BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23665_g8_i1 len=1152 path=[12036:0-359 12396:360-374 7548:375-380
12416:381-392 19864:393-404 19876:405-406 19878:407-415
16598:416-472 9096:473-479 19945:480-502 6851:503-611 6960:612-619
20136:620-636 20153:637-645 9267:646-1151]

Length=1152
                                                                      Score     E

ref|XP_008368001.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    247   1e-76   
ref|XP_011082761.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    246   2e-76   
ref|XP_006360044.1|  PREDICTED: uncharacterized protein LOC102584680    246   3e-76   
ref|XP_009334040.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    245   4e-76   
ref|XP_004248241.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    245   8e-76   
ref|XP_009622401.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    244   2e-75   
gb|KCW67509.1|  hypothetical protein EUGRSUZ_F01238                     241   1e-74   
ref|XP_006442502.1|  hypothetical protein CICLE_v10022456mg             241   1e-74   
ref|XP_009339946.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    241   2e-74   
ref|XP_006592933.1|  PREDICTED: uncharacterized protein LOC100806...    241   2e-74   
ref|XP_011015901.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    241   2e-74   
ref|XP_006370148.1|  hypothetical protein POPTR_0001s40140g             240   2e-74   
ref|NP_001237763.1|  uncharacterized protein LOC100527554               241   3e-74   
ref|XP_011013261.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    240   3e-74   
ref|XP_007021735.1|  Uncharacterized protein TCM_031777                 240   4e-74   
ref|XP_006358940.1|  PREDICTED: uncharacterized protein LOC102602985    240   6e-74   
gb|KHN36883.1|  hypothetical protein glysoja_001614                     239   1e-73   
ref|XP_010314085.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    238   1e-73   
ref|XP_007149389.1|  hypothetical protein PHAVU_005G066200g             238   1e-73   
ref|XP_010109876.1|  hypothetical protein L484_003806                   239   2e-73   
ref|XP_007212123.1|  hypothetical protein PRUPE_ppa012057mg             238   2e-73   
ref|XP_008226537.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    238   2e-73   
ref|XP_009770169.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    239   3e-73   
ref|XP_002317458.1|  hypothetical protein POPTR_0011s11120g             238   3e-73   Populus trichocarpa [western balsam poplar]
ref|XP_010108230.1|  hypothetical protein L484_018651                   238   4e-73   
ref|XP_004489028.1|  PREDICTED: uncharacterized protein LOC101497242    237   7e-73   
ref|XP_004294145.1|  PREDICTED: uncharacterized protein LOC101307097    237   1e-72   
ref|XP_002530382.1|  conserved hypothetical protein                     236   2e-72   Ricinus communis
ref|XP_006348309.1|  PREDICTED: uncharacterized protein LOC102581082    236   2e-72   
ref|XP_010062813.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    236   2e-72   
ref|XP_003596364.1|  177 protein                                        235   2e-72   
emb|CDP06011.1|  unnamed protein product                                236   3e-72   
gb|KDP34762.1|  hypothetical protein JCGZ_10542                         235   4e-72   
gb|AFK47598.1|  unknown                                                 235   4e-72   
ref|XP_007133232.1|  hypothetical protein PHAVU_011G162700g             235   4e-72   
ref|XP_010277024.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    234   5e-72   
ref|XP_006469013.1|  PREDICTED: uncharacterized protein LOC102606613    234   5e-72   
gb|AFK34719.1|  unknown                                                 234   7e-72   
ref|XP_006446791.1|  hypothetical protein CICLE_v10016699mg             235   8e-72   
ref|XP_008448236.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    234   1e-71   
ref|XP_002285447.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    235   1e-71   Vitis vinifera
ref|XP_010324393.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    234   1e-71   
emb|CAN63025.1|  hypothetical protein VITISV_034817                     233   1e-71   Vitis vinifera
ref|XP_003540402.1|  PREDICTED: uncharacterized protein LOC100802...    233   2e-71   
ref|XP_009784769.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    233   3e-71   
ref|XP_007025375.1|  Beta-lactamase-like protein ENSP00000383859        232   3e-71   
ref|XP_004151474.1|  PREDICTED: uncharacterized protein LOC101210225    232   4e-71   
ref|XP_011033736.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    231   5e-71   
ref|XP_002320411.1|  hypothetical protein POPTR_0014s13900g             231   5e-71   Populus trichocarpa [western balsam poplar]
ref|XP_010279129.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    232   5e-71   
gb|KGN65636.1|  hypothetical protein Csa_1G474480                       232   6e-71   
emb|CDO96796.1|  unnamed protein product                                232   6e-71   
ref|XP_008342774.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    232   6e-71   
gb|KHN36698.1|  hypothetical protein glysoja_001429                     231   7e-71   
ref|XP_009774704.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    232   8e-71   
ref|XP_011085992.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    231   8e-71   
ref|XP_007132855.1|  hypothetical protein PHAVU_011G130300g             231   8e-71   
ref|XP_002522583.1|  conserved hypothetical protein                     231   9e-71   Ricinus communis
gb|KGN47252.1|  hypothetical protein Csa_6G236080                       232   1e-70   
ref|XP_004171262.1|  PREDICTED: uncharacterized LOC101216601            232   1e-70   
ref|XP_009773140.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    231   1e-70   
ref|XP_007215057.1|  hypothetical protein PRUPE_ppa012217mg             231   1e-70   
gb|KDP35079.1|  hypothetical protein JCGZ_11031                         230   2e-70   
ref|XP_002301561.2|  hypothetical protein POPTR_0002s22690g             230   2e-70   Populus trichocarpa [western balsam poplar]
gb|AFK41155.1|  unknown                                                 231   2e-70   
ref|XP_010655519.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    230   2e-70   
emb|CAN72178.1|  hypothetical protein VITISV_012478                     230   2e-70   Vitis vinifera
ref|XP_004516078.1|  PREDICTED: uncharacterized protein LOC101514778    230   2e-70   
ref|XP_007149738.1|  hypothetical protein PHAVU_005G095100g             229   2e-70   
ref|XP_004150559.1|  PREDICTED: uncharacterized protein LOC101216601    231   3e-70   
ref|XP_006362411.1|  PREDICTED: uncharacterized protein LOC102591189    230   3e-70   
ref|NP_001235660.1|  uncharacterized protein LOC100306225               229   4e-70   
ref|XP_006467647.1|  PREDICTED: uncharacterized protein LOC102611919    230   5e-70   
ref|XP_004233074.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    230   5e-70   
ref|XP_011101384.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    229   5e-70   
gb|KDP21096.1|  hypothetical protein JCGZ_21567                         229   5e-70   
ref|XP_006449503.1|  hypothetical protein CICLE_v10016772mg             230   6e-70   
ref|XP_003607586.1|  177 protein                                        229   6e-70   
gb|EYU45022.1|  hypothetical protein MIMGU_mgv1a014215mg                230   6e-70   
ref|XP_009608555.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    229   6e-70   
ref|XP_004485894.1|  PREDICTED: uncharacterized protein LOC101502781    229   6e-70   
ref|XP_004174117.1|  PREDICTED: uncharacterized protein LOC101228453    229   6e-70   
ref|XP_003542999.1|  PREDICTED: uncharacterized protein LOC100778886    229   8e-70   
ref|XP_010035859.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   8e-70   
ref|XP_010104392.1|  hypothetical protein L484_010344                   228   9e-70   
ref|XP_002280666.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   1e-69   Vitis vinifera
ref|XP_003526225.1|  PREDICTED: uncharacterized protein LOC100815968    228   1e-69   
ref|XP_002305745.1|  hypothetical protein POPTR_0004s05610g             228   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_008465553.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   2e-69   
ref|XP_004303183.1|  PREDICTED: uncharacterized protein LOC101307414    229   2e-69   
emb|CAN66524.1|  hypothetical protein VITISV_034969                     227   2e-69   Vitis vinifera
ref|XP_007048693.1|  Pleckstrin domain-containing family N member 1     229   2e-69   
ref|XP_002521586.1|  conserved hypothetical protein                     228   2e-69   Ricinus communis
gb|KHG07235.1|  Putative beta-lactamase-like 1                          228   2e-69   
ref|XP_004487154.1|  PREDICTED: uncharacterized protein LOC101499419    227   3e-69   
ref|XP_009587002.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   3e-69   
emb|CDP15936.1|  unnamed protein product                                227   3e-69   
ref|XP_008225289.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    227   4e-69   
ref|XP_011008476.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    227   5e-69   
ref|XP_010531928.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    227   6e-69   
ref|XP_004293946.1|  PREDICTED: uncharacterized protein LOC101295...    227   6e-69   
gb|AFK49191.1|  unknown                                                 226   7e-69   
ref|XP_007148048.1|  hypothetical protein PHAVU_006G176100g             226   7e-69   
ref|XP_011008166.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   7e-69   
ref|XP_009786006.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   9e-69   
gb|KHG25854.1|  Major vault                                             226   1e-68   
ref|NP_001237249.1|  uncharacterized protein LOC100306082               226   1e-68   
ref|XP_010052190.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   1e-68   
ref|XP_004243287.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    225   1e-68   
ref|XP_007212120.1|  hypothetical protein PRUPE_ppa012018mg             226   1e-68   
ref|XP_006348870.1|  PREDICTED: uncharacterized protein LOC102600485    225   1e-68   
ref|XP_008381217.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   2e-68   
ref|XP_006411528.1|  hypothetical protein EUTSA_v10017308mg             225   2e-68   
ref|XP_009343797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    225   2e-68   
ref|XP_008371461.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   2e-68   
ref|XP_009133547.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    225   2e-68   
ref|XP_010052695.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    225   2e-68   
emb|CDY14848.1|  BnaC04g48450D                                          225   2e-68   
ref|NP_565978.1|  uncharacterized protein                               225   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009593391.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    225   3e-68   
gb|AES67378.2|  DUF640 family protein                                   224   3e-68   
ref|XP_011083008.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   3e-68   
ref|XP_009142076.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   3e-68   
ref|XP_006296565.1|  hypothetical protein CARUB_v100241591mg            224   3e-68   
gb|KGN55073.1|  hypothetical protein Csa_4G627230                       225   3e-68   
ref|XP_008358651.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    225   3e-68   
ref|XP_010525031.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   3e-68   
ref|XP_010508549.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   3e-68   
ref|XP_004146094.1|  PREDICTED: uncharacterized protein LOC101204141    225   4e-68   
ref|XP_010524062.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   4e-68   
ref|XP_010506094.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   4e-68   
ref|XP_004171006.1|  PREDICTED: uncharacterized LOC101204141            225   4e-68   
ref|XP_008463732.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    225   4e-68   
ref|XP_010549405.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    225   4e-68   
ref|XP_010553628.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   4e-68   
ref|XP_003597127.1|  177 protein                                        224   4e-68   
gb|AFK41138.1|  unknown                                                 223   7e-68   
gb|EPS69070.1|  hypothetical protein M569_05697                         222   8e-68   
ref|XP_011098044.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    223   8e-68   
ref|XP_006442831.1|  hypothetical protein CICLE_v10023710mg             229   9e-68   
gb|ACJ85482.1|  unknown                                                 222   2e-67   Medicago truncatula
ref|XP_002879996.1|  hypothetical protein ARALYDRAFT_903634             223   2e-67   
ref|XP_010540518.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    222   3e-67   
ref|XP_011011486.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    222   4e-67   
ref|XP_002317421.1|  hypothetical protein POPTR_0011s07350g             221   4e-67   Populus trichocarpa [western balsam poplar]
emb|CDY55387.1|  BnaA05g34250D                                          221   6e-67   
gb|EYU30777.1|  hypothetical protein MIMGU_mgv1a014751mg                221   6e-67   
gb|EPS59921.1|  hypothetical protein M569_14884                         220   7e-67   
ref|XP_011098405.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    220   1e-66   
ref|XP_009142855.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   3e-66   
ref|XP_009106595.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    220   3e-66   
ref|XP_006389954.1|  hypothetical protein EUTSA_v10019792mg             219   4e-66   
ref|XP_010429720.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   6e-66   
emb|CDX88480.1|  BnaC06g39240D                                          219   6e-66   
gb|KFK28531.1|  hypothetical protein AALP_AA7G008800                    219   7e-66   
ref|XP_010417489.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   7e-66   
ref|NP_565190.1|  protein LIGHT SENSITIVE HYPOCOTYLS 7                  219   7e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889213.1|  At1g78815                                          219   7e-66   
emb|CDY67351.1|  BnaCnng54640D                                          219   8e-66   
gb|ABF83646.1|  At1g78815                                               219   9e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108375.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   1e-65   
emb|CDX76510.1|  BnaA08g08900D                                          219   1e-65   
ref|XP_009626514.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    218   1e-65   
gb|AAM64330.1|  unknown                                                 218   1e-65   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42237.1|  hypothetical protein AALP_AA2G229400                    219   1e-65   
ref|XP_008455303.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    218   1e-65   
ref|XP_004136831.1|  PREDICTED: uncharacterized protein LOC101208687    218   2e-65   
emb|CDY34056.1|  BnaC03g62760D                                          218   3e-65   
ref|XP_006286146.1|  hypothetical protein CARUB_v10007704mg             217   4e-65   
emb|CDY14588.1|  BnaC02g25250D                                          217   4e-65   
emb|CDY26881.1|  BnaA02g19060D                                          217   4e-65   
ref|NP_193596.1|  uncharacterized protein                               217   6e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CDY69731.1|  BnaCnng65050D                                          217   6e-65   
ref|XP_010439831.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    216   6e-65   
ref|XP_010449492.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    216   6e-65   
ref|XP_010434509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    216   7e-65   
emb|CDX85083.1|  BnaC07g08230D                                          216   8e-65   
ref|XP_009102637.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    216   1e-64   
ref|XP_006302860.1|  hypothetical protein CARUB_v10020990mg             216   2e-64   
ref|XP_009790882.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   2e-64   
emb|CDX78877.1|  BnaA01g09440D                                          215   3e-64   
ref|XP_009790219.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   3e-64   
ref|XP_006414079.1|  hypothetical protein EUTSA_v10027091mg             215   3e-64   
ref|XP_002870033.1|  hypothetical protein ARALYDRAFT_914818             214   4e-64   
ref|XP_004505495.1|  PREDICTED: uncharacterized protein LOC101509969    213   4e-64   
ref|XP_009128313.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   4e-64   
ref|XP_009411199.1|  PREDICTED: protein G1-like7                        215   8e-64   
ref|XP_006478612.1|  PREDICTED: probable disease resistance prote...    233   1e-63   
gb|KDO64048.1|  hypothetical protein CISIN_1g0003541mg                  224   1e-63   
ref|XP_010327093.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    213   1e-63   
ref|XP_008649559.1|  PREDICTED: protein G1-like7                        216   2e-63   
gb|KHG29970.1|  Putative beta-lactamase-like 1                          211   2e-63   
gb|EYU43335.1|  hypothetical protein MIMGU_mgv1a022623mg                211   3e-63   
ref|NP_001143976.1|  uncharacterized protein LOC100276793               216   3e-63   Zea mays [maize]
emb|CDY01557.1|  BnaC07g35470D                                          212   3e-63   
ref|XP_009385358.1|  PREDICTED: protein G1-like7                        213   4e-63   
ref|XP_009132033.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    212   5e-63   
ref|XP_009615590.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    211   6e-63   
ref|XP_009108056.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    211   1e-62   
ref|XP_004244278.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    210   1e-62   
ref|XP_009383380.1|  PREDICTED: protein G1-like7                        211   1e-62   
ref|XP_008802142.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    210   2e-62   
ref|XP_010906808.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    210   3e-62   
ref|XP_010529198.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    210   3e-62   
ref|XP_008804907.1|  PREDICTED: protein G1-like7                        211   4e-62   
ref|XP_009136943.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   6e-62   
gb|KHG10505.1|  Error-prone DNA polymerase                              210   6e-62   
ref|XP_002892379.1|  hypothetical protein ARALYDRAFT_887918             209   8e-62   
ref|XP_009398867.1|  PREDICTED: protein G1-like4                        209   9e-62   
ref|XP_003524092.1|  PREDICTED: uncharacterized protein LOC100775838    210   9e-62   
ref|XP_003531069.1|  PREDICTED: uncharacterized protein LOC100798406    210   1e-61   
ref|NP_563780.1|  protein LIGHT SENSITIVE HYPOCOTYLS 6                  208   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475462.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    208   1e-61   
ref|XP_010487116.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    208   2e-61   
ref|XP_006303356.1|  hypothetical protein CARUB_v10010340mg             208   2e-61   
ref|XP_004504735.1|  PREDICTED: uncharacterized protein LOC101506113    209   2e-61   
ref|XP_010518804.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   3e-61   
ref|XP_010922606.1|  PREDICTED: protein G1-like7                        208   3e-61   
ref|XP_006401075.1|  hypothetical protein EUTSA_v10014789mg             207   3e-61   
ref|XP_010906823.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    208   3e-61   
ref|XP_010457872.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   4e-61   
ref|XP_009419635.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   4e-61   
ref|XP_010538562.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   4e-61   
gb|KFK43023.1|  hypothetical protein AALP_AA1G068900                    207   5e-61   
ref|XP_008657105.1|  PREDICTED: protein G1-like7                        207   5e-61   
ref|XP_007159026.1|  hypothetical protein PHAVU_002G202200g             207   6e-61   
ref|XP_002298496.1|  hypothetical protein POPTR_0001s28780g             207   8e-61   Populus trichocarpa [western balsam poplar]
ref|XP_006417846.1|  hypothetical protein EUTSA_v10009726mg             206   9e-61   
gb|EPS68444.1|  hypothetical protein M569_06326                         205   1e-60   
emb|CDP09236.1|  unnamed protein product                                207   1e-60   
ref|XP_002866271.1|  hypothetical protein ARALYDRAFT_919048             205   1e-60   
ref|XP_002313971.1|  hypothetical protein POPTR_0009s07990g             206   1e-60   Populus trichocarpa [western balsam poplar]
ref|NP_200658.1|  protein LIGHT SENSITIVE HYPOCOTYLS 5                  205   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007016962.1|  Zinc finger protein ZFPM1                          207   2e-60   
ref|XP_007159450.1|  hypothetical protein PHAVU_002G238600g             205   2e-60   
ref|XP_003537309.1|  PREDICTED: uncharacterized protein LOC100775798    206   2e-60   
ref|XP_010043398.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    205   2e-60   
ref|XP_011003514.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    206   2e-60   
ref|XP_010043397.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    206   3e-60   
ref|XP_006847407.1|  hypothetical protein AMTR_s00153p00047660          205   3e-60   
gb|EYU45980.1|  hypothetical protein MIMGU_mgv1a021801mg                205   3e-60   
ref|XP_003539992.1|  PREDICTED: uncharacterized protein LOC100806134    204   3e-60   
ref|XP_010685918.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    206   3e-60   
gb|AES98763.2|  DUF640 family protein                                   205   4e-60   
gb|KEH31304.1|  G1-like protein                                         206   4e-60   
gb|EYU28084.1|  hypothetical protein MIMGU_mgv1a022457mg                203   5e-60   
ref|XP_010542671.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    204   5e-60   
ref|XP_009385214.1|  PREDICTED: protein G1-like7                        204   7e-60   
ref|XP_002973743.1|  hypothetical protein SELMODRAFT_36560              202   7e-60   
ref|XP_003615805.1|  hypothetical protein MTR_5g072510                  206   8e-60   
ref|XP_002862737.1|  hypothetical protein ARALYDRAFT_920315             203   8e-60   
ref|XP_002879250.1|  hypothetical protein ARALYDRAFT_901988             203   9e-60   
ref|XP_006398272.1|  hypothetical protein EUTSA_v10001044mg             202   1e-59   
ref|XP_009391700.1|  PREDICTED: protein G1-like7                        205   1e-59   
ref|XP_009605797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   1e-59   
emb|CDY32697.1|  BnaA02g07590D                                          202   1e-59   
emb|CDY59510.1|  BnaCnng35040D                                          202   1e-59   
ref|XP_009126748.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   1e-59   
gb|KEH41129.1|  G1-like protein                                         204   1e-59   
ref|XP_006282119.1|  hypothetical protein CARUB_v10028368mg             202   1e-59   
ref|XP_009128817.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   1e-59   
emb|CDY06030.1|  BnaA09g37500D                                          202   2e-59   
ref|XP_006281173.1|  hypothetical protein CARUB_v10027208mg             202   2e-59   
ref|XP_009144329.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   2e-59   
ref|XP_010043396.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    205   2e-59   
ref|XP_002267312.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   2e-59   Vitis vinifera
dbj|BAI52974.1|  G1-like protein                                        203   3e-59   Selaginella moellendorffii
ref|XP_008811689.1|  PREDICTED: protein G1-like7                        203   3e-59   
ref|XP_010521971.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   3e-59   
ref|XP_008355077.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   4e-59   
emb|CDY10247.1|  BnaC05g04900D                                          201   5e-59   
ref|XP_003531259.1|  PREDICTED: uncharacterized protein LOC100810655    201   5e-59   
emb|CDY06675.1|  BnaA10g04540D                                          201   6e-59   
gb|EPS74620.1|  hypothetical protein M569_00139                         200   9e-59   
ref|XP_010443587.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   1e-58   
emb|CDY10712.1|  BnaA05g12240D                                          199   1e-58   
ref|XP_009770526.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   1e-58   
ref|XP_010453783.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   1e-58   
emb|CDY59064.1|  BnaAnng15760D                                          201   1e-58   
ref|XP_004504297.1|  PREDICTED: uncharacterized protein LOC101498424    200   1e-58   
ref|XP_010483448.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   1e-58   
emb|CDY52287.1|  BnaA03g57800D                                          200   2e-58   
emb|CDY32977.1|  BnaA10g11830D                                          199   2e-58   
ref|XP_006443825.1|  hypothetical protein CICLE_v10022295mg             200   2e-58   
ref|XP_009118463.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   2e-58   
emb|CDY61050.1|  BnaCnng37250D                                          199   3e-58   
ref|XP_003638136.1|  hypothetical protein MTR_119s0026                  206   3e-58   
ref|XP_009354180.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   3e-58   
gb|KFK27377.1|  hypothetical protein AALP_AA8G375000                    199   3e-58   
ref|XP_011024904.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   4e-58   
emb|CDX87760.1|  BnaC02g31890D                                          198   4e-58   
ref|XP_004233194.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   5e-58   
ref|XP_006353047.1|  PREDICTED: uncharacterized protein LOC102583639    198   6e-58   
ref|XP_009118997.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   9e-58   
ref|XP_009417987.1|  PREDICTED: protein G1-like7                        199   1e-57   
ref|XP_006410079.1|  hypothetical protein EUTSA_v10017270mg             198   1e-57   
ref|XP_003629770.1|  177 protein                                        197   1e-57   
ref|XP_002863446.1|  hypothetical protein ARALYDRAFT_916864             197   2e-57   
ref|XP_004134659.1|  PREDICTED: uncharacterized protein LOC101214534    198   2e-57   
gb|KHN45745.1|  hypothetical protein glysoja_043995                     197   2e-57   
ref|XP_009120359.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   2e-57   
ref|XP_008438509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   2e-57   
emb|CDY64755.1|  BnaCnng44770D                                          197   2e-57   
ref|XP_009611433.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   3e-57   
emb|CDY02038.1|  BnaC04g14630D                                          196   3e-57   
ref|XP_010497623.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   3e-57   
gb|KFK39618.1|  hypothetical protein AALP_AA3G267200                    196   5e-57   
ref|XP_009412626.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   7e-57   
ref|XP_002961823.1|  hypothetical protein SELMODRAFT_68566              195   8e-57   
emb|CDO99243.1|  unnamed protein product                                195   8e-57   
gb|EYU41125.1|  hypothetical protein MIMGU_mgv1a021620mg                194   9e-57   
ref|XP_010488385.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   9e-57   
ref|XP_004239743.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   1e-56   
ref|XP_010466654.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   1e-56   
ref|XP_010488383.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   1e-56   
ref|NP_001078202.2|  protein LIGHT SENSITIVE HYPOCOTYLS 4               195   1e-56   
ref|XP_009763597.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   1e-56   
ref|XP_010512305.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   1e-56   
ref|XP_008465528.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   1e-56   
ref|XP_002883419.1|  hypothetical protein ARALYDRAFT_898842             195   1e-56   
ref|XP_010689830.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   2e-56   
ref|XP_004134409.1|  PREDICTED: uncharacterized protein LOC101212284    194   3e-56   
ref|XP_004167341.1|  PREDICTED: uncharacterized protein LOC101231116    193   3e-56   
ref|XP_007143862.1|  hypothetical protein PHAVU_007G108200g             194   5e-56   
ref|XP_007143863.1|  hypothetical protein PHAVU_007G108200g             194   5e-56   
gb|KDP34854.1|  hypothetical protein JCGZ_09142                         194   7e-56   
ref|XP_011091303.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   1e-55   
ref|XP_006298606.1|  hypothetical protein CARUB_v10014690mg             193   1e-55   
sp|Q941W1.1|G1L7_ORYSJ  RecName: Full=Protein G1-like7                  193   1e-55   
sp|A2XED8.1|G1L7_ORYSI  RecName: Full=Protein G1-like7                  193   1e-55   
ref|XP_006354481.1|  PREDICTED: uncharacterized protein LOC102586971    193   1e-55   
emb|CDY35523.1|  BnaA01g23890D                                          192   1e-55   
ref|XP_006345889.1|  PREDICTED: uncharacterized protein LOC102588665    193   1e-55   
ref|XP_010907173.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   1e-55   
ref|XP_009410038.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   2e-55   
ref|XP_004236785.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   2e-55   
gb|EPS66277.1|  hypothetical protein M569_08502                         190   2e-55   
ref|XP_009398447.1|  PREDICTED: protein G1-like4                        192   2e-55   
ref|XP_006857299.1|  hypothetical protein AMTR_s00067p00052610          192   2e-55   
ref|XP_006406049.1|  hypothetical protein EUTSA_v10021563mg             192   2e-55   
ref|XP_009419675.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   3e-55   
ref|XP_008674867.1|  PREDICTED: protein G1-like7                        192   4e-55   
ref|XP_009124995.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   6e-55   
gb|EPS68159.1|  hypothetical protein M569_06614                         189   6e-55   
ref|NP_173135.1|  uncharacterized protein                               189   8e-55   
ref|XP_009772674.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   8e-55   
ref|XP_011043717.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   8e-55   
ref|XP_006361418.1|  PREDICTED: uncharacterized protein LOC102587546    190   8e-55   
emb|CDY21126.1|  BnaA01g33570D                                          190   9e-55   
ref|XP_002458704.1|  hypothetical protein SORBIDRAFT_03g038670          191   9e-55   
ref|XP_008807164.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   9e-55   
ref|XP_007010574.1|  Uncharacterized protein TCM_044482                 203   9e-55   
ref|XP_002313621.2|  hypothetical protein POPTR_0009s15930g             190   9e-55   
ref|XP_004247736.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   9e-55   
ref|XP_009603577.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   1e-54   
ref|XP_010671018.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   1e-54   
ref|XP_004970435.1|  PREDICTED: uncharacterized protein LOC101754104    190   1e-54   
ref|XP_010098512.1|  hypothetical protein L484_025951                   192   1e-54   
ref|XP_007022986.1|  Uncharacterized protein TCM_026988                 191   2e-54   
ref|XP_003567242.1|  PREDICTED: protein G1-like7                        190   2e-54   
ref|XP_010532649.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   2e-54   
emb|CDY30000.1|  BnaC01g40080D                                          189   2e-54   
ref|XP_009400810.1|  PREDICTED: protein G1-like4                        189   2e-54   
gb|AFK48050.1|  unknown                                                 189   2e-54   
ref|XP_008439509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   2e-54   
ref|XP_010926891.1|  PREDICTED: protein G1-like1                        191   3e-54   
ref|XP_011080720.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   3e-54   
ref|XP_010052568.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   3e-54   
ref|XP_003590857.1|  hypothetical protein MTR_1g075990                  189   3e-54   
ref|XP_010937928.1|  PREDICTED: protein G1-like7                        191   3e-54   
ref|XP_010527402.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   3e-54   
ref|XP_003536217.1|  PREDICTED: uncharacterized protein LOC100789...    188   6e-54   
sp|Q6ATW6.1|G1L8_ORYSJ  RecName: Full=Protein G1-like8                  189   6e-54   
ref|XP_007145860.1|  hypothetical protein PHAVU_007G274100g             188   7e-54   
ref|XP_009403861.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   7e-54   
ref|XP_006589267.1|  PREDICTED: uncharacterized protein LOC100789...    188   7e-54   
ref|XP_002317078.1|  hypothetical protein POPTR_0011s16010g             189   8e-54   
ref|XP_002533787.1|  conserved hypothetical protein                     189   9e-54   
ref|XP_002441248.1|  hypothetical protein SORBIDRAFT_09g023120          189   9e-54   
ref|XP_009613005.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   1e-53   
ref|XP_011005316.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   1e-53   
ref|XP_009399464.1|  PREDICTED: protein G1-like4                        187   1e-53   
ref|XP_004293717.1|  PREDICTED: uncharacterized protein LOC101301655    189   1e-53   
ref|XP_011040543.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   1e-53   
gb|EYU43203.1|  hypothetical protein MIMGU_mgv1a013748mg                187   2e-53   
gb|EYU46446.1|  hypothetical protein MIMGU_mgv1a020501mg                187   2e-53   
sp|A2Y5N0.1|G1L8_ORYSI  RecName: Full=Protein G1-like8                  188   2e-53   
ref|XP_008793554.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   2e-53   
gb|ABK21716.1|  unknown                                                 188   2e-53   
ref|XP_007146820.1|  hypothetical protein PHAVU_006G072500g             188   2e-53   
gb|KGN49491.1|  hypothetical protein Csa_6G526250                       187   2e-53   
ref|XP_011085173.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   2e-53   
ref|XP_004962398.1|  PREDICTED: skin secretory protein xP2-like         190   2e-53   
ref|XP_004296375.1|  PREDICTED: uncharacterized protein LOC101303109    187   2e-53   
ref|XP_008810562.1|  PREDICTED: protein G1-like4                        187   2e-53   
ref|XP_003566357.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   2e-53   
ref|XP_010023924.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   2e-53   
ref|XP_004134890.1|  PREDICTED: uncharacterized protein LOC101208925    186   3e-53   
ref|XP_008225689.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    187   3e-53   
ref|XP_009797641.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   3e-53   
ref|XP_009384790.1|  PREDICTED: protein G1-like7                        187   3e-53   
gb|EMT15017.1|  hypothetical protein F775_09728                         186   4e-53   
ref|XP_002271024.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   4e-53   
ref|XP_008656356.1|  PREDICTED: protein G1-like7                        190   5e-53   
ref|XP_003556381.1|  PREDICTED: uncharacterized protein LOC100806...    186   5e-53   
ref|XP_006606387.1|  PREDICTED: uncharacterized protein LOC100806...    186   5e-53   
ref|XP_009399903.1|  PREDICTED: protein G1-like7                        187   5e-53   
gb|EPS67535.1|  hypothetical protein M569_07240                         184   5e-53   
ref|XP_006350860.1|  PREDICTED: uncharacterized protein LOC102596443    187   5e-53   
gb|AES61217.2|  light-dependent short hypocotyls protein                185   5e-53   
ref|XP_006606388.1|  PREDICTED: uncharacterized protein LOC100806...    186   6e-53   
gb|ABR18275.1|  unknown                                                 187   6e-53   
ref|XP_009353874.1|  PREDICTED: protein G1-like1                        187   6e-53   
ref|XP_010650097.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   6e-53   
ref|XP_003590966.1|  hypothetical protein MTR_1g080210                  186   6e-53   
ref|XP_006489717.1|  PREDICTED: uncharacterized protein LOC102628291    186   6e-53   
ref|XP_002440915.1|  hypothetical protein SORBIDRAFT_09g016440          190   6e-53   
ref|XP_008804103.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   6e-53   
ref|XP_010557196.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   6e-53   
ref|XP_007211887.1|  hypothetical protein PRUPE_ppa010212mg             187   7e-53   
ref|XP_010104757.1|  hypothetical protein L484_021447                   186   7e-53   
ref|XP_004242504.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   7e-53   
gb|EEE55616.1|  hypothetical protein OsJ_03942                          185   7e-53   
ref|XP_008808528.1|  PREDICTED: protein G1-like1                        186   8e-53   
ref|XP_009401942.1|  PREDICTED: protein G1-like4                        185   8e-53   
ref|XP_010905797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   8e-53   
dbj|BAK01969.1|  predicted protein                                      186   8e-53   
ref|XP_007035134.1|  Uncharacterized protein TCM_020903                 186   9e-53   
ref|XP_004174147.1|  PREDICTED: uncharacterized LOC101222335            186   1e-52   
ref|XP_010921009.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    187   1e-52   
gb|ACN41049.1|  unknown                                                 186   1e-52   
ref|XP_009362175.1|  PREDICTED: protein G1-like1 isoform X2             186   1e-52   
ref|XP_010934319.1|  PREDICTED: protein G1-like4                        184   1e-52   
ref|XP_009362174.1|  PREDICTED: protein G1-like1 isoform X1             186   1e-52   
ref|XP_008224344.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   1e-52   
ref|XP_010510232.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   1e-52   
dbj|BAJ89549.1|  predicted protein                                      185   1e-52   
ref|XP_004497868.1|  PREDICTED: uncharacterized protein LOC101506...    185   1e-52   
ref|NP_001046002.1|  Os02g0166800                                       184   1e-52   
ref|NP_001048473.1|  Os02g0811000                                       186   1e-52   
ref|XP_002299015.2|  hypothetical protein POPTR_0001s46470g             187   1e-52   
ref|XP_010679333.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   1e-52   
ref|XP_009399257.1|  PREDICTED: protein G1-like1                        186   1e-52   
ref|XP_010264562.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   1e-52   
ref|XP_010414174.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   1e-52   
ref|XP_008789168.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   1e-52   
ref|XP_004495375.1|  PREDICTED: uncharacterized protein LOC101506...    184   2e-52   
ref|XP_009762992.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   2e-52   
ref|XP_007144019.1|  hypothetical protein PHAVU_007G122300g             184   2e-52   
ref|XP_004961778.1|  PREDICTED: bcl-2-binding component 3-like          186   2e-52   
ref|XP_010935915.1|  PREDICTED: protein G1-like4                        184   2e-52   
ref|XP_009120360.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   2e-52   
ref|XP_007226923.1|  hypothetical protein PRUPE_ppa015837mg             185   2e-52   
ref|XP_008807719.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   2e-52   
ref|XP_009387892.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   2e-52   
ref|XP_010522152.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   2e-52   
ref|XP_010469892.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   2e-52   
ref|XP_010557195.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   2e-52   
ref|XP_006420250.1|  hypothetical protein CICLE_v10005901mg             184   2e-52   
emb|CDY10790.1|  BnaA05g11460D                                          185   2e-52   
ref|NP_001047471.1|  Os02g0623400                                       185   2e-52   
ref|XP_009369632.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   2e-52   
ref|XP_006295008.1|  hypothetical protein CARUB_v10024080mg             184   2e-52   
ref|NP_001055266.1|  Os05g0347400                                       187   2e-52   
ref|XP_009384186.1|  PREDICTED: protein G1-like1                        185   2e-52   
ref|XP_004490633.1|  PREDICTED: uncharacterized protein LOC101513114    185   2e-52   
dbj|BAD22522.1|  hypothetical protein                                   186   3e-52   
gb|KHN04945.1|  hypothetical protein glysoja_013852                     184   3e-52   
ref|XP_006845978.1|  hypothetical protein AMTR_s00155p00022580          185   3e-52   
ref|XP_006468373.1|  PREDICTED: uncharacterized protein LOC102627798    186   3e-52   
ref|XP_008367221.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   3e-52   
ref|XP_008457336.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   3e-52   
ref|XP_010469755.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   3e-52   
ref|XP_002306857.2|  hypothetical protein POPTR_0005s24730g             184   3e-52   
ref|XP_008667635.1|  PREDICTED: uncharacterized protein LOC100275...    184   3e-52   
ref|XP_011004043.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   3e-52   
gb|EPS74320.1|  hypothetical protein M569_00435                         182   3e-52   
emb|CDY24755.1|  BnaC04g13600D                                          184   3e-52   
ref|XP_008457335.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   3e-52   
ref|XP_002446786.1|  hypothetical protein SORBIDRAFT_06g022610          184   3e-52   
ref|XP_002862787.1|  hypothetical protein ARALYDRAFT_497295             184   3e-52   
ref|NP_001142538.1|  uncharacterized protein LOC100274783               184   3e-52   
ref|XP_006606450.1|  PREDICTED: uncharacterized protein LOC102663941    183   3e-52   
ref|XP_006293520.1|  hypothetical protein CARUB_v10024036mg             184   3e-52   
ref|XP_009780996.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    183   3e-52   
ref|XP_010414310.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   4e-52   
ref|XP_008676897.1|  PREDICTED: uncharacterized protein LOC100274...    184   4e-52   
ref|XP_009144232.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   4e-52   
ref|NP_001183622.1|  putative protein of unknown function (DUF640...    185   4e-52   
gb|AFK46882.1|  unknown                                                 182   5e-52   
ref|XP_008384749.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   5e-52   
ref|XP_003581429.1|  PREDICTED: protein G1-like4                        184   5e-52   
ref|XP_006425133.1|  hypothetical protein CICLE_v10029262mg             184   5e-52   
ref|NP_565716.1|  uncharacterized protein                               184   5e-52   
ref|XP_011080055.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    183   5e-52   
ref|XP_010510405.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   5e-52   
ref|XP_009144231.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    183   6e-52   
ref|XP_006410244.1|  hypothetical protein EUTSA_v10017162mg             184   6e-52   
gb|KFK31223.1|  hypothetical protein AALP_AA6G084400                    184   6e-52   
ref|XP_002464485.1|  hypothetical protein SORBIDRAFT_01g019290          183   6e-52   



>ref|XP_008368001.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
Length=186

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 135/167 (81%), Gaps = 7/167 (4%)
 Frame = +1

Query  229  STDERREYGEGSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTFGQYL  408
            ST++ ++  EGSSS  A T       Q  Q  A       QLSRYESQKRRDWNTFGQYL
Sbjct  2    STNKGKDVAEGSSSASATTTDHQQQKQTSQPPA-------QLSRYESQKRRDWNTFGQYL  54

Query  409  KNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSL  588
            +NQRP VALSQ + +HVL+FL+YLDQFGKTKVH+  C+FFGQP+P GPCTCPLRQAWGSL
Sbjct  55   RNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHAQGCVFFGQPEPPGPCTCPLRQAWGSL  114

Query  589  DALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            DALIGRLRAAYEENGGLPETNPFA  +IRVYLR+VRDSQAKARGIPY
Sbjct  115  DALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKARGIPY  161



>ref|XP_011082761.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Sesamum 
indicum]
Length=182

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +1

Query  349  QLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFF  528
            QLSRYESQKRRDWNTFGQYL+NQRP VALSQC+YSHVL+F++YLDQFGKTKVH   C+FF
Sbjct  34   QLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNYSHVLDFMRYLDQFGKTKVHIQGCVFF  93

Query  529  GQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQA  708
            GQP+PAGPCTCPLRQAWGSLDALIGRLRAAYEENGG+PETNPFA  +IRVYLR+VRDSQA
Sbjct  94   GQPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGVPETNPFANGAIRVYLREVRDSQA  153

Query  709  KARGIPY  729
            KARGIPY
Sbjct  154  KARGIPY  160



>ref|XP_006360044.1| PREDICTED: uncharacterized protein LOC102584680 [Solanum tuberosum]
Length=207

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  349  QLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFF  528
            QLSRYESQKRRDWNTFGQYLKNQRP V+L QC+Y+HVL+FL+YLDQFGKTKVH H CLFF
Sbjct  48   QLSRYESQKRRDWNTFGQYLKNQRPPVSLPQCNYNHVLDFLRYLDQFGKTKVHLHGCLFF  107

Query  529  GQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQA  708
            GQP+P GPCTCPLRQAWGSLDALIGRLRAAYEENGGL ETNPFA  +IRVYLR+VRDSQA
Sbjct  108  GQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFASGAIRVYLREVRDSQA  167

Query  709  KARGIPY  729
            KARGIPY
Sbjct  168  KARGIPY  174



>ref|XP_009334040.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=186

 Score =   245 bits (626),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 134/167 (80%), Gaps = 7/167 (4%)
 Frame = +1

Query  229  STDERREYGEGSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTFGQYL  408
            ST++ ++  EGSSS  A T       Q  Q          QLSRYESQKRRDWNTFGQYL
Sbjct  2    STNKGKDIAEGSSSASATTTDHQQQKQTSQPPT-------QLSRYESQKRRDWNTFGQYL  54

Query  409  KNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSL  588
            +NQRP VALSQ + +HVL+FL+YLDQFGKTKVH+  C+FFGQP+P GPCTCPLRQAWGSL
Sbjct  55   RNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHAQGCVFFGQPEPPGPCTCPLRQAWGSL  114

Query  589  DALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            DALIGRLRAAYEENGGLPETNPFA  +IRVYLR+VRDSQAKARGIPY
Sbjct  115  DALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKARGIPY  161



>ref|XP_004248241.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=213

 Score =   245 bits (626),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +1

Query  349  QLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFF  528
            QLSRYESQKRRDWNTFGQYLKNQRP ++L QC+Y+HVL+FL+YLDQFGKTKVH H CLFF
Sbjct  54   QLSRYESQKRRDWNTFGQYLKNQRPPISLPQCNYNHVLDFLRYLDQFGKTKVHLHGCLFF  113

Query  529  GQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQA  708
            GQP+P GPCTCPLRQAWGSLDALIGRLRAAYEENGGL ETNPFA  +IRVYLR+VRDSQA
Sbjct  114  GQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFASGAIRVYLREVRDSQA  173

Query  709  KARGIPY  729
            KARGIPY
Sbjct  174  KARGIPY  180



>ref|XP_009622401.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=198

 Score =   244 bits (622),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V LS C+Y+HVL+FLKYLDQFGKTKVH H CLFFGQ
Sbjct  46   SRYESQKRRDWNTFGQYLKNQRPPVPLSNCNYNHVLDFLKYLDQFGKTKVHLHGCLFFGQ  105

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P GPCTCPLRQAWGSLDALIGRLRAAYEENGGLPE+NPFA  +IRVYLR+VRDSQAKA
Sbjct  106  PEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPESNPFASGAIRVYLREVRDSQAKA  165

Query  715  RGIPY  729
            RGIPY
Sbjct  166  RGIPY  170



>gb|KCW67509.1| hypothetical protein EUGRSUZ_F01238 [Eucalyptus grandis]
 gb|KCW67510.1| hypothetical protein EUGRSUZ_F01238 [Eucalyptus grandis]
Length=184

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 123/139 (88%), Gaps = 3/139 (2%)
 Frame = +1

Query  322  VAGGGVH---HHQLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFG  492
            VA  G H     QLSRYESQKRRDWNTFGQYL NQRP VA+SQC+ +HVL FL+YLDQFG
Sbjct  19   VAPSGDHLPQPTQLSRYESQKRRDWNTFGQYLSNQRPPVAISQCNSTHVLEFLRYLDQFG  78

Query  493  KTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASI  672
            KTKVH + C++FGQP+P GPCTCPL+QAWGSLDALIGRLRAAYEENGGLPETNPFA +SI
Sbjct  79   KTKVHFNGCVYFGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASSSI  138

Query  673  RVYLRDVRDSQAKARGIPY  729
            RVYLR+VRDSQAKARGIPY
Sbjct  139  RVYLREVRDSQAKARGIPY  157



>ref|XP_006442502.1| hypothetical protein CICLE_v10022456mg [Citrus clementina]
 ref|XP_006477739.1| PREDICTED: uncharacterized protein LOC102620640 [Citrus sinensis]
 gb|ESR55742.1| hypothetical protein CICLE_v10022456mg [Citrus clementina]
 gb|KDO47016.1| hypothetical protein CISIN_1g029917mg [Citrus sinensis]
Length=185

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 133/167 (80%), Gaps = 6/167 (4%)
 Frame = +1

Query  229  STDERREYGEGSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTFGQYL  408
            S+++ +E  EGSSSR +            QQ          LSRYESQKRRDWNTFGQYL
Sbjct  2    SSNKGKEVAEGSSSRSSTIATAAVAAASDQQSPA------PLSRYESQKRRDWNTFGQYL  55

Query  409  KNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSL  588
            +NQRP VALSQC+ +HVL+FL+YLDQFGKTKVH   C+FFGQP+P GPC+CPL+QAWGSL
Sbjct  56   RNQRPPVALSQCNSNHVLDFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCSCPLKQAWGSL  115

Query  589  DALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            DALIGRLRAAYEENGGLPETNPFA  +IR+YLR+VRDSQAKARGIPY
Sbjct  116  DALIGRLRAAYEENGGLPETNPFASGAIRIYLREVRDSQAKARGIPY  162



>ref|XP_009339946.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Pyrus 
x bretschneideri]
Length=183

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 130/167 (78%), Gaps = 10/167 (6%)
 Frame = +1

Query  229  STDERREYGEGSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTFGQYL  408
            ST++ ++  EGSSS  A                       QLSRYESQKRRDWNTFGQYL
Sbjct  2    STNKGKDIAEGSSSASATDHRQQKQASQPA----------QLSRYESQKRRDWNTFGQYL  51

Query  409  KNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSL  588
            +NQRP VALSQ + +HVL+FL+YLDQFGKTKVH   C+FFGQP+P GPCTCPLRQAWGSL
Sbjct  52   RNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPLRQAWGSL  111

Query  589  DALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            DALIGRLRAAYEENGGLPETNPFA  +IRVYLR+VRDSQAKARGIPY
Sbjct  112  DALIGRLRAAYEENGGLPETNPFATGAIRVYLREVRDSQAKARGIPY  158



>ref|XP_006592933.1| PREDICTED: uncharacterized protein LOC100806493 isoform X1 [Glycine 
max]
 ref|XP_006592934.1| PREDICTED: uncharacterized protein LOC100806493 isoform X2 [Glycine 
max]
Length=184

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 120/141 (85%), Gaps = 6/141 (4%)
 Frame = +1

Query  325  AGGGVHHHQ------LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQ  486
             G   HHH       LSRYESQKRRDWNTFGQYL+NQRP VALSQC  +HVL FL+YLDQ
Sbjct  20   GGDDDHHHNQQQQLPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCSSNHVLEFLRYLDQ  79

Query  487  FGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIA  666
            FGKTKVHS  CLFFGQ +P GPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFA  
Sbjct  80   FGKTKVHSQGCLFFGQTEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASG  139

Query  667  SIRVYLRDVRDSQAKARGIPY  729
            +IRVYLR+VRDSQ+KARGIPY
Sbjct  140  AIRVYLREVRDSQSKARGIPY  160



>ref|XP_011015901.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Populus 
euphratica]
Length=176

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 134/164 (82%), Gaps = 16/164 (10%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQC+ +HVL FL+YLDQFGKTKVH   C+FFG
Sbjct  29   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFLRYLDQFGKTKVHVQGCVFFG  88

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P GPCTCPL+QAWGSLDALIGRLRAAYEENGGLPETNPFA  +IRVYLR+VRDSQAK
Sbjct  89   QPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAK  148

Query  712  ARGIPYkkkkknkiintkkfinntnnVLKANDEEPTATPSFQMQ  843
            ARGIPYKKKKK +              +KANDE    + SF MQ
Sbjct  149  ARGIPYKKKKKKRNP------------MKANDE----SSSFHMQ  176



>ref|XP_006370148.1| hypothetical protein POPTR_0001s40140g [Populus trichocarpa]
 gb|ERP66717.1| hypothetical protein POPTR_0001s40140g [Populus trichocarpa]
Length=176

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 134/164 (82%), Gaps = 16/164 (10%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQC+ +HVL FL+YLDQFGKTKVH   C+FFG
Sbjct  29   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFLRYLDQFGKTKVHLQGCVFFG  88

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P GPCTCPL+QAWGSLDALIGRLRAAYEENGGLPETNPFA  +IRVYLR+VRDSQAK
Sbjct  89   QPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAK  148

Query  712  ARGIPYkkkkknkiintkkfinntnnVLKANDEEPTATPSFQMQ  843
            ARGIPYKKKKK +              +KANDE    + SF MQ
Sbjct  149  ARGIPYKKKKKKRNP------------MKANDE----SSSFHMQ  176



>ref|NP_001237763.1| uncharacterized protein LOC100527554 [Glycine max]
 gb|ACU16651.1| unknown [Glycine max]
Length=194

 Score =   241 bits (614),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQC  +HVL FL+YLDQFGKTKVHS  CLFFG
Sbjct  45   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCSSNHVLEFLRYLDQFGKTKVHSQGCLFFG  104

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +P GPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFA  +IRVYLR+VRDSQAK
Sbjct  105  QTEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGTIRVYLREVRDSQAK  164

Query  712  ARGIPY  729
            ARGIPY
Sbjct  165  ARGIPY  170



>ref|XP_011013261.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Populus 
euphratica]
Length=176

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 134/164 (82%), Gaps = 16/164 (10%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQC+ +HVL FL+YLDQFGKTKVH   C+FFG
Sbjct  29   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFLRYLDQFGKTKVHLQGCVFFG  88

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P GPCTCPL+QAWGSLDALIGRLRAAYEENGGLPETNPFA  +IRVYLR+VRDSQAK
Sbjct  89   QPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAK  148

Query  712  ARGIPYkkkkknkiintkkfinntnnVLKANDEEPTATPSFQMQ  843
            ARGIPYKKKKK +              +KANDE    + SF MQ
Sbjct  149  ARGIPYKKKKKKRNP------------MKANDE----SSSFHMQ  176



>ref|XP_007021735.1| Uncharacterized protein TCM_031777 [Theobroma cacao]
 gb|EOY13260.1| Uncharacterized protein TCM_031777 [Theobroma cacao]
Length=186

 Score =   240 bits (613),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQC+ +HVL FL+YLDQFGKTKVH   C+FFG
Sbjct  37   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFLRYLDQFGKTKVHLQGCVFFG  96

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P GPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFA  +IR+YLR+VRDSQAK
Sbjct  97   QPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRIYLREVRDSQAK  156

Query  712  ARGIPY  729
            ARGIPY
Sbjct  157  ARGIPY  162



>ref|XP_006358940.1| PREDICTED: uncharacterized protein LOC102602985 [Solanum tuberosum]
Length=205

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 120/145 (83%), Gaps = 9/145 (6%)
 Frame = +1

Query  322  VAGGGVHHHQL---------SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLK  474
            +A    HHHQL         SRYESQKRRDWNTFGQYLKNQRP V LSQC+Y+HVL FL+
Sbjct  30   IAPSDDHHHQLPSVPVPPQLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLR  89

Query  475  YLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNP  654
            YLDQFGKTKVH H C FFGQP+P GPCTCPLRQAWGSLDALIGRLRAAYEENGGLPE NP
Sbjct  90   YLDQFGKTKVHLHGCPFFGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPENNP  149

Query  655  FAIASIRVYLRDVRDSQAKARGIPY  729
            FA  SIRVYLR+VRD QAKARGI Y
Sbjct  150  FASGSIRVYLREVRDFQAKARGISY  174



>gb|KHN36883.1| hypothetical protein glysoja_001614 [Glycine soja]
Length=193

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQC  +HVL FL+YLDQFGKTKVHS  CLFFG
Sbjct  44   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCSSNHVLEFLRYLDQFGKTKVHSQGCLFFG  103

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +P GPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFA  +IRVYLR+VRDSQAK
Sbjct  104  QTEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGTIRVYLREVRDSQAK  163

Query  712  ARGIPY  729
            ARGIPY
Sbjct  164  ARGIPY  169



>ref|XP_010314085.1| PREDICTED: LOW QUALITY PROTEIN: protein LIGHT-DEPENDENT SHORT 
HYPOCOTYLS 10, partial [Solanum lycopersicum]
Length=171

 Score =   238 bits (607),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 135/167 (81%), Gaps = 9/167 (5%)
 Frame = +1

Query  349  QLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFF  528
            QLSRYESQKRRDWNTFGQYLKNQRP V LSQC+Y+HVL FL+YLDQFGKTKVH H C FF
Sbjct  14   QLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPFF  73

Query  529  GQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQA  708
            GQP+P GPCTCPLRQAWGSLDALIGRLRAAYEENGGLPE NPFA  +IRVYLR+VRD QA
Sbjct  74   GQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGAIRVYLREVRDFQA  133

Query  709  KARGIPYkkkkknkiintkkfinntnnVLKANDEEPTATPSFQMQSA  849
            KARGI YKKKKK + +  K           +N  EPT T +FQ QS+
Sbjct  134  KARGICYKKKKKKRKMQNKPT--------SSNAHEPTTT-TFQFQSS  171



>ref|XP_007149389.1| hypothetical protein PHAVU_005G066200g [Phaseolus vulgaris]
 gb|ESW21383.1| hypothetical protein PHAVU_005G066200g [Phaseolus vulgaris]
Length=179

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQC  SHVL FL+YLDQFGKTKVH   CLFFG
Sbjct  31   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCSSSHVLEFLRYLDQFGKTKVHLQGCLFFG  90

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +P GPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFA  +IRVYLR+VRDSQAK
Sbjct  91   QSEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAK  150

Query  712  ARGIPY  729
            ARGIPY
Sbjct  151  ARGIPY  156



>ref|XP_010109876.1| hypothetical protein L484_003806 [Morus notabilis]
 gb|EXC24829.1| hypothetical protein L484_003806 [Morus notabilis]
Length=194

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 135/175 (77%), Gaps = 19/175 (11%)
 Frame = +1

Query  229  STDERREYG-EGSSSRLAATMATppppqplqqVAGGGVHHHQ-------LSRYESQKRRD  384
            S D R++   EGSSSR + TM T          A   +HHHQ       LSRYESQK+RD
Sbjct  2    SGDRRKDSAAEGSSSR-SITMTT----------APADLHHHQQQPSAAPLSRYESQKKRD  50

Query  385  WNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCP  564
            WNTFGQYLKNQ P VALSQC+ +HVL+FL+YLDQFGKTKVH H C+FFGQPDP  PCTCP
Sbjct  51   WNTFGQYLKNQTPPVALSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCP  110

Query  565  LRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            LRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+V++ QAKARGIPY
Sbjct  111  LRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARGIPY  165



>ref|XP_007212123.1| hypothetical protein PRUPE_ppa012057mg [Prunus persica]
 gb|EMJ13322.1| hypothetical protein PRUPE_ppa012057mg [Prunus persica]
Length=185

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +1

Query  349  QLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFF  528
            QLSRYESQKRRDWNTFGQYL+NQRP VALSQ + +HVL+FL+YLDQFGKTKVH   C+FF
Sbjct  34   QLSRYESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHLQGCVFF  93

Query  529  GQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQA  708
            GQP+P GPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFA  +IRVYLR+VRDSQA
Sbjct  94   GQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQA  153

Query  709  KARGIPY  729
            KARGIPY
Sbjct  154  KARGIPY  160



>ref|XP_008226537.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Prunus 
mume]
Length=186

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +1

Query  349  QLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFF  528
            QLSRYESQKRRDWNTFGQYL+NQRP VALSQ + +HVL+FL+YLDQFGKTKVH   C+FF
Sbjct  35   QLSRYESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHLQGCVFF  94

Query  529  GQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQA  708
            GQP+P GPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFA  +IRVYLR+VRDSQA
Sbjct  95   GQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQA  154

Query  709  KARGIPY  729
            KARGIPY
Sbjct  155  KARGIPY  161



>ref|XP_009770169.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=206

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +1

Query  358  RYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQP  537
            RYESQKRRDWNTFGQYLKNQRP V LS C+Y+HVL+FL+YLDQFGKTKVH H CLFFGQP
Sbjct  49   RYESQKRRDWNTFGQYLKNQRPPVPLSNCNYNHVLDFLRYLDQFGKTKVHLHGCLFFGQP  108

Query  538  DPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKAR  717
            DP GPCTCPLRQAWGSLDALIGRLRAAYEENGGLP +NPFA  +IRVYLR++RDSQAKAR
Sbjct  109  DPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPVSNPFASGAIRVYLREIRDSQAKAR  168

Query  718  GIPY  729
            GIPY
Sbjct  169  GIPY  172



>ref|XP_002317458.1| hypothetical protein POPTR_0011s11120g [Populus trichocarpa]
 gb|EEE98070.1| hypothetical protein POPTR_0011s11120g [Populus trichocarpa]
Length=176

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQC+ + VL+FL+YLDQFGKTKVH   C+FFG
Sbjct  29   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCNANQVLDFLRYLDQFGKTKVHLQGCVFFG  88

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P GPCTCPL+QAWGSLDALIGRLRAAYEENGGLPETNPFA  +IRVYLR+VRDSQAK
Sbjct  89   QPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAK  148

Query  712  ARGIPY  729
            ARGIPY
Sbjct  149  ARGIPY  154



>ref|XP_010108230.1| hypothetical protein L484_018651 [Morus notabilis]
 gb|EXC18470.1| hypothetical protein L484_018651 [Morus notabilis]
Length=184

 Score =   238 bits (606),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 129/164 (79%), Gaps = 11/164 (7%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRR W TFGQYL+NQRP VALSQC+ +HVL+FL+YLDQFGKTKVH   C+FFG
Sbjct  32   LSRYESQKRRGWETFGQYLRNQRPPVALSQCNGNHVLDFLRYLDQFGKTKVHLQGCVFFG  91

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P GPC+CPLRQAWGSLDALIGRLRAAYEENGGLPETNPFA  +IRVYLRDVRDSQAK
Sbjct  92   QPEPPGPCSCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLRDVRDSQAK  151

Query  712  ARGIPYkkkkknkiintkkfinntnnVLKANDEEPTATPSFQMQ  843
            ARGIPY            K     N + K+ND +   + SF MQ
Sbjct  152  ARGIPY-----------TKKKKKRNLINKSNDHDHQHSSSFTMQ  184



>ref|XP_004489028.1| PREDICTED: uncharacterized protein LOC101497242 [Cicer arietinum]
Length=189

 Score =   237 bits (604),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQC+ +HVL FL+YLDQFGKTKVH   CLFFG
Sbjct  43   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCLFFG  102

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +P GPCTCPL+QAWGSLDALIGRLRAAYEENGGLPETNPFA  SIR+YLR+VRDSQAK
Sbjct  103  QVEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGSIRIYLREVRDSQAK  162

Query  712  ARGIPY  729
            ARGIPY
Sbjct  163  ARGIPY  168



>ref|XP_004294145.1| PREDICTED: uncharacterized protein LOC101307097 [Fragaria vesca 
subsp. vesca]
Length=194

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQ + SHVL+FL+YLDQFGKTKVH   C+FFG
Sbjct  40   LSRYESQKRRDWNTFGQYLRNQRPPVALSQSNSSHVLDFLRYLDQFGKTKVHLQGCVFFG  99

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P GPCTCPLRQAWGSLDALIGRLRAAYEENGGLPE+NPFA  +IRVYLR+VRDSQAK
Sbjct  100  QPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPESNPFASGAIRVYLREVRDSQAK  159

Query  712  ARGIPY  729
            ARGIPY
Sbjct  160  ARGIPY  165



>ref|XP_002530382.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32002.1| conserved hypothetical protein [Ricinus communis]
Length=197

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQC+ +HVL+FL+YLDQFGKTKVH   C+FFG
Sbjct  48   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLDFLRYLDQFGKTKVHLQGCVFFG  107

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P GPCTCPL+QAWGSLDALIGRLRAAYEENGGLPETNPFA  +IRV+LR+VRDSQAK
Sbjct  108  QPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVHLREVRDSQAK  167

Query  712  ARGIPY  729
            ARGIPY
Sbjct  168  ARGIPY  173



>ref|XP_006348309.1| PREDICTED: uncharacterized protein LOC102581082 [Solanum tuberosum]
Length=191

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 137/171 (80%), Gaps = 7/171 (4%)
 Frame = +1

Query  226  SSTDERRE---YGEGSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTF  396
            SS+++RRE    GEGSSS  A T+A         Q++       QLSRYESQKRRDWNTF
Sbjct  3    SSSEQRREAGGEGEGSSSTTAITLAQSDDHHHHHQLS----PPPQLSRYESQKRRDWNTF  58

Query  397  GQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQA  576
            GQYLKN +P V L QC+Y+HVL+FL+YLDQFGKTKVH + C+FFGQ +  GPCTCPL+QA
Sbjct  59   GQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKTKVHLNGCVFFGQVEQVGPCTCPLKQA  118

Query  577  WGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            WGSLDALIGRLRAAYEENGGL ETNPFA ++IR++LR+VRDSQAKARGIPY
Sbjct  119  WGSLDALIGRLRAAYEENGGLQETNPFANSAIRIHLREVRDSQAKARGIPY  169



>ref|XP_010062813.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 ref|XP_010062814.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 ref|XP_010062815.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 gb|KCW69948.1| hypothetical protein EUGRSUZ_F03266 [Eucalyptus grandis]
Length=182

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 120/134 (90%), Gaps = 4/134 (3%)
 Frame = +1

Query  340  HHHQ----LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVH  507
            HH Q    LSRYESQKRRDWNTFGQYL+NQRP +A++Q + +HVL+FL+YLDQFGKTKVH
Sbjct  24   HHQQRVLPLSRYESQKRRDWNTFGQYLRNQRPPIAITQFNSNHVLDFLRYLDQFGKTKVH  83

Query  508  SHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLR  687
             H C++FGQP+P GPCTCPLRQAWGSLDALIGRLRAAYEENGGLPE NPFA  SIR+YLR
Sbjct  84   LHGCIYFGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPEANPFASGSIRMYLR  143

Query  688  DVRDSQAKARGIPY  729
            +V+DSQAKARGIPY
Sbjct  144  EVKDSQAKARGIPY  157



>ref|XP_003596364.1| 177 protein [Medicago truncatula]
 gb|AES66615.1| DUF640 family protein [Medicago truncatula]
Length=178

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALS C+ +HVL FL+YLDQFGKTKVH   CLFFG
Sbjct  31   LSRYESQKRRDWNTFGQYLRNQRPPVALSNCNSNHVLEFLRYLDQFGKTKVHLQGCLFFG  90

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +P GPCTCPL+QAWGSLDALIGRLRAAYEENGGLPETNPFA  SIR+YLR+VRDSQAK
Sbjct  91   QTEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGSIRIYLREVRDSQAK  150

Query  712  ARGIPY  729
            ARGIPY
Sbjct  151  ARGIPY  156



>emb|CDP06011.1| unnamed protein product [Coffea canephora]
Length=200

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP V LSQC+++HVL+FL+YLDQFGKTKVH   C+FFG
Sbjct  50   LSRYESQKRRDWNTFGQYLRNQRPPVPLSQCNFNHVLDFLRYLDQFGKTKVHLQGCVFFG  109

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
             P+PAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLP+ NPFA  +IRVYLR+VRDSQAK
Sbjct  110  HPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPDKNPFASGAIRVYLREVRDSQAK  169

Query  712  ARGIPY  729
            ARGIPY
Sbjct  170  ARGIPY  175



>gb|KDP34762.1| hypothetical protein JCGZ_10542 [Jatropha curcas]
Length=184

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP V L+ C+ +HVL+FL+YLDQFGKTKVH   C+FFG
Sbjct  36   LSRYESQKRRDWNTFGQYLRNQRPPVTLANCNATHVLDFLRYLDQFGKTKVHLQGCVFFG  95

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P GPCTCPL+QAWGSLDALIGRLRAAYEENGGLPETNPFA  +IRVYLR+VRDSQAK
Sbjct  96   QPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAK  155

Query  712  ARGIPY  729
            ARGIPY
Sbjct  156  ARGIPY  161



>gb|AFK47598.1| unknown [Lotus japonicus]
Length=179

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQC+ + VL FL+YLDQFGKTKVH   CLFFG
Sbjct  29   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLEFLRYLDQFGKTKVHVQGCLFFG  88

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +P GPCTCPLRQAWGSLDALIGRLRAAYEENGGLPE NPFA  +IR+YLR+VRDSQAK
Sbjct  89   QAEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPEANPFASGTIRLYLREVRDSQAK  148

Query  712  ARGIPY  729
            ARGIPY
Sbjct  149  ARGIPY  154



>ref|XP_007133232.1| hypothetical protein PHAVU_011G162700g [Phaseolus vulgaris]
 gb|AGV54196.1| 177 protein [Phaseolus vulgaris]
 gb|ESW05226.1| hypothetical protein PHAVU_011G162700g [Phaseolus vulgaris]
Length=187

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQC+ + VL+FL+YLDQFGKTKVH+  CLFFG
Sbjct  39   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLDFLRYLDQFGKTKVHAQGCLFFG  98

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +P GPCTCPL+QAWGSLDALIGRLRAAYEENGGLPETNPFA  +IRVYLR+VRDSQAK
Sbjct  99   QVEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAK  158

Query  712  ARGIPY  729
            ARGIPY
Sbjct  159  ARGIPY  164



>ref|XP_010277024.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Nelumbo 
nucifera]
Length=182

 Score =   234 bits (598),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 118/137 (86%), Gaps = 3/137 (2%)
 Frame = +1

Query  328  GGGVHHHQ---LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKT  498
            GGG    Q   LSRYESQKRRDWNTFGQYLKNQRP V+LSQC+ SHVL+FL+YLDQFGKT
Sbjct  17   GGGGEQQQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCSHVLDFLRYLDQFGKT  76

Query  499  KVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRV  678
            KVH   C+FFGQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPF   +IRV
Sbjct  77   KVHLQGCVFFGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFGSGAIRV  136

Query  679  YLRDVRDSQAKARGIPY  729
            YLR+VR+ QAKARGIPY
Sbjct  137  YLREVRECQAKARGIPY  153



>ref|XP_006469013.1| PREDICTED: uncharacterized protein LOC102606613 [Citrus sinensis]
 gb|KDO63369.1| hypothetical protein CISIN_1g047785mg [Citrus sinensis]
Length=174

 Score =   234 bits (597),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 118/140 (84%), Gaps = 6/140 (4%)
 Frame = +1

Query  328  GGGVHHHQL------SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQF  489
            G   HHHQL      SRYESQKRRDWNTFGQYLKNQRP V LSQC  +HVL+FL+YLDQF
Sbjct  12   GSSDHHHQLQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCSCNHVLDFLRYLDQF  71

Query  490  GKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIAS  669
            GKTKVH   C+F+GQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +
Sbjct  72   GKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGA  131

Query  670  IRVYLRDVRDSQAKARGIPY  729
            IRVYLR+VR+ QAKARGIPY
Sbjct  132  IRVYLREVRECQAKARGIPY  151



>gb|AFK34719.1| unknown [Lotus japonicus]
Length=179

 Score =   234 bits (597),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQC+ + VL FL+YLDQFGKTKVH   CLFFG
Sbjct  29   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLEFLRYLDQFGKTKVHVQGCLFFG  88

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +P GPCTCPLRQAWGSLDALIGRLRAAYEENGGLPE NPFA  +IR+YLR+VRDSQAK
Sbjct  89   QAEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPEANPFASGTIRLYLREVRDSQAK  148

Query  712  ARGIPY  729
            ARGIPY
Sbjct  149  ARGIPY  154



>ref|XP_006446791.1| hypothetical protein CICLE_v10016699mg [Citrus clementina]
 gb|ESR60031.1| hypothetical protein CICLE_v10016699mg [Citrus clementina]
Length=209

 Score =   235 bits (599),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 118/140 (84%), Gaps = 6/140 (4%)
 Frame = +1

Query  328  GGGVHHHQL------SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQF  489
            G   HHHQL      SRYESQKRRDWNTFGQYLKNQRP V LSQC  +HVL+FL+YLDQF
Sbjct  47   GSSDHHHQLQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCSCNHVLDFLRYLDQF  106

Query  490  GKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIAS  669
            GKTKVH   C+F+GQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +
Sbjct  107  GKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGA  166

Query  670  IRVYLRDVRDSQAKARGIPY  729
            IRVYLR+VR+ QAKARGIPY
Sbjct  167  IRVYLREVRECQAKARGIPY  186



>ref|XP_008448236.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=200

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 128/162 (79%), Gaps = 20/162 (12%)
 Frame = +1

Query  244  REYGEGSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTFGQYLKNQRP  423
            +EYGEGSS+  +   AT P                  SRYESQKRRDWNTFGQYLKNQRP
Sbjct  13   KEYGEGSSN--SPPTATTP------------------SRYESQKRRDWNTFGQYLKNQRP  52

Query  424  AVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIG  603
             VALSQC+++HVL FL+YLDQFGKTKVH   C+F+GQP+P  PCTCPL+QAWGSLDALIG
Sbjct  53   PVALSQCNFNHVLEFLRYLDQFGKTKVHVQGCMFYGQPEPPAPCTCPLKQAWGSLDALIG  112

Query  604  RLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            RLRAAYEENGG PETNPFA ASIRVYLR+VR+ QAKARGIPY
Sbjct  113  RLRAAYEENGGSPETNPFASASIRVYLREVRECQAKARGIPY  154



>ref|XP_002285447.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Vitis 
vinifera]
Length=220

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 131/167 (78%), Gaps = 14/167 (8%)
 Frame = +1

Query  229  STDERREYGEGSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTFGQYL  408
            S+++ ++ GEGSS+R +A                       LSRYESQKRRDWNTFGQ+L
Sbjct  44   SSNKGKDTGEGSSTRSSAEDQQQ--------------QPPPLSRYESQKRRDWNTFGQFL  89

Query  409  KNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSL  588
            KNQRP VAL+QC+ + VL+FL+YLDQFGKTKVH   C++FGQP+P GPCTCPL+QAWGSL
Sbjct  90   KNQRPPVALAQCNSNQVLDFLRYLDQFGKTKVHLQGCVYFGQPEPPGPCTCPLKQAWGSL  149

Query  589  DALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            DALIGRLRAAYEENGGLPE NPFA  +IR+YLR+VRDSQAKARG+PY
Sbjct  150  DALIGRLRAAYEENGGLPEKNPFASGAIRIYLREVRDSQAKARGVPY  196



>ref|XP_010324393.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like isoform 
X1 [Solanum lycopersicum]
Length=199

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 136/178 (76%), Gaps = 26/178 (15%)
 Frame = +1

Query  226  SSTDERREYG----EGSSSRLAATMATppppqplqqVAGGGVHHHQLS------RYESQK  375
            SS++++RE G    EGSSS +  T +                HHHQLS      RYESQK
Sbjct  3    SSSEQKREVGGREGEGSSS-MTLTQSD---------------HHHQLSPPPQLSRYESQK  46

Query  376  RRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPC  555
            RRDWNTFGQYLKN +P V L QC+Y+HVL+FL+YLDQFGKTKVH + C+FFGQ +  GPC
Sbjct  47   RRDWNTFGQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKTKVHLNGCVFFGQVEQVGPC  106

Query  556  TCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            TCPLRQAWGSLDALIGRLRAAYEENGGL ETNPFA ++IR+YLR+VRDSQAKARGIPY
Sbjct  107  TCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREVRDSQAKARGIPY  164



>emb|CAN63025.1| hypothetical protein VITISV_034817 [Vitis vinifera]
Length=177

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 127/162 (78%), Gaps = 14/162 (9%)
 Frame = +1

Query  244  REYGEGSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTFGQYLKNQRP  423
            ++ GEGSS+R +A                       LSRYESQKRRDWNTFGQ+LKNQRP
Sbjct  6    KDTGEGSSTRSSAEDQQQ--------------QPPPLSRYESQKRRDWNTFGQFLKNQRP  51

Query  424  AVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIG  603
             VAL+QC+ + VL+FL+YLDQFGKTKVH   C++FGQP+P GPCTCPL+QAWGSLDALIG
Sbjct  52   PVALAQCNSNQVLDFLRYLDQFGKTKVHLQGCVYFGQPEPPGPCTCPLKQAWGSLDALIG  111

Query  604  RLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            RLRAAYEENGGLPE NPFA  +IR+YLR+VRDSQAKARG+PY
Sbjct  112  RLRAAYEENGGLPEKNPFASGAIRIYLREVRDSQAKARGVPY  153



>ref|XP_003540402.1| PREDICTED: uncharacterized protein LOC100802937 isoform X1 [Glycine 
max]
 ref|XP_006592869.1| PREDICTED: uncharacterized protein LOC100802937 isoform X2 [Glycine 
max]
 gb|KHN27942.1| hypothetical protein glysoja_007674 [Glycine soja]
Length=175

 Score =   233 bits (593),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 131/171 (77%), Gaps = 19/171 (11%)
 Frame = +1

Query  217  MTSSSTDERREYGEGSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTF  396
            M+SSS+   +++GEGSSS       +P                  LSRYESQKRRDWNTF
Sbjct  1    MSSSSS---KDFGEGSSSPTDNYQQSPGT----------------LSRYESQKRRDWNTF  41

Query  397  GQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQA  576
            GQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKVH   C+F+GQP+P  PCTCPLRQA
Sbjct  42   GQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQA  101

Query  577  WGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            WGSLDALIGRLRAAYEENGG PETNPFA  SIRVYL++VR+ QAKARGIPY
Sbjct  102  WGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLKEVRECQAKARGIPY  152



>ref|XP_009784769.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=196

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 128/167 (77%), Gaps = 12/167 (7%)
 Frame = +1

Query  349  QLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFF  528
            QLSRYESQKRRDWNTFG YLKN RP + LSQC+Y+HVL FL+YLDQFGKTKVH H C FF
Sbjct  42   QLSRYESQKRRDWNTFGHYLKNLRPPIPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPFF  101

Query  529  GQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQA  708
            GQP+P GPC CPLRQAWGSLDALIGRLRAAYEENGGLPE NPFA  SIR+YLR+VRD QA
Sbjct  102  GQPEPPGPCACPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRIYLREVRDFQA  161

Query  709  KARGIPYkkkkknkiintkkfinntnnVLKANDEEPTATPSFQMQSA  849
            KARGI Y           KK       +  + + EPTAT  FQ+QS+
Sbjct  162  KARGISY----------KKKKKKRKLQINASTNVEPTAT--FQLQSS  196



>ref|XP_007025375.1| Beta-lactamase-like protein ENSP00000383859 [Theobroma cacao]
 gb|EOY27997.1| Beta-lactamase-like protein ENSP00000383859 [Theobroma cacao]
Length=179

 Score =   232 bits (592),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 118/137 (86%), Gaps = 5/137 (4%)
 Frame = +1

Query  334  GVHHHQ-----LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKT  498
            G HH Q     LSRYESQKRRDWNTFGQYLKNQRP VALSQC+ +HVL+FL+YLDQFGKT
Sbjct  18   GNHHQQPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVALSQCNCNHVLDFLRYLDQFGKT  77

Query  499  KVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRV  678
            KVH H C+FFGQPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG  ETNPF   +IRV
Sbjct  78   KVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSSETNPFGNGAIRV  137

Query  679  YLRDVRDSQAKARGIPY  729
            YLR+VR+ QAKARGIPY
Sbjct  138  YLREVRECQAKARGIPY  154



>ref|XP_004151474.1| PREDICTED: uncharacterized protein LOC101210225 [Cucumis sativus]
Length=187

 Score =   232 bits (592),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 128/168 (76%), Gaps = 20/168 (12%)
 Frame = +1

Query  229  STDERREYGE-GSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTFGQY  405
            ST+ R++  E GSSSR   T A                    LSRYESQKRRDWNTFGQY
Sbjct  2    STEGRKDPTEAGSSSRATTTTAA-------------------LSRYESQKRRDWNTFGQY  42

Query  406  LKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGS  585
            LKNQ PAV+LSQC+ +HVL FL+YLDQFGKTKVH H C+FFGQPDP  PCTCPLRQAWGS
Sbjct  43   LKNQTPAVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGS  102

Query  586  LDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            LDALIGRLRAAYEE+GG PETNPF   +IRVYLR+V++ QAKARGIPY
Sbjct  103  LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARGIPY  150



>ref|XP_011033736.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
 ref|XP_011033737.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
 ref|XP_011033738.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
Length=170

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 119/139 (86%), Gaps = 3/139 (2%)
 Frame = +1

Query  322  VAGGGVHHHQL---SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFG  492
            VA G   + Q    SRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFG
Sbjct  9    VAEGSSENQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFG  68

Query  493  KTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASI  672
            KTKVH   C+F+GQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA ASI
Sbjct  69   KTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFANASI  128

Query  673  RVYLRDVRDSQAKARGIPY  729
            RVYLR+VRD QAKARGIP+
Sbjct  129  RVYLREVRDYQAKARGIPH  147



>ref|XP_002320411.1| hypothetical protein POPTR_0014s13900g [Populus trichocarpa]
 gb|ABK93899.1| unknown [Populus trichocarpa]
 gb|EEE98726.1| hypothetical protein POPTR_0014s13900g [Populus trichocarpa]
Length=170

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 119/139 (86%), Gaps = 3/139 (2%)
 Frame = +1

Query  322  VAGGGVHHHQL---SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFG  492
            +A G   + Q    SRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFG
Sbjct  9    IAEGSSENQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFG  68

Query  493  KTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASI  672
            KTKVH   C+F+GQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA ASI
Sbjct  69   KTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFANASI  128

Query  673  RVYLRDVRDSQAKARGIPY  729
            RVYLR+VRD QAKARGIP+
Sbjct  129  RVYLREVRDYQAKARGIPH  147



>ref|XP_010279129.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nelumbo 
nucifera]
Length=176

 Score =   232 bits (591),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +1

Query  325  AGGGVHHHQLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKV  504
            AG       LSRYESQKRRDWNTFGQYLKNQRP V+LSQC  SHVL FL+YLDQFGKTKV
Sbjct  17   AGEQQQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCSCSHVLEFLRYLDQFGKTKV  76

Query  505  HSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYL  684
            H   C+FFGQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPF   +IRVYL
Sbjct  77   HLQGCIFFGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFGSGAIRVYL  136

Query  685  RDVRDSQAKARGIPY  729
            R+VR+ QAKARGIPY
Sbjct  137  REVRECQAKARGIPY  151



>gb|KGN65636.1| hypothetical protein Csa_1G474480 [Cucumis sativus]
Length=186

 Score =   232 bits (591),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 128/168 (76%), Gaps = 20/168 (12%)
 Frame = +1

Query  229  STDERREYGE-GSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTFGQY  405
            ST+ R++  E GSSSR   T A                    LSRYESQKRRDWNTFGQY
Sbjct  2    STEGRKDPTEAGSSSRATTTTAA-------------------LSRYESQKRRDWNTFGQY  42

Query  406  LKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGS  585
            LKNQ PAV+LSQC+ +HVL FL+YLDQFGKTKVH H C+FFGQPDP  PCTCPLRQAWGS
Sbjct  43   LKNQTPAVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGS  102

Query  586  LDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            LDALIGRLRAAYEE+GG PETNPF   +IRVYLR+V++ QAKARGIPY
Sbjct  103  LDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARGIPY  150



>emb|CDO96796.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   232 bits (591),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V+LSQC+ +HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  38   LSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFG  97

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPF   +IRVYLR+V++ QAK
Sbjct  98   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFGNGAIRVYLREVKECQAK  157

Query  712  ARGIPY  729
            ARGIPY
Sbjct  158  ARGIPY  163



>ref|XP_008342774.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009354254.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
 ref|XP_009348397.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=185

 Score =   232 bits (591),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 118/140 (84%), Gaps = 5/140 (4%)
 Frame = +1

Query  325  AGGGVHHHQL-----SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQF  489
            AGG  +  Q      SRYESQKRRDWNTFGQYLKNQRP VALSQC+Y+HVL FL+YLDQF
Sbjct  19   AGGSPNDDQQQPATPSRYESQKRRDWNTFGQYLKNQRPPVALSQCNYNHVLEFLRYLDQF  78

Query  490  GKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIAS  669
            GKTKVH   C+F+GQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPFA  +
Sbjct  79   GKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFASGA  138

Query  670  IRVYLRDVRDSQAKARGIPY  729
            IRVYLR+VR+ QAKARGIPY
Sbjct  139  IRVYLREVRECQAKARGIPY  158



>gb|KHN36698.1| hypothetical protein glysoja_001429 [Glycine soja]
Length=175

 Score =   231 bits (590),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKVH   C+F+G
Sbjct  27   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYG  86

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  SIRVYL+++R+ QAK
Sbjct  87   QPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLKEIRECQAK  146

Query  712  ARGIPY  729
            ARGIPY
Sbjct  147  ARGIPY  152



>ref|XP_009774704.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=190

 Score =   232 bits (591),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 128/173 (74%), Gaps = 18/173 (10%)
 Frame = +1

Query  226  SSTDERREYGEGSSSRLAATMATppppqplqqVAGGGVHHH-----QLSRYESQKRRDWN  390
            SS    RE GEGSSS                 +     HH      QLSRYESQKRRDW 
Sbjct  3    SSEQRLREVGEGSSS-------------TSIMLEPSDDHHQLPSPPQLSRYESQKRRDWT  49

Query  391  TFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLR  570
            TFGQYLKN +P V LS C+Y+HVL+FL+YLDQFGKTKVH H C+FFG+ +  GPCTCPLR
Sbjct  50   TFGQYLKNHKPPVPLSNCNYNHVLDFLRYLDQFGKTKVHLHGCVFFGESEQGGPCTCPLR  109

Query  571  QAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            QAWGSLDALIGRLRAAYEENGGL ETNPFA ++IR+YLR+VRDSQAKARGIPY
Sbjct  110  QAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREVRDSQAKARGIPY  162



>ref|XP_011085992.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=175

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V+LS C+ +HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  23   LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLHGCVFFG  82

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+V+DSQAK
Sbjct  83   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKDSQAK  142

Query  712  ARGIPY  729
            ARGIPY
Sbjct  143  ARGIPY  148



>ref|XP_007132855.1| hypothetical protein PHAVU_011G130300g [Phaseolus vulgaris]
 gb|ESW04849.1| hypothetical protein PHAVU_011G130300g [Phaseolus vulgaris]
Length=183

 Score =   231 bits (590),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKVH   C+F+G
Sbjct  36   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYG  95

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  SIRVYLR+VR+ QAK
Sbjct  96   QPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAK  155

Query  712  ARGIPY  729
            ARGIPY
Sbjct  156  ARGIPY  161



>ref|XP_002522583.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39883.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score =   231 bits (589),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V+LSQC+ +HVL+FL+YLDQFGKTKVH H C+FFG
Sbjct  30   LSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFG  89

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+VR+ QAK
Sbjct  90   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAK  149

Query  712  ARGIPY  729
            ARGIPY
Sbjct  150  ARGIPY  155



>gb|KGN47252.1| hypothetical protein Csa_6G236080 [Cucumis sativus]
Length=205

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRPAVALSQC+++HVL FL+YLDQFGKTKVH   C+F+G 
Sbjct  30   SRYESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRYLDQFGKTKVHVQGCMFYGH  89

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPL+QAWGSLDALIGRLRAAYEENGG PETNPFA ASIR+YLR VR+ QAKA
Sbjct  90   PEPPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFATASIRLYLRQVRECQAKA  149

Query  715  RGIPY  729
            RGIPY
Sbjct  150  RGIPY  154



>ref|XP_004171262.1| PREDICTED: uncharacterized LOC101216601 [Cucumis sativus]
Length=206

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRPAVALSQC+++HVL FL+YLDQFGKTKVH   C+F+G 
Sbjct  30   SRYESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRYLDQFGKTKVHVQGCMFYGH  89

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPL+QAWGSLDALIGRLRAAYEENGG PETNPFA ASIR+YLR VR+ QAKA
Sbjct  90   PEPPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFATASIRLYLRQVRECQAKA  149

Query  715  RGIPY  729
            RGIPY
Sbjct  150  RGIPY  154



>ref|XP_009773140.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=188

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP VALSQC+ +HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  31   LSRYESQKRRDWNTFGQYLKNQRPPVALSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFG  90

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPF   +IR+YLR+V++ QAK
Sbjct  91   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKECQAK  150

Query  712  ARGIPY  729
            ARGIPY
Sbjct  151  ARGIPY  156



>ref|XP_007215057.1| hypothetical protein PRUPE_ppa012217mg [Prunus persica]
 ref|XP_008229093.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Prunus 
mume]
 gb|EMJ16256.1| hypothetical protein PRUPE_ppa012217mg [Prunus persica]
Length=179

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V LSQC+Y+HVL FL+YLDQFGKTKVH   C+F+GQ
Sbjct  30   SRYESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLRYLDQFGKTKVHLQGCMFYGQ  89

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VR+ QAKA
Sbjct  90   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKA  149

Query  715  RGIPY  729
            RGIPY
Sbjct  150  RGIPY  154



>gb|KDP35079.1| hypothetical protein JCGZ_11031 [Jatropha curcas]
Length=169

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  22   SRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHVQGCMFYGQ  81

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VRD QAKA
Sbjct  82   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRDCQAKA  141

Query  715  RGIPY  729
            RGIPY
Sbjct  142  RGIPY  146



>ref|XP_002301561.2| hypothetical protein POPTR_0002s22690g [Populus trichocarpa]
 gb|ABK94357.1| unknown [Populus trichocarpa]
 gb|EEE80834.2| hypothetical protein POPTR_0002s22690g [Populus trichocarpa]
Length=170

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 120/139 (86%), Gaps = 3/139 (2%)
 Frame = +1

Query  322  VAGGGVHHHQL---SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFG  492
            +A G + + Q    SRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFG
Sbjct  9    IAEGSIENQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFG  68

Query  493  KTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASI  672
            KTKVH  +C+F+GQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG  ETNPFA ASI
Sbjct  69   KTKVHLQSCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTLETNPFANASI  128

Query  673  RVYLRDVRDSQAKARGIPY  729
            RVYLR+V+D QAKARGIP+
Sbjct  129  RVYLREVKDYQAKARGIPH  147



>gb|AFK41155.1| unknown [Lotus japonicus]
Length=185

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQK+RDWNTFGQYL+NQRP VALSQC+ +HVL FL+YLDQFGKTKVHS  CLFFG
Sbjct  36   LSRYESQKKRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHSQGCLFFG  95

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +P GPCTCPL+QAWGSLDALIGRLRAAYEENGGLPETNPFA  SIRV+L +VRD QAK
Sbjct  96   QTEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGSIRVHLHEVRDFQAK  155

Query  712  ARGIPY  729
            ARGIPY
Sbjct  156  ARGIPY  161



>ref|XP_010655519.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Vitis 
vinifera]
 ref|XP_010655520.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Vitis 
vinifera]
Length=175

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V+L+QC  +HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  27   LSRYESQKRRDWNTFGQYLKNQRPPVSLAQCSCNHVLEFLRYLDQFGKTKVHLHGCVFFG  86

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+VRD Q+K
Sbjct  87   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDCQSK  146

Query  712  ARGIPY  729
            ARGIPY
Sbjct  147  ARGIPY  152



>emb|CAN72178.1| hypothetical protein VITISV_012478 [Vitis vinifera]
Length=175

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V+L+QC  +HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  27   LSRYESQKRRDWNTFGQYLKNQRPPVSLAQCSCNHVLEFLRYLDQFGKTKVHLHGCVFFG  86

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+VRD Q+K
Sbjct  87   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDCQSK  146

Query  712  ARGIPY  729
            ARGIPY
Sbjct  147  ARGIPY  152



>ref|XP_004516078.1| PREDICTED: uncharacterized protein LOC101514778 [Cicer arietinum]
Length=179

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP VALSQC+ + VL+FL+YLDQFGKTKVH   C+FFG
Sbjct  28   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLDFLRYLDQFGKTKVHVQGCIFFG  87

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +P  PCTCPL+QAWGSLDALIGRLRAAYEENGGLPETNPFA  +IR+YLR VRDSQAK
Sbjct  88   QVEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRLYLRQVRDSQAK  147

Query  712  ARGIPY  729
            ARGIPY
Sbjct  148  ARGIPY  153



>ref|XP_007149738.1| hypothetical protein PHAVU_005G095100g [Phaseolus vulgaris]
 gb|AGV54192.1| hypothetical protein [Phaseolus vulgaris]
 gb|ESW21732.1| hypothetical protein PHAVU_005G095100g [Phaseolus vulgaris]
Length=165

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKVH   C+F+G
Sbjct  20   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCVFYG  79

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA +SIR+YL+++R+ QAK
Sbjct  80   QPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFATSSIRLYLKEIRECQAK  139

Query  712  ARGIPY  729
            ARGIPY
Sbjct  140  ARGIPY  145



>ref|XP_004150559.1| PREDICTED: uncharacterized protein LOC101216601 [Cucumis sativus]
Length=226

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRPAVALSQC+++HVL FL+YLDQFGKTKVH   C+F+G 
Sbjct  30   SRYESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRYLDQFGKTKVHVQGCMFYGH  89

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPL+QAWGSLDALIGRLRAAYEENGG PETNPFA ASIR+YLR VR+ QAKA
Sbjct  90   PEPPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFATASIRLYLRQVRECQAKA  149

Query  715  RGIPY  729
            RGIPY
Sbjct  150  RGIPY  154



>ref|XP_006362411.1| PREDICTED: uncharacterized protein LOC102591189 [Solanum tuberosum]
Length=191

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V+LSQC+ +HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  32   LSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFG  91

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPF   +IR+YLR+V++ QAK
Sbjct  92   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKECQAK  151

Query  712  ARGIPY  729
            ARGIPY
Sbjct  152  ARGIPY  157



>ref|NP_001235660.1| uncharacterized protein LOC100306225 [Glycine max]
 gb|ACU14309.1| unknown [Glycine max]
Length=175

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKVH   C+F+G
Sbjct  27   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYG  86

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P  PCTCPLRQAWGSLDAL GRLRAAYEENGG PETNPFA  SIRVYL+++R+ QAK
Sbjct  87   QPEPPAPCTCPLRQAWGSLDALTGRLRAAYEENGGSPETNPFASGSIRVYLKEIRECQAK  146

Query  712  ARGIPY  729
            ARGIPY
Sbjct  147  ARGIPY  152



>ref|XP_006467647.1| PREDICTED: uncharacterized protein LOC102611919 [Citrus sinensis]
 gb|KDO77861.1| hypothetical protein CISIN_1g029090mg [Citrus sinensis]
Length=199

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V+LSQC  +HVL+FL+YLDQFGKTKVH H C+FFG
Sbjct  48   LSRYESQKRRDWNTFGQYLKNQRPPVSLSQCSCNHVLDFLRYLDQFGKTKVHLHGCVFFG  107

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+VR+ QAK
Sbjct  108  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAK  167

Query  712  ARGIPY  729
            ARGIPY
Sbjct  168  ARGIPY  173



>ref|XP_004233074.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=191

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  32   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFG  91

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPF   +IR+YLR+V++ QAK
Sbjct  92   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKECQAK  151

Query  712  ARGIPY  729
            ARGIPY
Sbjct  152  ARGIPY  157



>ref|XP_011101384.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=183

 Score =   229 bits (585),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V +SQC+ +HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  32   LSRYESQKRRDWNTFGQYLKNQRPPVPISQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFG  91

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+V+D QAK
Sbjct  92   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKDCQAK  151

Query  712  ARGIPY  729
            ARGIPY
Sbjct  152  ARGIPY  157



>gb|KDP21096.1| hypothetical protein JCGZ_21567 [Jatropha curcas]
Length=182

 Score =   229 bits (585),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V+LSQC+ +HVL+FL+YLDQFGKTKVH H C+FFGQ
Sbjct  34   SRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQ  93

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            PDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+VR+ QAKA
Sbjct  94   PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAKA  153

Query  715  RGIPY  729
            RGIPY
Sbjct  154  RGIPY  158



>ref|XP_006449503.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 ref|XP_006449504.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 gb|ESR62743.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 gb|ESR62744.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
Length=199

 Score =   230 bits (586),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V+LSQC  +HVL+FL+YLDQFGKTKVH H C+FFG
Sbjct  48   LSRYESQKRRDWNTFGQYLKNQRPPVSLSQCSCNHVLDFLRYLDQFGKTKVHLHGCVFFG  107

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+VR+ QAK
Sbjct  108  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAK  167

Query  712  ARGIPY  729
            ARGIPY
Sbjct  168  ARGIPY  173



>ref|XP_003607586.1| 177 protein [Medicago truncatula]
 gb|AES89783.1| DUF640 family protein [Medicago truncatula]
Length=176

 Score =   229 bits (584),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL N RP V LSQC+ +HVL+FL+YLDQFGKTKVH   C+F+G
Sbjct  27   LSRYESQKRRDWNTFGQYLNNMRPPVPLSQCNSNHVLDFLRYLDQFGKTKVHVQGCMFYG  86

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG P+TNPFA  SIRVYLR++R+SQAK
Sbjct  87   QPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPDTNPFASGSIRVYLREIRESQAK  146

Query  712  ARGIPY  729
            ARGIPY
Sbjct  147  ARGIPY  152



>gb|EYU45022.1| hypothetical protein MIMGU_mgv1a014215mg [Erythranthe guttata]
Length=197

 Score =   230 bits (586),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYL+NQRP V L QC+YSHVL F++YLDQFGKTKVH   C FFGQ
Sbjct  41   SRYESQKRRDWNTFGQYLRNQRPPVGLPQCNYSHVLEFMRYLDQFGKTKVHGQGCPFFGQ  100

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+PAGPC CPLRQAWGSLDAL+GRLRAAYEENGG  ETNPFA  +IRVYLR+VRDSQAKA
Sbjct  101  PEPAGPCACPLRQAWGSLDALVGRLRAAYEENGGSQETNPFANGAIRVYLREVRDSQAKA  160

Query  715  RGIPY  729
            RGIPY
Sbjct  161  RGIPY  165



>ref|XP_009608555.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=187

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  30   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFG  89

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPF   +IR+YLR+V++ QAK
Sbjct  90   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKECQAK  149

Query  712  ARGIPY  729
            ARGIPY
Sbjct  150  ARGIPY  155



>ref|XP_004485894.1| PREDICTED: uncharacterized protein LOC101502781 [Cicer arietinum]
Length=183

 Score =   229 bits (584),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQK+RDWNTFGQYL+NQ PAV+LSQC+++HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  32   LSRYESQKKRDWNTFGQYLRNQTPAVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFG  91

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PE NPF   +IRVYLR+V++ Q+K
Sbjct  92   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPENNPFGSGAIRVYLREVKECQSK  151

Query  712  ARGIPY  729
            ARGIPY
Sbjct  152  ARGIPY  157



>ref|XP_004174117.1| PREDICTED: uncharacterized protein LOC101228453 [Cucumis sativus]
Length=191

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQ PAV+LSQC+ +HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  29   LSRYESQKRRDWNTFGQYLKNQTPAVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFG  88

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+V++ QAK
Sbjct  89   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAK  148

Query  712  ARGIPY  729
            ARGIPY
Sbjct  149  ARGIPY  154



>ref|XP_003542999.1| PREDICTED: uncharacterized protein LOC100778886 [Glycine max]
Length=181

 Score =   229 bits (583),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQ P V+LSQC+++HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  31   LSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFG  90

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE GG PETNPF   +IRVYLR+V++ QAK
Sbjct  91   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEERGGSPETNPFGSGAIRVYLREVKECQAK  150

Query  712  ARGIPY  729
            ARGIPY
Sbjct  151  ARGIPY  156



>ref|XP_010035859.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Eucalyptus 
grandis]
 gb|KCW47341.1| hypothetical protein EUGRSUZ_K01128 [Eucalyptus grandis]
Length=174

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWN F QYLKNQRP V LSQC+Y+HVL FL+YLDQFGKTKVH   C+F+GQ
Sbjct  26   SRYESQKRRDWNAFIQYLKNQRPPVPLSQCNYTHVLEFLRYLDQFGKTKVHIQGCIFYGQ  85

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VRD Q+KA
Sbjct  86   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFASGAIRVYLREVRDCQSKA  145

Query  715  RGIPY  729
            RGIPY
Sbjct  146  RGIPY  150



>ref|XP_010104392.1| hypothetical protein L484_010344 [Morus notabilis]
 gb|EXC00237.1| hypothetical protein L484_010344 [Morus notabilis]
Length=173

 Score =   228 bits (582),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  24   SRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHVQGCMFYGQ  83

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VR+ QAKA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGFPETNPFASGAIRVYLREVRECQAKA  143

Query  715  RGIPY  729
            RGIPY
Sbjct  144  RGIPY  148



>ref|XP_002280666.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Vitis 
vinifera]
Length=167

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKVH   C+FFGQ
Sbjct  26   SRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFFGQ  85

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDAL+GRLRAAYEENGG PETNPFA  +IR+YLR+VR+ Q+KA
Sbjct  86   PEPPAPCTCPLRQAWGSLDALVGRLRAAYEENGGSPETNPFASGAIRIYLREVRECQSKA  145

Query  715  RGIPY  729
            RGIPY
Sbjct  146  RGIPY  150



>ref|XP_003526225.1| PREDICTED: uncharacterized protein LOC100815968 [Glycine max]
 gb|KHN33957.1| hypothetical protein glysoja_036764 [Glycine soja]
Length=179

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V LSQC+ + VL+FL+YLDQFGKTKVH   C+F+G
Sbjct  31   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNQVLDFLRYLDQFGKTKVHLQGCMFYG  90

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  SIRVYLR+VR+ QAK
Sbjct  91   QPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAK  150

Query  712  ARGIPY  729
            ARGIPY
Sbjct  151  ARGIPY  156



>ref|XP_002305745.1| hypothetical protein POPTR_0004s05610g [Populus trichocarpa]
 gb|ABK93578.1| unknown [Populus trichocarpa]
 gb|EEE86256.1| hypothetical protein POPTR_0004s05610g [Populus trichocarpa]
Length=177

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 118/137 (86%), Gaps = 4/137 (3%)
 Frame = +1

Query  331  GGVHHH----QLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKT  498
            GG HH      LSRYESQKRRDWNTFGQYLKNQRP V+LSQC+ +HVL+FL+YLDQFGKT
Sbjct  18   GGDHHQLQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKT  77

Query  499  KVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRV  678
            KVH H C+FFGQPDP  PCTCPLRQAWGSLDALIGRLRAA+EE+GG  ETNPF   +IRV
Sbjct  78   KVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAFEEHGGSAETNPFGNGAIRV  137

Query  679  YLRDVRDSQAKARGIPY  729
            YLR+V++ QAKARGIPY
Sbjct  138  YLREVKECQAKARGIPY  154



>ref|XP_008465553.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=182

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQ P V+LSQC+ +HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  26   LSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFG  85

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+V++ QAK
Sbjct  86   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAK  145

Query  712  ARGIPY  729
            ARGIPY
Sbjct  146  ARGIPY  151



>ref|XP_004303183.1| PREDICTED: uncharacterized protein LOC101307414 [Fragaria vesca 
subsp. vesca]
Length=209

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 116/136 (85%), Gaps = 6/136 (4%)
 Frame = +1

Query  340  HHHQL------SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTK  501
            HH Q       SRYESQKRRDWNTFGQYL+NQRP V LSQC+YSHVL FL+YLDQFGKTK
Sbjct  27   HHEQQQQPATPSRYESQKRRDWNTFGQYLRNQRPPVPLSQCNYSHVLEFLRYLDQFGKTK  86

Query  502  VHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVY  681
            VH   C+F+GQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PE+NPFA  +IRVY
Sbjct  87   VHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGAPESNPFASGAIRVY  146

Query  682  LRDVRDSQAKARGIPY  729
            LR+VR+ QAKARGIPY
Sbjct  147  LREVRECQAKARGIPY  162



>emb|CAN66524.1| hypothetical protein VITISV_034969 [Vitis vinifera]
Length=158

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKVH   C+FFGQ
Sbjct  26   SRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFFGQ  85

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDAL+GRLRAAYEENGG PETNPFA  +IR+YLR+VR+ Q+KA
Sbjct  86   PEPPAPCTCPLRQAWGSLDALVGRLRAAYEENGGSPETNPFASGAIRIYLREVRECQSKA  145

Query  715  RGIPY  729
            RGIPY
Sbjct  146  RGIPY  150



>ref|XP_007048693.1| Pleckstrin domain-containing family N member 1 [Theobroma cacao]
 gb|EOX92850.1| Pleckstrin domain-containing family N member 1 [Theobroma cacao]
Length=212

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 116/135 (86%), Gaps = 3/135 (2%)
 Frame = +1

Query  334  GVHHHQL---SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKV  504
            G H  Q    SRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKV
Sbjct  55   GDHQQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKV  114

Query  505  HSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYL  684
            H   C+F+GQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYL
Sbjct  115  HLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYL  174

Query  685  RDVRDSQAKARGIPY  729
            R+VR+ QAKARGIPY
Sbjct  175  REVRECQAKARGIPY  189



>ref|XP_002521586.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40857.1| conserved hypothetical protein [Ricinus communis]
Length=174

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  26   SRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQ  85

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRV+LR+VRD QAKA
Sbjct  86   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVFLREVRDCQAKA  145

Query  715  RGIPY  729
            RGIPY
Sbjct  146  RGIPY  150



>gb|KHG07235.1| Putative beta-lactamase-like 1 [Gossypium arboreum]
Length=175

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  28   SRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQ  87

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VR+ QAKA
Sbjct  88   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKA  147

Query  715  RGIPY  729
            RGIPY
Sbjct  148  RGIPY  152



>ref|XP_004487154.1| PREDICTED: uncharacterized protein LOC101499419 [Cicer arietinum]
Length=166

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +1

Query  322  VAGGGVHHHQLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTK  501
            V GG      LSRYESQKRRDWNTFGQYL NQRP + LS C+ +HVL FL+YLDQFGKTK
Sbjct  9    VEGGSTSPITLSRYESQKRRDWNTFGQYLNNQRPPIPLSHCNCNHVLEFLRYLDQFGKTK  68

Query  502  VHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVY  681
            VH   C+FFGQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG  ETNPFA ++IRVY
Sbjct  69   VHLQGCMFFGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFASSAIRVY  128

Query  682  LRDVRDSQAKARGIPY  729
            LR+VR+ QAKARGIPY
Sbjct  129  LREVRECQAKARGIPY  144



>ref|XP_009587002.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=180

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 127/170 (75%), Gaps = 21/170 (12%)
 Frame = +1

Query  226  SSTDERREYGEGSSSRLAATMATppppqplqqVAGGGVHHH--QLSRYESQKRRDWNTFG  399
            SS    RE GEG++S +A                    HH   QLSRY SQKRRDWNTFG
Sbjct  2    SSEQRLREVGEGTTSTIAN-------------------HHQPPQLSRYVSQKRRDWNTFG  42

Query  400  QYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAW  579
            QYLKN +P V LS C+Y+HVL+FL+YLDQFGKTKVH H C+FFG+ +   PCTCPLRQAW
Sbjct  43   QYLKNHKPPVPLSNCNYNHVLHFLRYLDQFGKTKVHLHGCIFFGESEQTEPCTCPLRQAW  102

Query  580  GSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            GSLDALIGRLRAAYEENGGL ETNPFA ++IR+YLR+VRDSQAKARGI Y
Sbjct  103  GSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREVRDSQAKARGISY  152



>emb|CDP15936.1| unnamed protein product [Coffea canephora]
Length=170

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V LSQC+ SHVL FL+YLDQFGKTKVH   C+F+GQ
Sbjct  21   SRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSSHVLEFLRYLDQFGKTKVHLQGCMFYGQ  80

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PE+NPFA  +IRVYLR+V++ QAKA
Sbjct  81   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPESNPFASGAIRVYLREVKECQAKA  140

Query  715  RGIPY  729
            RGIPY
Sbjct  141  RGIPY  145



>ref|XP_008225289.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Prunus 
mume]
Length=187

 Score =   227 bits (579),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQ P V+LSQC+ +HVL+FL+YLDQFGKTKVH H C+FFG
Sbjct  35   LSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFG  94

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+V++ QAK
Sbjct  95   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAK  154

Query  712  ARGIPY  729
            ARGIPY
Sbjct  155  ARGIPY  160



>ref|XP_011008476.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=177

 Score =   227 bits (578),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 117/134 (87%), Gaps = 5/134 (4%)
 Frame = +1

Query  343  HHQL-----SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVH  507
            HHQL     SRYESQKRRDWNTFGQYLKNQRP V+LSQC+ +HVL+FL+YLDQFGKTKVH
Sbjct  21   HHQLQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTKVH  80

Query  508  SHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLR  687
             H C+FFGQPDP  PCTCPLRQAWGSLDALIGRLRAA+EE+GG  ETNPF   +IRVYLR
Sbjct  81   LHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAFEEHGGSAETNPFGNGAIRVYLR  140

Query  688  DVRDSQAKARGIPY  729
            +V++ QAKARGIPY
Sbjct  141  EVKECQAKARGIPY  154



>ref|XP_010531928.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Tarenaya 
hassleriana]
Length=183

 Score =   227 bits (578),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = +1

Query  286  MATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLN  465
            MAT       ++VA G      LSRYESQKRRDWNTF QYL+NQRP V +SQC+ +++L+
Sbjct  1    MATSTRNTRGKEVAEGS-SPQPLSRYESQKRRDWNTFCQYLRNQRPPVHISQCNTNNILD  59

Query  466  FLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPE  645
            FL+YLDQFGKTKVH   C+FFGQPDP+G C CPLRQAWGSLDALIGRLRAAYEENGGLPE
Sbjct  60   FLRYLDQFGKTKVHLQGCVFFGQPDPSGQCNCPLRQAWGSLDALIGRLRAAYEENGGLPE  119

Query  646  TNPFAIASIRVYLRDVRDSQAKARGIPY  729
             NPFA   IRVYLR+VRDSQAKARG+PY
Sbjct  120  RNPFAGGGIRVYLREVRDSQAKARGVPY  147



>ref|XP_004293946.1| PREDICTED: uncharacterized protein LOC101295692 isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004293947.1| PREDICTED: uncharacterized protein LOC101295692 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=187

 Score =   227 bits (578),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQ P V +S C ++HVL+FL+YLDQFGKTKVH H C+FFG
Sbjct  36   LSRYESQKRRDWNTFGQYLKNQTPPVPMSHCQFNHVLDFLRYLDQFGKTKVHLHCCVFFG  95

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+V++ QAK
Sbjct  96   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGAPETNPFGNGAIRVYLREVKECQAK  155

Query  712  ARGIPY  729
            ARGIPY
Sbjct  156  ARGIPY  161



>gb|AFK49191.1| unknown [Medicago truncatula]
 gb|KEH36593.1| DUF640 family protein [Medicago truncatula]
Length=184

 Score =   226 bits (577),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQK+RDWNTFGQYL+NQ P V+LSQC+++HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  33   LSRYESQKKRDWNTFGQYLRNQSPPVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFG  92

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PE NPF   +IRVYLR+V++ Q+K
Sbjct  93   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPENNPFGTGAIRVYLREVKECQSK  152

Query  712  ARGIPY  729
            ARGIPY
Sbjct  153  ARGIPY  158



>ref|XP_007148048.1| hypothetical protein PHAVU_006G176100g [Phaseolus vulgaris]
 gb|ESW20042.1| hypothetical protein PHAVU_006G176100g [Phaseolus vulgaris]
Length=183

 Score =   226 bits (577),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQ P V+LS C+++HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  33   LSRYESQKRRDWNTFGQYLKNQTPPVSLSLCNFNHVLEFLRYLDQFGKTKVHLHGCIFFG  92

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+V++ QAK
Sbjct  93   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGSGAIRVYLREVKECQAK  152

Query  712  ARGIPY  729
            ARGIPY
Sbjct  153  ARGIPY  158



>ref|XP_011008166.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008167.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008168.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008170.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=170

 Score =   226 bits (576),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 118/139 (85%), Gaps = 3/139 (2%)
 Frame = +1

Query  322  VAGGGVHHHQL---SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFG  492
            +A G + + Q    SRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFG
Sbjct  9    IAEGSIENQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFG  68

Query  493  KTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASI  672
            KTKVH   C+F+GQP+P  PCTCPLRQAW SLDALIGRLRAAYEENGG  ETNPFA ASI
Sbjct  69   KTKVHLQGCMFYGQPEPPAPCTCPLRQAWCSLDALIGRLRAAYEENGGTLETNPFANASI  128

Query  673  RVYLRDVRDSQAKARGIPY  729
            RVYLR+V+D QAKARGIP+
Sbjct  129  RVYLREVKDYQAKARGIPH  147



>ref|XP_009786006.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=177

 Score =   226 bits (576),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP V++SQC+ +HVL FL+YLDQFGKTKVH   C+F+G
Sbjct  25   LSRYESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYG  84

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+V++ Q+K
Sbjct  85   QPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQSK  144

Query  712  ARGIPY  729
            ARGIPY
Sbjct  145  ARGIPY  150



>gb|KHG25854.1| Major vault [Gossypium arboreum]
Length=179

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 128/167 (77%), Gaps = 14/167 (8%)
 Frame = +1

Query  229  STDERREYGEGSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTFGQYL  408
            S ++ +E  EGSS  + A +              G  +  +LSRYESQKRRDW TFGQYL
Sbjct  3    SFNKGKEIIEGSSRSVTAVV--------------GVENPPRLSRYESQKRRDWITFGQYL  48

Query  409  KNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSL  588
            +N+RP VA+SQC+ +HVL+FL YLDQFGKTKVH   C+FFGQP+P GPC C LRQAWGSL
Sbjct  49   RNRRPPVAISQCNANHVLDFLGYLDQFGKTKVHLQGCMFFGQPEPPGPCACSLRQAWGSL  108

Query  589  DALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            DALIGRLRAAYEENGG PETNPFA  +IR+YLR+VRDSQAKARGIPY
Sbjct  109  DALIGRLRAAYEENGGSPETNPFANGAIRIYLREVRDSQAKARGIPY  155



>ref|NP_001237249.1| uncharacterized protein LOC100306082 [Glycine max]
 gb|ACU14083.1| unknown [Glycine max]
Length=181

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQ P V+LSQC+++HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  31   LSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFG  90

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG  ETNPF   +IRVYLR+V++ QAK
Sbjct  91   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSAETNPFGSGAIRVYLREVKECQAK  150

Query  712  ARGIPY  729
            ARGIPY
Sbjct  151  ARGIPY  156



>ref|XP_010052190.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Eucalyptus 
grandis]
 gb|KCW76110.1| hypothetical protein EUGRSUZ_D00487 [Eucalyptus grandis]
Length=177

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 126/168 (75%), Gaps = 14/168 (8%)
 Frame = +1

Query  226  SSTDERREYGEGSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTFGQY  405
            SST+ +R   EGSS  +    A P P                LSRYESQKRRDWNTFGQY
Sbjct  2    SSTEIQRNIAEGSSRSVIDQPALPAPAP--------------LSRYESQKRRDWNTFGQY  47

Query  406  LKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGS  585
            L+NQ+P VALSQC+ +HVL FL+YLDQFGKTKVH H C+FFGQ +P  PCTCPLRQAWGS
Sbjct  48   LRNQKPPVALSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQREPPAPCTCPLRQAWGS  107

Query  586  LDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            LDALIGRLRAAYEENGG PE NPF   +IRVYLR+V++ QAKARGIPY
Sbjct  108  LDALIGRLRAAYEENGGAPENNPFGNGAIRVYLREVKECQAKARGIPY  155



>ref|XP_004243287.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=167

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYL+NQRP V++SQC+ +HVL FL+YLDQFGKTKVH   C+F+GQ
Sbjct  20   SRYESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  79

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+V++ QAKA
Sbjct  80   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQAKA  139

Query  715  RGIPY  729
            RGIPY
Sbjct  140  RGIPY  144



>ref|XP_007212120.1| hypothetical protein PRUPE_ppa012018mg [Prunus persica]
 gb|EMJ13319.1| hypothetical protein PRUPE_ppa012018mg [Prunus persica]
Length=187

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQ P V+LSQC+ +HVL+FL+YLDQFGKTKVH H C+FFG
Sbjct  35   LSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFG  94

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPL+QAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+V++ QAK
Sbjct  95   QPDPPAPCTCPLKQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAK  154

Query  712  ARGIPY  729
            ARGIPY
Sbjct  155  ARGIPY  160



>ref|XP_006348870.1| PREDICTED: uncharacterized protein LOC102600485 [Solanum tuberosum]
Length=173

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYL+NQRP V++SQC+ +HVL FL+YLDQFGKTKVH   C+F+GQ
Sbjct  26   SRYESQKRRDWNTFGQYLRNQRPPVSMSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  85

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+V++ QAKA
Sbjct  86   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQAKA  145

Query  715  RGIPY  729
            RGIPY
Sbjct  146  RGIPY  150



>ref|XP_008381217.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
Length=181

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 117/140 (84%), Gaps = 5/140 (4%)
 Frame = +1

Query  325  AGGGVHHHQL-----SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQF  489
            AGG ++  Q      SRYESQKRRDWNTFGQYLKNQRP VALSQ +Y+HVL FL+YLDQF
Sbjct  15   AGGSLNDDQQQPATPSRYESQKRRDWNTFGQYLKNQRPPVALSQSNYNHVLEFLRYLDQF  74

Query  490  GKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIAS  669
            GKTKVH   C+F+GQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPFA  +
Sbjct  75   GKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFASGA  134

Query  670  IRVYLRDVRDSQAKARGIPY  729
            IRVYLR+VR+ QA ARGIP+
Sbjct  135  IRVYLREVRECQAMARGIPF  154



>ref|XP_006411528.1| hypothetical protein EUTSA_v10017308mg [Eutrema salsugineum]
 gb|ESQ52981.1| hypothetical protein EUTSA_v10017308mg [Eutrema salsugineum]
Length=177

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP+V +S C  +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  24   SRYESQKRRDWNTFGQYLKNQRPSVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQ  83

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VR+ QAKA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKA  143

Query  715  RGIPY  729
            RGIPY
Sbjct  144  RGIPY  148



>ref|XP_009343797.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=181

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 117/140 (84%), Gaps = 5/140 (4%)
 Frame = +1

Query  325  AGGGVHHHQL-----SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQF  489
            AGG ++  Q      SRYESQKRRDWNTFGQYLKNQRP VALSQ +Y+HVL FL+YLDQF
Sbjct  15   AGGSLNDDQQQPATPSRYESQKRRDWNTFGQYLKNQRPPVALSQSNYNHVLEFLRYLDQF  74

Query  490  GKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIAS  669
            GKTKVH   C+F+GQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPFA  +
Sbjct  75   GKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFASGA  134

Query  670  IRVYLRDVRDSQAKARGIPY  729
            IRVYLR+VR+ QA ARGIP+
Sbjct  135  IRVYLREVRECQAMARGIPF  154



>ref|XP_008371461.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_008371462.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009349575.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
 ref|XP_009349639.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=187

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQ P V+LS C+ +HVL+FL+YLDQFGKTKVH H C+FFG
Sbjct  39   LSRYESQKRRDWNTFGQYLKNQSPPVSLSHCNCNHVLDFLRYLDQFGKTKVHLHGCVFFG  98

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+V++ QAK
Sbjct  99   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAK  158

Query  712  ARGIPY  729
            ARGIPY
Sbjct  159  ARGIPY  164



>ref|XP_009133547.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Brassica 
rapa]
Length=177

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V +S C+ +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  24   SRYESQKRRDWNTFGQYLKNQRPPVPMSHCNCNHVLDFLRYLDQFGKTKVHVPGCMFYGQ  83

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VR+ QAKA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKA  143

Query  715  RGIPY  729
            RGIPY
Sbjct  144  RGIPY  148



>ref|XP_010052695.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Eucalyptus 
grandis]
 gb|KCW89641.1| hypothetical protein EUGRSUZ_A01916 [Eucalyptus grandis]
Length=176

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFG YL+NQRP V LSQC+ +HVL FL+YLDQFGKTKVH   C+F+GQ
Sbjct  27   SRYESQKRRDWNTFGHYLRNQRPPVPLSQCNCNHVLEFLRYLDQFGKTKVHLQGCVFYGQ  86

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VR+ QAKA
Sbjct  87   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKA  146

Query  715  RGIPY  729
            RGIPY
Sbjct  147  RGIPY  151



>emb|CDY14848.1| BnaC04g48450D [Brassica napus]
Length=177

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V +S C  +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  24   SRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVFGCMFYGQ  83

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VR+ QAKA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFATGAIRVYLREVRECQAKA  143

Query  715  RGIPY  729
            RGIPY
Sbjct  144  RGIPY  148



>ref|NP_565978.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_850374.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9S7R3.1|LSH10_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10; AltName: 
Full=Protein ORGAN BOUNDARY 10 [Arabidopsis thaliana]
 gb|AAF24517.1|AF218765_1 177 protein [Arabidopsis thaliana]
 gb|AAD22993.1| expressed protein [Arabidopsis thaliana]
 dbj|BAC43308.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43624.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39968.1| At2g42610 [Arabidopsis thaliana]
 gb|ABQ85148.1| unknown [Arabidopsis thaliana]
 gb|ABQ85149.1| unknown [Arabidopsis thaliana]
 gb|ABQ85150.1| unknown [Arabidopsis thaliana]
 gb|ABQ85151.1| unknown [Arabidopsis thaliana]
 gb|ABQ85152.1| unknown [Arabidopsis thaliana]
 gb|ABQ85153.1| unknown [Arabidopsis thaliana]
 gb|ABQ85154.1| unknown [Arabidopsis thaliana]
 gb|ABQ85155.1| unknown [Arabidopsis thaliana]
 gb|ABQ85156.1| unknown [Arabidopsis thaliana]
 gb|ABQ85157.1| unknown [Arabidopsis thaliana]
 gb|ABQ85158.1| unknown [Arabidopsis thaliana]
 gb|ABQ85159.1| unknown [Arabidopsis thaliana]
 gb|ABQ85160.1| unknown [Arabidopsis thaliana]
 gb|ABQ85161.1| unknown [Arabidopsis thaliana]
 gb|ABQ85162.1| unknown [Arabidopsis thaliana]
 gb|ABQ85163.1| unknown [Arabidopsis thaliana]
 gb|ABQ85164.1| unknown [Arabidopsis thaliana]
 gb|ABQ85165.1| unknown [Arabidopsis thaliana]
 gb|ABQ85166.1| unknown [Arabidopsis thaliana]
 gb|ABQ85167.1| unknown [Arabidopsis thaliana]
 gb|ABQ85168.1| unknown [Arabidopsis thaliana]
 gb|ABQ85169.1| unknown [Arabidopsis thaliana]
 gb|ABQ85170.1| unknown [Arabidopsis thaliana]
 gb|ABQ85171.1| unknown [Arabidopsis thaliana]
 gb|AEC10147.1| uncharacterized protein AT2G42610 [Arabidopsis thaliana]
 gb|AEC10148.1| uncharacterized protein AT2G42610 [Arabidopsis thaliana]
Length=177

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V +S C  +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  24   SRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQ  83

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VR+ QAKA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGPPETNPFASGAIRVYLREVRECQAKA  143

Query  715  RGIPY  729
            RGIPY
Sbjct  144  RGIPY  148



>ref|XP_009593391.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
 ref|XP_009593396.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=177

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL+NQRP V++SQC+ +HVL FL+YLDQFGKTKVH   C+F+G
Sbjct  25   LSRYESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYG  84

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+V++ Q+K
Sbjct  85   QPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQSK  144

Query  712  ARGIPY  729
            ARGIPY
Sbjct  145  ARGIPY  150



>gb|AES67378.2| DUF640 family protein [Medicago truncatula]
Length=167

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 115/139 (83%), Gaps = 3/139 (2%)
 Frame = +1

Query  322  VAGGGVHHHQ---LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFG  492
            +A GG    Q   LSRYESQKRRDWNTFGQYL N RP V LS C+ +HVL FL+YLDQFG
Sbjct  8    LAEGGSSTSQGITLSRYESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLDQFG  67

Query  493  KTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASI  672
            KTKVH   C+F+GQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +I
Sbjct  68   KTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFASGAI  127

Query  673  RVYLRDVRDSQAKARGIPY  729
            RVYLR+VR+ QAKARGIPY
Sbjct  128  RVYLREVRECQAKARGIPY  146



>ref|XP_011083008.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Sesamum 
indicum]
Length=172

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQ+LKNQRP VAL QC+ +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  25   SRYESQKRRDWNTFGQFLKNQRPPVALPQCNSNHVLDFLRYLDQFGKTKVHLQGCIFYGQ  84

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IR+YLR+V++ QAKA
Sbjct  85   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRIYLREVKECQAKA  144

Query  715  RGIPY  729
            RGIPY
Sbjct  145  RGIPY  149



>ref|XP_009142076.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Brassica 
rapa]
 emb|CDY47983.1| BnaA04g24610D [Brassica napus]
Length=176

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V +S C  +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  24   SRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVFGCMFYGQ  83

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VR+ QAKA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFATGAIRVYLREVRECQAKA  143

Query  715  RGIPY  729
            RGIPY
Sbjct  144  RGIPY  148



>ref|XP_006296565.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 ref|XP_006296566.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 gb|EOA29463.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 gb|EOA29464.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
Length=178

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V +S C  +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  24   SRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQ  83

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VR+ QAKA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKA  143

Query  715  RGIPY  729
            RGIPY
Sbjct  144  RGIPY  148



>gb|KGN55073.1| hypothetical protein Csa_4G627230 [Cucumis sativus]
Length=201

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            +SRYESQKRRDW TFGQYL+NQRP +A+SQC+ SHVL FL+YLDQFGKTKVH + C FFG
Sbjct  59   ISRYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKVHLNGCGFFG  118

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            +P+PAGPCTCPLRQAWGSLDALIGRLRAAYEENGG  +TNPFA  +IRVYLR+VRDSQ+K
Sbjct  119  EPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYLREVRDSQSK  178

Query  712  ARGIPY  729
            ARGIPY
Sbjct  179  ARGIPY  184



>ref|XP_008358651.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009352770.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=190

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQ P V+LS C+ +HVL+FL+YLDQFGKTKVH H C+FFG
Sbjct  39   LSRYESQKRRDWNTFGQYLKNQSPPVSLSHCNCNHVLDFLRYLDQFGKTKVHLHGCVFFG  98

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRVYLR+V++ QAK
Sbjct  99   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAK  158

Query  712  ARGIPY  729
            ARGIPY
Sbjct  159  ARGIPY  164



>ref|XP_010525031.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
 ref|XP_010525039.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=178

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  26   SRYESQKRRDWNTFGQYLKNQRPPVHLSQCNCNHVLDFLRYLDQFGKTKVHVPGCMFYGQ  85

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPFA  +IRVYLR+VR+ QAKA
Sbjct  86   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEMNPFATGAIRVYLREVRECQAKA  145

Query  715  RGIPY  729
            RGIPY
Sbjct  146  RGIPY  150



>ref|XP_010508549.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010508550.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010517796.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010517797.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
Length=178

 Score =   224 bits (572),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V +S C  +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  24   SRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQ  83

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VR+ QAKA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKA  143

Query  715  RGIPY  729
            RGIPY
Sbjct  144  RGIPY  148



>ref|XP_004146094.1| PREDICTED: uncharacterized protein LOC101204141 [Cucumis sativus]
Length=204

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            +SRYESQKRRDW TFGQYL+NQRP +A+SQC+ SHVL FL+YLDQFGKTKVH + C FFG
Sbjct  59   ISRYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKVHLNGCGFFG  118

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            +P+PAGPCTCPLRQAWGSLDALIGRLRAAYEENGG  +TNPFA  +IRVYLR+VRDSQ+K
Sbjct  119  EPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYLREVRDSQSK  178

Query  712  ARGIPY  729
            ARGIPY
Sbjct  179  ARGIPY  184



>ref|XP_010524062.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=176

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKVH+  C+F+GQ
Sbjct  26   SRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHAPGCMFYGQ  85

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PC CPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRV+LR+VR+ QAKA
Sbjct  86   PEPPAPCICPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVFLREVRECQAKA  145

Query  715  RGIPY  729
            RGIPY
Sbjct  146  RGIPY  150



>ref|XP_010506094.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Camelina 
sativa]
 ref|XP_010506095.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Camelina 
sativa]
Length=178

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V +S C  +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  24   SRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQ  83

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VR+ QAKA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKA  143

Query  715  RGIPY  729
            RGIPY
Sbjct  144  RGIPY  148



>ref|XP_004171006.1| PREDICTED: uncharacterized LOC101204141, partial [Cucumis sativus]
Length=200

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            +SRYESQKRRDW TFGQYL+NQRP +A+SQC+ SHVL FL+YLDQFGKTKVH + C FFG
Sbjct  60   ISRYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKVHLNGCGFFG  119

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            +P+PAGPCTCPLRQAWGSLDALIGRLRAAYEENGG  +TNPFA  +IRVYLR+VRDSQ+K
Sbjct  120  EPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYLREVRDSQSK  179

Query  712  ARGIPY  729
            ARGIPY
Sbjct  180  ARGIPY  185



>ref|XP_008463732.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=199

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            +SRYESQKRRDW TFGQYL+NQRP +A+SQC+ SHVL FL+YLDQFGKTKVH + C FFG
Sbjct  57   ISRYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKVHLNGCGFFG  116

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            +P+PAGPCTCPLRQAWGSLDALIGRLRAAYEENGG  +TNPFA  +IRVYLR+VRDSQ+K
Sbjct  117  EPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYLREVRDSQSK  176

Query  712  ARGIPY  729
            ARGIPY
Sbjct  177  ARGIPY  182



>ref|XP_010549405.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=190

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  334  GVHHHQLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSH  513
            G  H QLSRYESQK RDWNTFGQYL NQRP V+++Q +++HV+NFLKYLDQFGKTKVH H
Sbjct  18   GPIHRQLSRYESQKLRDWNTFGQYLNNQRPPVSVTQFNFNHVINFLKYLDQFGKTKVHHH  77

Query  514  ACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDV  693
             C FFGQPDP GPCTCPL+QAWGSLDALIGRLRAAYEE+GG P  NPF   +IRVYLR+V
Sbjct  78   GCAFFGQPDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGSPGLNPFGNGAIRVYLREV  137

Query  694  RDSQAKARGIPY  729
            RDSQ+KARGI Y
Sbjct  138  RDSQSKARGIQY  149



>ref|XP_010553628.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
 ref|XP_010553707.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=170

 Score =   224 bits (571),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP + LSQC  SHVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  27   SRYESQKRRDWNTFGQYLKNQRPPMPLSQCSCSHVLDFLRYLDQFGKTKVHVPGCMFYGQ  86

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PC CPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IR YL++VRD QAKA
Sbjct  87   PEPPAPCICPLRQAWGSLDALIGRLRAAYEENGGPPETNPFASGAIRAYLKEVRDCQAKA  146

Query  715  RGIPY  729
            RGIPY
Sbjct  147  RGIPY  151



>ref|XP_003597127.1| 177 protein [Medicago truncatula]
Length=186

 Score =   224 bits (572),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 115/139 (83%), Gaps = 3/139 (2%)
 Frame = +1

Query  322  VAGGGVHHHQ---LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFG  492
            +A GG    Q   LSRYESQKRRDWNTFGQYL N RP V LS C+ +HVL FL+YLDQFG
Sbjct  8    LAEGGSSTSQGITLSRYESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLDQFG  67

Query  493  KTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASI  672
            KTKVH   C+F+GQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +I
Sbjct  68   KTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFASGAI  127

Query  673  RVYLRDVRDSQAKARGIPY  729
            RVYLR+VR+ QAKARGIPY
Sbjct  128  RVYLREVRECQAKARGIPY  146



>gb|AFK41138.1| unknown [Lotus japonicus]
Length=173

 Score =   223 bits (569),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYL NQRP V LSQC+++HV+ FL+YLDQFGKTKVH   C++FG
Sbjct  24   LSRYESQKRRDWNTFGQYLNNQRPPVPLSQCNFNHVMEFLRYLDQFGKTKVHLQGCVYFG  83

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
             P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPFA   IRVYLR+VR+ QAK
Sbjct  84   MPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEANPFASGFIRVYLREVRECQAK  143

Query  712  ARGIPY  729
            ARGIPY
Sbjct  144  ARGIPY  149



>gb|EPS69070.1| hypothetical protein M569_05697, partial [Genlisea aurea]
Length=131

 Score =   222 bits (565),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQ+L+NQRP VALSQC+ +HVL+FL+YLDQFGKT+VH+  C+F+GQ
Sbjct  4    SRYESQKRRDWNTFGQFLRNQRPPVALSQCNINHVLDFLRYLDQFGKTRVHAQGCIFYGQ  63

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PC CPL+QAWGSLDALIGRLRAAYEENGG PETNPFA A+IRV+LR++++ QAKA
Sbjct  64   PEPPAPCGCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASAAIRVFLREIKECQAKA  123

Query  715  RGIPY  729
            RGIPY
Sbjct  124  RGIPY  128



>ref|XP_011098044.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like, 
partial [Sesamum indicum]
Length=157

 Score =   223 bits (567),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQ+L+NQRP VALSQC   HVL FL+YLDQFGKTKVH   C+F+GQ
Sbjct  24   SRYESQKRRDWNTFGQFLRNQRPPVALSQCSSGHVLEFLRYLDQFGKTKVHLQGCIFYGQ  83

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG  ETNPFA ++IR+YLR+V++SQAKA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGPQETNPFASSAIRIYLREVKESQAKA  143

Query  715  RGIPY  729
            RGIPY
Sbjct  144  RGIPY  148



>ref|XP_006442831.1| hypothetical protein CICLE_v10023710mg [Citrus clementina]
 gb|ESR56071.1| hypothetical protein CICLE_v10023710mg [Citrus clementina]
Length=332

 Score =   229 bits (583),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V LSQC  SHVL FL+YLDQFGKTKVH   C+F+G
Sbjct  183  LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCSSSHVLEFLRYLDQFGKTKVHLQGCMFYG  242

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA   +RV+L +VR+ QAK
Sbjct  243  QPNPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGEMRVFLGEVRERQAK  302

Query  712  ARGIPY  729
            ARGIPY
Sbjct  303  ARGIPY  308



>gb|ACJ85482.1| unknown [Medicago truncatula]
 gb|AFK37885.1| unknown [Medicago truncatula]
Length=167

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 115/139 (83%), Gaps = 3/139 (2%)
 Frame = +1

Query  322  VAGGGVHHHQ---LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFG  492
            +A GG    Q   LSRYESQKRRDWNTFGQYL N RP V LS C+ +HVL FL+YLDQFG
Sbjct  8    LAEGGSSTSQGITLSRYESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLDQFG  67

Query  493  KTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASI  672
            KTKVH   C+F+GQP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +I
Sbjct  68   KTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGAPETNPFASGAI  127

Query  673  RVYLRDVRDSQAKARGIPY  729
            RVYLR+VR+ +AKARGIPY
Sbjct  128  RVYLREVRECRAKARGIPY  146



>ref|XP_002879996.1| hypothetical protein ARALYDRAFT_903634 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56255.1| hypothetical protein ARALYDRAFT_903634 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score =   223 bits (567),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKNQRP V +S C  +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  24   SRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQ  83

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPFA  +IRVYLR+VR+ QAKA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEANPFASGAIRVYLREVRECQAKA  143

Query  715  RGIPY  729
            RGIPY
Sbjct  144  RGIPY  148



>ref|XP_010540518.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
Length=179

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +1

Query  340  HHHQLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHAC  519
               QLSRYESQKRRDWNTFGQYLKNQRP V+ +Q  ++HV++FLKYLDQFGKTKVH H C
Sbjct  10   QQQQLSRYESQKRRDWNTFGQYLKNQRPPVSFAQLSFNHVIDFLKYLDQFGKTKVHHHGC  69

Query  520  LFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRD  699
            +FFGQPDP GPCTCPL+QAWGSLDALIGRLRAA+EE+GG  + NPF   +IRVYLR+VRD
Sbjct  70   VFFGQPDPPGPCTCPLKQAWGSLDALIGRLRAAFEEHGGSSDQNPFGNGAIRVYLREVRD  129

Query  700  SQAKARGIPY  729
            SQ+KARGI Y
Sbjct  130  SQSKARGIQY  139



>ref|XP_011011486.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=177

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 117/137 (85%), Gaps = 5/137 (4%)
 Frame = +1

Query  334  GVHHHQ-----LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKT  498
            G  H+Q     LSRYESQKRRDWNTFGQYLKNQRP V+LSQ + +HVL+FL+YLDQFGKT
Sbjct  18   GSDHYQPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQSNCNHVLDFLRYLDQFGKT  77

Query  499  KVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRV  678
            KVH H C+FFGQP+P  PCTCPLRQAWGSLDALIGRLRAAYEE+GG  ETNPF   +IRV
Sbjct  78   KVHLHGCVFFGQPNPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSAETNPFGNGAIRV  137

Query  679  YLRDVRDSQAKARGIPY  729
            YLR+V++ QAKARGIPY
Sbjct  138  YLREVKECQAKARGIPY  154



>ref|XP_002317421.1| hypothetical protein POPTR_0011s07350g [Populus trichocarpa]
 gb|ABK94387.1| unknown [Populus trichocarpa]
 gb|EEE98033.1| hypothetical protein POPTR_0011s07350g [Populus trichocarpa]
Length=177

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 117/137 (85%), Gaps = 4/137 (3%)
 Frame = +1

Query  331  GGVHHHQ----LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKT  498
            GG H+      LSRYESQKRRDWNTFGQYLKNQRP V+LSQ + +HVL+FL+YLDQFGKT
Sbjct  18   GGDHYQPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQSNCNHVLDFLRYLDQFGKT  77

Query  499  KVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRV  678
            KVH H C+FFGQP+P  PCTCPLRQAWGSLDALIGRLRAAYEE+GG  ETNPF   +IRV
Sbjct  78   KVHLHGCVFFGQPNPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSAETNPFGNGAIRV  137

Query  679  YLRDVRDSQAKARGIPY  729
            YLR+V++ QAKARGIPY
Sbjct  138  YLREVKECQAKARGIPY  154



>emb|CDY55387.1| BnaA05g34250D [Brassica napus]
Length=178

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYL+NQRP + +S C+ +HVL+FL+YLDQFGKTKVH   C+F+GQ
Sbjct  24   SRYESQKRRDWNTFGQYLRNQRPPLPMSHCNCNHVLDFLRYLDQFGKTKVHVPGCMFYGQ  83

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VR+ QAKA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKA  143

Query  715  RGIPY  729
            RGIP+
Sbjct  144  RGIPF  148



>gb|EYU30777.1| hypothetical protein MIMGU_mgv1a014751mg [Erythranthe guttata]
Length=179

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQ+L+N RPAV ++QC+ SHVL+F++YLDQFGKTKVHS  C F+GQ
Sbjct  24   SRYESQKRRDWNTFGQFLRNMRPAVGVAQCNSSHVLDFMRYLDQFGKTKVHSQGCTFYGQ  83

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDAL+GRLRAAYEENGG PE+NPFA +SIR+YLR+V++ Q+KA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALVGRLRAAYEENGGSPESNPFASSSIRMYLREVKECQSKA  143

Query  715  RGIPY  729
            RGIPY
Sbjct  144  RGIPY  148



>gb|EPS59921.1| hypothetical protein M569_14884, partial [Genlisea aurea]
Length=143

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYLKNQRP V L  C+YSHVL+F++YLDQFGKTKVH   C+FFG
Sbjct  11   LSRYESQKRRDWNTFRQYLKNQRPPVPLEHCNYSHVLDFMRYLDQFGKTKVHLRGCVFFG  70

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP G CTCPLRQAWGSLDAL+GRLRAAYE NGG  ETNPFA  +IRVYLR+VRD QAK
Sbjct  71   QPDPDGACTCPLRQAWGSLDALVGRLRAAYEGNGGSQETNPFADGAIRVYLREVRDLQAK  130

Query  712  ARGIPY  729
            ARGIPY
Sbjct  131  ARGIPY  136



>ref|XP_011098405.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=173

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  373  KRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGP  552
            KRRDWNTFGQYL+NQRP V L QC+YSHVL+FL+YLDQFGKTKVH   C+FFGQP+PAGP
Sbjct  24   KRRDWNTFGQYLRNQRPPVGLPQCNYSHVLDFLRYLDQFGKTKVHVQGCVFFGQPEPAGP  83

Query  553  CTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            C+CPLRQAWGSLDALIGRLRAAYEENGG  ETNPFA  +IRVYLR+VR+SQAKARGIPY
Sbjct  84   CSCPLRQAWGSLDALIGRLRAAYEENGGAAETNPFANGAIRVYLREVRESQAKARGIPY  142



>ref|XP_009142855.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142857.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142858.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142859.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142860.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
Length=178

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYL+NQRP + +S C+ +HVL+FL++LDQFGKTKVH   C+F+GQ
Sbjct  24   SRYESQKRRDWNTFGQYLRNQRPPLPMSHCNCNHVLDFLRHLDQFGKTKVHVPGCMFYGQ  83

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+VR+ QAKA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKA  143

Query  715  RGIPY  729
            RGIP+
Sbjct  144  RGIPF  148



>ref|XP_009106595.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Brassica 
rapa]
 emb|CDX87432.1| BnaA07g34410D [Brassica napus]
Length=190

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYL+NQ+P V +SQC  +H+L+FL+YLDQFGKTKVH H C+FFG
Sbjct  38   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFG  97

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +PAG C CPL+QAWGSLDALIGRLRAAYEENGGLPE NPFA   IRV+LR+VRDSQAK
Sbjct  98   QVEPAGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAK  157

Query  712  ARGIPY  729
            ARG+PY
Sbjct  158  ARGVPY  163



>ref|XP_006389954.1| hypothetical protein EUTSA_v10019792mg [Eutrema salsugineum]
 gb|ESQ27240.1| hypothetical protein EUTSA_v10019792mg [Eutrema salsugineum]
Length=188

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYL+NQ+P V +SQC  +H+L+FL+YLDQFGKTKVH H C+FFG
Sbjct  32   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFG  91

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +PAG C CPL+QAWGSLDALIGRLRAAYEENGGLPE NPFA   IRV+LR+VRDSQAK
Sbjct  92   QVEPAGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAK  151

Query  712  ARGIPY  729
            ARG+PY
Sbjct  152  ARGVPY  157



>ref|XP_010429720.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Camelina 
sativa]
Length=193

 Score =   219 bits (558),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYL+NQ+P V +SQC  +H+L+FL+YLDQFGKTKVH H C+FFG
Sbjct  36   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFG  95

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +PAG C CPL+QAWGSLDALIGRLRAA+EENGGLPE NPFA   IRV+LR+VRDSQAK
Sbjct  96   QVEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAK  155

Query  712  ARGIPY  729
            ARG+PY
Sbjct  156  ARGVPY  161



>emb|CDX88480.1| BnaC06g39240D [Brassica napus]
Length=185

 Score =   219 bits (557),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYL+NQ P V +SQC  +H+L+FL+YLDQFGKTKVH H C+FFG
Sbjct  33   LSRYESQKRRDWNTFCQYLRNQHPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFG  92

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +PAG C CPL+QAWGSLDALIGRLRAAYEENGGLPE NPFA   IRV+LR+VRDSQAK
Sbjct  93   QVEPAGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAK  152

Query  712  ARGIPY  729
            ARG+PY
Sbjct  153  ARGVPY  158



>gb|KFK28531.1| hypothetical protein AALP_AA7G008800 [Arabis alpina]
Length=194

 Score =   219 bits (558),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLK+Q P + +SQ  Y+HVL+FL+YLDQFGKTKVH  AC+FFGQ
Sbjct  39   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  98

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQAK  711
            PDP GPCTCPLRQAWGSLDALIGRLRAAYEE+ GG PETNPFA  SIRV+LR+VR+SQAK
Sbjct  99   PDPPGPCTCPLRQAWGSLDALIGRLRAAYEEHGGGSPETNPFANGSIRVHLREVRESQAK  158

Query  712  ARGIPY  729
            ARGIPY
Sbjct  159  ARGIPY  164



>ref|XP_010417489.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Camelina 
sativa]
Length=196

 Score =   219 bits (558),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYL+NQ+P V +SQC  +H+L+FL+YLDQFGKTKVH H C+FFG
Sbjct  39   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFG  98

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +PAG C CPL+QAWGSLDALIGRLRAA+EENGGLPE NPFA   IRV+LR+VRDSQAK
Sbjct  99   QVEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAK  158

Query  712  ARGIPY  729
            ARG+PY
Sbjct  159  ARGVPY  164



>ref|NP_565190.1| protein LIGHT SENSITIVE HYPOCOTYLS 7 [Arabidopsis thaliana]
 sp|Q9ZVA0.1|LSH7_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7; AltName: 
Full=Protein ORGAN BOUNDARY 7 [Arabidopsis thaliana]
 gb|AAC83029.1| Strong similarity to T16B12.3 gi|3746060 unknown protein from 
Arabidopsis thaliana BAC gb|AC005311 [Arabidopsis thaliana]
 gb|AEE36158.1| uncharacterized protein AT1G78815 [Arabidopsis thaliana]
Length=195

 Score =   219 bits (558),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYL+NQ+P V +SQC  +H+L+FL+YLDQFGKTKVH H C+FFG
Sbjct  38   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFG  97

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +PAG C CPL+QAWGSLDALIGRLRAA+EENGGLPE NPFA   IRV+LR+VRDSQAK
Sbjct  98   QVEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAK  157

Query  712  ARGIPY  729
            ARG+PY
Sbjct  158  ARGVPY  163



>ref|XP_002889213.1| At1g78815 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65472.1| At1g78815 [Arabidopsis lyrata subsp. lyrata]
Length=191

 Score =   219 bits (558),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYL+NQ+P V +SQC  +H+L+FL+YLDQFGKTKVH H C+FFG
Sbjct  34   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFG  93

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +PAG C CPL+QAWGSLDALIGRLRAA+EENGGLPE NPFA   IRV+LR+VRDSQAK
Sbjct  94   QVEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAK  153

Query  712  ARGIPY  729
            ARG+PY
Sbjct  154  ARGVPY  159



>emb|CDY67351.1| BnaCnng54640D [Brassica napus]
Length=193

 Score =   219 bits (557),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 114/127 (90%), Gaps = 1/127 (1%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYLK+Q P + +SQ  Y+HVL+FL+YLDQFGKTKVH  AC+FFG
Sbjct  35   LSRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFG  94

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQA  708
            QPDP GPCTCPL+QAWGSLDALIGRLRAAYEE+ GG P+TNPFA  SIRV+LR+VR+SQA
Sbjct  95   QPDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQA  154

Query  709  KARGIPY  729
            KARGIPY
Sbjct  155  KARGIPY  161



>gb|ABF83646.1| At1g78815 [Arabidopsis thaliana]
Length=195

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYL+NQ+P V +SQC  +H+L+FL+YLDQFGKTKVH H C+FFG
Sbjct  38   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFG  97

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +PAG C CPL+QAWGSLDALIGRLRAA+EENGGLPE NPFA   IRV+LR+VRDSQAK
Sbjct  98   QVEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAK  157

Query  712  ARGIPY  729
            ARG+PY
Sbjct  158  ARGVPY  163



>ref|XP_009108375.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Brassica 
rapa]
 ref|XP_009108376.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Brassica 
rapa]
Length=193

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 114/127 (90%), Gaps = 1/127 (1%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYLK+Q P + +SQ  Y+HVL+FL+YLDQFGKTKVH  AC+FFG
Sbjct  37   LSRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFG  96

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQA  708
            QPDP GPCTCPL+QAWGSLDALIGRLRAAYEE+ GG P+TNPFA  SIRV+LR+VR+SQA
Sbjct  97   QPDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQA  156

Query  709  KARGIPY  729
            KARGIPY
Sbjct  157  KARGIPY  163



>emb|CDX76510.1| BnaA08g08900D [Brassica napus]
Length=193

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 114/127 (90%), Gaps = 1/127 (1%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYLK+Q P + +SQ  Y+HVL+FL+YLDQFGKTKVH  AC+FFG
Sbjct  37   LSRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFG  96

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQA  708
            QPDP GPCTCPL+QAWGSLDALIGRLRAAYEE+ GG P+TNPFA  SIRV+LR+VR+SQA
Sbjct  97   QPDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQA  156

Query  709  KARGIPY  729
            KARGIPY
Sbjct  157  KARGIPY  163



>ref|XP_009626514.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=176

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYL+NQR  + LSQC+ +HVL FL+YLDQFGKTKVH   C+F+GQ
Sbjct  27   SRYESQKRRDWNTFNQYLRNQRQPIPLSQCNSNHVLEFLRYLDQFGKTKVHLQGCMFYGQ  86

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+V++ QAKA
Sbjct  87   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASTAIRVYLREVKECQAKA  146

Query  715  RGIPY  729
            RGI Y
Sbjct  147  RGIAY  151



>gb|AAM64330.1| unknown [Arabidopsis thaliana]
Length=195

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYL+NQ+P V +SQC  +H+L+FL+YLDQFGKTKVH H C+FFG
Sbjct  38   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFG  97

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +PAG C CPL+QAWGSLDALIGRLRAA+EENGGLPE NPFA   IRV+LR+VRDSQAK
Sbjct  98   QVEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAK  157

Query  712  ARGIPY  729
            ARG+PY
Sbjct  158  ARGVPY  163



>gb|KFK42237.1| hypothetical protein AALP_AA2G229400 [Arabis alpina]
Length=200

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYL+NQ+P V +SQC  +H+L+FL+YLDQFGKTKVH H C+FFG
Sbjct  42   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFG  101

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +P G C CPL+QAWGSLDALIGRLRAAYEENGGLPE NPFA   IRV+LR+VRDSQAK
Sbjct  102  QVEPPGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAK  161

Query  712  ARGIPY  729
            ARG+PY
Sbjct  162  ARGVPY  167



>ref|XP_008455303.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Cucumis 
melo]
Length=188

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLKNQRP V LS C+ + VL FL+YLDQFGKTKVH   C+F+GQ
Sbjct  31   SRYESQKRRDWNTFCQYLKNQRPPVPLSHCNCNQVLEFLRYLDQFGKTKVHIQGCMFYGQ  90

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG  ETNPFA  +IRVYLRDVR+ QAKA
Sbjct  91   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFASGAIRVYLRDVRECQAKA  150

Query  715  RGIPY  729
            RGIPY
Sbjct  151  RGIPY  155



>ref|XP_004136831.1| PREDICTED: uncharacterized protein LOC101208687 [Cucumis sativus]
 ref|XP_004155471.1| PREDICTED: uncharacterized protein LOC101230404 [Cucumis sativus]
 gb|KGN43628.1| hypothetical protein Csa_7G048120 [Cucumis sativus]
Length=189

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLKNQRP V LS C+ + VL FL+YLDQFGKTKVH   C+F+GQ
Sbjct  32   SRYESQKRRDWNTFCQYLKNQRPPVPLSHCNCNQVLEFLRYLDQFGKTKVHIQGCMFYGQ  91

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG  ETNPFA  +IRVYLRDVR+ QAKA
Sbjct  92   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFASGAIRVYLRDVRECQAKA  151

Query  715  RGIPY  729
            RGIPY
Sbjct  152  RGIPY  156



>emb|CDY34056.1| BnaC03g62760D [Brassica napus]
Length=193

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 113/127 (89%), Gaps = 1/127 (1%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYLK+Q P   +SQ  Y+HVL+FL+YLDQFGKTKVH  AC+FFG
Sbjct  37   LSRYESQKRRDWNTFIQYLKSQNPPQMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFG  96

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQA  708
            QPDP GPCTCPL+QAWGSLDALIGRLRAAYEE+ GG P+TNPFA  SIRV+LR+VR+SQA
Sbjct  97   QPDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQA  156

Query  709  KARGIPY  729
            KARGIPY
Sbjct  157  KARGIPY  163



>ref|XP_006286146.1| hypothetical protein CARUB_v10007704mg [Capsella rubella]
 gb|EOA19044.1| hypothetical protein CARUB_v10007704mg [Capsella rubella]
Length=191

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLK+Q P + +SQ  Y+HVL+FL+YLDQFGKTKVH  AC+FFGQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHQQACVFFGQ  95

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQAK  711
            PDP GPCTCPL+QAWGSLDALIGRLRAAYEE+ GG P+TNPFA  SIRV+LR+VR+SQAK
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAK  155

Query  712  ARGIPY  729
            ARGIPY
Sbjct  156  ARGIPY  161



>emb|CDY14588.1| BnaC02g25250D [Brassica napus]
Length=190

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQK+RDWNTF QYL+NQ+P V +SQC  +H+L+FL+YLDQFGKTKVH+H C+FFG
Sbjct  33   LSRYESQKKRDWNTFCQYLRNQQPPVHVSQCGSNHILDFLQYLDQFGKTKVHAHGCVFFG  92

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +P+G C CPL+QAWGSLDALIGRLRAAYEENGGLPE NPFA   IRV+L++VRDSQAK
Sbjct  93   QVEPSGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLKEVRDSQAK  152

Query  712  ARGIPY  729
            ARG+PY
Sbjct  153  ARGVPY  158



>emb|CDY26881.1| BnaA02g19060D [Brassica napus]
Length=191

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQK+RDWNTF QYL+NQ+P V +SQC  +H+L+FL+YLDQFGKTKVH+H C+FFG
Sbjct  33   LSRYESQKKRDWNTFCQYLRNQQPPVHVSQCGSNHILDFLQYLDQFGKTKVHAHGCVFFG  92

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +P+G C CPL+QAWGSLDALIGRLRAAYEENGGLPE NPFA   IRV+L++VRDSQAK
Sbjct  93   QVEPSGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLKEVRDSQAK  152

Query  712  ARGIPY  729
            ARG+PY
Sbjct  153  ARGVPY  158



>ref|NP_193596.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SN52.1|LSH9_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9; AltName: 
Full=Protein ORGAN BOUNDARY 9 [Arabidopsis thaliana]
 emb|CAB37446.1| putative protein [Arabidopsis thaliana]
 emb|CAB78863.1| putative protein [Arabidopsis thaliana]
 gb|AAR24223.1| At4g18610 [Arabidopsis thaliana]
 gb|AAT35235.1| At4g18610 [Arabidopsis thaliana]
 gb|AEE84068.1| uncharacterized protein AT4G18610 [Arabidopsis thaliana]
Length=191

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLK+Q P + +SQ  Y+HVL+FL+YLDQFGKTKVH  AC+FFGQ
Sbjct  36   SRYESQKRRDWNTFVQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQAK  711
            PDP GPCTCPL+QAWGSLDALIGRLRAAYEE+ GG P+TNPFA  SIRV+LR+VR+SQAK
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAK  155

Query  712  ARGIPY  729
            ARGIPY
Sbjct  156  ARGIPY  161



>emb|CDY69731.1| BnaCnng65050D [Brassica napus]
Length=195

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +1

Query  349  QLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFF  528
            QLSRYE+QKRRDWNTFGQYL+N RP ++LS+C  +HVL FL+YLDQFGKTKVH+  C FF
Sbjct  44   QLSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFF  103

Query  529  GQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQA  708
            G P+P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPF   ++R+YLR+VRDSQA
Sbjct  104  GHPNPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQA  163

Query  709  KARGIPY  729
            KARGI Y
Sbjct  164  KARGISY  170



>ref|XP_010439831.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Camelina 
sativa]
Length=191

 Score =   216 bits (551),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLK+Q P + +SQ  Y+HVL+FL+YLDQFGKTKVH  AC+FFGQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQAK  711
            PDP GPCTCPL+QAWGSLDALIGRLRAAYEE+ GG P+TNPFA  SIRV+LR+VR+SQAK
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAK  155

Query  712  ARGIPY  729
            ARGIPY
Sbjct  156  ARGIPY  161



>ref|XP_010449492.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Camelina 
sativa]
Length=192

 Score =   216 bits (551),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLK+Q P + +SQ  Y+HVL+FL+YLDQFGKTKVH  AC+FFGQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQAK  711
            PDP GPCTCPL+QAWGSLDALIGRLRAAYEE+ GG P+TNPFA  SIRV+LR+VR+SQAK
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAK  155

Query  712  ARGIPY  729
            ARGIPY
Sbjct  156  ARGIPY  161



>ref|XP_010434509.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Camelina 
sativa]
Length=191

 Score =   216 bits (551),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLK+Q P + +SQ  Y+HVL+FL+YLDQFGKTKVH  AC+FFGQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQAK  711
            PDP GPCTCPL+QAWGSLDALIGRLRAAYEE+ GG P+TNPFA  SIRV+LR+VR+SQAK
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAK  155

Query  712  ARGIPY  729
            ARGIPY
Sbjct  156  ARGIPY  161



>emb|CDX85083.1| BnaC07g08230D [Brassica napus]
Length=199

 Score =   216 bits (551),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  346  HQLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLF  525
            +QLSRYE+QKRRDWNTFGQYL+N RP ++LS+C  +HVL FL+YLDQFGKTKVH   C F
Sbjct  44   NQLSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHMQICPF  103

Query  526  FGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQ  705
            FG P+P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPF   ++R+YLR+VRDSQ
Sbjct  104  FGHPNPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQ  163

Query  706  AKARGIPY  729
            AKARGI Y
Sbjct  164  AKARGISY  171



>ref|XP_009102637.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Brassica 
rapa]
 emb|CDX77531.1| BnaA07g06690D [Brassica napus]
Length=199

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  346  HQLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLF  525
            +QLSRYE+QKRRDWNTFGQYL+N RP ++LS+C  +HVL FL+YLDQFGKTKVH   C F
Sbjct  44   NQLSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHMQICPF  103

Query  526  FGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQ  705
            FG P+P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PETNPF   ++R+YLR+VRDSQ
Sbjct  104  FGHPNPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQ  163

Query  706  AKARGIPY  729
            AKARGI Y
Sbjct  164  AKARGISY  171



>ref|XP_006302860.1| hypothetical protein CARUB_v10020990mg [Capsella rubella]
 gb|EOA35758.1| hypothetical protein CARUB_v10020990mg [Capsella rubella]
Length=191

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +1

Query  358  RYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQP  537
            RYESQKRRDWNTF QYL+NQ+P V +SQC  +H+L+FL+YLDQFGKTKVH H C+FFGQ 
Sbjct  36   RYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQV  95

Query  538  DPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKAR  717
            +PAG C CPL+QAWGSLDALIGRLRAA+EENGGLPE NPFA   IRV+LR+VRDSQAKAR
Sbjct  96   EPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKAR  155

Query  718  GIPY  729
            G+PY
Sbjct  156  GVPY  159



>ref|XP_009790882.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=176

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF Q+L+NQR  + LSQC+ +HVL FL YLDQFGKTKVH   C+F+GQ
Sbjct  27   SRYESQKRRDWNTFNQFLRNQRQPIPLSQCNDNHVLEFLGYLDQFGKTKVHLQGCMFYGQ  86

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+V++ QAKA
Sbjct  87   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASTAIRVYLREVKECQAKA  146

Query  715  RGIPY  729
            RGI Y
Sbjct  147  RGIAY  151



>emb|CDX78877.1| BnaA01g09440D [Brassica napus]
Length=196

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = +1

Query  358  RYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQP  537
            RYESQKRRDWNTF QYLK+Q P + +SQ  Y+HVL+FL+YLDQFGKTKVH  AC+FFGQP
Sbjct  40   RYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQP  99

Query  538  DPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQAKA  714
            DP GPCTCPL+QAWGSLDALIGRLRAAYEE+ GG P+TNPFA  SIRV+LR+VR+SQAKA
Sbjct  100  DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  159

Query  715  RGIPY  729
            RGIPY
Sbjct  160  RGIPY  164



>ref|XP_009790219.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=176

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF Q+L+NQR  + LSQC+ +HVL FL YLDQFGKTKVH   C+F+GQ
Sbjct  27   SRYESQKRRDWNTFNQFLRNQRQPIPLSQCNGNHVLEFLGYLDQFGKTKVHLQGCMFYGQ  86

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  +IRVYLR+V++ QAKA
Sbjct  87   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASTAIRVYLREVKECQAKA  146

Query  715  RGIPY  729
            RGI Y
Sbjct  147  RGIAY  151



>ref|XP_006414079.1| hypothetical protein EUTSA_v10027091mg [Eutrema salsugineum]
 gb|ESQ55532.1| hypothetical protein EUTSA_v10027091mg [Eutrema salsugineum]
Length=193

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 113/126 (90%), Gaps = 1/126 (1%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLK+Q P + +SQ  Y+HVL+FL+YLDQFGKTKVH  AC+F+GQ
Sbjct  38   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHQQACVFYGQ  97

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQAK  711
            PDP GPCTCPL+QAWGSLDALIGRLRAAYEE+ GG P+TNPFA  SIR++LR+VR+SQAK
Sbjct  98   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRIHLREVRESQAK  157

Query  712  ARGIPY  729
            ARGIPY
Sbjct  158  ARGIPY  163



>ref|XP_002870033.1| hypothetical protein ARALYDRAFT_914818 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46292.1| hypothetical protein ARALYDRAFT_914818 [Arabidopsis lyrata subsp. 
lyrata]
Length=191

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 112/126 (89%), Gaps = 1/126 (1%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLK+Q P + +SQ  Y+HVL+FL+YLDQFGKTKVH  AC+FFGQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQAK  711
            PDP GPCTCPL+QAWGSLDALIGRLRAAYEE+ GG P+ NPFA  SIRV+LR+VR+SQAK
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDANPFANGSIRVHLREVRESQAK  155

Query  712  ARGIPY  729
            ARGIPY
Sbjct  156  ARGIPY  161



>ref|XP_004505495.1| PREDICTED: uncharacterized protein LOC101509969 [Cicer arietinum]
Length=165

 Score =   213 bits (543),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLK Q+P V L  C+ ++VL+FL+YLDQFGKTKVH   C+F+G
Sbjct  22   LSRYESQKRRDWNTFGQYLKTQKPPVPLVHCNSNNVLDFLRYLDQFGKTKVHIQGCMFYG  81

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
             P+P  PC+CPLRQAWGSLDALIGRLRAAYEENGG P TNPFA +SIR+YLR+VR+ QA 
Sbjct  82   NPEPPAPCSCPLRQAWGSLDALIGRLRAAYEENGGSPHTNPFATSSIRLYLREVRECQAL  141

Query  712  ARGIPY  729
            ARGIPY
Sbjct  142  ARGIPY  147



>ref|XP_009128313.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Brassica 
rapa]
Length=191

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQK+RDWNTF QYL+NQ+P V +SQC  +H+L+FL+YLDQFGKTKVH+H C+FFG
Sbjct  33   LSRYESQKKRDWNTFCQYLRNQQPPVHVSQCGSNHILDFLQYLDQFGKTKVHAHGCVFFG  92

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            Q +P+G C CPL+QAWGSLDAL GRLRAAYEENGGLPE NPFA   IRV+L++VRDSQAK
Sbjct  93   QVEPSGQCNCPLKQAWGSLDALSGRLRAAYEENGGLPERNPFAGGGIRVFLKEVRDSQAK  152

Query  712  ARGIPY  729
            ARG+PY
Sbjct  153  ARGVPY  158



>ref|XP_009411199.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=221

 Score =   215 bits (547),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYL+N +P +AL++C  +HV+ FL+YLDQFGKTKVH+  C F+G 
Sbjct  47   SRYESQKRRDWNTFLQYLRNHKPPLALARCSGAHVIEFLRYLDQFGKTKVHAPGCAFYGH  106

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P P GPC CPLRQAWGSLDALIGRLRAAYEE+GG PETNPFA  ++R+YLRDVR+SQAKA
Sbjct  107  PSPPGPCACPLRQAWGSLDALIGRLRAAYEESGGTPETNPFAARAVRIYLRDVRESQAKA  166

Query  715  RGIPY  729
            RGIPY
Sbjct  167  RGIPY  171



>ref|XP_006478612.1| PREDICTED: probable disease resistance protein At4g27220-like 
isoform X1 [Citrus sinensis]
Length=1622

 Score =   233 bits (593),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 101/125 (81%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355   SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
             SRYE QKRRDWNTFGQYLKNQRP V LSQC  SHVL FL+YLD FGK KVH   C+F+GQ
Sbjct  1482  SRYELQKRRDWNTFGQYLKNQRPPVPLSQCSSSHVLEFLRYLDPFGKIKVHLQGCMFYGQ  1541

Query  535   PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
             P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA   IRVYLR+VR+ QAKA
Sbjct  1542  PNPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGEIRVYLREVRECQAKA  1601

Query  715   RGIPY  729
             RGIPY
Sbjct  1602  RGIPY  1606



>gb|KDO64048.1| hypothetical protein CISIN_1g0003541mg, partial [Citrus sinensis]
Length=553

 Score =   224 bits (571),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYE QKRRDWNTFGQYLKNQRP V LSQC  SHVL FL+YLD FGK KVH   C+F+GQ
Sbjct  413  SRYELQKRRDWNTFGQYLKNQRPPVPLSQCSSSHVLEFLRYLDPFGKIKVHLQGCMFYGQ  472

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PETNPFA   IRVYLR+VR+ QAKA
Sbjct  473  PNPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGEIRVYLREVRECQAKA  532

Query  715  RGIPY  729
            RGIPY
Sbjct  533  RGIPY  537



>ref|XP_010327093.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=178

 Score =   213 bits (542),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF  YLKNQRP + L  CH +HVL FL+YLDQFGKTKVH   C+F+GQ
Sbjct  26   SRYESQKRRDWNTFNHYLKNQRPPILLPHCHSNHVLEFLRYLDQFGKTKVHLLGCMFYGQ  85

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            PDP  PCTCPLRQAWGSLDALIGRLRAAYEENGG  ETNPFA   IRVYLR+V++ QAKA
Sbjct  86   PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSSETNPFASVGIRVYLREVKECQAKA  145

Query  715  RGIPY  729
            RGI Y
Sbjct  146  RGIAY  150



>ref|XP_008649559.1| PREDICTED: protein G1-like7 [Zea mays]
 gb|AFW77771.1| putative protein of unknown function (DUF640) domain family protein 
[Zea mays]
Length=301

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYL+N +P + L++C  +HV+ FL+YLDQFGKTKVH+  C +FG
Sbjct  81   LSRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHAEGCAYFG  140

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PE+NPFA  ++R+YLRDVR++QAK
Sbjct  141  QPNPPAPCTCPLRQAWGSLDALIGRLRAAYEESGGRPESNPFAAKAVRIYLRDVREAQAK  200

Query  712  ARGIPY  729
            ARGIPY
Sbjct  201  ARGIPY  206



>gb|KHG29970.1| Putative beta-lactamase-like 1 [Gossypium arboreum]
Length=161

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 110/132 (83%), Gaps = 7/132 (5%)
 Frame = +1

Query  334  GVHHHQ-----LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKT  498
            G H  Q     LSRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKT
Sbjct  18   GNHQQQPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKT  77

Query  499  KVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRV  678
            KVH H C+FFGQPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   +IRV
Sbjct  78   KVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRV  137

Query  679  YLRDVRDSQAKA  714
            YLR+  D +AKA
Sbjct  138  YLRE--DDKAKA  147



>gb|EYU43335.1| hypothetical protein MIMGU_mgv1a022623mg, partial [Erythranthe 
guttata]
Length=169

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYLKNQ P ++L  C Y+HVL FL+YLDQFGKTKVH H C FFG
Sbjct  24   LSRYESQKRRDWNTFLQYLKNQNPPLSLPNCSYNHVLEFLRYLDQFGKTKVHLHGCPFFG  83

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QPDP G CTCPLRQAWGSLDALIGRLRAAYEE+GG PE NPF   +IRVYLR+V++ QAK
Sbjct  84   QPDPPGQCTCPLRQAWGSLDALIGRLRAAYEEHGGPPEGNPFGNGAIRVYLREVKECQAK  143

Query  712  ARGI  723
            ARGI
Sbjct  144  ARGI  147



>ref|NP_001143976.1| uncharacterized protein LOC100276793 [Zea mays]
 gb|ACG36867.1| hypothetical protein [Zea mays]
Length=305

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYL+N +P + L++C  +HV+ FL+YLDQFGKTKVH+  C +FG
Sbjct  83   LSRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHAEGCAYFG  142

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PE+NPFA  ++R+YLRDVR++QAK
Sbjct  143  QPNPPAPCTCPLRQAWGSLDALIGRLRAAYEESGGRPESNPFAAKAVRIYLRDVREAQAK  202

Query  712  ARGIPY  729
            ARGIPY
Sbjct  203  ARGIPY  208



>emb|CDY01557.1| BnaC07g35470D [Brassica napus]
Length=191

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 111/126 (88%), Gaps = 1/126 (1%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLK+Q P + + Q  Y+HVL FL+YLDQFGKTKVH  AC+FFGQ
Sbjct  39   SRYESQKRRDWNTFIQYLKSQNPPLLMPQFDYTHVLCFLRYLDQFGKTKVHQQACVFFGQ  98

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQAK  711
            PDP GPCTCPL+QAWGSLDALIGRLRAAYEE+ GG P+TNPFA  SIRV+LR+VR+SQAK
Sbjct  99   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAK  158

Query  712  ARGIPY  729
            ARGIPY
Sbjct  159  ARGIPY  164



>ref|XP_009385358.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=210

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYL+N +P +AL++C  +HV+ FL+YLDQFGKTKVH+  C F+G 
Sbjct  36   SRYESQKRRDWNTFLQYLRNHKPPLALARCSGAHVIEFLRYLDQFGKTKVHAPGCAFYGH  95

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
              P GPC CPLRQAWGSLDALIGRLRAAYEE+GG PETNPFA  ++R+YLRDVR+SQAKA
Sbjct  96   ASPPGPCACPLRQAWGSLDALIGRLRAAYEESGGTPETNPFAARAVRIYLRDVRESQAKA  155

Query  715  RGIPY  729
            RGIPY
Sbjct  156  RGIPY  160



>ref|XP_009132033.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Brassica 
rapa]
Length=196

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +1

Query  358  RYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQP  537
            RYESQKRRDWNTF QYLK+Q P + +SQ  Y+HVL FL+YL QFGKTKVH  AC+FFGQP
Sbjct  40   RYESQKRRDWNTFIQYLKSQNPPLMISQFDYTHVLGFLRYLAQFGKTKVHRQACVFFGQP  99

Query  538  DPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQAKA  714
            DP+GPCTCPL+QAWGSLDALIGRLRAAYEE+ GG P+TNPFA  SIRV+LR+VR+SQAKA
Sbjct  100  DPSGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  159

Query  715  RGIPY  729
            RGIPY
Sbjct  160  RGIPY  164



>ref|XP_009615590.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=194

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 126/173 (73%), Gaps = 8/173 (5%)
 Frame = +1

Query  214  MMTSSSTDERR-EYGEGSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWN  390
            M    S D R+ E GEG  S    T+A       L           QLSRYESQKRRDWN
Sbjct  1    MQAMMSNDHRKVEEGEGEGSSATVTLAPSDNHLQLPPPP-------QLSRYESQKRRDWN  53

Query  391  TFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLR  570
            TFGQYLKN RP + LSQC+Y+HVL FL+YLDQFGKTKVH H C FFGQP+P  PC CPLR
Sbjct  54   TFGQYLKNLRPPIPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPFFGQPEPPAPCACPLR  113

Query  571  QAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            QAWGSLDALIGRLRAAYEENGGLPE NPFA  SIR+YLR+VRD QAKARGI Y
Sbjct  114  QAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRIYLREVRDFQAKARGISY  166



>ref|XP_009108056.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Brassica 
rapa]
Length=195

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +1

Query  349  QLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFF  528
            QLSRYE+QKRRDWNTFGQYL+N RP ++LS+C  +HVL FL+YLDQFGKTKVH+  C FF
Sbjct  44   QLSRYENQKRRDWNTFGQYLRNHRPPLSLSRCGGAHVLEFLRYLDQFGKTKVHTQLCPFF  103

Query  529  GQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQA  708
            G  +P  PC CPLRQAWGSLDALIGRLRAA+EENGG PETNPF   ++R+YLR+VRDSQA
Sbjct  104  GHANPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQA  163

Query  709  KARGIPY  729
            KARGI Y
Sbjct  164  KARGISY  170



>ref|XP_004244278.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like isoform 
X2 [Solanum lycopersicum]
Length=168

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 127/175 (73%), Gaps = 27/175 (15%)
 Frame = +1

Query  226  SSTDERREYG----EGSSSRLAATMATppppqplqqVAGGGVHHHQLS------RYESQK  375
            SS++++RE G    EGSSS +  T +                HHHQLS      RYESQK
Sbjct  3    SSSEQKREVGGREGEGSSS-MTLTQSD---------------HHHQLSPPPQLSRYESQK  46

Query  376  RRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPC  555
            RRDWNTFGQYLKN +P V L QC+Y+HVL+FL+YLDQFGKTKVH + C+FFGQ +  GPC
Sbjct  47   RRDWNTFGQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKTKVHLNGCVFFGQVEQVGPC  106

Query  556  TCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVR-DSQAKAR  717
            TCPLRQAWGSLDALIGRLRAAYEENGGL ETNPFA ++IR+YLR+ R D   K R
Sbjct  107  TCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREARADEDLKLR  161



>ref|XP_009383380.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=200

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYL+N +P + L++C  +HV+ FL+YLDQFGKTKVH   C F+G 
Sbjct  26   SRYESQKRRDWNTFLQYLRNHKPPLVLTRCSGAHVIEFLRYLDQFGKTKVHLSGCAFYGH  85

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P P  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPFA  ++R++LRDVRDSQAKA
Sbjct  86   PSPPAPCTCPLRQAWGSLDALIGRLRAAYEESGGSPETNPFAARAVRIFLRDVRDSQAKA  145

Query  715  RGIPY  729
            RGIPY
Sbjct  146  RGIPY  150



>ref|XP_008802142.1| PREDICTED: LOW QUALITY PROTEIN: protein G1-like4 [Phoenix dactylifera]
Length=189

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTFGQYLKN RP + LS+C  +HVL FL+YLDQFGKTKVH+  C FFG 
Sbjct  42   SRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGH  101

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PC+CPLRQAWGSLDALIGRLRAAYEENGG PE+NPF   ++R+YLR+VR+ QAKA
Sbjct  102  PNPPAPCSCPLRQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRLYLREVRELQAKA  161

Query  715  RGIPY  729
            RGI Y
Sbjct  162  RGISY  166



>ref|XP_010906808.1| PREDICTED: LOW QUALITY PROTEIN: protein G1-like4 [Elaeis guineensis]
Length=198

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  358  RYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQP  537
            RYESQKRRDWNTFGQYLKN RP + LS+C  +HVL FL+YLDQFGKTKVH+  C FFG P
Sbjct  52   RYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHP  111

Query  538  DPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKAR  717
            +P  PC+CPLRQAWGSLDALIGRLRAAYEENGG PE+NPF   ++R+YLR+VR+ QAKAR
Sbjct  112  NPPAPCSCPLRQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRLYLREVRELQAKAR  171

Query  718  GIPY  729
            GI Y
Sbjct  172  GISY  175



>ref|XP_010529198.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010529199.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010529200.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010532377.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010532378.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010532379.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
Length=208

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 116/144 (81%), Gaps = 14/144 (10%)
 Frame = +1

Query  340  HHHQ-------------LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYL  480
            HHHQ             LSRYESQKRRDWNTF QYLK+Q P V++SQ  YSHVL+FLKYL
Sbjct  25   HHHQPETQTQLQPQPQQLSRYESQKRRDWNTFLQYLKSQNPPVSMSQFDYSHVLSFLKYL  84

Query  481  DQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPF  657
            DQFGKTKVH  +C+FFGQPDP  PCTCPLRQAWGSLDALIGRLRAAYEE+ GG PE NPF
Sbjct  85   DQFGKTKVHHPSCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGGSPENNPF  144

Query  658  AIASIRVYLRDVRDSQAKARGIPY  729
               +IRV+LR++R+SQA+ARGIPY
Sbjct  145  GNGAIRVHLREMRESQARARGIPY  168



>ref|XP_008804907.1| PREDICTED: protein G1-like7 [Phoenix dactylifera]
Length=229

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYL+N +P + L++C  +HV+ FL+YLDQFGKTKVH+  C FFGQ
Sbjct  43   SRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHNAGCTFFGQ  102

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P GPC CPL+QAWGSLDALIGRLRAAYEE+GG PE NPFA  ++R+YLR+VR+SQAKA
Sbjct  103  PNPPGPCACPLKQAWGSLDALIGRLRAAYEESGGRPEANPFAARAVRIYLREVRESQAKA  162

Query  715  RGIPY  729
            RG+PY
Sbjct  163  RGVPY  167



>ref|XP_009136943.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Brassica 
rapa]
 ref|XP_009136944.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Brassica 
rapa]
 emb|CDY53996.1| BnaA03g58210D [Brassica napus]
Length=191

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 111/126 (88%), Gaps = 1/126 (1%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLK+Q P + +SQ +Y+HVL FL+YLDQFGKTKVH  AC+FFGQ
Sbjct  39   SRYESQKRRDWNTFIQYLKSQNPPLLMSQFNYTHVLCFLRYLDQFGKTKVHEQACVFFGQ  98

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQAK  711
            PDP G CTCPL+QAWGSLDALIGRLRAAYEE+ GG P+TNPFA  SIRV+LR+VR+SQAK
Sbjct  99   PDPPGACTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAK  158

Query  712  ARGIPY  729
            ARGI Y
Sbjct  159  ARGISY  164



>gb|KHG10505.1| Error-prone DNA polymerase [Gossypium arboreum]
Length=238

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = +1

Query  256  EGSSSRLAATMATppppqplqqVAGGGVHHHQLSRYESQKRRDWNTFGQYLKNQRPAVAL  435
            EG SS +   +ATPP                  SRYESQKRRDWNTF QYLKN +P + L
Sbjct  18   EGPSSAVVTALATPPTVSQQGGAGESSSSPAPPSRYESQKRRDWNTFLQYLKNHKPPLTL  77

Query  436  SQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRA  615
            ++C  +HV+ FLKYLDQFGKTKVH   C +FG P+P  PC+CPL+QAWGSLDALIGRLRA
Sbjct  78   ARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHPNPPAPCSCPLKQAWGSLDALIGRLRA  137

Query  616  AYEENGGLPETNPFAIASIRVYLRDVRDSQAKARGIPY  729
            AYEENGG PE+NPFA  ++R+YLR+VR+ QAKARGIPY
Sbjct  138  AYEENGGRPESNPFAARAVRIYLREVREGQAKARGIPY  175



>ref|XP_002892379.1| hypothetical protein ARALYDRAFT_887918 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68638.1| hypothetical protein ARALYDRAFT_887918 [Arabidopsis lyrata subsp. 
lyrata]
Length=198

 Score =   209 bits (531),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLKN +P +ALS+C  +HV+ FLKYLDQFGKTKVH  AC +FG 
Sbjct  32   SRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGH  91

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
              P  PC+CPL+QAWGSLDALIGRLRAAYEENGG P++NPFA  ++R+YLR+VR+SQAKA
Sbjct  92   QQPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFATRAVRIYLREVRESQAKA  151

Query  715  RGIPY  729
            RGIPY
Sbjct  152  RGIPY  156



>ref|XP_009398867.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
Length=206

 Score =   209 bits (531),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  358  RYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQP  537
            RYESQKRRDWNTFGQYL+N RP ++LSQC  SHVL FL+YLDQFGKTK+H+H C FFG  
Sbjct  43   RYESQKRRDWNTFGQYLRNHRPPLSLSQCSSSHVLEFLRYLDQFGKTKIHTHLCPFFGNS  102

Query  538  DPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKAR  717
            +P  PC CPLRQAWGSLDALIGRLRAAYEENGG PE+NPF   +IR+YLR+VR+ Q+KAR
Sbjct  103  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPESNPFGARAIRLYLREVREVQSKAR  162

Query  718  GIPY  729
            GI Y
Sbjct  163  GISY  166



>ref|XP_003524092.1| PREDICTED: uncharacterized protein LOC100775838 [Glycine max]
Length=236

 Score =   210 bits (534),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKN RP + LS+C  +HVL FL+YLDQFGKTKVH+  C +FG
Sbjct  45   LSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAETCAYFG  104

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
               P GPC CPLRQAWGSLDALIGRLRAA+EENGG PE NPF   ++R+YLR+VRD+QAK
Sbjct  105  NSHPPGPCACPLRQAWGSLDALIGRLRAAFEENGGTPEMNPFGTRAVRLYLREVRDAQAK  164

Query  712  ARGIPY  729
            ARGI Y
Sbjct  165  ARGIAY  170



>ref|XP_003531069.1| PREDICTED: uncharacterized protein LOC100798406 [Glycine max]
Length=247

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKN RP + LS+C  +HVL FL+YLDQFGKTKVH+  C +FG
Sbjct  46   LSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAETCGYFG  105

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
               P GPC CPLRQAWGSLDALIGRLRAA+EENGG PE NPF   ++R+YLR+VRD+QAK
Sbjct  106  NSHPPGPCACPLRQAWGSLDALIGRLRAAFEENGGAPEMNPFGTRAVRLYLREVRDAQAK  165

Query  712  ARGIPY  729
            ARGI Y
Sbjct  166  ARGIAY  171



>ref|NP_563780.1| protein LIGHT SENSITIVE HYPOCOTYLS 6 [Arabidopsis thaliana]
 sp|Q9LMK2.1|LSH6_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6; AltName: 
Full=Protein ORGAN BOUNDARY 6 [Arabidopsis thaliana]
 gb|AAF82211.1|AC067971_19 Strong similarity to an unknown protein At2g31160 gi|3746060 
from Arabidopsis thaliana BAC F7F1 gb|AC005311. EST gb|AI998165 
comes from this gene [Arabidopsis thaliana]
 gb|AAM63916.1| unknown [Arabidopsis thaliana]
 gb|AAO41893.1| unknown protein [Arabidopsis thaliana]
 gb|AAV84524.1| At1g07090 [Arabidopsis thaliana]
 gb|ABD42982.1| At1g07090 [Arabidopsis thaliana]
 gb|AEE28076.1| uncharacterized protein AT1G07090 [Arabidopsis thaliana]
Length=196

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLKN +P +ALS+C  +HV+ FLKYLDQFGKTKVH  AC +FG 
Sbjct  30   SRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGH  89

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
              P  PC+CPL+QAWGSLDALIGRLRAAYEENGG P++NPFA  ++R+YLR+VR+SQAKA
Sbjct  90   QQPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKA  149

Query  715  RGIPY  729
            RGIPY
Sbjct  150  RGIPY  154



>ref|XP_010475462.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Camelina 
sativa]
Length=196

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLKN +P +ALS+C  +HV+ FLKYLDQFGKTKVH  AC +FG 
Sbjct  32   SRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGH  91

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
              P  PC+CPL+QAWGSLDALIGRLRAAYEENGG P++NPFA  ++R+YLR+VR+SQAKA
Sbjct  92   QQPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKA  151

Query  715  RGIPY  729
            RGIPY
Sbjct  152  RGIPY  156



>ref|XP_010487116.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 [Camelina 
sativa]
Length=196

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLKN +P +ALS+C  +HV+ FLKYLDQFGKTKVH  AC +FG 
Sbjct  32   SRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGH  91

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
              P  PC+CPL+QAWGSLDALIGRLRAAYEENGG P++NPFA  ++R+YLR+VR+SQAKA
Sbjct  92   QQPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKA  151

Query  715  RGIPY  729
            RGIPY
Sbjct  152  RGIPY  156



>ref|XP_006303356.1| hypothetical protein CARUB_v10010340mg [Capsella rubella]
 gb|EOA36254.1| hypothetical protein CARUB_v10010340mg [Capsella rubella]
Length=198

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLKN +P +ALS+C  +HV+ FLKYLDQFGKTKVH  AC +FG 
Sbjct  33   SRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGH  92

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
              P  PC+CPL+QAWGSLDALIGRLRAAYEENGG P++NPFA  ++R+YLR+VR+SQAKA
Sbjct  93   QQPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKA  152

Query  715  RGIPY  729
            RGIPY
Sbjct  153  RGIPY  157



>ref|XP_004504735.1| PREDICTED: uncharacterized protein LOC101506113 [Cicer arietinum]
Length=236

 Score =   209 bits (532),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKN RP + LS+C  +HVL FL+YLDQFGKTKVHS  C +FG
Sbjct  45   LSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHSENCAYFG  104

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
              +P GPC CPL+QAWGSLDALIGRLRAA+EENGG PE NPF   ++R+YLR+VRD+QAK
Sbjct  105  NSNPPGPCPCPLKQAWGSLDALIGRLRAAFEENGGSPEINPFGARAVRLYLREVRDAQAK  164

Query  712  ARGIPY  729
            ARGI Y
Sbjct  165  ARGIGY  170



>ref|XP_010518804.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010518805.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010518806.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
Length=195

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = +1

Query  358  RYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQP  537
            RYESQKRRDWNTF QYLK+Q+P +++SQ  YSHVL+FL YLDQFGKTKVH+ AC+FFGQP
Sbjct  38   RYESQKRRDWNTFLQYLKSQKPPISMSQFEYSHVLSFLNYLDQFGKTKVHNQACVFFGQP  97

Query  538  DPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQAKA  714
            DP   CTCPLRQAWGSLDALIGRLRAAYEE+ GG  E+NPFA  +IRV+LR+V++SQ++A
Sbjct  98   DPPAACTCPLRQAWGSLDALIGRLRAAYEEHGGGSTESNPFANGAIRVHLREVKESQSRA  157

Query  715  RGIPY  729
            RGIPY
Sbjct  158  RGIPY  162



>ref|XP_010922606.1| PREDICTED: protein G1-like7 [Elaeis guineensis]
Length=225

 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +1

Query  358  RYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQP  537
            RYESQKRRDWNTF QYL+N +P + L++C  +HV+ FL+YLDQFGKTKVH+  C FFGQP
Sbjct  40   RYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHNAGCTFFGQP  99

Query  538  DPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKAR  717
            +P GPC CPL+QAWGSLDALIGRLRAAYEE+GG PE NPFA  ++R+YLR+VR+SQAKAR
Sbjct  100  NPPGPCACPLKQAWGSLDALIGRLRAAYEESGGRPEANPFAARAVRIYLREVRESQAKAR  159

Query  718  GIPY  729
            G+PY
Sbjct  160  GVPY  163



>ref|XP_006401075.1| hypothetical protein EUTSA_v10014789mg [Eutrema salsugineum]
 gb|ESQ42528.1| hypothetical protein EUTSA_v10014789mg [Eutrema salsugineum]
Length=183

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLKN +P ++LS+C  +HV+ FLKYLDQFGKTKVH  AC FFG+
Sbjct  18   SRYESQKRRDWNTFLQYLKNHKPPLSLSRCSGAHVIEFLKYLDQFGKTKVHVVACPFFGE  77

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEE-NGGLPETNPFAIASIRVYLRDVRDSQAK  711
            P+P   CTCPL+QAWGSLDALIGRLRAA+EE  GGLPE+NPFA  ++R+YL++VR+SQAK
Sbjct  78   PNPPAQCTCPLKQAWGSLDALIGRLRAAFEEIGGGLPESNPFAAKAVRIYLKEVRESQAK  137

Query  712  ARGIPY  729
            ARGIPY
Sbjct  138  ARGIPY  143



>ref|XP_010906823.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Elaeis 
guineensis]
Length=218

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYL+N +P + L++C  +HV+ FL+YLDQFGKTKVH+  C FFG 
Sbjct  35   SRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHNAGCAFFGH  94

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P GPC CPL+QAWGSLDALIGRLRAAYEE+GG PE NPFA  ++R+YLR+VR+SQAKA
Sbjct  95   PNPPGPCACPLKQAWGSLDALIGRLRAAYEESGGRPEANPFAARAVRIYLREVRESQAKA  154

Query  715  RGIPY  729
            RGIPY
Sbjct  155  RGIPY  159



>ref|XP_010457872.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Camelina 
sativa]
Length=196

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLKN +P +ALS+C  +HV+ FLKYLDQFGKTKVH  AC +FG 
Sbjct  32   SRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGH  91

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
              P  PC+CPL+QAWGSLDALIGRLRAAYEENGG P++NPFA  ++R+YLR+VR++QAKA
Sbjct  92   QQPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRETQAKA  151

Query  715  RGIPY  729
            RGIPY
Sbjct  152  RGIPY  156



>ref|XP_009419635.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Musa 
acuminata subsp. malaccensis]
Length=213

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 111/134 (83%), Gaps = 4/134 (3%)
 Frame = +1

Query  328  GGGVHHHQLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVH  507
            GGG    + SRYESQKRRDWN+FGQYL+N RP + LS+C  +HVL FL+YLDQFGKTKVH
Sbjct  17   GGG----RPSRYESQKRRDWNSFGQYLRNHRPPLELSRCSGAHVLEFLRYLDQFGKTKVH  72

Query  508  SHACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLR  687
            +  C FFG P P  PCTCPLRQAWGSLD+L+GRLRAA+EE+GG PE NPFA  ++R+YLR
Sbjct  73   TAGCPFFGHPQPPAPCTCPLRQAWGSLDSLVGRLRAAFEEDGGQPEVNPFAARAVRLYLR  132

Query  688  DVRDSQAKARGIPY  729
            +VRDSQAKARGI Y
Sbjct  133  EVRDSQAKARGIAY  146



>ref|XP_010538562.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
Length=198

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +1

Query  349  QLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFF  528
            QLSRYESQKRRDWNTF QYLK+Q P V+ S+  YSHVL+FL+YLDQFGKTKVH  AC+FF
Sbjct  32   QLSRYESQKRRDWNTFLQYLKSQNPPVSTSRFDYSHVLSFLQYLDQFGKTKVHDQACVFF  91

Query  529  GQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEEN-GGLPETNPFAIASIRVYLRDVRDSQ  705
            GQP+P  PCTCPLRQAWGSLDALIGRLRAAYEE+ GG PE NPF   +IRV+LR+VR++Q
Sbjct  92   GQPNPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGGSPENNPFGNGAIRVHLREVREAQ  151

Query  706  AKARGI  723
            A+ARGI
Sbjct  152  ARARGI  157



>gb|KFK43023.1| hypothetical protein AALP_AA1G068900 [Arabis alpina]
Length=194

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLKN +P +ALS+C  +HV+ FLKYLDQFGKTKVH  AC +FG 
Sbjct  32   SRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGH  91

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
              P  PC CPL+QAWGSLDALIGRLRAAYEENGG P++NPFA  ++R+YLR+VR+SQAKA
Sbjct  92   QQPPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKA  151

Query  715  RGIPY  729
            RGIPY
Sbjct  152  RGIPY  156



>ref|XP_008657105.1| PREDICTED: protein G1-like7 [Zea mays]
 gb|AFW84710.1| putative protein of unknown function (DUF640) domain family protein 
[Zea mays]
Length=208

 Score =   207 bits (527),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +1

Query  349  QLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFF  528
            QLSRYESQKRRDWNTF QYL+N RP + L++C  +HV+ FL+YLDQFGKTKVH+  C ++
Sbjct  30   QLSRYESQKRRDWNTFLQYLRNHRPPLTLARCSGAHVIEFLRYLDQFGKTKVHAAGCAYY  89

Query  529  GQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQA  708
            GQ  P GPC CPLRQAWGSLDALIGRLRAAYEE+G  PE+NP A  ++R+YLR+VRDSQA
Sbjct  90   GQRAPPGPCPCPLRQAWGSLDALIGRLRAAYEESGRTPESNPLAARAVRIYLREVRDSQA  149

Query  709  KARGIPY  729
            KARGIPY
Sbjct  150  KARGIPY  156



>ref|XP_007159026.1| hypothetical protein PHAVU_002G202200g [Phaseolus vulgaris]
 gb|ESW31020.1| hypothetical protein PHAVU_002G202200g [Phaseolus vulgaris]
Length=230

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKN RP + LS+C  +HVL FL+YLDQFGKTKVH+  C FFG
Sbjct  40   LSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAETCAFFG  99

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
               P GPC+CPL+QAWGSLDALIGRLRAA+EE+GG PE NPF   ++R+YLR+VRD+QAK
Sbjct  100  NSHPPGPCSCPLKQAWGSLDALIGRLRAAFEEHGGAPEMNPFGTRAVRLYLREVRDAQAK  159

Query  712  ARGIPY  729
            ARGI Y
Sbjct  160  ARGIAY  165



>ref|XP_002298496.1| hypothetical protein POPTR_0001s28780g [Populus trichocarpa]
 gb|EEE83301.1| hypothetical protein POPTR_0001s28780g [Populus trichocarpa]
Length=228

 Score =   207 bits (527),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QY+KN +P + L++C  +HV+ FLKYLDQFGKTKVH   C +FG 
Sbjct  47   SRYESQKRRDWNTFLQYIKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGH  106

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PC+CPL+QAWGSLDALIGRLRAAYEENGGLPE+NPF   ++R+YLR+VR+ QAKA
Sbjct  107  PNPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGLPESNPFGARAVRIYLREVREGQAKA  166

Query  715  RGIPY  729
            RGIPY
Sbjct  167  RGIPY  171



>ref|XP_006417846.1| hypothetical protein EUTSA_v10009726mg [Eutrema salsugineum]
 gb|ESQ36199.1| hypothetical protein EUTSA_v10009726mg [Eutrema salsugineum]
Length=200

 Score =   206 bits (524),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLKN +P +ALS+C  +HV+ FLKYLDQFGKTKVH   C +FG 
Sbjct  34   SRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAVCPYFGH  93

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
              P  PC CPL+QAWGSLDALIGRLRAAYEENGG P++NPFA  ++R+YLR+VR+SQAKA
Sbjct  94   QQPPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKA  153

Query  715  RGIPY  729
            RGIPY
Sbjct  154  RGIPY  158



>gb|EPS68444.1| hypothetical protein M569_06326 [Genlisea aurea]
Length=181

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTF QYL+NQRP V+L QC+  HVL F++YLDQFGKTKVH   C+FFG
Sbjct  29   LSRYESQKRRDWNTFRQYLRNQRPPVSLGQCNGGHVLEFMRYLDQFGKTKVHVRGCVFFG  88

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            +P+P   CTCP+RQAWGSLDAL+GRLRAAYE +GG  E NPFA A+IR YL++VR++QAK
Sbjct  89   RPEPDSACTCPVRQAWGSLDALVGRLRAAYEGSGGAQERNPFADAAIRRYLKEVRETQAK  148

Query  712  ARGIPY  729
            ARGIPY
Sbjct  149  ARGIPY  154



>emb|CDP09236.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +1

Query  331  GGVHHHQLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHS  510
            GG      SRYESQKRRDWNTF QYL+N +P + L++C  +HV+ FLKYLDQFGKTKVH 
Sbjct  31   GGSTAAPPSRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHV  90

Query  511  HACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRD  690
              C +FG P+P  PC CPL+QAWGSLDALIGRLRAAYEENGG PE+NPF   ++R+YLR+
Sbjct  91   AGCPYFGHPNPPAPCQCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLRE  150

Query  691  VRDSQAKARGIPY  729
            VR+SQAKARGIPY
Sbjct  151  VRESQAKARGIPY  163



>ref|XP_002866271.1| hypothetical protein ARALYDRAFT_919048 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42530.1| hypothetical protein ARALYDRAFT_919048 [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 109/126 (87%), Gaps = 1/126 (1%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYL+N +P + LS+C  +HVL FLKYLDQFGKTKVH+ AC FFGQ
Sbjct  18   SRYESQKRRDWNTFLQYLRNHKPPLNLSRCSGAHVLEFLKYLDQFGKTKVHATACPFFGQ  77

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEE-NGGLPETNPFAIASIRVYLRDVRDSQAK  711
            P+P   CTCPL+QAWGSLDALIGRLRAA+EE  GGLPE+NPFA  ++R+YL++VR +QAK
Sbjct  78   PNPPSQCTCPLKQAWGSLDALIGRLRAAFEEIGGGLPESNPFAAKAVRIYLKEVRQTQAK  137

Query  712  ARGIPY  729
            ARGIPY
Sbjct  138  ARGIPY  143



>ref|XP_002313971.1| hypothetical protein POPTR_0009s07990g [Populus trichocarpa]
 gb|EEE87926.1| hypothetical protein POPTR_0009s07990g [Populus trichocarpa]
Length=223

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLKN +P + L++C  +HV+ FLKYLDQFGKTKVH   C +FG 
Sbjct  47   SRYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGH  106

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PC+CPL+QAWGSLDALIGRLRAAYEENGG PE+NPF   ++R+YLR+VR+ QAKA
Sbjct  107  PNPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLREVREGQAKA  166

Query  715  RGIPY  729
            RGIPY
Sbjct  167  RGIPY  171



>ref|NP_200658.1| protein LIGHT SENSITIVE HYPOCOTYLS 5 [Arabidopsis thaliana]
 sp|Q9FGH2.1|LSH5_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5; AltName: 
Full=Protein ORGAN BOUNDARY 5 [Arabidopsis thaliana]
 dbj|BAB10265.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAQ56844.1| At5g58500 [Arabidopsis thaliana]
 gb|AED97060.1| uncharacterized protein AT5G58500 [Arabidopsis thaliana]
Length=182

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 109/126 (87%), Gaps = 1/126 (1%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYL+N +P + LS+C  +HVL FLKYLDQFGKTKVH+ AC FFGQ
Sbjct  18   SRYESQKRRDWNTFLQYLRNHKPPLNLSRCSGAHVLEFLKYLDQFGKTKVHATACPFFGQ  77

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEE-NGGLPETNPFAIASIRVYLRDVRDSQAK  711
            P+P   CTCPL+QAWGSLDALIGRLRAA+EE  GGLPE+NPFA  ++R+YL++VR +QAK
Sbjct  78   PNPPSQCTCPLKQAWGSLDALIGRLRAAFEEIGGGLPESNPFAAKAVRIYLKEVRQTQAK  137

Query  712  ARGIPY  729
            ARGIPY
Sbjct  138  ARGIPY  143



>ref|XP_007016962.1| Zinc finger protein ZFPM1 [Theobroma cacao]
 gb|EOY34581.1| Zinc finger protein ZFPM1 [Theobroma cacao]
Length=241

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  358  RYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQP  537
            RYESQKRRDWNTF QYLKN +P + L++C  +HV+ FLKYLDQFGKTKVH   C +FG P
Sbjct  53   RYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHP  112

Query  538  DPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKAR  717
            +P  PC+CPL+QAWGSLDALIGRLRAAYEENGG PE+NPF   ++R+YLR+VR+ QAKAR
Sbjct  113  NPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGAKAVRIYLREVREGQAKAR  172

Query  718  GIPY  729
            GIPY
Sbjct  173  GIPY  176



>ref|XP_007159450.1| hypothetical protein PHAVU_002G238600g [Phaseolus vulgaris]
 gb|ESW31444.1| hypothetical protein PHAVU_002G238600g [Phaseolus vulgaris]
Length=179

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQ P VALSQC+++HVL+FL+YLDQFGKTKVH H C+FFG
Sbjct  29   LSRYESQKRRDWNTFGQYLKNQSPPVALSQCNFNHVLDFLRYLDQFGKTKVHLHGCIFFG  88

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP P  PC CPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   SIRVYLR+V++ QAK
Sbjct  89   QPTPPAPCACPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGGGSIRVYLREVKECQAK  148

Query  712  ARGIPY  729
            ARGIPY
Sbjct  149  ARGIPY  154



>ref|XP_003537309.1| PREDICTED: uncharacterized protein LOC100775798 [Glycine max]
Length=235

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = +1

Query  334  GVHHHQLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSH  513
            G     LSRYESQKRRDWNTF QYL+N RP + L++C  +HV+ FLKYLDQFGKTKVH  
Sbjct  40   GSSPAPLSRYESQKRRDWNTFLQYLQNHRPPLTLARCSGAHVIEFLKYLDQFGKTKVHVT  99

Query  514  ACLFFGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDV  693
             C +FG P+P  PCTCPL+QAWGSLDALIGRLRAAYEENGG PE+NPF   ++R  LR+V
Sbjct  100  GCPYFGHPNPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRTCLREV  159

Query  694  RDSQAKARGIPY  729
            R+ QAKARGIPY
Sbjct  160  REGQAKARGIPY  171



>ref|XP_010043398.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 isoform 
X3 [Eucalyptus grandis]
 gb|KCW85401.1| hypothetical protein EUGRSUZ_B02224 [Eucalyptus grandis]
Length=204

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYL+N +P + L++C  + VL FLKYLDQFGKTKVH + C FFG 
Sbjct  49   SRYESQKRRDWNTFLQYLQNHKPPLTLARCSGAQVLEFLKYLDQFGKTKVHMNGCPFFGN  108

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P P GPC CPL+QAWGSLDALIGRLRAA+EENGG PE NPFA  ++R+YLR+V++ QAKA
Sbjct  109  PTPPGPCACPLKQAWGSLDALIGRLRAAFEENGGRPELNPFAARAVRIYLREVKEGQAKA  168

Query  715  RGIPY  729
            RGIPY
Sbjct  169  RGIPY  173



>ref|XP_011003514.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 [Populus 
euphratica]
Length=220

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLKN +P + L++C  +HV+ FLKYLDQFGKTKVH   C +FG 
Sbjct  45   SRYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGH  104

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PC+CPL+QAWGSLDALIGRLRAAYEENGG PE+NPF   ++R+YLR+VR+ QAKA
Sbjct  105  PNPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLREVREGQAKA  164

Query  715  RGIPY  729
            RGIPY
Sbjct  165  RGIPY  169



>ref|XP_010043397.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 isoform 
X2 [Eucalyptus grandis]
 gb|KCW85400.1| hypothetical protein EUGRSUZ_B02224 [Eucalyptus grandis]
Length=225

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYL+N +P + L++C  + VL FLKYLDQFGKTKVH + C FFG 
Sbjct  49   SRYESQKRRDWNTFLQYLQNHKPPLTLARCSGAQVLEFLKYLDQFGKTKVHMNGCPFFGN  108

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P P GPC CPL+QAWGSLDALIGRLRAA+EENGG PE NPFA  ++R+YLR+V++ QAKA
Sbjct  109  PTPPGPCACPLKQAWGSLDALIGRLRAAFEENGGRPELNPFAARAVRIYLREVKEGQAKA  168

Query  715  RGIPY  729
            RGIPY
Sbjct  169  RGIPY  173



>ref|XP_006847407.1| hypothetical protein AMTR_s00153p00047660 [Amborella trichopoda]
 gb|ERN08988.1| hypothetical protein AMTR_s00153p00047660 [Amborella trichopoda]
Length=203

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYLKN +P ++LS+C  +HV+ FLKYLDQFGKTKVH   C +FG 
Sbjct  39   SRYESQKRRDWNTFLQYLKNHKPPLSLSRCSGAHVIEFLKYLDQFGKTKVHLVGCPYFGH  98

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P P  PC CPL+QAWGSLDALIGRLRAAYEENGG P+ NPF   ++R+YLR+VR+SQAKA
Sbjct  99   PSPPNPCACPLKQAWGSLDALIGRLRAAYEENGGRPDANPFGARAVRIYLREVRESQAKA  158

Query  715  RGIPY  729
            RGIPY
Sbjct  159  RGIPY  163



>gb|EYU45980.1| hypothetical protein MIMGU_mgv1a021801mg [Erythranthe guttata]
Length=201

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  358  RYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQP  537
            RYESQKRRDWNTF QYL+N +P + L++C  +HV+ FLKYLDQFGKTKVH   C +FGQP
Sbjct  43   RYESQKRRDWNTFQQYLRNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHVTGCPYFGQP  102

Query  538  DPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKAR  717
            DP  PC C L+QAWGSLDALIGRLRAAYEENGG P+TNPF   ++R+YLR+VR+SQAKAR
Sbjct  103  DPPAPCACQLKQAWGSLDALIGRLRAAYEENGGRPDTNPFGAKAVRIYLREVRESQAKAR  162

Query  718  GIPY  729
            GIPY
Sbjct  163  GIPY  166



>ref|XP_003539992.1| PREDICTED: uncharacterized protein LOC100806134 [Glycine max]
Length=177

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V LSQC+ +HVL+FL+YLDQFGKTKVH   C+F+G
Sbjct  30   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYG  89

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP+P  PC CPLRQAWGSLDALIGRLRAAYEENGG PETNPFA  SIRVYLR+VR+ QAK
Sbjct  90   QPEPPAPCACPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAK  149

Query  712  ARGIPY  729
            ARGI Y
Sbjct  150  ARGIAY  155



>ref|XP_010685918.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 [Beta vulgaris 
subsp. vulgaris]
Length=258

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYL+N +P ++LS+C  +HV+ FLKYLDQFGKTKVH   C +FG 
Sbjct  76   SRYESQKRRDWNTFLQYLRNHKPPLSLSRCSGAHVIEFLKYLDQFGKTKVHITGCPYFGH  135

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PC CPL+QAWGSLDALIGRLRAAYEENGG PE+NPF   ++R+YLR+VR+SQAKA
Sbjct  136  PNPPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLREVRESQAKA  195

Query  715  RGIPY  729
            RGIPY
Sbjct  196  RGIPY  200



>gb|AES98763.2| DUF640 family protein [Medicago truncatula]
Length=225

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYL+N +P + L+ C  +HV+ FLKYLDQFGKTKVH   C +FGQ
Sbjct  36   SRYESQKRRDWNTFQQYLRNHKPPLTLALCSGAHVIEFLKYLDQFGKTKVHVIGCPYFGQ  95

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PC CPL+QAWGSLDALIGRLRAA+EENGG PE+NPF   ++R+YLR+V+D QAKA
Sbjct  96   PNPPSPCACPLKQAWGSLDALIGRLRAAFEENGGKPESNPFGTRAVRIYLREVKDGQAKA  155

Query  715  RGIPY  729
            RG+PY
Sbjct  156  RGVPY  160



>gb|KEH31304.1| G1-like protein [Medicago truncatula]
Length=234

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKN RP + LS+C  +HVL FL+YLDQFGKTKVHS  C +FG
Sbjct  44   LSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHSENCAYFG  103

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
               P GPC CPL+QAWGSLDALIGRLRAA+EENGG  E NPF   ++R+YLR+VRD+QAK
Sbjct  104  NSHPPGPCPCPLKQAWGSLDALIGRLRAAFEENGGSQEMNPFGARAVRLYLREVRDAQAK  163

Query  712  ARGIPY  729
            ARGI Y
Sbjct  164  ARGIGY  169



>gb|EYU28084.1| hypothetical protein MIMGU_mgv1a022457mg [Erythranthe guttata]
Length=176

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  352  LSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFG  531
            LSRYESQKRRDWNTFGQYLKNQRP V+L QC+ +HVL FL+YLDQFGKTKVH H C+FFG
Sbjct  21   LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCNCNHVLEFLRYLDQFGKTKVHVHGCVFFG  80

Query  532  QPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAK  711
            QP P  PCTCPLRQAWGSLDALIGRLRAAYEE+GG PETNPF   SIRVYLR+V+D QAK
Sbjct  81   QPAPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGSIRVYLREVKDCQAK  140

Query  712  ARGIPY  729
            ARGIPY
Sbjct  141  ARGIPY  146



>ref|XP_010542671.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Tarenaya 
hassleriana]
Length=187

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  346  HQLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLF  525
             Q SRYESQKRRDW+TF QYLKN +P + LS C  +HV+ FLKYLDQFGKTKVH  AC +
Sbjct  29   QQPSRYESQKRRDWSTFLQYLKNHKPPLTLSWCSGAHVIEFLKYLDQFGKTKVHVTACPY  88

Query  526  FGQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQ  705
            FG  +P  PC CPL+QAWGSLDALIGRLRAAYEENGG P++NPFA  ++R+YLR+VR+ Q
Sbjct  89   FGHQNPPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVREGQ  148

Query  706  AKARGIPY  729
            AKARGIPY
Sbjct  149  AKARGIPY  156



>ref|XP_009385214.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=195

 Score =   204 bits (518),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  349  QLSRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFF  528
            + SRYESQKRRDWNTF QYL+N +P + LS+C  +HV+ FL+YLDQFGKTKVH   C F+
Sbjct  17   EPSRYESQKRRDWNTFVQYLRNHKPPLVLSRCSGAHVIEFLRYLDQFGKTKVHVPRCAFY  76

Query  529  GQPDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQA  708
            G P P GPC CPLRQAWGSLDAL+GRLRAAYEE+GG P+TNPFA  +IR++L DVR+SQA
Sbjct  77   GHPSPPGPCACPLRQAWGSLDALVGRLRAAYEESGGSPDTNPFAARAIRIFLHDVRESQA  136

Query  709  KARGIPY  729
            K+RGIPY
Sbjct  137  KSRGIPY  143



>ref|XP_002973743.1| hypothetical protein SELMODRAFT_36560, partial [Selaginella moellendorffii]
 ref|XP_002975792.1| hypothetical protein SELMODRAFT_36559, partial [Selaginella moellendorffii]
 gb|EFJ23421.1| hypothetical protein SELMODRAFT_36559, partial [Selaginella moellendorffii]
 gb|EFJ25403.1| hypothetical protein SELMODRAFT_36560, partial [Selaginella moellendorffii]
Length=153

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYE+QKRRDWNTFGQYLKN RP +ALS+C  +HVL FL+YLDQFGKTK+H+ AC FFG 
Sbjct  21   SRYEAQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGKTKIHAPACPFFGL  80

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
              P  PC CPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   ++R+YLR+VR+ QAKA
Sbjct  81   AHPPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARAVRLYLREVREMQAKA  140

Query  715  RGIPY  729
            RGI Y
Sbjct  141  RGIAY  145



>ref|XP_003615805.1| hypothetical protein MTR_5g072510 [Medicago truncatula]
Length=257

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +1

Query  355  SRYESQKRRDWNTFGQYLKNQRPAVALSQCHYSHVLNFLKYLDQFGKTKVHSHACLFFGQ  534
            SRYESQKRRDWNTF QYL+N +P + L+ C  +HV+ FLKYLDQFGKTKVH   C +FGQ
Sbjct  36   SRYESQKRRDWNTFQQYLRNHKPPLTLALCSGAHVIEFLKYLDQFGKTKVHVIGCPYFGQ  95

Query  535  PDPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFAIASIRVYLRDVRDSQAKA  714
            P+P  PC CPL+QAWGSLDALIGRLRAA+EENGG PE+NPF   ++R+YLR+V+D QAKA
Sbjct  96   PNPPSPCACPLKQAWGSLDALIGRLRAAFEENGGKPESNPFGTRAVRIYLREVKDGQAKA  155

Query  715  RGIPY  729
            RG+PY
Sbjct  156  RGVPY  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2797048251622