+L +G+ IS  L+KAIEES +A+
Sbjct  11   SYHVFLSFRGPDVRNYFLGHLYTALNQAGINTYKDDEELRKGEHISTELQKAIEESRIAI  70

Query  702  VVFSEHYADSSWCLEELVKIMECMKVKGQTVVPIFYGVDPSTVRKQKEKYGEAFEGHEKS  523
            VVFSEHYA S+WCL+EL KIMEC + +   V P+FY V+P  VR  +E Y +    HE  
Sbjct  71   VVFSEHYASSTWCLKELGKIMECKEQRHLMVYPVFYKVEPCEVRTPRESYLQDMAKHEDK  130

Query  522  FEKEGEKVKKWRKVLEDVSNLSGWDLNN  439
            F K+ EKVK+W+K L D  +LSGW   +
Sbjct  131  FGKDSEKVKRWKKALLDAGSLSGWHFTD  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2295101849455