BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23665_g7_i1 len=1256 path=[8643:0-374 19864:375-386 19887:387-388
19889:389-398 12450:399-464 9105:465-490 9130:491-601 20136:602-618
20153:619-627 15554:628-1255]

Length=1256
                                                                      Score     E

ref|XP_009622401.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    243   1e-74   
emb|CDP06011.1|  unnamed protein product                                242   2e-74   
ref|XP_006360044.1|  PREDICTED: uncharacterized protein LOC102584680    240   2e-73   
ref|XP_004248241.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    239   8e-73   
ref|XP_009770169.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    238   9e-73   
ref|XP_006370148.1|  hypothetical protein POPTR_0001s40140g             236   3e-72   
ref|XP_002280666.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    235   4e-72   Vitis vinifera
ref|XP_011082761.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    236   4e-72   
ref|XP_011013261.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    236   4e-72   
ref|XP_010324393.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    236   5e-72   
ref|XP_006442502.1|  hypothetical protein CICLE_v10022456mg             236   5e-72   
emb|CAN66524.1|  hypothetical protein VITISV_034969                     234   8e-72   Vitis vinifera
ref|XP_011015901.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    235   8e-72   
ref|XP_009334040.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    235   9e-72   
ref|XP_008368001.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    235   1e-71   
ref|XP_007021735.1|  Uncharacterized protein TCM_031777                 235   1e-71   
ref|XP_002317458.1|  hypothetical protein POPTR_0011s11120g             234   1e-71   Populus trichocarpa [western balsam poplar]
ref|XP_009339946.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    234   1e-71   
ref|XP_007215057.1|  hypothetical protein PRUPE_ppa012217mg             234   2e-71   
ref|XP_007212123.1|  hypothetical protein PRUPE_ppa012057mg             234   2e-71   
ref|XP_008226537.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    234   2e-71   
gb|KDP35079.1|  hypothetical protein JCGZ_11031                         233   2e-71   
ref|XP_002320411.1|  hypothetical protein POPTR_0014s13900g             233   3e-71   Populus trichocarpa [western balsam poplar]
ref|XP_011033736.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    233   4e-71   
ref|XP_003540402.1|  PREDICTED: uncharacterized protein LOC100802...    233   4e-71   
emb|CAN63025.1|  hypothetical protein VITISV_034817                     233   5e-71   Vitis vinifera
ref|XP_007149738.1|  hypothetical protein PHAVU_005G095100g             232   6e-71   
ref|XP_002521586.1|  conserved hypothetical protein                     232   7e-71   Ricinus communis
gb|KHN36698.1|  hypothetical protein glysoja_001429                     232   8e-71   
ref|XP_002285447.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    234   8e-71   Vitis vinifera
ref|XP_004294145.1|  PREDICTED: uncharacterized protein LOC101307097    233   1e-70   
ref|XP_007132855.1|  hypothetical protein PHAVU_011G130300g             232   1e-70   
ref|XP_006446791.1|  hypothetical protein CICLE_v10016699mg             233   1e-70   
ref|XP_006348309.1|  PREDICTED: uncharacterized protein LOC102581082    232   1e-70   
ref|XP_007048693.1|  Pleckstrin domain-containing family N member 1     233   1e-70   
ref|XP_006469013.1|  PREDICTED: uncharacterized protein LOC102606613    232   1e-70   
gb|KHG07235.1|  Putative beta-lactamase-like 1                          232   1e-70   
ref|XP_002530382.1|  conserved hypothetical protein                     233   1e-70   Ricinus communis
ref|XP_010104392.1|  hypothetical protein L484_010344                   231   2e-70   
gb|KDP34762.1|  hypothetical protein JCGZ_10542                         232   2e-70   
ref|XP_008342774.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    232   2e-70   
ref|XP_010314085.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    231   2e-70   
ref|XP_004303183.1|  PREDICTED: uncharacterized protein LOC101307414    232   2e-70   
ref|XP_006358940.1|  PREDICTED: uncharacterized protein LOC102602985    232   4e-70   
ref|NP_001235660.1|  uncharacterized protein LOC100306225               230   4e-70   
ref|XP_009774704.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    231   4e-70   
ref|XP_004489028.1|  PREDICTED: uncharacterized protein LOC101497242    231   6e-70   
ref|XP_003596364.1|  177 protein                                        230   6e-70   
ref|XP_004487154.1|  PREDICTED: uncharacterized protein LOC101499419    229   6e-70   
emb|CDP15936.1|  unnamed protein product                                229   9e-70   
gb|KCW67509.1|  hypothetical protein EUGRSUZ_F01238                     230   9e-70   
ref|XP_010062813.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    230   9e-70   
ref|XP_010035859.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    229   1e-69   
ref|XP_006592933.1|  PREDICTED: uncharacterized protein LOC100806...    229   1e-69   
gb|AFK47598.1|  unknown                                                 229   1e-69   
gb|AES67378.2|  DUF640 family protein                                   229   1e-69   
ref|XP_003526225.1|  PREDICTED: uncharacterized protein LOC100815968    229   1e-69   
ref|XP_003597127.1|  177 protein                                        229   2e-69   
gb|AFK34719.1|  unknown                                                 229   3e-69   
ref|XP_010108230.1|  hypothetical protein L484_018651                   229   3e-69   
ref|XP_003607586.1|  177 protein                                        228   4e-69   
ref|XP_011083008.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   4e-69   
ref|XP_009784769.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    229   4e-69   
ref|XP_007149389.1|  hypothetical protein PHAVU_005G066200g             228   4e-69   
ref|XP_002301561.2|  hypothetical protein POPTR_0002s22690g             228   4e-69   Populus trichocarpa [western balsam poplar]
ref|XP_010052695.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   5e-69   
gb|AFK41138.1|  unknown                                                 227   8e-69   
ref|XP_009133547.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    227   8e-69   
gb|ACJ85482.1|  unknown                                                 226   1e-68   Medicago truncatula
ref|NP_001237763.1|  uncharacterized protein LOC100527554               228   1e-68   
ref|XP_004516078.1|  PREDICTED: uncharacterized protein LOC101514778    227   1e-68   
ref|XP_008448236.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    228   1e-68   
ref|XP_011008166.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   2e-68   
ref|XP_007133232.1|  hypothetical protein PHAVU_011G162700g             226   2e-68   
ref|XP_009786006.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   3e-68   
ref|XP_010277024.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   3e-68   
ref|XP_004233074.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   3e-68   
ref|XP_010508549.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   4e-68   
ref|XP_010506094.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    226   4e-68   
ref|XP_006296565.1|  hypothetical protein CARUB_v100241591mg            226   4e-68   
ref|XP_011098405.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    225   5e-68   
gb|KHN36883.1|  hypothetical protein glysoja_001614                     226   6e-68   
ref|XP_009608555.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    225   6e-68   
gb|EYU45022.1|  hypothetical protein MIMGU_mgv1a014215mg                226   6e-68   
ref|NP_565978.1|  uncharacterized protein                               225   7e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879996.1|  hypothetical protein ARALYDRAFT_903634             225   7e-68   
ref|XP_004243287.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   7e-68   
ref|XP_009343797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   9e-68   
ref|XP_008381217.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   9e-68   
ref|XP_010279129.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   1e-67   
ref|XP_009593391.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   1e-67   
ref|XP_006348870.1|  PREDICTED: uncharacterized protein LOC102600485    224   1e-67   
ref|XP_010524062.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   1e-67   
ref|XP_009626514.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   1e-67   
emb|CDY14848.1|  BnaC04g48450D                                          224   1e-67   
ref|XP_009142076.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   1e-67   
emb|CDY55387.1|  BnaA05g34250D                                          223   3e-67   
ref|XP_011101384.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    223   3e-67   
ref|XP_009587002.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    223   3e-67   
ref|XP_010531928.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    223   3e-67   
ref|XP_006411528.1|  hypothetical protein EUTSA_v10017308mg             223   4e-67   
ref|XP_006362411.1|  PREDICTED: uncharacterized protein LOC102591189    223   5e-67   
ref|XP_011085992.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    222   7e-67   
ref|XP_009773140.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    223   7e-67   
emb|CDO96796.1|  unnamed protein product                                223   7e-67   
ref|XP_010655519.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    222   7e-67   
gb|KHG25854.1|  Major vault                                             222   8e-67   
ref|XP_010525031.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    222   8e-67   
emb|CAN72178.1|  hypothetical protein VITISV_012478                     222   8e-67   Vitis vinifera
ref|XP_004150559.1|  PREDICTED: uncharacterized protein LOC101216601    224   9e-67   
gb|KGN47252.1|  hypothetical protein Csa_6G236080                       223   1e-66   
ref|XP_004171262.1|  PREDICTED: uncharacterized LOC101216601            223   1e-66   
ref|XP_009142855.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    222   1e-66   
gb|KDP21096.1|  hypothetical protein JCGZ_21567                         222   1e-66   
ref|XP_002522583.1|  conserved hypothetical protein                     221   1e-66   Ricinus communis
ref|XP_010553628.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    220   3e-66   
ref|XP_004505495.1|  PREDICTED: uncharacterized protein LOC101509969    220   3e-66   
ref|XP_007025375.1|  Beta-lactamase-like protein ENSP00000383859        221   3e-66   
ref|XP_004136831.1|  PREDICTED: uncharacterized protein LOC101208687    221   4e-66   
ref|XP_010109876.1|  hypothetical protein L484_003806                   221   4e-66   
ref|XP_011008476.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    220   4e-66   
ref|XP_008455303.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    220   5e-66   
gb|EPS59921.1|  hypothetical protein M569_14884                         219   5e-66   
ref|XP_002305745.1|  hypothetical protein POPTR_0004s05610g             220   6e-66   Populus trichocarpa [western balsam poplar]
gb|KGN55073.1|  hypothetical protein Csa_4G627230                       221   6e-66   
ref|XP_006467647.1|  PREDICTED: uncharacterized protein LOC102611919    221   6e-66   
ref|XP_004146094.1|  PREDICTED: uncharacterized protein LOC101204141    221   6e-66   
ref|XP_004171006.1|  PREDICTED: uncharacterized LOC101204141            220   7e-66   
gb|AFK41155.1|  unknown                                                 219   8e-66   
ref|XP_006449503.1|  hypothetical protein CICLE_v10016772mg             220   8e-66   
gb|AFK49191.1|  unknown                                                 219   9e-66   
ref|XP_009790882.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   1e-65   
ref|XP_008463732.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    220   1e-65   
ref|XP_009790219.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   1e-65   
ref|XP_011098044.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    218   1e-65   
ref|XP_008371461.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   1e-65   
ref|XP_004485894.1|  PREDICTED: uncharacterized protein LOC101502781    219   1e-65   
ref|XP_004293946.1|  PREDICTED: uncharacterized protein LOC101295...    219   2e-65   
ref|XP_008225289.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   2e-65   
ref|XP_003542999.1|  PREDICTED: uncharacterized protein LOC100778886    219   2e-65   
ref|XP_008465553.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   2e-65   
ref|XP_008358651.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   2e-65   
ref|XP_010052190.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    218   2e-65   
ref|XP_007148048.1|  hypothetical protein PHAVU_006G176100g             218   3e-65   
ref|XP_006442831.1|  hypothetical protein CICLE_v10023710mg             223   4e-65   
gb|EPS69070.1|  hypothetical protein M569_05697                         216   4e-65   
ref|XP_007212120.1|  hypothetical protein PRUPE_ppa012018mg             218   5e-65   
ref|XP_004151474.1|  PREDICTED: uncharacterized protein LOC101210225    217   8e-65   
ref|NP_001237249.1|  uncharacterized protein LOC100306082               217   9e-65   
gb|KGN65636.1|  hypothetical protein Csa_1G474480                       216   2e-64   
ref|NP_565190.1|  protein LIGHT SENSITIVE HYPOCOTYLS 7                  216   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006478612.1|  PREDICTED: probable disease resistance prote...    236   2e-64   
ref|XP_002889213.1|  At1g78815                                          216   3e-64   
gb|ABF83646.1|  At1g78815                                               216   4e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004174117.1|  PREDICTED: uncharacterized protein LOC101228453    216   4e-64   
ref|XP_010429720.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    216   4e-64   
gb|EYU30777.1|  hypothetical protein MIMGU_mgv1a014751mg                215   5e-64   
ref|XP_010417489.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    216   5e-64   
ref|XP_006302860.1|  hypothetical protein CARUB_v10020990mg             215   5e-64   
ref|XP_004244278.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   8e-64   
gb|AAM64330.1|  unknown                                                 215   8e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011011486.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   1e-63   
ref|XP_002317421.1|  hypothetical protein POPTR_0011s07350g             214   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_009106595.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    213   3e-63   
ref|XP_006389954.1|  hypothetical protein EUTSA_v10019792mg             213   3e-63   
emb|CDX88480.1|  BnaC06g39240D                                          212   6e-63   
ref|XP_010540518.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    212   6e-63   
gb|KFK42237.1|  hypothetical protein AALP_AA2G229400                    212   1e-62   
gb|KDO64048.1|  hypothetical protein CISIN_1g0003541mg                  223   1e-62   
ref|XP_010327093.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    211   1e-62   
emb|CDX85083.1|  BnaC07g08230D                                          210   6e-62   
ref|XP_009102637.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    210   7e-62   
emb|CDY14588.1|  BnaC02g25250D                                          209   1e-61   
ref|XP_003531069.1|  PREDICTED: uncharacterized protein LOC100798406    211   1e-61   
emb|CDY26881.1|  BnaA02g19060D                                          209   1e-61   
emb|CDY69731.1|  BnaCnng65050D                                          209   1e-61   
ref|XP_003524092.1|  PREDICTED: uncharacterized protein LOC100775838    211   1e-61   
ref|XP_008649559.1|  PREDICTED: protein G1-like7                        212   2e-61   
gb|EYU43335.1|  hypothetical protein MIMGU_mgv1a022623mg                207   3e-61   
ref|XP_003539992.1|  PREDICTED: uncharacterized protein LOC100806134    208   3e-61   
ref|NP_001143976.1|  uncharacterized protein LOC100276793               212   4e-61   Zea mays [maize]
gb|KHG10505.1|  Error-prone DNA polymerase                              209   7e-61   
ref|XP_004504735.1|  PREDICTED: uncharacterized protein LOC101506113    209   7e-61   
ref|XP_010906808.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    207   8e-61   
gb|KHG29970.1|  Putative beta-lactamase-like 1                          206   8e-61   
ref|XP_009128313.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   9e-61   
ref|XP_007016962.1|  Zinc finger protein ZFPM1                          208   1e-60   
ref|XP_008802142.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    206   2e-60   
ref|XP_009419635.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    206   2e-60   
ref|XP_010549405.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    206   2e-60   
ref|XP_009383380.1|  PREDICTED: protein G1-like7                        206   4e-60   
ref|XP_009615590.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    205   6e-60   
gb|KEH31304.1|  G1-like protein                                         206   7e-60   
ref|XP_002313971.1|  hypothetical protein POPTR_0009s07990g             206   7e-60   Populus trichocarpa [western balsam poplar]
ref|XP_002298496.1|  hypothetical protein POPTR_0001s28780g             206   9e-60   Populus trichocarpa [western balsam poplar]
ref|XP_009108056.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    204   2e-59   
ref|XP_011003514.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    204   2e-59   
ref|XP_007159026.1|  hypothetical protein PHAVU_002G202200g             205   2e-59   
gb|KFK28531.1|  hypothetical protein AALP_AA7G008800                    203   3e-59   
ref|XP_003531259.1|  PREDICTED: uncharacterized protein LOC100810655    202   3e-59   
ref|XP_008804907.1|  PREDICTED: protein G1-like7                        204   4e-59   
ref|XP_008657105.1|  PREDICTED: protein G1-like7                        203   4e-59   
ref|XP_009411199.1|  PREDICTED: protein G1-like7                        203   5e-59   
gb|AES98763.2|  DUF640 family protein                                   203   6e-59   
ref|XP_009385358.1|  PREDICTED: protein G1-like7                        202   7e-59   
ref|XP_006847407.1|  hypothetical protein AMTR_s00153p00047660          202   7e-59   
emb|CDP09236.1|  unnamed protein product                                203   7e-59   
ref|XP_002973743.1|  hypothetical protein SELMODRAFT_36560              201   8e-59   
ref|XP_010922606.1|  PREDICTED: protein G1-like7                        203   8e-59   
ref|XP_010475462.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   1e-58   
ref|XP_006417846.1|  hypothetical protein EUTSA_v10009726mg             202   1e-58   
ref|XP_003615805.1|  hypothetical protein MTR_5g072510                  204   1e-58   
ref|XP_010487116.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   1e-58   
ref|XP_002892379.1|  hypothetical protein ARALYDRAFT_887918             201   1e-58   
ref|NP_563780.1|  protein LIGHT SENSITIVE HYPOCOTYLS 6                  201   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003537309.1|  PREDICTED: uncharacterized protein LOC100775798    202   2e-58   
gb|EPS68444.1|  hypothetical protein M569_06326                         201   2e-58   
ref|XP_006303356.1|  hypothetical protein CARUB_v10010340mg             201   2e-58   
emb|CDY10247.1|  BnaC05g04900D                                          201   2e-58   
ref|XP_010457872.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   2e-58   
ref|XP_010043398.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   2e-58   
emb|CDY06675.1|  BnaA10g04540D                                          201   2e-58   
ref|XP_010043397.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   2e-58   
gb|EYU41125.1|  hypothetical protein MIMGU_mgv1a021620mg                200   2e-58   
gb|EYU45980.1|  hypothetical protein MIMGU_mgv1a021801mg                201   2e-58   
ref|XP_010906823.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   2e-58   
ref|XP_004504297.1|  PREDICTED: uncharacterized protein LOC101498424    200   2e-58   
ref|XP_006443825.1|  hypothetical protein CICLE_v10022295mg             201   3e-58   
ref|XP_010439831.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   3e-58   
ref|XP_006286146.1|  hypothetical protein CARUB_v10007704mg             200   3e-58   
ref|XP_010685918.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   3e-58   
gb|KHN45745.1|  hypothetical protein glysoja_043995                     200   3e-58   
ref|XP_009398867.1|  PREDICTED: protein G1-like4                        201   3e-58   
ref|XP_003629770.1|  177 protein                                        200   3e-58   
emb|CDX78877.1|  BnaA01g09440D                                          200   3e-58   
ref|NP_193596.1|  uncharacterized protein                               200   4e-58   Arabidopsis thaliana [mouse-ear cress]
dbj|BAI52974.1|  G1-like protein                                        201   4e-58   Selaginella moellendorffii
ref|XP_009108375.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   4e-58   
gb|KEH41129.1|  G1-like protein                                         201   4e-58   
ref|XP_010434509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   4e-58   
ref|XP_007159450.1|  hypothetical protein PHAVU_002G238600g             199   4e-58   
emb|CDY67351.1|  BnaCnng54640D                                          200   5e-58   
emb|CDY01557.1|  BnaC07g35470D                                          200   5e-58   
emb|CDX76510.1|  BnaA08g08900D                                          200   5e-58   
ref|XP_010449492.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   5e-58   
ref|XP_002870033.1|  hypothetical protein ARALYDRAFT_914818             199   5e-58   
ref|XP_003638136.1|  hypothetical protein MTR_119s0026                  207   6e-58   
ref|XP_006401075.1|  hypothetical protein EUTSA_v10014789mg             199   6e-58   
ref|XP_002961823.1|  hypothetical protein SELMODRAFT_68566              199   6e-58   
gb|EPS74620.1|  hypothetical protein M569_00139                         199   7e-58   
ref|XP_010497623.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   7e-58   
gb|KFK43023.1|  hypothetical protein AALP_AA1G068900                    199   7e-58   
gb|EYU28084.1|  hypothetical protein MIMGU_mgv1a022457mg                199   8e-58   
ref|XP_010043396.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   8e-58   
ref|XP_008811689.1|  PREDICTED: protein G1-like7                        200   9e-58   
ref|XP_006414079.1|  hypothetical protein EUTSA_v10027091mg             199   1e-57   
ref|XP_008355077.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   1e-57   
emb|CDY34056.1|  BnaC03g62760D                                          199   1e-57   
ref|XP_009354180.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   1e-57   
ref|XP_011024904.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   1e-57   
emb|CDY59510.1|  BnaCnng35040D                                          198   2e-57   
ref|XP_009126748.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   2e-57   
ref|XP_002866271.1|  hypothetical protein ARALYDRAFT_919048             197   2e-57   
emb|CDY32697.1|  BnaA02g07590D                                          197   2e-57   
ref|XP_009118997.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   2e-57   
gb|KFK27377.1|  hypothetical protein AALP_AA8G375000                    197   2e-57   
ref|XP_010521971.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   3e-57   
ref|XP_010689830.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   3e-57   
ref|NP_200658.1|  protein LIGHT SENSITIVE HYPOCOTYLS 5                  197   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002862737.1|  hypothetical protein ARALYDRAFT_920315             197   3e-57   
ref|XP_009132033.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   4e-57   
ref|XP_006281173.1|  hypothetical protein CARUB_v10027208mg             197   5e-57   
ref|XP_002879250.1|  hypothetical protein ARALYDRAFT_901988             197   6e-57   
emb|CDY64755.1|  BnaCnng44770D                                          197   6e-57   
ref|XP_009605797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   7e-57   
emb|CDY61050.1|  BnaCnng37250D                                          196   1e-56   
ref|XP_002267312.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   2e-56   Vitis vinifera
ref|XP_009391700.1|  PREDICTED: protein G1-like7                        197   2e-56   
ref|XP_010453783.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   2e-56   
emb|CDY32977.1|  BnaA10g11830D                                          195   2e-56   
ref|XP_009770526.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   2e-56   
ref|XP_010443587.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   3e-56   
ref|XP_010518804.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   3e-56   
ref|XP_009412626.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   3e-56   
ref|XP_010483448.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   3e-56   
emb|CDY59064.1|  BnaAnng15760D                                          195   4e-56   
ref|XP_010542671.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   4e-56   
ref|XP_009136943.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   5e-56   
ref|XP_010538562.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   6e-56   
ref|XP_004233194.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   6e-56   
ref|XP_009120359.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   6e-56   
emb|CDY52287.1|  BnaA03g57800D                                          194   7e-56   
ref|XP_009118463.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   7e-56   
ref|XP_009611433.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   8e-56   
ref|XP_006353047.1|  PREDICTED: uncharacterized protein LOC102583639    193   1e-55   
ref|XP_009385214.1|  PREDICTED: protein G1-like7                        193   2e-55   
ref|XP_009763597.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   2e-55   
ref|XP_006410079.1|  hypothetical protein EUTSA_v10017270mg             192   3e-55   
ref|XP_011043717.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   5e-55   
ref|XP_010529198.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   5e-55   
ref|XP_002313621.2|  hypothetical protein POPTR_0009s15930g             191   8e-55   
ref|XP_002317078.1|  hypothetical protein POPTR_0011s16010g             192   1e-54   
ref|XP_009144329.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   2e-54   
gb|KDP34854.1|  hypothetical protein JCGZ_09142                         191   3e-54   
emb|CDY10712.1|  BnaA05g12240D                                          189   3e-54   
ref|XP_004239743.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   3e-54   
emb|CDO99243.1|  unnamed protein product                                189   3e-54   
ref|XP_011005316.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   3e-54   
ref|XP_004296375.1|  PREDICTED: uncharacterized protein LOC101303109    190   4e-54   
ref|XP_011080720.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   4e-54   
ref|NP_173135.1|  uncharacterized protein                               188   5e-54   
ref|XP_009417987.1|  PREDICTED: protein G1-like7                        191   5e-54   
ref|XP_002533787.1|  conserved hypothetical protein                     191   6e-54   
ref|XP_010264562.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   6e-54   
ref|XP_008438509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   7e-54   
ref|XP_002458704.1|  hypothetical protein SORBIDRAFT_03g038670          189   7e-54   
ref|XP_004490633.1|  PREDICTED: uncharacterized protein LOC101513114    190   7e-54   
ref|XP_010052568.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   8e-54   
ref|XP_008674867.1|  PREDICTED: protein G1-like7                        189   8e-54   
ref|XP_010907173.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   8e-54   
ref|XP_009401942.1|  PREDICTED: protein G1-like4                        189   9e-54   
ref|XP_006354481.1|  PREDICTED: uncharacterized protein LOC102586971    189   9e-54   
ref|XP_011040543.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   1e-53   
ref|XP_007143862.1|  hypothetical protein PHAVU_007G108200g             188   1e-53   
ref|XP_004970435.1|  PREDICTED: uncharacterized protein LOC101754104    189   1e-53   
gb|AFK48050.1|  unknown                                                 188   1e-53   
ref|XP_010926891.1|  PREDICTED: protein G1-like1                        190   1e-53   
ref|XP_007143863.1|  hypothetical protein PHAVU_007G108200g             188   1e-53   
ref|XP_004134659.1|  PREDICTED: uncharacterized protein LOC101214534    189   1e-53   
gb|EEE55616.1|  hypothetical protein OsJ_03942                          188   1e-53   
sp|Q941W1.1|G1L7_ORYSJ  RecName: Full=Protein G1-like7                  189   1e-53   
sp|A2XED8.1|G1L7_ORYSI  RecName: Full=Protein G1-like7                  189   1e-53   
ref|XP_004962398.1|  PREDICTED: skin secretory protein xP2-like         192   1e-53   
ref|XP_008439509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   1e-53   
ref|XP_009124995.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   1e-53   
emb|CDY02038.1|  BnaC04g14630D                                          187   1e-53   
emb|CDY35523.1|  BnaA01g23890D                                          188   1e-53   
emb|CDY21126.1|  BnaA01g33570D                                          188   2e-53   
ref|XP_008807164.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   2e-53   
ref|XP_008465528.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   2e-53   
ref|XP_010650097.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   2e-53   
ref|XP_003590857.1|  hypothetical protein MTR_1g075990                  187   2e-53   
ref|XP_010069122.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   2e-53   
ref|XP_001753216.1|  predicted protein                                  186   2e-53   
ref|XP_003536217.1|  PREDICTED: uncharacterized protein LOC100789...    188   2e-53   
ref|XP_006589267.1|  PREDICTED: uncharacterized protein LOC100789...    188   2e-53   
ref|XP_011091303.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   3e-53   
gb|KFK39618.1|  hypothetical protein AALP_AA3G267200                    187   3e-53   
ref|XP_009410038.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   3e-53   
ref|XP_006606387.1|  PREDICTED: uncharacterized protein LOC100806...    187   3e-53   
ref|XP_007142170.1|  hypothetical protein PHAVU_008G258200g             188   3e-53   
ref|XP_010414174.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   3e-53   
ref|XP_006406049.1|  hypothetical protein EUTSA_v10021563mg             187   3e-53   
ref|XP_003556381.1|  PREDICTED: uncharacterized protein LOC100806...    187   3e-53   
ref|XP_003567242.1|  PREDICTED: protein G1-like7                        188   3e-53   
ref|XP_008804103.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   3e-53   
ref|XP_010469755.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   4e-53   
ref|XP_010510232.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   4e-53   
sp|Q6ATW6.1|G1L8_ORYSJ  RecName: Full=Protein G1-like8                  188   4e-53   
ref|XP_006606388.1|  PREDICTED: uncharacterized protein LOC100806...    187   4e-53   
emb|CDY10790.1|  BnaA05g11460D                                          187   4e-53   
ref|XP_004497868.1|  PREDICTED: uncharacterized protein LOC101506...    187   4e-53   
gb|KDO60474.1|  hypothetical protein CISIN_1g046561mg                   187   4e-53   
ref|XP_004167341.1|  PREDICTED: uncharacterized protein LOC101231116    186   4e-53   
ref|XP_006350860.1|  PREDICTED: uncharacterized protein LOC102596443    188   4e-53   
ref|XP_010522152.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   5e-53   
ref|XP_009336145.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   5e-53   
gb|EPS66277.1|  hypothetical protein M569_08502                         184   5e-53   
gb|EYU43203.1|  hypothetical protein MIMGU_mgv1a013748mg                187   5e-53   
ref|XP_004134409.1|  PREDICTED: uncharacterized protein LOC101212284    186   5e-53   
sp|A2Y5N0.1|G1L8_ORYSI  RecName: Full=Protein G1-like8                  188   5e-53   
ref|XP_008356205.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    187   5e-53   
ref|NP_001055266.1|  Os05g0347400                                       189   6e-53   
emb|CDY24755.1|  BnaC04g13600D                                          187   6e-53   
ref|XP_009144232.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   6e-53   
ref|XP_004242504.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   6e-53   
ref|XP_006845978.1|  hypothetical protein AMTR_s00155p00022580          187   6e-53   
ref|XP_006345889.1|  PREDICTED: uncharacterized protein LOC102588665    187   6e-53   
ref|XP_003544306.1|  PREDICTED: uncharacterized protein LOC100780494    187   7e-53   
ref|XP_002299015.2|  hypothetical protein POPTR_0001s46470g             189   7e-53   
ref|XP_002440915.1|  hypothetical protein SORBIDRAFT_09g016440          191   7e-53   
ref|XP_006410244.1|  hypothetical protein EUTSA_v10017162mg             187   7e-53   
emb|CDY30000.1|  BnaC01g40080D                                          186   8e-53   
ref|XP_009772674.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   8e-53   
emb|CDM84812.1|  unnamed protein product                                187   8e-53   
ref|XP_010488385.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   8e-53   
emb|CDY57087.1|  BnaA04g28750D                                          187   9e-53   
ref|NP_001078202.2|  protein LIGHT SENSITIVE HYPOCOTYLS 4               186   9e-53   
ref|XP_010023924.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   9e-53   
ref|XP_010104757.1|  hypothetical protein L484_021447                   187   9e-53   
ref|XP_006857299.1|  hypothetical protein AMTR_s00067p00052610          186   9e-53   
ref|XP_007022986.1|  Uncharacterized protein TCM_026988                 187   1e-52   
ref|XP_007146820.1|  hypothetical protein PHAVU_006G072500g             187   1e-52   
ref|XP_002862787.1|  hypothetical protein ARALYDRAFT_497295             187   1e-52   
ref|XP_008789168.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   1e-52   
ref|XP_004247736.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   1e-52   
ref|XP_010488383.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   1e-52   
emb|CDY15426.1|  BnaC04g41970D                                          186   1e-52   
ref|XP_010098512.1|  hypothetical protein L484_025951                   187   1e-52   
ref|XP_009128817.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   1e-52   
ref|XP_009144231.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   1e-52   
ref|XP_010466654.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   1e-52   
ref|XP_008810562.1|  PREDICTED: protein G1-like4                        186   1e-52   
ref|XP_009603577.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   1e-52   
ref|XP_006293520.1|  hypothetical protein CARUB_v10024036mg             186   1e-52   
ref|XP_006425133.1|  hypothetical protein CICLE_v10029262mg             186   1e-52   
ref|XP_008235666.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   1e-52   
ref|XP_010512305.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   1e-52   
emb|CDY06030.1|  BnaA09g37500D                                          185   1e-52   
ref|XP_008367221.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   2e-52   
ref|XP_010532649.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   2e-52   
ref|XP_002883419.1|  hypothetical protein ARALYDRAFT_898842             185   2e-52   
ref|XP_006298606.1|  hypothetical protein CARUB_v10014690mg             186   2e-52   
ref|XP_006398272.1|  hypothetical protein EUTSA_v10001044mg             185   2e-52   
ref|XP_008793554.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   2e-52   
ref|XP_004134890.1|  PREDICTED: uncharacterized protein LOC101208925    185   2e-52   
gb|ABK21716.1|  unknown                                                 186   2e-52   
ref|XP_006420250.1|  hypothetical protein CICLE_v10005901mg             186   2e-52   
ref|XP_010935915.1|  PREDICTED: protein G1-like4                        185   2e-52   
ref|XP_010934319.1|  PREDICTED: protein G1-like4                        185   2e-52   
ref|XP_002306857.2|  hypothetical protein POPTR_0005s24730g             185   2e-52   
ref|XP_011004043.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   2e-52   
ref|XP_001760807.1|  predicted protein                                  183   2e-52   
gb|KGN49491.1|  hypothetical protein Csa_6G526250                       185   2e-52   
ref|XP_009762992.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   2e-52   
ref|XP_009403861.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   2e-52   
ref|NP_565716.1|  uncharacterized protein                               186   2e-52   
ref|XP_010671018.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   3e-52   
ref|XP_002441248.1|  hypothetical protein SORBIDRAFT_09g023120          186   3e-52   
ref|XP_003566357.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   3e-52   
ref|XP_009141136.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   3e-52   
ref|XP_002879309.1|  hypothetical protein ARALYDRAFT_344884             186   3e-52   
ref|XP_002271024.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   3e-52   
ref|XP_008224344.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   3e-52   
ref|XP_010905797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   3e-52   
ref|XP_006410245.1|  hypothetical protein EUTSA_v10017162mg             186   3e-52   
ref|XP_007145860.1|  hypothetical protein PHAVU_007G274100g             185   3e-52   
ref|XP_002863446.1|  hypothetical protein ARALYDRAFT_916864             184   3e-52   
ref|XP_009369632.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   3e-52   
gb|KDO66991.1|  hypothetical protein CISIN_1g023835mg                   185   3e-52   
ref|XP_006488572.1|  PREDICTED: uncharacterized protein LOC102610331    185   4e-52   
ref|XP_009399257.1|  PREDICTED: protein G1-like1                        186   4e-52   
gb|KDP40343.1|  hypothetical protein JCGZ_02341                         185   4e-52   
ref|XP_009384186.1|  PREDICTED: protein G1-like1                        186   4e-52   
dbj|BAK01969.1|  predicted protein                                      186   4e-52   
ref|XP_002311674.2|  hypothetical protein POPTR_0008s16750g             184   4e-52   
ref|XP_004292213.1|  PREDICTED: uncharacterized protein LOC101301170    185   4e-52   
ref|XP_007201372.1|  hypothetical protein PRUPE_ppa012142mg             184   4e-52   
ref|XP_009419675.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   4e-52   
ref|XP_008808528.1|  PREDICTED: protein G1-like1                        186   4e-52   
ref|XP_008656356.1|  PREDICTED: protein G1-like7                        188   5e-52   
ref|NP_001046002.1|  Os02g0166800                                       184   5e-52   
ref|XP_010527402.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   5e-52   
gb|KDO66990.1|  hypothetical protein CISIN_1g023835mg                   187   5e-52   
ref|XP_010257059.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   5e-52   
ref|XP_009391974.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   5e-52   
ref|XP_007035134.1|  Uncharacterized protein TCM_020903                 184   6e-52   
ref|XP_004293717.1|  PREDICTED: uncharacterized protein LOC101301655    186   6e-52   
ref|XP_009120360.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   6e-52   
emb|CAN67056.1|  hypothetical protein VITISV_036348                     183   6e-52   
ref|NP_001235822.1|  uncharacterized protein LOC100527164               184   6e-52   
gb|KHN10748.1|  hypothetical protein glysoja_019179                     184   6e-52   
ref|XP_003521294.1|  PREDICTED: uncharacterized protein LOC100778...    184   6e-52   
ref|XP_011085173.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   6e-52   
ref|XP_007010574.1|  Uncharacterized protein TCM_044482                 196   7e-52   
ref|XP_010652376.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    183   7e-52   
ref|XP_006282119.1|  hypothetical protein CARUB_v10028368mg             183   7e-52   
ref|XP_007226923.1|  hypothetical protein PRUPE_ppa015837mg             184   7e-52   
ref|XP_004493783.1|  PREDICTED: uncharacterized protein LOC101490141    184   8e-52   
ref|XP_010262338.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   8e-52   
ref|XP_010679333.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    183   8e-52   
ref|XP_010921009.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    186   8e-52   
gb|ACN41049.1|  unknown                                                 185   9e-52   
ref|XP_006378330.1|  hypothetical protein POPTR_0010s08140g             184   9e-52   
ref|XP_008391225.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   9e-52   
ref|XP_010246796.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    183   9e-52   
gb|KEH23934.1|  G1-like protein                                         184   1e-51   
ref|XP_009129837.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    183   1e-51   
ref|XP_011028817.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    183   1e-51   
ref|XP_009629990.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   1e-51   
ref|XP_009400810.1|  PREDICTED: protein G1-like4                        183   1e-51   
ref|XP_006489717.1|  PREDICTED: uncharacterized protein LOC102628291    184   1e-51   
ref|XP_002302041.2|  hypothetical protein POPTR_0002s03860g             183   1e-51   
gb|KDP45779.1|  hypothetical protein JCGZ_17386                         184   1e-51   
ref|XP_003599342.1|  hypothetical protein MTR_3g031830                  184   1e-51   
gb|KEH42512.1|  G1-like protein                                         184   1e-51   
gb|KFK31223.1|  hypothetical protein AALP_AA6G084400                    184   1e-51   
ref|XP_004500306.1|  PREDICTED: dual specificity protein phosphat...    184   1e-51   
gb|KHN05068.1|  hypothetical protein glysoja_013975                     181   1e-51   
ref|XP_010262340.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   1e-51   
gb|ABR18275.1|  unknown                                                 184   1e-51   
ref|XP_007050277.1|  IQ motif and SEC7 domain-containing protein 2      182   2e-51   
gb|EPS68159.1|  hypothetical protein M569_06614                         181   2e-51   
gb|EPS74320.1|  hypothetical protein M569_00435                         182   2e-51   
ref|XP_002451603.1|  hypothetical protein SORBIDRAFT_04g004470          185   2e-51   
ref|XP_008785240.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    183   2e-51   
ref|XP_004152052.1|  PREDICTED: uncharacterized protein LOC101218342    182   2e-51   
ref|XP_004966292.1|  PREDICTED: uncharacterized protein LOC101766...    185   2e-51   
emb|CDX87760.1|  BnaC02g31890D                                          182   2e-51   
ref|NP_001159319.1|  uncharacterized protein LOC100304411               183   2e-51   



>ref|XP_009622401.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=198

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL  CNYNHVLDFL+YLDQFGKTKVHL GC++FGQPE
Sbjct  48   YESQKRRDWNTFGQYLKNQRPPVPLSNCNYNHVLDFLKYLDQFGKTKVHLHGCLFFGQPE  107

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPESNPFA  AIR+YLREVRD+Q+KARG
Sbjct  108  PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPESNPFASGAIRVYLREVRDSQAKARG  167

Query  703  IPYkkkkkkknnalpkpnnDET-PSFQMQSS  792
            IPYKKKKKK+N  +          +FQ+QSS
Sbjct  168  IPYKKKKKKRNMQIKTSKTAAVAATFQLQSS  198



>emb|CDP06011.1| unnamed protein product [Coffea canephora]
Length=200

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 137/150 (91%), Gaps = 2/150 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPVPL +CN+NHVLDFLRYLDQFGKTKVHLQGC++FG PE
Sbjct  53   YESQKRRDWNTFGQYLRNQRPPVPLSQCNFNHVLDFLRYLDQFGKTKVHLQGCVFFGHPE  112

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAGPCTCPLRQAWGSLDALIGRLRAA+EENGGLP+ NPFA  AIR+YLREVRD+Q+KARG
Sbjct  113  PAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPDKNPFASGAIRVYLREVRDSQAKARG  172

Query  703  IPYkkkkkkknnalpkpnnDETPSFQMQSS  792
            IPY  KKKKK  ++P   N+E+ +FQMQSS
Sbjct  173  IPY--KKKKKRKSIPMKPNNESSNFQMQSS  200



>ref|XP_006360044.1| PREDICTED: uncharacterized protein LOC102584680 [Solanum tuberosum]
Length=207

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV LP+CNYNHVLDFLRYLDQFGKTKVHL GC++FGQPE
Sbjct  52   YESQKRRDWNTFGQYLKNQRPPVSLPQCNYNHVLDFLRYLDQFGKTKVHLHGCLFFGQPE  111

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGL E+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  112  PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFASGAIRVYLREVRDSQAKARG  171

Query  703  IPY  711
            IPY
Sbjct  172  IPY  174



>ref|XP_004248241.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=213

 Score =   239 bits (609),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPP+ LP+CNYNHVLDFLRYLDQFGKTKVHL GC++FGQPE
Sbjct  58   YESQKRRDWNTFGQYLKNQRPPISLPQCNYNHVLDFLRYLDQFGKTKVHLHGCLFFGQPE  117

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGL E+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  118  PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFASGAIRVYLREVRDSQAKARG  177

Query  703  IPY  711
            IPY
Sbjct  178  IPY  180



>ref|XP_009770169.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=206

 Score =   238 bits (608),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL  CNYNHVLDFLRYLDQFGKTKVHL GC++FGQP+
Sbjct  50   YESQKRRDWNTFGQYLKNQRPPVPLSNCNYNHVLDFLRYLDQFGKTKVHLHGCLFFGQPD  109

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLP SNPFA  AIR+YLRE+RD+Q+KARG
Sbjct  110  PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPVSNPFASGAIRVYLREIRDSQAKARG  169

Query  703  IPY  711
            IPY
Sbjct  170  IPY  172



>ref|XP_006370148.1| hypothetical protein POPTR_0001s40140g [Populus trichocarpa]
 gb|ERP66717.1| hypothetical protein POPTR_0001s40140g [Populus trichocarpa]
Length=176

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 130/148 (88%), Gaps = 3/148 (2%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +CN NHVL+FLRYLDQFGKTKVHLQGC++FGQPE
Sbjct  32   YESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFLRYLDQFGKTKVHLQGCVFFGQPE  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  92   PPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKARG  151

Query  703  IPYkkkkkkknnalpkpnnDETPSFQMQ  786
            IPY   KKKK    P   NDE+ SF MQ
Sbjct  152  IPY---KKKKKKRNPMKANDESSSFHMQ  176



>ref|XP_002280666.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Vitis 
vinifera]
Length=167

 Score =   235 bits (600),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGCM+FGQPE
Sbjct  28   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFFGQPE  87

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDAL+GRLRAA+EENGG PE+NPFA  AIR+YLREVR+ QSKARG
Sbjct  88   PPAPCTCPLRQAWGSLDALVGRLRAAYEENGGSPETNPFASGAIRIYLREVRECQSKARG  147

Query  703  IPY  711
            IPY
Sbjct  148  IPY  150



>ref|XP_011082761.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Sesamum 
indicum]
Length=182

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +CNY+HVLDF+RYLDQFGKTKVH+QGC++FGQPE
Sbjct  38   YESQKRRDWNTFGQYLRNQRPPVALSQCNYSHVLDFMRYLDQFGKTKVHIQGCVFFGQPE  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAGPCTCPLRQAWGSLDALIGRLRAA+EENGG+PE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  98   PAGPCTCPLRQAWGSLDALIGRLRAAYEENGGVPETNPFANGAIRVYLREVRDSQAKARG  157

Query  703  IPY  711
            IPY
Sbjct  158  IPY  160



>ref|XP_011013261.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Populus 
euphratica]
Length=176

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 130/148 (88%), Gaps = 3/148 (2%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +CN NHVL+FLRYLDQFGKTKVHLQGC++FGQPE
Sbjct  32   YESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFLRYLDQFGKTKVHLQGCVFFGQPE  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  92   PPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKARG  151

Query  703  IPYkkkkkkknnalpkpnnDETPSFQMQ  786
            IPY   KKKK    P   NDE+ SF MQ
Sbjct  152  IPY---KKKKKKRNPMKANDESSSFHMQ  176



>ref|XP_010324393.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like isoform 
X1 [Solanum lycopersicum]
Length=199

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKN +PPVPLP+CNYNHVLDFLRYLDQFGKTKVHL GC++FGQ E
Sbjct  42   YESQKRRDWNTFGQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKTKVHLNGCVFFGQVE  101

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
              GPCTCPLRQAWGSLDALIGRLRAA+EENGGL E+NPFA SAIR+YLREVRD+Q+KARG
Sbjct  102  QVGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREVRDSQAKARG  161

Query  703  IPY  711
            IPY
Sbjct  162  IPY  164



>ref|XP_006442502.1| hypothetical protein CICLE_v10022456mg [Citrus clementina]
 ref|XP_006477739.1| PREDICTED: uncharacterized protein LOC102620640 [Citrus sinensis]
 gb|ESR55742.1| hypothetical protein CICLE_v10022456mg [Citrus clementina]
 gb|KDO47016.1| hypothetical protein CISIN_1g029917mg [Citrus sinensis]
Length=185

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +CN NHVLDFLRYLDQFGKTKVHLQGC++FGQPE
Sbjct  40   YESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLDFLRYLDQFGKTKVHLQGCVFFGQPE  99

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC+CPL+QAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  100  PPGPCSCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRIYLREVRDSQAKARG  159

Query  703  IPY  711
            IPY
Sbjct  160  IPY  162



>emb|CAN66524.1| hypothetical protein VITISV_034969 [Vitis vinifera]
Length=158

 Score =   234 bits (597),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGCM+FGQPE
Sbjct  28   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFFGQPE  87

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDAL+GRLRAA+EENGG PE+NPFA  AIR+YLREVR+ QSKARG
Sbjct  88   PPAPCTCPLRQAWGSLDALVGRLRAAYEENGGSPETNPFASGAIRIYLREVRECQSKARG  147

Query  703  IPY  711
            IPY
Sbjct  148  IPY  150



>ref|XP_011015901.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Populus 
euphratica]
Length=176

 Score =   235 bits (599),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 130/148 (88%), Gaps = 3/148 (2%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +CN NHVL+FLRYLDQFGKTKVH+QGC++FGQPE
Sbjct  32   YESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFLRYLDQFGKTKVHVQGCVFFGQPE  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  92   PPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKARG  151

Query  703  IPYkkkkkkknnalpkpnnDETPSFQMQ  786
            IPY   KKKK    P   NDE+ SF MQ
Sbjct  152  IPY---KKKKKKRNPMKANDESSSFHMQ  176



>ref|XP_009334040.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=186

 Score =   235 bits (600),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 129/150 (86%), Gaps = 2/150 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L + N NHVLDFLRYLDQFGKTKVH QGC++FGQPE
Sbjct  39   YESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHAQGCVFFGQPE  98

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  99   PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKARG  158

Query  703  IPYkkkkkkknnalpkpnnDETPSFQMQSS  792
            IPY  KKKKK   L K N D  P+  MQ S
Sbjct  159  IPY--KKKKKKRNLMKANLDHNPNISMQQS  186



>ref|XP_008368001.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
Length=186

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 129/150 (86%), Gaps = 2/150 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L + N NHVLDFLRYLDQFGKTKVH QGC++FGQPE
Sbjct  39   YESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHAQGCVFFGQPE  98

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  99   PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKARG  158

Query  703  IPYkkkkkkknnalpkpnnDETPSFQMQSS  792
            IPY  KKKKK   L K N D  P+  MQ S
Sbjct  159  IPY--KKKKKKRNLMKANLDHNPNISMQQS  186



>ref|XP_007021735.1| Uncharacterized protein TCM_031777 [Theobroma cacao]
 gb|EOY13260.1| Uncharacterized protein TCM_031777 [Theobroma cacao]
Length=186

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +CN NHVL+FLRYLDQFGKTKVHLQGC++FGQPE
Sbjct  40   YESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFLRYLDQFGKTKVHLQGCVFFGQPE  99

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  100  PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRIYLREVRDSQAKARG  159

Query  703  IPY  711
            IPY
Sbjct  160  IPY  162



>ref|XP_002317458.1| hypothetical protein POPTR_0011s11120g [Populus trichocarpa]
 gb|EEE98070.1| hypothetical protein POPTR_0011s11120g [Populus trichocarpa]
Length=176

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +CN N VLDFLRYLDQFGKTKVHLQGC++FGQPE
Sbjct  32   YESQKRRDWNTFGQYLRNQRPPVALSQCNANQVLDFLRYLDQFGKTKVHLQGCVFFGQPE  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  92   PPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKARG  151

Query  703  IPYkkkkkkknnalpkpnnDETPSFQMQ  786
            IPY   KKKK    P   NDE+ SF MQ
Sbjct  152  IPY---KKKKKKRNPTKANDESSSFHMQ  176



>ref|XP_009339946.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Pyrus 
x bretschneideri]
Length=183

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L + N NHVLDFLRYLDQFGKTKVHLQGC++FGQPE
Sbjct  36   YESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHLQGCVFFGQPE  95

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  96   PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFATGAIRVYLREVRDSQAKARG  155

Query  703  IPY  711
            IPY
Sbjct  156  IPY  158



>ref|XP_007215057.1| hypothetical protein PRUPE_ppa012217mg [Prunus persica]
 ref|XP_008229093.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Prunus 
mume]
 gb|EMJ16256.1| hypothetical protein PRUPE_ppa012217mg [Prunus persica]
Length=179

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CNYNHVL+FLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  32   YESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLRYLDQFGKTKVHLQGCMFYGQPE  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  92   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>ref|XP_007212123.1| hypothetical protein PRUPE_ppa012057mg [Prunus persica]
 gb|EMJ13322.1| hypothetical protein PRUPE_ppa012057mg [Prunus persica]
Length=185

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L + N NHVLDFLRYLDQFGKTKVHLQGC++FGQPE
Sbjct  38   YESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHLQGCVFFGQPE  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  98   PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKARG  157

Query  703  IPYkkkkkkknnalpkpnnDETPSFQMQSS  792
            IPY  KKKKK   L K N D  P+F M  S
Sbjct  158  IPY--KKKKKKRNLLKANLDHNPNFTMHQS  185



>ref|XP_008226537.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Prunus 
mume]
Length=186

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L + N NHVLDFLRYLDQFGKTKVHLQGC++FGQPE
Sbjct  39   YESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHLQGCVFFGQPE  98

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  99   PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKARG  158

Query  703  IPYkkkkkkknnalpkpnnDETPSFQMQSS  792
            IPY  KKKKK   L K N D  P+F M  S
Sbjct  159  IPY--KKKKKKRNLLKANLDHNPNFTMHQS  186



>gb|KDP35079.1| hypothetical protein JCGZ_11031 [Jatropha curcas]
Length=169

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVH+QGCM++GQPE
Sbjct  24   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHVQGCMFYGQPE  83

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVRD Q+KARG
Sbjct  84   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRDCQAKARG  143

Query  703  IPY  711
            IPY
Sbjct  144  IPY  146



>ref|XP_002320411.1| hypothetical protein POPTR_0014s13900g [Populus trichocarpa]
 gb|ABK93899.1| unknown [Populus trichocarpa]
 gb|EEE98726.1| hypothetical protein POPTR_0014s13900g [Populus trichocarpa]
Length=170

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  25   YESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFGKTKVHLQGCMFYGQPE  84

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA ++IR+YLREVRD Q+KARG
Sbjct  85   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFANASIRVYLREVRDYQAKARG  144

Query  703  IPY  711
            IP+
Sbjct  145  IPH  147



>ref|XP_011033736.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
 ref|XP_011033737.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
 ref|XP_011033738.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
Length=170

 Score =   233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  25   YESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFGKTKVHLQGCMFYGQPE  84

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA ++IR+YLREVRD Q+KARG
Sbjct  85   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFANASIRVYLREVRDYQAKARG  144

Query  703  IPY  711
            IP+
Sbjct  145  IPH  147



>ref|XP_003540402.1| PREDICTED: uncharacterized protein LOC100802937 isoform X1 [Glycine 
max]
 ref|XP_006592869.1| PREDICTED: uncharacterized protein LOC100802937 isoform X2 [Glycine 
max]
 gb|KHN27942.1| hypothetical protein glysoja_007674 [Glycine soja]
Length=175

 Score =   233 bits (594),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  30   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPE  89

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  +IR+YL+EVR+ Q+KARG
Sbjct  90   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLKEVRECQAKARG  149

Query  703  IPY  711
            IPY
Sbjct  150  IPY  152



>emb|CAN63025.1| hypothetical protein VITISV_034817 [Vitis vinifera]
Length=177

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQ+LKNQRPPV L +CN N VLDFLRYLDQFGKTKVHLQGC+YFGQPE
Sbjct  31   YESQKRRDWNTFGQFLKNQRPPVALAQCNSNQVLDFLRYLDQFGKTKVHLQGCVYFGQPE  90

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAA+EENGGLPE NPFA  AIR+YLREVRD+Q+KARG
Sbjct  91   PPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPEKNPFASGAIRIYLREVRDSQAKARG  150

Query  703  IPY  711
            +PY
Sbjct  151  VPY  153



>ref|XP_007149738.1| hypothetical protein PHAVU_005G095100g [Phaseolus vulgaris]
 gb|AGV54192.1| hypothetical protein [Phaseolus vulgaris]
 gb|ESW21732.1| hypothetical protein PHAVU_005G095100g [Phaseolus vulgaris]
Length=165

 Score =   232 bits (592),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGC+++GQPE
Sbjct  23   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCVFYGQPE  82

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA S+IRLYL+E+R+ Q+KARG
Sbjct  83   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFATSSIRLYLKEIRECQAKARG  142

Query  703  IPY  711
            IPY
Sbjct  143  IPY  145



>ref|XP_002521586.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40857.1| conserved hypothetical protein [Ricinus communis]
Length=174

 Score =   232 bits (592),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  28   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPE  87

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR++LREVRD Q+KARG
Sbjct  88   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVFLREVRDCQAKARG  147

Query  703  IPY  711
            IPY
Sbjct  148  IPY  150



>gb|KHN36698.1| hypothetical protein glysoja_001429 [Glycine soja]
Length=175

 Score =   232 bits (592),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  30   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPE  89

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  +IR+YL+E+R+ Q+KARG
Sbjct  90   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLKEIRECQAKARG  149

Query  703  IPY  711
            IPY
Sbjct  150  IPY  152



>ref|XP_002285447.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Vitis 
vinifera]
Length=220

 Score =   234 bits (596),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQ+LKNQRPPV L +CN N VLDFLRYLDQFGKTKVHLQGC+YFGQPE
Sbjct  74   YESQKRRDWNTFGQFLKNQRPPVALAQCNSNQVLDFLRYLDQFGKTKVHLQGCVYFGQPE  133

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAA+EENGGLPE NPFA  AIR+YLREVRD+Q+KARG
Sbjct  134  PPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPEKNPFASGAIRIYLREVRDSQAKARG  193

Query  703  IPY  711
            +PY
Sbjct  194  VPY  196



>ref|XP_004294145.1| PREDICTED: uncharacterized protein LOC101307097 [Fragaria vesca 
subsp. vesca]
Length=194

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L + N +HVLDFLRYLDQFGKTKVHLQGC++FGQPE
Sbjct  43   YESQKRRDWNTFGQYLRNQRPPVALSQSNSSHVLDFLRYLDQFGKTKVHLQGCVFFGQPE  102

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPESNPFA  AIR+YLREVRD+Q+KARG
Sbjct  103  PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPESNPFASGAIRVYLREVRDSQAKARG  162

Query  703  IPY  711
            IPY
Sbjct  163  IPY  165



>ref|XP_007132855.1| hypothetical protein PHAVU_011G130300g [Phaseolus vulgaris]
 gb|ESW04849.1| hypothetical protein PHAVU_011G130300g [Phaseolus vulgaris]
Length=183

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  39   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPE  98

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  +IR+YLREVR+ Q+KARG
Sbjct  99   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAKARG  158

Query  703  IPY  711
            IPY
Sbjct  159  IPY  161



>ref|XP_006446791.1| hypothetical protein CICLE_v10016699mg [Citrus clementina]
 gb|ESR60031.1| hypothetical protein CICLE_v10016699mg [Citrus clementina]
Length=209

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +C+ NHVLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  64   YESQKRRDWNTFGQYLKNQRPPVPLSQCSCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPE  123

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  124  PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARG  183

Query  703  IPY  711
            IPY
Sbjct  184  IPY  186



>ref|XP_006348309.1| PREDICTED: uncharacterized protein LOC102581082 [Solanum tuberosum]
Length=191

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKN +PPVPLP+CNYNHVLDFLRYLDQFGKTKVHL GC++FGQ E
Sbjct  47   YESQKRRDWNTFGQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKTKVHLNGCVFFGQVE  106

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
              GPCTCPL+QAWGSLDALIGRLRAA+EENGGL E+NPFA SAIR++LREVRD+Q+KARG
Sbjct  107  QVGPCTCPLKQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIHLREVRDSQAKARG  166

Query  703  IPY  711
            IPY
Sbjct  167  IPY  169



>ref|XP_007048693.1| Pleckstrin domain-containing family N member 1 [Theobroma cacao]
 gb|EOX92850.1| Pleckstrin domain-containing family N member 1 [Theobroma cacao]
Length=212

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  67   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPE  126

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  127  PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARG  186

Query  703  IPY  711
            IPY
Sbjct  187  IPY  189



>ref|XP_006469013.1| PREDICTED: uncharacterized protein LOC102606613 [Citrus sinensis]
 gb|KDO63369.1| hypothetical protein CISIN_1g047785mg [Citrus sinensis]
Length=174

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +C+ NHVLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  29   YESQKRRDWNTFGQYLKNQRPPVPLSQCSCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPE  88

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  89   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARG  148

Query  703  IPY  711
            IPY
Sbjct  149  IPY  151



>gb|KHG07235.1| Putative beta-lactamase-like 1 [Gossypium arboreum]
Length=175

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  30   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPE  89

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  90   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARG  149

Query  703  IPY  711
            IPY
Sbjct  150  IPY  152



>ref|XP_002530382.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32002.1| conserved hypothetical protein [Ricinus communis]
Length=197

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +CN NHVLDFLRYLDQFGKTKVHLQGC++FGQPE
Sbjct  51   YESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLDFLRYLDQFGKTKVHLQGCVFFGQPE  110

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR++LREVRD+Q+KARG
Sbjct  111  PPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVHLREVRDSQAKARG  170

Query  703  IPY  711
            IPY
Sbjct  171  IPY  173



>ref|XP_010104392.1| hypothetical protein L484_010344 [Morus notabilis]
 gb|EXC00237.1| hypothetical protein L484_010344 [Morus notabilis]
Length=173

 Score =   231 bits (590),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVH+QGCM++GQPE
Sbjct  26   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHVQGCMFYGQPE  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  86   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGFPETNPFASGAIRVYLREVRECQAKARG  145

Query  703  IPY  711
            IPY
Sbjct  146  IPY  148



>gb|KDP34762.1| hypothetical protein JCGZ_10542 [Jatropha curcas]
Length=184

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L  CN  HVLDFLRYLDQFGKTKVHLQGC++FGQPE
Sbjct  39   YESQKRRDWNTFGQYLRNQRPPVTLANCNATHVLDFLRYLDQFGKTKVHLQGCVFFGQPE  98

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  99   PPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKARG  158

Query  703  IPY  711
            IPY
Sbjct  159  IPY  161



>ref|XP_008342774.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009354254.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
 ref|XP_009348397.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=185

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +CNYNHVL+FLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  36   YESQKRRDWNTFGQYLKNQRPPVALSQCNYNHVLEFLRYLDQFGKTKVHLQGCMFYGQPE  95

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  96   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFASGAIRVYLREVRECQAKARG  155

Query  703  IPY  711
            IPY
Sbjct  156  IPY  158



>ref|XP_010314085.1| PREDICTED: LOW QUALITY PROTEIN: protein LIGHT-DEPENDENT SHORT 
HYPOCOTYLS 10, partial [Solanum lycopersicum]
Length=171

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 132/154 (86%), Gaps = 4/154 (3%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CNYNHVL+FLRYLDQFGKTKVHL GC +FGQPE
Sbjct  18   YESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPFFGQPE  77

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD Q+KARG
Sbjct  78   PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGAIRVYLREVRDFQAKARG  137

Query  703  IPYkkkkkkknnalpkpnnD----ETPSFQMQSS  792
            I YKKKKKK+       +++     T +FQ QSS
Sbjct  138  ICYKKKKKKRKMQNKPTSSNAHEPTTTTFQFQSS  171



>ref|XP_004303183.1| PREDICTED: uncharacterized protein LOC101307414 [Fragaria vesca 
subsp. vesca]
Length=209

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPVPL +CNY+HVL+FLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  40   YESQKRRDWNTFGQYLRNQRPPVPLSQCNYSHVLEFLRYLDQFGKTKVHLQGCMFYGQPE  99

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PESNPFA  AIR+YLREVR+ Q+KARG
Sbjct  100  PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGAPESNPFASGAIRVYLREVRECQAKARG  159

Query  703  IPY  711
            IPY
Sbjct  160  IPY  162



>ref|XP_006358940.1| PREDICTED: uncharacterized protein LOC102602985 [Solanum tuberosum]
Length=205

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CNYNHVL+FLRYLDQFGKTKVHL GC +FGQPE
Sbjct  52   YESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPFFGQPE  111

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA  +IR+YLREVRD Q+KARG
Sbjct  112  PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRVYLREVRDFQAKARG  171

Query  703  IPY  711
            I Y
Sbjct  172  ISY  174



>ref|NP_001235660.1| uncharacterized protein LOC100306225 [Glycine max]
 gb|ACU14309.1| unknown [Glycine max]
Length=175

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  30   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPE  89

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDAL GRLRAA+EENGG PE+NPFA  +IR+YL+E+R+ Q+KARG
Sbjct  90   PPAPCTCPLRQAWGSLDALTGRLRAAYEENGGSPETNPFASGSIRVYLKEIRECQAKARG  149

Query  703  IPY  711
            IPY
Sbjct  150  IPY  152



>ref|XP_009774704.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=190

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 132/152 (87%), Gaps = 3/152 (2%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDW TFGQYLKN +PPVPL  CNYNHVLDFLRYLDQFGKTKVHL GC++FG+ E
Sbjct  40   YESQKRRDWTTFGQYLKNHKPPVPLSNCNYNHVLDFLRYLDQFGKTKVHLHGCVFFGESE  99

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
              GPCTCPLRQAWGSLDALIGRLRAA+EENGGL E+NPFA SAIR+YLREVRD+Q+KARG
Sbjct  100  QGGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREVRDSQAKARG  159

Query  703  IPYkkkkkkknnalpkpnnDETP--SFQMQSS  792
            IPY KKKKK+   +   NN+ETP  +FQ+ SS
Sbjct  160  IPY-KKKKKRKIQINSSNNNETPARTFQLHSS  190



>ref|XP_004489028.1| PREDICTED: uncharacterized protein LOC101497242 [Cicer arietinum]
Length=189

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +CN NHVL+FLRYLDQFGKTKVHLQGC++FGQ E
Sbjct  46   YESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCLFFGQVE  105

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAA+EENGGLPE+NPFA  +IR+YLREVRD+Q+KARG
Sbjct  106  PPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGSIRIYLREVRDSQAKARG  165

Query  703  IPY  711
            IPY
Sbjct  166  IPY  168



>ref|XP_003596364.1| 177 protein [Medicago truncatula]
 gb|AES66615.1| DUF640 family protein [Medicago truncatula]
Length=178

 Score =   230 bits (587),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L  CN NHVL+FLRYLDQFGKTKVHLQGC++FGQ E
Sbjct  34   YESQKRRDWNTFGQYLRNQRPPVALSNCNSNHVLEFLRYLDQFGKTKVHLQGCLFFGQTE  93

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAA+EENGGLPE+NPFA  +IR+YLREVRD+Q+KARG
Sbjct  94   PPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGSIRIYLREVRDSQAKARG  153

Query  703  IPY  711
            IPY
Sbjct  154  IPY  156



>ref|XP_004487154.1| PREDICTED: uncharacterized protein LOC101499419 [Cicer arietinum]
Length=166

 Score =   229 bits (585),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL NQRPP+PL  CN NHVL+FLRYLDQFGKTKVHLQGCM+FGQPE
Sbjct  22   YESQKRRDWNTFGQYLNNQRPPIPLSHCNCNHVLEFLRYLDQFGKTKVHLQGCMFFGQPE  81

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG  E+NPFA SAIR+YLREVR+ Q+KARG
Sbjct  82   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFASSAIRVYLREVRECQAKARG  141

Query  703  IPY  711
            IPY
Sbjct  142  IPY  144



>emb|CDP15936.1| unnamed protein product [Coffea canephora]
Length=170

 Score =   229 bits (585),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN +HVL+FLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  23   YESQKRRDWNTFGQYLKNQRPPVPLSQCNSSHVLEFLRYLDQFGKTKVHLQGCMFYGQPE  82

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PESNPFA  AIR+YLREV++ Q+KARG
Sbjct  83   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPESNPFASGAIRVYLREVKECQAKARG  142

Query  703  IPY  711
            IPY
Sbjct  143  IPY  145



>gb|KCW67509.1| hypothetical protein EUGRSUZ_F01238 [Eucalyptus grandis]
 gb|KCW67510.1| hypothetical protein EUGRSUZ_F01238 [Eucalyptus grandis]
Length=184

 Score =   230 bits (586),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL NQRPPV + +CN  HVL+FLRYLDQFGKTKVH  GC+YFGQPE
Sbjct  35   YESQKRRDWNTFGQYLSNQRPPVAISQCNSTHVLEFLRYLDQFGKTKVHFNGCVYFGQPE  94

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAA+EENGGLPE+NPFA S+IR+YLREVRD+Q+KARG
Sbjct  95   PPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASSSIRVYLREVRDSQAKARG  154

Query  703  IPY  711
            IPY
Sbjct  155  IPY  157



>ref|XP_010062813.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 ref|XP_010062814.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 ref|XP_010062815.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 gb|KCW69948.1| hypothetical protein EUGRSUZ_F03266 [Eucalyptus grandis]
Length=182

 Score =   230 bits (586),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPP+ + + N NHVLDFLRYLDQFGKTKVHL GC+YFGQPE
Sbjct  35   YESQKRRDWNTFGQYLRNQRPPIAITQFNSNHVLDFLRYLDQFGKTKVHLHGCIYFGQPE  94

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA  +IR+YLREV+D+Q+KARG
Sbjct  95   PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPEANPFASGSIRMYLREVKDSQAKARG  154

Query  703  IPY  711
            IPY
Sbjct  155  IPY  157



>ref|XP_010035859.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Eucalyptus 
grandis]
 gb|KCW47341.1| hypothetical protein EUGRSUZ_K01128 [Eucalyptus grandis]
Length=174

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWN F QYLKNQRPPVPL +CNY HVL+FLRYLDQFGKTKVH+QGC+++GQPE
Sbjct  28   YESQKRRDWNAFIQYLKNQRPPVPLSQCNYTHVLEFLRYLDQFGKTKVHIQGCIFYGQPE  87

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVRD QSKARG
Sbjct  88   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFASGAIRVYLREVRDCQSKARG  147

Query  703  IPY  711
            IPY
Sbjct  148  IPY  150



>ref|XP_006592933.1| PREDICTED: uncharacterized protein LOC100806493 isoform X1 [Glycine 
max]
 ref|XP_006592934.1| PREDICTED: uncharacterized protein LOC100806493 isoform X2 [Glycine 
max]
Length=184

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +C+ NHVL+FLRYLDQFGKTKVH QGC++FGQ E
Sbjct  38   YESQKRRDWNTFGQYLRNQRPPVALSQCSSNHVLEFLRYLDQFGKTKVHSQGCLFFGQTE  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+QSKARG
Sbjct  98   PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQSKARG  157

Query  703  IPY  711
            IPY
Sbjct  158  IPY  160



>gb|AFK47598.1| unknown [Lotus japonicus]
Length=179

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +CN N VL+FLRYLDQFGKTKVH+QGC++FGQ E
Sbjct  32   YESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLEFLRYLDQFGKTKVHVQGCLFFGQAE  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA   IRLYLREVRD+Q+KARG
Sbjct  92   PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPEANPFASGTIRLYLREVRDSQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>gb|AES67378.2| DUF640 family protein [Medicago truncatula]
Length=167

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL N RPPVPL  CN NHVL+FLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  24   YESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLDQFGKTKVHLQGCMFYGQPE  83

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  84   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFASGAIRVYLREVRECQAKARG  143

Query  703  IPY  711
            IPY
Sbjct  144  IPY  146



>ref|XP_003526225.1| PREDICTED: uncharacterized protein LOC100815968 [Glycine max]
 gb|KHN33957.1| hypothetical protein glysoja_036764 [Glycine soja]
Length=179

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN N VLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  34   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNQVLDFLRYLDQFGKTKVHLQGCMFYGQPE  93

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  +IR+YLREVR+ Q+KARG
Sbjct  94   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAKARG  153

Query  703  IPY  711
            IPY
Sbjct  154  IPY  156



>ref|XP_003597127.1| 177 protein [Medicago truncatula]
Length=186

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL N RPPVPL  CN NHVL+FLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  24   YESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLDQFGKTKVHLQGCMFYGQPE  83

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  84   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFASGAIRVYLREVRECQAKARG  143

Query  703  IPY  711
            IPY
Sbjct  144  IPY  146



>gb|AFK34719.1| unknown [Lotus japonicus]
Length=179

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +CN N VL+FLRYLDQFGKTKVH+QGC++FGQ E
Sbjct  32   YESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLEFLRYLDQFGKTKVHVQGCLFFGQAE  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA   IRLYLREVRD+Q+KARG
Sbjct  92   PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPEANPFASGTIRLYLREVRDSQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>ref|XP_010108230.1| hypothetical protein L484_018651 [Morus notabilis]
 gb|EXC18470.1| hypothetical protein L484_018651 [Morus notabilis]
Length=184

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRR W TFGQYL+NQRPPV L +CN NHVLDFLRYLDQFGKTKVHLQGC++FGQPE
Sbjct  35   YESQKRRGWETFGQYLRNQRPPVALSQCNGNHVLDFLRYLDQFGKTKVHLQGCVFFGQPE  94

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC+CPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLR+VRD+Q+KARG
Sbjct  95   PPGPCSCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLRDVRDSQAKARG  154

Query  703  IPYkkkkkkknnalpkpnnD--ETPSFQMQ  786
            IPY KKKKK+N      ++D   + SF MQ
Sbjct  155  IPYTKKKKKRNLINKSNDHDHQHSSSFTMQ  184



>ref|XP_003607586.1| 177 protein [Medicago truncatula]
 gb|AES89783.1| DUF640 family protein [Medicago truncatula]
Length=176

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL N RPPVPL +CN NHVLDFLRYLDQFGKTKVH+QGCM++GQPE
Sbjct  30   YESQKRRDWNTFGQYLNNMRPPVPLSQCNSNHVLDFLRYLDQFGKTKVHVQGCMFYGQPE  89

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG P++NPFA  +IR+YLRE+R++Q+KARG
Sbjct  90   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPDTNPFASGSIRVYLREIRESQAKARG  149

Query  703  IPY  711
            IPY
Sbjct  150  IPY  152



>ref|XP_011083008.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Sesamum 
indicum]
Length=172

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQ+LKNQRPPV LP+CN NHVLDFLRYLDQFGKTKVHLQGC+++GQPE
Sbjct  27   YESQKRRDWNTFGQFLKNQRPPVALPQCNSNHVLDFLRYLDQFGKTKVHLQGCIFYGQPE  86

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREV++ Q+KARG
Sbjct  87   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRIYLREVKECQAKARG  146

Query  703  IPY  711
            IPY
Sbjct  147  IPY  149



>ref|XP_009784769.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=196

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 130/151 (86%), Gaps = 1/151 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFG YLKN RPP+PL +CNYNHVL+FLRYLDQFGKTKVHL GC +FGQPE
Sbjct  46   YESQKRRDWNTFGHYLKNLRPPIPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPFFGQPE  105

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC CPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA  +IR+YLREVRD Q+KARG
Sbjct  106  PPGPCACPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRIYLREVRDFQAKARG  165

Query  703  IPYkkkkkkknnalpkpnnDE-TPSFQMQSS  792
            I YKKKKKK+   +    N E T +FQ+QSS
Sbjct  166  ISYKKKKKKRKLQINASTNVEPTATFQLQSS  196



>ref|XP_007149389.1| hypothetical protein PHAVU_005G066200g [Phaseolus vulgaris]
 gb|ESW21383.1| hypothetical protein PHAVU_005G066200g [Phaseolus vulgaris]
Length=179

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +C+ +HVL+FLRYLDQFGKTKVHLQGC++FGQ E
Sbjct  34   YESQKRRDWNTFGQYLRNQRPPVALSQCSSSHVLEFLRYLDQFGKTKVHLQGCLFFGQSE  93

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  94   PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKARG  153

Query  703  IPY  711
            IPY
Sbjct  154  IPY  156



>ref|XP_002301561.2| hypothetical protein POPTR_0002s22690g [Populus trichocarpa]
 gb|ABK94357.1| unknown [Populus trichocarpa]
 gb|EEE80834.2| hypothetical protein POPTR_0002s22690g [Populus trichocarpa]
Length=170

 Score =   228 bits (580),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQ CM++GQPE
Sbjct  25   YESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFGKTKVHLQSCMFYGQPE  84

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG  E+NPFA ++IR+YLREV+D Q+KARG
Sbjct  85   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTLETNPFANASIRVYLREVKDYQAKARG  144

Query  703  IPY  711
            IP+
Sbjct  145  IPH  147



>ref|XP_010052695.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Eucalyptus 
grandis]
 gb|KCW89641.1| hypothetical protein EUGRSUZ_A01916 [Eucalyptus grandis]
Length=176

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFG YL+NQRPPVPL +CN NHVL+FLRYLDQFGKTKVHLQGC+++GQPE
Sbjct  29   YESQKRRDWNTFGHYLRNQRPPVPLSQCNCNHVLEFLRYLDQFGKTKVHLQGCVFYGQPE  88

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  89   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARG  148

Query  703  IPY  711
            IPY
Sbjct  149  IPY  151



>gb|AFK41138.1| unknown [Lotus japonicus]
Length=173

 Score =   227 bits (579),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL NQRPPVPL +CN+NHV++FLRYLDQFGKTKVHLQGC+YFG PE
Sbjct  27   YESQKRRDWNTFGQYLNNQRPPVPLSQCNFNHVMEFLRYLDQFGKTKVHLQGCVYFGMPE  86

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA   IR+YLREVR+ Q+KARG
Sbjct  87   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEANPFASGFIRVYLREVRECQAKARG  146

Query  703  IPY  711
            IPY
Sbjct  147  IPY  149



>ref|XP_009133547.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Brassica 
rapa]
Length=177

 Score =   227 bits (579),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVP+  CN NHVLDFLRYLDQFGKTKVH+ GCM++GQPE
Sbjct  26   YESQKRRDWNTFGQYLKNQRPPVPMSHCNCNHVLDFLRYLDQFGKTKVHVPGCMFYGQPE  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  86   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARG  145

Query  703  IPY  711
            IPY
Sbjct  146  IPY  148



>gb|ACJ85482.1| unknown [Medicago truncatula]
 gb|AFK37885.1| unknown [Medicago truncatula]
Length=167

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL N RPPVPL  CN NHVL+FLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  24   YESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLDQFGKTKVHLQGCMFYGQPE  83

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ ++KARG
Sbjct  84   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGAPETNPFASGAIRVYLREVRECRAKARG  143

Query  703  IPY  711
            IPY
Sbjct  144  IPY  146



>ref|NP_001237763.1| uncharacterized protein LOC100527554 [Glycine max]
 gb|ACU16651.1| unknown [Glycine max]
Length=194

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +C+ NHVL+FLRYLDQFGKTKVH QGC++FGQ E
Sbjct  48   YESQKRRDWNTFGQYLRNQRPPVALSQCSSNHVLEFLRYLDQFGKTKVHSQGCLFFGQTE  107

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA   IR+YLREVRD+Q+KARG
Sbjct  108  PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGTIRVYLREVRDSQAKARG  167

Query  703  IPY  711
            IPY
Sbjct  168  IPY  170



>ref|XP_004516078.1| PREDICTED: uncharacterized protein LOC101514778 [Cicer arietinum]
Length=179

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +CN N VLDFLRYLDQFGKTKVH+QGC++FGQ E
Sbjct  31   YESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLDFLRYLDQFGKTKVHVQGCIFFGQVE  90

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPL+QAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIRLYLR+VRD+Q+KARG
Sbjct  91   PPAPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRLYLRQVRDSQAKARG  150

Query  703  IPY  711
            IPY
Sbjct  151  IPY  153



>ref|XP_008448236.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=200

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +CN+NHVL+FLRYLDQFGKTKVH+QGCM++GQPE
Sbjct  32   YESQKRRDWNTFGQYLKNQRPPVALSQCNFNHVLEFLRYLDQFGKTKVHVQGCMFYGQPE  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPL+QAWGSLDALIGRLRAA+EENGG PE+NPFA ++IR+YLREVR+ Q+KARG
Sbjct  92   PPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASASIRVYLREVRECQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>ref|XP_011008166.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008167.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008168.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008170.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=170

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  25   YESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFGKTKVHLQGCMFYGQPE  84

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAW SLDALIGRLRAA+EENGG  E+NPFA ++IR+YLREV+D Q+KARG
Sbjct  85   PPAPCTCPLRQAWCSLDALIGRLRAAYEENGGTLETNPFANASIRVYLREVKDYQAKARG  144

Query  703  IPY  711
            IP+
Sbjct  145  IPH  147



>ref|XP_007133232.1| hypothetical protein PHAVU_011G162700g [Phaseolus vulgaris]
 gb|AGV54196.1| 177 protein [Phaseolus vulgaris]
 gb|ESW05226.1| hypothetical protein PHAVU_011G162700g [Phaseolus vulgaris]
Length=187

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +CN N VLDFLRYLDQFGKTKVH QGC++FGQ E
Sbjct  42   YESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLDFLRYLDQFGKTKVHAQGCLFFGQVE  101

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAA+EENGGLPE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  102  PPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAKARG  161

Query  703  IPY  711
            IPY
Sbjct  162  IPY  164



>ref|XP_009786006.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=177

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV + +CN NHVL+FLRYLDQFGKTKVHLQGC+++GQPE
Sbjct  28   YESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPE  87

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREV++ QSKARG
Sbjct  88   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQSKARG  147

Query  703  IPY  711
            IPY
Sbjct  148  IPY  150



>ref|XP_010277024.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Nelumbo 
nucifera]
Length=182

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +CN +HVLDFLRYLDQFGKTKVHLQGC++FGQPE
Sbjct  31   YESQKRRDWNTFGQYLKNQRPPVSLSQCNCSHVLDFLRYLDQFGKTKVHLQGCVFFGQPE  90

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPF   AIR+YLREVR+ Q+KARG
Sbjct  91   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFGSGAIRVYLREVRECQAKARG  150

Query  703  IPY  711
            IPY
Sbjct  151  IPY  153



>ref|XP_004233074.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=191

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  35   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPD  94

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPF   AIRLYLREV++ Q+KARG
Sbjct  95   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKECQAKARG  154

Query  703  IPY  711
            IPY
Sbjct  155  IPY  157



>ref|XP_010508549.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010508550.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010517796.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010517797.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
Length=178

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVP+  C+ NHVLDFLRYLDQFGKTKVH+ GCM++GQPE
Sbjct  26   YESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQPE  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  86   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARG  145

Query  703  IPY  711
            IPY
Sbjct  146  IPY  148



>ref|XP_010506094.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Camelina 
sativa]
 ref|XP_010506095.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Camelina 
sativa]
Length=178

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVP+  C+ NHVLDFLRYLDQFGKTKVH+ GCM++GQPE
Sbjct  26   YESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQPE  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  86   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARG  145

Query  703  IPY  711
            IPY
Sbjct  146  IPY  148



>ref|XP_006296565.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 ref|XP_006296566.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 gb|EOA29463.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 gb|EOA29464.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
Length=178

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVP+  C+ NHVLDFLRYLDQFGKTKVH+ GCM++GQPE
Sbjct  26   YESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQPE  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  86   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARG  145

Query  703  IPY  711
            IPY
Sbjct  146  IPY  148



>ref|XP_011098405.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=173

 Score =   225 bits (573),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +1

Query  355  KRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPEPAGP  534
            KRRDWNTFGQYL+NQRPPV LP+CNY+HVLDFLRYLDQFGKTKVH+QGC++FGQPEPAGP
Sbjct  24   KRRDWNTFGQYLRNQRPPVGLPQCNYSHVLDFLRYLDQFGKTKVHVQGCVFFGQPEPAGP  83

Query  535  CTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARGIPY  711
            C+CPLRQAWGSLDALIGRLRAA+EENGG  E+NPFA  AIR+YLREVR++Q+KARGIPY
Sbjct  84   CSCPLRQAWGSLDALIGRLRAAYEENGGAAETNPFANGAIRVYLREVRESQAKARGIPY  142



>gb|KHN36883.1| hypothetical protein glysoja_001614 [Glycine soja]
Length=193

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV L +C+ NHVL+FLRYLDQFGKTKVH QGC++FGQ E
Sbjct  47   YESQKRRDWNTFGQYLRNQRPPVALSQCSSNHVLEFLRYLDQFGKTKVHSQGCLFFGQTE  106

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA   IR+YLREVRD+Q+KARG
Sbjct  107  PPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGTIRVYLREVRDSQAKARG  166

Query  703  IPY  711
            IPY
Sbjct  167  IPY  169



>ref|XP_009608555.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=187

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  33   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPD  92

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPF   AIRLYLREV++ Q+KARG
Sbjct  93   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKECQAKARG  152

Query  703  IPY  711
            IPY
Sbjct  153  IPY  155



>gb|EYU45022.1| hypothetical protein MIMGU_mgv1a014215mg [Erythranthe guttata]
Length=197

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV LP+CNY+HVL+F+RYLDQFGKTKVH QGC +FGQPE
Sbjct  43   YESQKRRDWNTFGQYLRNQRPPVGLPQCNYSHVLEFMRYLDQFGKTKVHGQGCPFFGQPE  102

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAGPC CPLRQAWGSLDAL+GRLRAA+EENGG  E+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  103  PAGPCACPLRQAWGSLDALVGRLRAAYEENGGSQETNPFANGAIRVYLREVRDSQAKARG  162

Query  703  IPY  711
            IPY
Sbjct  163  IPY  165



>ref|NP_565978.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_850374.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9S7R3.1|LSH10_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10; AltName: 
Full=Protein ORGAN BOUNDARY 10 [Arabidopsis thaliana]
 gb|AAF24517.1|AF218765_1 177 protein [Arabidopsis thaliana]
 gb|AAD22993.1| expressed protein [Arabidopsis thaliana]
 dbj|BAC43308.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43624.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39968.1| At2g42610 [Arabidopsis thaliana]
 gb|ABQ85148.1| unknown [Arabidopsis thaliana]
 gb|ABQ85149.1| unknown [Arabidopsis thaliana]
 gb|ABQ85150.1| unknown [Arabidopsis thaliana]
 gb|ABQ85151.1| unknown [Arabidopsis thaliana]
 gb|ABQ85152.1| unknown [Arabidopsis thaliana]
 gb|ABQ85153.1| unknown [Arabidopsis thaliana]
 gb|ABQ85154.1| unknown [Arabidopsis thaliana]
 gb|ABQ85155.1| unknown [Arabidopsis thaliana]
 gb|ABQ85156.1| unknown [Arabidopsis thaliana]
 gb|ABQ85157.1| unknown [Arabidopsis thaliana]
 gb|ABQ85158.1| unknown [Arabidopsis thaliana]
 gb|ABQ85159.1| unknown [Arabidopsis thaliana]
 gb|ABQ85160.1| unknown [Arabidopsis thaliana]
 gb|ABQ85161.1| unknown [Arabidopsis thaliana]
 gb|ABQ85162.1| unknown [Arabidopsis thaliana]
 gb|ABQ85163.1| unknown [Arabidopsis thaliana]
 gb|ABQ85164.1| unknown [Arabidopsis thaliana]
 gb|ABQ85165.1| unknown [Arabidopsis thaliana]
 gb|ABQ85166.1| unknown [Arabidopsis thaliana]
 gb|ABQ85167.1| unknown [Arabidopsis thaliana]
 gb|ABQ85168.1| unknown [Arabidopsis thaliana]
 gb|ABQ85169.1| unknown [Arabidopsis thaliana]
 gb|ABQ85170.1| unknown [Arabidopsis thaliana]
 gb|ABQ85171.1| unknown [Arabidopsis thaliana]
 gb|AEC10147.1| uncharacterized protein AT2G42610 [Arabidopsis thaliana]
 gb|AEC10148.1| uncharacterized protein AT2G42610 [Arabidopsis thaliana]
Length=177

 Score =   225 bits (573),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVP+  C+ NHVLDFLRYLDQFGKTKVH+ GCM++GQPE
Sbjct  26   YESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQPE  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  86   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGPPETNPFASGAIRVYLREVRECQAKARG  145

Query  703  IPY  711
            IPY
Sbjct  146  IPY  148



>ref|XP_002879996.1| hypothetical protein ARALYDRAFT_903634 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56255.1| hypothetical protein ARALYDRAFT_903634 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score =   225 bits (573),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVP+  C+ NHVLDFLRYLDQFGKTKVH+ GCM++GQPE
Sbjct  26   YESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQPE  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  86   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEANPFASGAIRVYLREVRECQAKARG  145

Query  703  IPY  711
            IPY
Sbjct  146  IPY  148



>ref|XP_004243287.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=167

 Score =   224 bits (572),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV + +CN NHVL+FLRYLDQFGKTKVHLQGC+++GQPE
Sbjct  22   YESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPE  81

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREV++ Q+KARG
Sbjct  82   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQAKARG  141

Query  703  IPY  711
            IPY
Sbjct  142  IPY  144



>ref|XP_009343797.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=181

 Score =   224 bits (572),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L + NYNHVL+FLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  32   YESQKRRDWNTFGQYLKNQRPPVALSQSNYNHVLEFLRYLDQFGKTKVHLQGCMFYGQPE  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+ ARG
Sbjct  92   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFASGAIRVYLREVRECQAMARG  151

Query  703  IPY  711
            IP+
Sbjct  152  IPF  154



>ref|XP_008381217.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
Length=181

 Score =   224 bits (572),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L + NYNHVL+FLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  32   YESQKRRDWNTFGQYLKNQRPPVALSQSNYNHVLEFLRYLDQFGKTKVHLQGCMFYGQPE  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+ ARG
Sbjct  92   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFASGAIRVYLREVRECQAMARG  151

Query  703  IPY  711
            IP+
Sbjct  152  IPF  154



>ref|XP_010279129.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nelumbo 
nucifera]
Length=176

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +C+ +HVL+FLRYLDQFGKTKVHLQGC++FGQPE
Sbjct  29   YESQKRRDWNTFGQYLKNQRPPVSLSQCSCSHVLEFLRYLDQFGKTKVHLQGCIFFGQPE  88

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPF   AIR+YLREVR+ Q+KARG
Sbjct  89   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFGSGAIRVYLREVRECQAKARG  148

Query  703  IPY  711
            IPY
Sbjct  149  IPY  151



>ref|XP_009593391.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
 ref|XP_009593396.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=177

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV + +CN NHVL+FLRYLDQFGKTKVHLQGC+++GQPE
Sbjct  28   YESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPE  87

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREV++ QSKARG
Sbjct  88   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQSKARG  147

Query  703  IPY  711
            IPY
Sbjct  148  IPY  150



>ref|XP_006348870.1| PREDICTED: uncharacterized protein LOC102600485 [Solanum tuberosum]
Length=173

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPPV + +CN NHVL+FLRYLDQFGKTKVHLQGC+++GQPE
Sbjct  28   YESQKRRDWNTFGQYLRNQRPPVSMSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPE  87

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREV++ Q+KARG
Sbjct  88   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQAKARG  147

Query  703  IPY  711
            IPY
Sbjct  148  IPY  150



>ref|XP_010524062.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=176

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVH  GCM++GQPE
Sbjct  28   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHAPGCMFYGQPE  87

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR++LREVR+ Q+KARG
Sbjct  88   PPAPCICPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVFLREVRECQAKARG  147

Query  703  IPY  711
            IPY
Sbjct  148  IPY  150



>ref|XP_009626514.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=176

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+NQR P+PL +CN NHVL+FLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  29   YESQKRRDWNTFNQYLRNQRQPIPLSQCNSNHVLEFLRYLDQFGKTKVHLQGCMFYGQPE  88

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA +AIR+YLREV++ Q+KARG
Sbjct  89   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASTAIRVYLREVKECQAKARG  148

Query  703  IPY  711
            I Y
Sbjct  149  IAY  151



>emb|CDY14848.1| BnaC04g48450D [Brassica napus]
Length=177

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVP+  C+ NHVLDFLRYLDQFGKTKVH+ GCM++GQPE
Sbjct  26   YESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVFGCMFYGQPE  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  86   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFATGAIRVYLREVRECQAKARG  145

Query  703  IPY  711
            IPY
Sbjct  146  IPY  148



>ref|XP_009142076.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Brassica 
rapa]
 emb|CDY47983.1| BnaA04g24610D [Brassica napus]
Length=176

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/123 (83%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVP+  C+ NHVLDFLRYLDQFGKTKVH+ GCM++GQPE
Sbjct  26   YESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVFGCMFYGQPE  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  86   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFATGAIRVYLREVRECQAKARG  145

Query  703  IPY  711
            IPY
Sbjct  146  IPY  148



>emb|CDY55387.1| BnaA05g34250D [Brassica napus]
Length=178

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPP+P+  CN NHVLDFLRYLDQFGKTKVH+ GCM++GQPE
Sbjct  26   YESQKRRDWNTFGQYLRNQRPPLPMSHCNCNHVLDFLRYLDQFGKTKVHVPGCMFYGQPE  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  86   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARG  145

Query  703  IPY  711
            IP+
Sbjct  146  IPF  148



>ref|XP_011101384.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=183

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVP+ +CN NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  35   YESQKRRDWNTFGQYLKNQRPPVPISQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPD  94

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV+D Q+KARG
Sbjct  95   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKDCQAKARG  154

Query  703  IPY  711
            IPY
Sbjct  155  IPY  157



>ref|XP_009587002.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=180

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            Y +QKRRDWNTFGQYLKN +PPVPL  CNYNHVL FLRYLDQFGKTKVHL GC++FG+ E
Sbjct  30   YVSQKRRDWNTFGQYLKNHKPPVPLSNCNYNHVLHFLRYLDQFGKTKVHLHGCIFFGESE  89

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
               PCTCPLRQAWGSLDALIGRLRAA+EENGGL E+NPFA SAIR+YLREVRD+Q+KARG
Sbjct  90   QTEPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREVRDSQAKARG  149

Query  703  IPY  711
            I Y
Sbjct  150  ISY  152



>ref|XP_010531928.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Tarenaya 
hassleriana]
Length=183

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+NQRPPV + +CN N++LDFLRYLDQFGKTKVHLQGC++FGQP+
Sbjct  25   YESQKRRDWNTFCQYLRNQRPPVHISQCNTNNILDFLRYLDQFGKTKVHLQGCVFFGQPD  84

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P+G C CPLRQAWGSLDALIGRLRAA+EENGGLPE NPFAG  IR+YLREVRD+Q+KARG
Sbjct  85   PSGQCNCPLRQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVYLREVRDSQAKARG  144

Query  703  IPY  711
            +PY
Sbjct  145  VPY  147



>ref|XP_006411528.1| hypothetical protein EUTSA_v10017308mg [Eutrema salsugineum]
 gb|ESQ52981.1| hypothetical protein EUTSA_v10017308mg [Eutrema salsugineum]
Length=177

 Score =   223 bits (568),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRP VP+  C+ NHVLDFLRYLDQFGKTKVH+ GCM++GQPE
Sbjct  26   YESQKRRDWNTFGQYLKNQRPSVPMSHCSCNHVLDFLRYLDQFGKTKVHVPGCMFYGQPE  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  86   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARG  145

Query  703  IPY  711
            IPY
Sbjct  146  IPY  148



>ref|XP_006362411.1| PREDICTED: uncharacterized protein LOC102591189 [Solanum tuberosum]
Length=191

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +CN NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  35   YESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPD  94

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPF   AIRLYLREV++ Q+KARG
Sbjct  95   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKECQAKARG  154

Query  703  IPY  711
            IPY
Sbjct  155  IPY  157



>ref|XP_011085992.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=175

 Score =   222 bits (566),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L  CN NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  26   YESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPD  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV+D+Q+KARG
Sbjct  86   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKDSQAKARG  145

Query  703  IPY  711
            IPY
Sbjct  146  IPY  148



>ref|XP_009773140.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=188

 Score =   223 bits (567),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +CN NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  34   YESQKRRDWNTFGQYLKNQRPPVALSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPD  93

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPF   AIRLYLREV++ Q+KARG
Sbjct  94   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKECQAKARG  153

Query  703  IPY  711
            IPY
Sbjct  154  IPY  156



>emb|CDO96796.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   223 bits (567),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +CN NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  41   YESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPD  100

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPF   AIR+YLREV++ Q+KARG
Sbjct  101  PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFGNGAIRVYLREVKECQAKARG  160

Query  703  IPY  711
            IPY
Sbjct  161  IPY  163



>ref|XP_010655519.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Vitis 
vinifera]
 ref|XP_010655520.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Vitis 
vinifera]
Length=175

 Score =   222 bits (566),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +C+ NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  30   YESQKRRDWNTFGQYLKNQRPPVSLAQCSCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPD  89

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREVRD QSKARG
Sbjct  90   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDCQSKARG  149

Query  703  IPY  711
            IPY
Sbjct  150  IPY  152



>gb|KHG25854.1| Major vault [Gossypium arboreum]
Length=179

 Score =   222 bits (566),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDW TFGQYL+N+RPPV + +CN NHVLDFL YLDQFGKTKVHLQGCM+FGQPE
Sbjct  33   YESQKRRDWITFGQYLRNRRPPVAISQCNANHVLDFLGYLDQFGKTKVHLQGCMFFGQPE  92

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC C LRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVRD+Q+KARG
Sbjct  93   PPGPCACSLRQAWGSLDALIGRLRAAYEENGGSPETNPFANGAIRIYLREVRDSQAKARG  152

Query  703  IPY  711
            IPY
Sbjct  153  IPY  155



>ref|XP_010525031.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
 ref|XP_010525039.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=178

 Score =   222 bits (566),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +CN NHVLDFLRYLDQFGKTKVH+ GCM++GQPE
Sbjct  28   YESQKRRDWNTFGQYLKNQRPPVHLSQCNCNHVLDFLRYLDQFGKTKVHVPGCMFYGQPE  87

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE NPFA  AIR+YLREVR+ Q+KARG
Sbjct  88   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEMNPFATGAIRVYLREVRECQAKARG  147

Query  703  IPY  711
            IPY
Sbjct  148  IPY  150



>emb|CAN72178.1| hypothetical protein VITISV_012478 [Vitis vinifera]
Length=175

 Score =   222 bits (565),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +C+ NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  30   YESQKRRDWNTFGQYLKNQRPPVSLAQCSCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPD  89

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREVRD QSKARG
Sbjct  90   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRDCQSKARG  149

Query  703  IPY  711
            IPY
Sbjct  150  IPY  152



>ref|XP_004150559.1| PREDICTED: uncharacterized protein LOC101216601 [Cucumis sativus]
Length=226

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRP V L +CN+NHVL+FLRYLDQFGKTKVH+QGCM++G PE
Sbjct  32   YESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRYLDQFGKTKVHVQGCMFYGHPE  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPL+QAWGSLDALIGRLRAA+EENGG PE+NPFA ++IRLYLR+VR+ Q+KARG
Sbjct  92   PPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFATASIRLYLRQVRECQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>gb|KGN47252.1| hypothetical protein Csa_6G236080 [Cucumis sativus]
Length=205

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRP V L +CN+NHVL+FLRYLDQFGKTKVH+QGCM++G PE
Sbjct  32   YESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRYLDQFGKTKVHVQGCMFYGHPE  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPL+QAWGSLDALIGRLRAA+EENGG PE+NPFA ++IRLYLR+VR+ Q+KARG
Sbjct  92   PPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFATASIRLYLRQVRECQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>ref|XP_004171262.1| PREDICTED: uncharacterized LOC101216601 [Cucumis sativus]
Length=206

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRP V L +CN+NHVL+FLRYLDQFGKTKVH+QGCM++G PE
Sbjct  32   YESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRYLDQFGKTKVHVQGCMFYGHPE  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPL+QAWGSLDALIGRLRAA+EENGG PE+NPFA ++IRLYLR+VR+ Q+KARG
Sbjct  92   PPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFATASIRLYLRQVRECQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>ref|XP_009142855.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142857.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142858.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142859.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142860.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
Length=178

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQRPP+P+  CN NHVLDFLR+LDQFGKTKVH+ GCM++GQPE
Sbjct  26   YESQKRRDWNTFGQYLRNQRPPLPMSHCNCNHVLDFLRHLDQFGKTKVHVPGCMFYGQPE  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR+YLREVR+ Q+KARG
Sbjct  86   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARG  145

Query  703  IPY  711
            IP+
Sbjct  146  IPF  148



>gb|KDP21096.1| hypothetical protein JCGZ_21567 [Jatropha curcas]
Length=182

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +CN NHVLDFLRYLDQFGKTKVHL GC++FGQP+
Sbjct  36   YESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPD  95

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREVR+ Q+KARG
Sbjct  96   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAKARG  155

Query  703  IPY  711
            IPY
Sbjct  156  IPY  158



>ref|XP_002522583.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39883.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +CN NHVLDFLRYLDQFGKTKVHL GC++FGQP+
Sbjct  33   YESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPD  92

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREVR+ Q+KARG
Sbjct  93   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAKARG  152

Query  703  IPY  711
            IPY
Sbjct  153  IPY  155



>ref|XP_010553628.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
 ref|XP_010553707.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=170

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPP+PL +C+ +HVLDFLRYLDQFGKTKVH+ GCM++GQPE
Sbjct  29   YESQKRRDWNTFGQYLKNQRPPMPLSQCSCSHVLDFLRYLDQFGKTKVHVPGCMFYGQPE  88

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  AIR YL+EVRD Q+KARG
Sbjct  89   PPAPCICPLRQAWGSLDALIGRLRAAYEENGGPPETNPFASGAIRAYLKEVRDCQAKARG  148

Query  703  IPY  711
            IPY
Sbjct  149  IPY  151



>ref|XP_004505495.1| PREDICTED: uncharacterized protein LOC101509969 [Cicer arietinum]
Length=165

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLK Q+PPVPL  CN N+VLDFLRYLDQFGKTKVH+QGCM++G PE
Sbjct  25   YESQKRRDWNTFGQYLKTQKPPVPLVHCNSNNVLDFLRYLDQFGKTKVHIQGCMFYGNPE  84

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC+CPLRQAWGSLDALIGRLRAA+EENGG P +NPFA S+IRLYLREVR+ Q+ ARG
Sbjct  85   PPAPCSCPLRQAWGSLDALIGRLRAAYEENGGSPHTNPFATSSIRLYLREVRECQALARG  144

Query  703  IPY  711
            IPY
Sbjct  145  IPY  147



>ref|XP_007025375.1| Beta-lactamase-like protein ENSP00000383859 [Theobroma cacao]
 gb|EOY27997.1| Beta-lactamase-like protein ENSP00000383859 [Theobroma cacao]
Length=179

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +CN NHVLDFLRYLDQFGKTKVHL GC++FGQP+
Sbjct  32   YESQKRRDWNTFGQYLKNQRPPVALSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPD  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG  E+NPF   AIR+YLREVR+ Q+KARG
Sbjct  92   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSSETNPFGNGAIRVYLREVRECQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>ref|XP_004136831.1| PREDICTED: uncharacterized protein LOC101208687 [Cucumis sativus]
 ref|XP_004155471.1| PREDICTED: uncharacterized protein LOC101230404 [Cucumis sativus]
 gb|KGN43628.1| hypothetical protein Csa_7G048120 [Cucumis sativus]
Length=189

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKNQRPPVPL  CN N VL+FLRYLDQFGKTKVH+QGCM++GQPE
Sbjct  34   YESQKRRDWNTFCQYLKNQRPPVPLSHCNCNQVLEFLRYLDQFGKTKVHIQGCMFYGQPE  93

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG  E+NPFA  AIR+YLR+VR+ Q+KARG
Sbjct  94   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFASGAIRVYLRDVRECQAKARG  153

Query  703  IPY  711
            IPY
Sbjct  154  IPY  156



>ref|XP_010109876.1| hypothetical protein L484_003806 [Morus notabilis]
 gb|EXC24829.1| hypothetical protein L484_003806 [Morus notabilis]
Length=194

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QK+RDWNTFGQYLKNQ PPV L +CN NHVLDFLRYLDQFGKTKVHL GC++FGQP+
Sbjct  43   YESQKKRDWNTFGQYLKNQTPPVALSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPD  102

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV++ Q+KARG
Sbjct  103  PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARG  162

Query  703  IPY  711
            IPY
Sbjct  163  IPY  165



>ref|XP_011008476.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=177

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +CN NHVLDFLRYLDQFGKTKVHL GC++FGQP+
Sbjct  32   YESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPD  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAAFEE+GG  E+NPF   AIR+YLREV++ Q+KARG
Sbjct  92   PPAPCTCPLRQAWGSLDALIGRLRAAFEEHGGSAETNPFGNGAIRVYLREVKECQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>ref|XP_008455303.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Cucumis 
melo]
Length=188

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKNQRPPVPL  CN N VL+FLRYLDQFGKTKVH+QGCM++GQPE
Sbjct  33   YESQKRRDWNTFCQYLKNQRPPVPLSHCNCNQVLEFLRYLDQFGKTKVHIQGCMFYGQPE  92

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG  E+NPFA  AIR+YLR+VR+ Q+KARG
Sbjct  93   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFASGAIRVYLRDVRECQAKARG  152

Query  703  IPY  711
            IPY
Sbjct  153  IPY  155



>gb|EPS59921.1| hypothetical protein M569_14884, partial [Genlisea aurea]
Length=143

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKNQRPPVPL  CNY+HVLDF+RYLDQFGKTKVHL+GC++FGQP+
Sbjct  14   YESQKRRDWNTFRQYLKNQRPPVPLEHCNYSHVLDFMRYLDQFGKTKVHLRGCVFFGQPD  73

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P G CTCPLRQAWGSLDAL+GRLRAA+E NGG  E+NPFA  AIR+YLREVRD Q+KARG
Sbjct  74   PDGACTCPLRQAWGSLDALVGRLRAAYEGNGGSQETNPFADGAIRVYLREVRDLQAKARG  133

Query  703  IPY  711
            IPY
Sbjct  134  IPY  136



>ref|XP_002305745.1| hypothetical protein POPTR_0004s05610g [Populus trichocarpa]
 gb|ABK93578.1| unknown [Populus trichocarpa]
 gb|EEE86256.1| hypothetical protein POPTR_0004s05610g [Populus trichocarpa]
Length=177

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +CN NHVLDFLRYLDQFGKTKVHL GC++FGQP+
Sbjct  32   YESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPD  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAAFEE+GG  E+NPF   AIR+YLREV++ Q+KARG
Sbjct  92   PPAPCTCPLRQAWGSLDALIGRLRAAFEEHGGSAETNPFGNGAIRVYLREVKECQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>gb|KGN55073.1| hypothetical protein Csa_4G627230 [Cucumis sativus]
Length=201

 Score =   221 bits (562),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDW TFGQYL+NQRPP+ + +CN +HVL+FLRYLDQFGKTKVHL GC +FG+PE
Sbjct  62   YESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKVHLNGCGFFGEPE  121

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAGPCTCPLRQAWGSLDALIGRLRAA+EENGG  ++NPFA  AIR+YLREVRD+QSKARG
Sbjct  122  PAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYLREVRDSQSKARG  181

Query  703  IPY  711
            IPY
Sbjct  182  IPY  184



>ref|XP_006467647.1| PREDICTED: uncharacterized protein LOC102611919 [Citrus sinensis]
 gb|KDO77861.1| hypothetical protein CISIN_1g029090mg [Citrus sinensis]
Length=199

 Score =   221 bits (562),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +C+ NHVLDFLRYLDQFGKTKVHL GC++FGQP+
Sbjct  51   YESQKRRDWNTFGQYLKNQRPPVSLSQCSCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPD  110

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREVR+ Q+KARG
Sbjct  111  PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAKARG  170

Query  703  IPY  711
            IPY
Sbjct  171  IPY  173



>ref|XP_004146094.1| PREDICTED: uncharacterized protein LOC101204141 [Cucumis sativus]
Length=204

 Score =   221 bits (562),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDW TFGQYL+NQRPP+ + +CN +HVL+FLRYLDQFGKTKVHL GC +FG+PE
Sbjct  62   YESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKVHLNGCGFFGEPE  121

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAGPCTCPLRQAWGSLDALIGRLRAA+EENGG  ++NPFA  AIR+YLREVRD+QSKARG
Sbjct  122  PAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYLREVRDSQSKARG  181

Query  703  IPY  711
            IPY
Sbjct  182  IPY  184



>ref|XP_004171006.1| PREDICTED: uncharacterized LOC101204141, partial [Cucumis sativus]
Length=200

 Score =   220 bits (561),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDW TFGQYL+NQRPP+ + +CN +HVL+FLRYLDQFGKTKVHL GC +FG+PE
Sbjct  63   YESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKVHLNGCGFFGEPE  122

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAGPCTCPLRQAWGSLDALIGRLRAA+EENGG  ++NPFA  AIR+YLREVRD+QSKARG
Sbjct  123  PAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYLREVRDSQSKARG  182

Query  703  IPY  711
            IPY
Sbjct  183  IPY  185



>gb|AFK41155.1| unknown [Lotus japonicus]
Length=185

 Score =   219 bits (559),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QK+RDWNTFGQYL+NQRPPV L +CN NHVL+FLRYLDQFGKTKVH QGC++FGQ E
Sbjct  39   YESQKKRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHSQGCLFFGQTE  98

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAA+EENGGLPE+NPFA  +IR++L EVRD Q+KARG
Sbjct  99   PPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGSIRVHLHEVRDFQAKARG  158

Query  703  IPY  711
            IPY
Sbjct  159  IPY  161



>ref|XP_006449503.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 ref|XP_006449504.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 gb|ESR62743.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 gb|ESR62744.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
Length=199

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L +C+ NHVLDFLRYLDQFGKTKVHL GC++FGQP+
Sbjct  51   YESQKRRDWNTFGQYLKNQRPPVSLSQCSCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPD  110

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREVR+ Q+KARG
Sbjct  111  PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQAKARG  170

Query  703  IPY  711
            IPY
Sbjct  171  IPY  173



>gb|AFK49191.1| unknown [Medicago truncatula]
 gb|KEH36593.1| DUF640 family protein [Medicago truncatula]
Length=184

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QK+RDWNTFGQYL+NQ PPV L +CN+NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  36   YESQKKRDWNTFGQYLRNQSPPVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQPD  95

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV++ QSKARG
Sbjct  96   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPENNPFGTGAIRVYLREVKECQSKARG  155

Query  703  IPY  711
            IPY
Sbjct  156  IPY  158



>ref|XP_009790882.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=176

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF Q+L+NQR P+PL +CN NHVL+FL YLDQFGKTKVHLQGCM++GQPE
Sbjct  29   YESQKRRDWNTFNQFLRNQRQPIPLSQCNDNHVLEFLGYLDQFGKTKVHLQGCMFYGQPE  88

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA +AIR+YLREV++ Q+KARG
Sbjct  89   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASTAIRVYLREVKECQAKARG  148

Query  703  IPY  711
            I Y
Sbjct  149  IAY  151



>ref|XP_008463732.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=199

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDW TFGQYL+NQRPP+ + +CN +HVL+FLRYLDQFGKTKVHL GC +FG+PE
Sbjct  60   YESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKVHLNGCGFFGEPE  119

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAGPCTCPLRQAWGSLDALIGRLRAA+EENGG  ++NPFA  AIR+YLREVRD+QSKARG
Sbjct  120  PAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYLREVRDSQSKARG  179

Query  703  IPY  711
            IPY
Sbjct  180  IPY  182



>ref|XP_009790219.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=176

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF Q+L+NQR P+PL +CN NHVL+FL YLDQFGKTKVHLQGCM++GQPE
Sbjct  29   YESQKRRDWNTFNQFLRNQRQPIPLSQCNGNHVLEFLGYLDQFGKTKVHLQGCMFYGQPE  88

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA +AIR+YLREV++ Q+KARG
Sbjct  89   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASTAIRVYLREVKECQAKARG  148

Query  703  IPY  711
            I Y
Sbjct  149  IAY  151



>ref|XP_011098044.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like, 
partial [Sesamum indicum]
Length=157

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQ+L+NQRPPV L +C+  HVL+FLRYLDQFGKTKVHLQGC+++GQPE
Sbjct  26   YESQKRRDWNTFGQFLRNQRPPVALSQCSSGHVLEFLRYLDQFGKTKVHLQGCIFYGQPE  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG  E+NPFA SAIR+YLREV+++Q+KARG
Sbjct  86   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGPQETNPFASSAIRIYLREVKESQAKARG  145

Query  703  IPY  711
            IPY
Sbjct  146  IPY  148



>ref|XP_008371461.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_008371462.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009349575.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
 ref|XP_009349639.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=187

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQ PPV L  CN NHVLDFLRYLDQFGKTKVHL GC++FGQP+
Sbjct  42   YESQKRRDWNTFGQYLKNQSPPVSLSHCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPD  101

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV++ Q+KARG
Sbjct  102  PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARG  161

Query  703  IPY  711
            IPY
Sbjct  162  IPY  164



>ref|XP_004485894.1| PREDICTED: uncharacterized protein LOC101502781 [Cicer arietinum]
Length=183

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QK+RDWNTFGQYL+NQ P V L +CN+NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  35   YESQKKRDWNTFGQYLRNQTPAVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQPD  94

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV++ QSKARG
Sbjct  95   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPENNPFGSGAIRVYLREVKECQSKARG  154

Query  703  IPY  711
            IPY
Sbjct  155  IPY  157



>ref|XP_004293946.1| PREDICTED: uncharacterized protein LOC101295692 isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004293947.1| PREDICTED: uncharacterized protein LOC101295692 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=187

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQ PPVP+  C +NHVLDFLRYLDQFGKTKVHL  C++FGQP+
Sbjct  39   YESQKRRDWNTFGQYLKNQTPPVPMSHCQFNHVLDFLRYLDQFGKTKVHLHCCVFFGQPD  98

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV++ Q+KARG
Sbjct  99   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGAPETNPFGNGAIRVYLREVKECQAKARG  158

Query  703  IPY  711
            IPY
Sbjct  159  IPY  161



>ref|XP_008225289.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Prunus 
mume]
Length=187

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQ PPV L +CN NHVLDFLRYLDQFGKTKVHL GC++FGQP+
Sbjct  38   YESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPD  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV++ Q+KARG
Sbjct  98   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARG  157

Query  703  IPY  711
            IPY
Sbjct  158  IPY  160



>ref|XP_003542999.1| PREDICTED: uncharacterized protein LOC100778886 [Glycine max]
Length=181

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQ PPV L +CN+NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  34   YESQKRRDWNTFGQYLKNQTPPVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQPD  93

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE GG PE+NPF   AIR+YLREV++ Q+KARG
Sbjct  94   PPAPCTCPLRQAWGSLDALIGRLRAAYEERGGSPETNPFGSGAIRVYLREVKECQAKARG  153

Query  703  IPY  711
            IPY
Sbjct  154  IPY  156



>ref|XP_008465553.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=182

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQ PPV L +CN NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  29   YESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPD  88

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV++ Q+KARG
Sbjct  89   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARG  148

Query  703  IPY  711
            IPY
Sbjct  149  IPY  151



>ref|XP_008358651.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009352770.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=190

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQ PPV L  CN NHVLDFLRYLDQFGKTKVHL GC++FGQP+
Sbjct  42   YESQKRRDWNTFGQYLKNQSPPVSLSHCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPD  101

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV++ Q+KARG
Sbjct  102  PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARG  161

Query  703  IPY  711
            IPY
Sbjct  162  IPY  164



>ref|XP_010052190.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Eucalyptus 
grandis]
 gb|KCW76110.1| hypothetical protein EUGRSUZ_D00487 [Eucalyptus grandis]
Length=177

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQ+PPV L +CN NHVL+FLRYLDQFGKTKVHL GC++FGQ E
Sbjct  33   YESQKRRDWNTFGQYLRNQKPPVALSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQRE  92

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPF   AIR+YLREV++ Q+KARG
Sbjct  93   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGAPENNPFGNGAIRVYLREVKECQAKARG  152

Query  703  IPY  711
            IPY
Sbjct  153  IPY  155



>ref|XP_007148048.1| hypothetical protein PHAVU_006G176100g [Phaseolus vulgaris]
 gb|ESW20042.1| hypothetical protein PHAVU_006G176100g [Phaseolus vulgaris]
Length=183

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQ PPV L  CN+NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  36   YESQKRRDWNTFGQYLKNQTPPVSLSLCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQPD  95

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV++ Q+KARG
Sbjct  96   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGSGAIRVYLREVKECQAKARG  155

Query  703  IPY  711
            IPY
Sbjct  156  IPY  158



>ref|XP_006442831.1| hypothetical protein CICLE_v10023710mg [Citrus clementina]
 gb|ESR56071.1| hypothetical protein CICLE_v10023710mg [Citrus clementina]
Length=332

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +C+ +HVL+FLRYLDQFGKTKVHLQGCM++GQP 
Sbjct  186  YESQKRRDWNTFGQYLKNQRPPVPLSQCSSSHVLEFLRYLDQFGKTKVHLQGCMFYGQPN  245

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA   +R++L EVR+ Q+KARG
Sbjct  246  PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGEMRVFLGEVRERQAKARG  305

Query  703  IPY  711
            IPY
Sbjct  306  IPY  308



>gb|EPS69070.1| hypothetical protein M569_05697, partial [Genlisea aurea]
Length=131

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQ+L+NQRPPV L +CN NHVLDFLRYLDQFGKT+VH QGC+++GQPE
Sbjct  6    YESQKRRDWNTFGQFLRNQRPPVALSQCNINHVLDFLRYLDQFGKTRVHAQGCIFYGQPE  65

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPL+QAWGSLDALIGRLRAA+EENGG PE+NPFA +AIR++LRE+++ Q+KARG
Sbjct  66   PPAPCGCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASAAIRVFLREIKECQAKARG  125

Query  703  IPY  711
            IPY
Sbjct  126  IPY  128



>ref|XP_007212120.1| hypothetical protein PRUPE_ppa012018mg [Prunus persica]
 gb|EMJ13319.1| hypothetical protein PRUPE_ppa012018mg [Prunus persica]
Length=187

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQ PPV L +CN NHVLDFLRYLDQFGKTKVHL GC++FGQP+
Sbjct  38   YESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPD  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPL+QAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV++ Q+KARG
Sbjct  98   PPAPCTCPLKQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARG  157

Query  703  IPY  711
            IPY
Sbjct  158  IPY  160



>ref|XP_004151474.1| PREDICTED: uncharacterized protein LOC101210225 [Cucumis sativus]
Length=187

 Score =   217 bits (553),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQ P V L +CN NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  28   YESQKRRDWNTFGQYLKNQTPAVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPD  87

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV++ Q+KARG
Sbjct  88   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARG  147

Query  703  IPY  711
            IPY
Sbjct  148  IPY  150



>ref|NP_001237249.1| uncharacterized protein LOC100306082 [Glycine max]
 gb|ACU14083.1| unknown [Glycine max]
Length=181

 Score =   217 bits (552),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQ PPV L +CN+NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  34   YESQKRRDWNTFGQYLKNQTPPVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQPD  93

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG  E+NPF   AIR+YLREV++ Q+KARG
Sbjct  94   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSAETNPFGSGAIRVYLREVKECQAKARG  153

Query  703  IPY  711
            IPY
Sbjct  154  IPY  156



>gb|KGN65636.1| hypothetical protein Csa_1G474480 [Cucumis sativus]
Length=186

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQ P V L +CN NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  28   YESQKRRDWNTFGQYLKNQTPAVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPD  87

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV++ Q+KARG
Sbjct  88   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARG  147

Query  703  IPY  711
            IPY
Sbjct  148  IPY  150



>ref|NP_565190.1| protein LIGHT SENSITIVE HYPOCOTYLS 7 [Arabidopsis thaliana]
 sp|Q9ZVA0.1|LSH7_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7; AltName: 
Full=Protein ORGAN BOUNDARY 7 [Arabidopsis thaliana]
 gb|AAC83029.1| Strong similarity to T16B12.3 gi|3746060 unknown protein from 
Arabidopsis thaliana BAC gb|AC005311 [Arabidopsis thaliana]
 gb|AEE36158.1| uncharacterized protein AT1G78815 [Arabidopsis thaliana]
Length=195

 Score =   216 bits (551),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+NQ+PPV + +C  NH+LDFL+YLDQFGKTKVH+ GC++FGQ E
Sbjct  41   YESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFGQVE  100

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAG C CPL+QAWGSLDALIGRLRAAFEENGGLPE NPFAG  IR++LREVRD+Q+KARG
Sbjct  101  PAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKARG  160

Query  703  IPY  711
            +PY
Sbjct  161  VPY  163



>ref|XP_006478612.1| PREDICTED: probable disease resistance protein At4g27220-like 
isoform X1 [Citrus sinensis]
Length=1622

 Score =   236 bits (601),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 99/123 (80%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343   YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
             YE QKRRDWNTFGQYLKNQRPPVPL +C+ +HVL+FLRYLD FGK KVHLQGCM++GQP 
Sbjct  1484  YELQKRRDWNTFGQYLKNQRPPVPLSQCSSSHVLEFLRYLDPFGKIKVHLQGCMFYGQPN  1543

Query  523   PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
             P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA   IR+YLREVR+ Q+KARG
Sbjct  1544  PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGEIRVYLREVRECQAKARG  1603

Query  703   IPY  711
             IPY
Sbjct  1604  IPY  1606



>ref|XP_002889213.1| At1g78815 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65472.1| At1g78815 [Arabidopsis lyrata subsp. lyrata]
Length=191

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+NQ+PPV + +C  NH+LDFL+YLDQFGKTKVH+ GC++FGQ E
Sbjct  37   YESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFGQVE  96

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAG C CPL+QAWGSLDALIGRLRAAFEENGGLPE NPFAG  IR++LREVRD+Q+KARG
Sbjct  97   PAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKARG  156

Query  703  IPY  711
            +PY
Sbjct  157  VPY  159



>gb|ABF83646.1| At1g78815 [Arabidopsis thaliana]
Length=195

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+NQ+PPV + +C  NH+LDFL+YLDQFGKTKVH+ GC++FGQ E
Sbjct  41   YESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFGQVE  100

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAG C CPL+QAWGSLDALIGRLRAAFEENGGLPE NPFAG  IR++LREVRD+Q+KARG
Sbjct  101  PAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKARG  160

Query  703  IPY  711
            +PY
Sbjct  161  VPY  163



>ref|XP_004174117.1| PREDICTED: uncharacterized protein LOC101228453 [Cucumis sativus]
Length=191

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQ P V L +CN NHVL+FLRYLDQFGKTKVHL GC++FGQP+
Sbjct  32   YESQKRRDWNTFGQYLKNQTPAVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPD  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLREV++ Q+KARG
Sbjct  92   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>ref|XP_010429720.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Camelina 
sativa]
Length=193

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+NQ+PPV + +C  NH+LDFL+YLDQFGKTKVH+ GC++FGQ E
Sbjct  39   YESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQVE  98

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAG C CPL+QAWGSLDALIGRLRAAFEENGGLPE NPFAG  IR++LREVRD+Q+KARG
Sbjct  99   PAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKARG  158

Query  703  IPY  711
            +PY
Sbjct  159  VPY  161



>gb|EYU30777.1| hypothetical protein MIMGU_mgv1a014751mg [Erythranthe guttata]
Length=179

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQ+L+N RP V + +CN +HVLDF+RYLDQFGKTKVH QGC ++GQPE
Sbjct  26   YESQKRRDWNTFGQFLRNMRPAVGVAQCNSSHVLDFMRYLDQFGKTKVHSQGCTFYGQPE  85

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDAL+GRLRAA+EENGG PESNPFA S+IR+YLREV++ QSKARG
Sbjct  86   PPAPCTCPLRQAWGSLDALVGRLRAAYEENGGSPESNPFASSSIRMYLREVKECQSKARG  145

Query  703  IPY  711
            IPY
Sbjct  146  IPY  148



>ref|XP_010417489.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Camelina 
sativa]
Length=196

 Score =   216 bits (549),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+NQ+PPV + +C  NH+LDFL+YLDQFGKTKVH+ GC++FGQ E
Sbjct  42   YESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQVE  101

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAG C CPL+QAWGSLDALIGRLRAAFEENGGLPE NPFAG  IR++LREVRD+Q+KARG
Sbjct  102  PAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKARG  161

Query  703  IPY  711
            +PY
Sbjct  162  VPY  164



>ref|XP_006302860.1| hypothetical protein CARUB_v10020990mg [Capsella rubella]
 gb|EOA35758.1| hypothetical protein CARUB_v10020990mg [Capsella rubella]
Length=191

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+NQ+PPV + +C  NH+LDFL+YLDQFGKTKVH+ GC++FGQ E
Sbjct  37   YESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQVE  96

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAG C CPL+QAWGSLDALIGRLRAAFEENGGLPE NPFAG  IR++LREVRD+Q+KARG
Sbjct  97   PAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKARG  156

Query  703  IPY  711
            +PY
Sbjct  157  VPY  159



>ref|XP_004244278.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like isoform 
X2 [Solanum lycopersicum]
Length=168

 Score =   214 bits (545),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKN +PPVPLP+CNYNHVLDFLRYLDQFGKTKVHL GC++FGQ E
Sbjct  42   YESQKRRDWNTFGQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKTKVHLNGCVFFGQVE  101

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVR  678
              GPCTCPLRQAWGSLDALIGRLRAA+EENGGL E+NPFA SAIR+YLRE R
Sbjct  102  QVGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREAR  153



>gb|AAM64330.1| unknown [Arabidopsis thaliana]
Length=195

 Score =   215 bits (547),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+NQ+PPV + +C  NH+LDFL+YLDQFGKTKVH+ GC++FGQ E
Sbjct  41   YESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFGQVE  100

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAG C CPL+QAWGSLDALIGRLRAAFEENGGLPE NPFAG  IR++LREVRD+Q+KARG
Sbjct  101  PAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAKARG  160

Query  703  IPY  711
            +PY
Sbjct  161  VPY  163



>ref|XP_011011486.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=177

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L + N NHVLDFLRYLDQFGKTKVHL GC++FGQP 
Sbjct  32   YESQKRRDWNTFGQYLKNQRPPVSLSQSNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPN  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG  E+NPF   AIR+YLREV++ Q+KARG
Sbjct  92   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSAETNPFGNGAIRVYLREVKECQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>ref|XP_002317421.1| hypothetical protein POPTR_0011s07350g [Populus trichocarpa]
 gb|ABK94387.1| unknown [Populus trichocarpa]
 gb|EEE98033.1| hypothetical protein POPTR_0011s07350g [Populus trichocarpa]
Length=177

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV L + N NHVLDFLRYLDQFGKTKVHL GC++FGQP 
Sbjct  32   YESQKRRDWNTFGQYLKNQRPPVSLSQSNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPN  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG  E+NPF   AIR+YLREV++ Q+KARG
Sbjct  92   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSAETNPFGNGAIRVYLREVKECQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>ref|XP_009106595.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Brassica 
rapa]
 emb|CDX87432.1| BnaA07g34410D [Brassica napus]
Length=190

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+NQ+PPV + +C  NH+LDFL+YLDQFGKTKVH+ GC++FGQ E
Sbjct  41   YESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQVE  100

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAG C CPL+QAWGSLDALIGRLRAA+EENGGLPE NPFAG  IR++LREVRD+Q+KARG
Sbjct  101  PAGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAKARG  160

Query  703  IPY  711
            +PY
Sbjct  161  VPY  163



>ref|XP_006389954.1| hypothetical protein EUTSA_v10019792mg [Eutrema salsugineum]
 gb|ESQ27240.1| hypothetical protein EUTSA_v10019792mg [Eutrema salsugineum]
Length=188

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+NQ+PPV + +C  NH+LDFL+YLDQFGKTKVH+ GC++FGQ E
Sbjct  35   YESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQVE  94

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAG C CPL+QAWGSLDALIGRLRAA+EENGGLPE NPFAG  IR++LREVRD+Q+KARG
Sbjct  95   PAGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAKARG  154

Query  703  IPY  711
            +PY
Sbjct  155  VPY  157



>emb|CDX88480.1| BnaC06g39240D [Brassica napus]
Length=185

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+NQ PPV + +C  NH+LDFL+YLDQFGKTKVH+ GC++FGQ E
Sbjct  36   YESQKRRDWNTFCQYLRNQHPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQVE  95

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            PAG C CPL+QAWGSLDALIGRLRAA+EENGGLPE NPFAG  IR++LREVRD+Q+KARG
Sbjct  96   PAGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAKARG  155

Query  703  IPY  711
            +PY
Sbjct  156  VPY  158



>ref|XP_010540518.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
Length=179

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPV   + ++NHV+DFL+YLDQFGKTKVH  GC++FGQP+
Sbjct  17   YESQKRRDWNTFGQYLKNQRPPVSFAQLSFNHVIDFLKYLDQFGKTKVHHHGCVFFGQPD  76

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAAFEE+GG  + NPF   AIR+YLREVRD+QSKARG
Sbjct  77   PPGPCTCPLKQAWGSLDALIGRLRAAFEEHGGSSDQNPFGNGAIRVYLREVRDSQSKARG  136

Query  703  IPY  711
            I Y
Sbjct  137  IQY  139



>gb|KFK42237.1| hypothetical protein AALP_AA2G229400 [Arabis alpina]
Length=200

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+NQ+PPV + +C  NH+LDFL+YLDQFGKTKVH+ GC++FGQ E
Sbjct  45   YESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQVE  104

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P G C CPL+QAWGSLDALIGRLRAA+EENGGLPE NPFAG  IR++LREVRD+Q+KARG
Sbjct  105  PPGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAKARG  164

Query  703  IPY  711
            +PY
Sbjct  165  VPY  167



>gb|KDO64048.1| hypothetical protein CISIN_1g0003541mg, partial [Citrus sinensis]
Length=553

 Score =   223 bits (567),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE QKRRDWNTFGQYLKNQRPPVPL +C+ +HVL+FLRYLD FGK KVHLQGCM++GQP 
Sbjct  415  YELQKRRDWNTFGQYLKNQRPPVPLSQCSSSHVLEFLRYLDPFGKIKVHLQGCMFYGQPN  474

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA   IR+YLREVR+ Q+KARG
Sbjct  475  PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGEIRVYLREVRECQAKARG  534

Query  703  IPY  711
            IPY
Sbjct  535  IPY  537



>ref|XP_010327093.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=178

 Score =   211 bits (537),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF  YLKNQRPP+ LP C+ NHVL+FLRYLDQFGKTKVHL GCM++GQP+
Sbjct  28   YESQKRRDWNTFNHYLKNQRPPILLPHCHSNHVLEFLRYLDQFGKTKVHLLGCMFYGQPD  87

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EENGG  E+NPFA   IR+YLREV++ Q+KARG
Sbjct  88   PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSSETNPFASVGIRVYLREVKECQAKARG  147

Query  703  IPY  711
            I Y
Sbjct  148  IAY  150



>emb|CDX85083.1| BnaC07g08230D [Brassica napus]
Length=199

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE QKRRDWNTFGQYL+N RPP+ L RC+  HVL+FLRYLDQFGKTKVH+Q C +FG P 
Sbjct  49   YENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHMQICPFFGHPN  108

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAAFEENGG PE+NPF   A+RLYLREVRD+Q+KARG
Sbjct  109  PPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAKARG  168

Query  703  IPY  711
            I Y
Sbjct  169  ISY  171



>ref|XP_009102637.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Brassica 
rapa]
 emb|CDX77531.1| BnaA07g06690D [Brassica napus]
Length=199

 Score =   210 bits (535),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE QKRRDWNTFGQYL+N RPP+ L RC+  HVL+FLRYLDQFGKTKVH+Q C +FG P 
Sbjct  49   YENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHMQICPFFGHPN  108

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAAFEENGG PE+NPF   A+RLYLREVRD+Q+KARG
Sbjct  109  PPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAKARG  168

Query  703  IPY  711
            I Y
Sbjct  169  ISY  171



>emb|CDY14588.1| BnaC02g25250D [Brassica napus]
Length=190

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QK+RDWNTF QYL+NQ+PPV + +C  NH+LDFL+YLDQFGKTKVH  GC++FGQ E
Sbjct  36   YESQKKRDWNTFCQYLRNQQPPVHVSQCGSNHILDFLQYLDQFGKTKVHAHGCVFFGQVE  95

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P+G C CPL+QAWGSLDALIGRLRAA+EENGGLPE NPFAG  IR++L+EVRD+Q+KARG
Sbjct  96   PSGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLKEVRDSQAKARG  155

Query  703  IPY  711
            +PY
Sbjct  156  VPY  158



>ref|XP_003531069.1| PREDICTED: uncharacterized protein LOC100798406 [Glycine max]
Length=247

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKN RPP+ L RC+  HVL+FLRYLDQFGKTKVH + C YFG   
Sbjct  49   YESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAETCGYFGNSH  108

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC CPLRQAWGSLDALIGRLRAAFEENGG PE NPF   A+RLYLREVRDAQ+KARG
Sbjct  109  PPGPCACPLRQAWGSLDALIGRLRAAFEENGGAPEMNPFGTRAVRLYLREVRDAQAKARG  168

Query  703  IPY  711
            I Y
Sbjct  169  IAY  171



>emb|CDY26881.1| BnaA02g19060D [Brassica napus]
Length=191

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QK+RDWNTF QYL+NQ+PPV + +C  NH+LDFL+YLDQFGKTKVH  GC++FGQ E
Sbjct  36   YESQKKRDWNTFCQYLRNQQPPVHVSQCGSNHILDFLQYLDQFGKTKVHAHGCVFFGQVE  95

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P+G C CPL+QAWGSLDALIGRLRAA+EENGGLPE NPFAG  IR++L+EVRD+Q+KARG
Sbjct  96   PSGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLKEVRDSQAKARG  155

Query  703  IPY  711
            +PY
Sbjct  156  VPY  158



>emb|CDY69731.1| BnaCnng65050D [Brassica napus]
Length=195

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE QKRRDWNTFGQYL+N RPP+ L RC+  HVL+FLRYLDQFGKTKVH Q C +FG P 
Sbjct  48   YENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGHPN  107

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAAFEENGG PE+NPF   A+RLYLREVRD+Q+KARG
Sbjct  108  PPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAKARG  167

Query  703  IPY  711
            I Y
Sbjct  168  ISY  170



>ref|XP_003524092.1| PREDICTED: uncharacterized protein LOC100775838 [Glycine max]
Length=236

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKN RPP+ L RC+  HVL+FLRYLDQFGKTKVH + C YFG   
Sbjct  48   YESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAETCAYFGNSH  107

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC CPLRQAWGSLDALIGRLRAAFEENGG PE NPF   A+RLYLREVRDAQ+KARG
Sbjct  108  PPGPCACPLRQAWGSLDALIGRLRAAFEENGGTPEMNPFGTRAVRLYLREVRDAQAKARG  167

Query  703  IPY  711
            I Y
Sbjct  168  IAY  170



>ref|XP_008649559.1| PREDICTED: protein G1-like7 [Zea mays]
 gb|AFW77771.1| putative protein of unknown function (DUF640) domain family protein 
[Zea mays]
Length=301

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L RC+  HV++FLRYLDQFGKTKVH +GC YFGQP 
Sbjct  84   YESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHAEGCAYFGQPN  143

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PESNPFA  A+R+YLR+VR+AQ+KARG
Sbjct  144  PPAPCTCPLRQAWGSLDALIGRLRAAYEESGGRPESNPFAAKAVRIYLRDVREAQAKARG  203

Query  703  IPY  711
            IPY
Sbjct  204  IPY  206



>gb|EYU43335.1| hypothetical protein MIMGU_mgv1a022623mg, partial [Erythranthe 
guttata]
Length=169

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKNQ PP+ LP C+YNHVL+FLRYLDQFGKTKVHL GC +FGQP+
Sbjct  27   YESQKRRDWNTFLQYLKNQNPPLSLPNCSYNHVLEFLRYLDQFGKTKVHLHGCPFFGQPD  86

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P G CTCPLRQAWGSLDALIGRLRAA+EE+GG PE NPF   AIR+YLREV++ Q+KARG
Sbjct  87   PPGQCTCPLRQAWGSLDALIGRLRAAYEEHGGPPEGNPFGNGAIRVYLREVKECQAKARG  146

Query  703  I  705
            I
Sbjct  147  I  147



>ref|XP_003539992.1| PREDICTED: uncharacterized protein LOC100806134 [Glycine max]
Length=177

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  33   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPE  92

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  +IR+YLREVR+ Q+KARG
Sbjct  93   PPAPCACPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAKARG  152

Query  703  IPY  711
            I Y
Sbjct  153  IAY  155



>ref|NP_001143976.1| uncharacterized protein LOC100276793 [Zea mays]
 gb|ACG36867.1| hypothetical protein [Zea mays]
Length=305

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L RC+  HV++FLRYLDQFGKTKVH +GC YFGQP 
Sbjct  86   YESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHAEGCAYFGQPN  145

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PESNPFA  A+R+YLR+VR+AQ+KARG
Sbjct  146  PPAPCTCPLRQAWGSLDALIGRLRAAYEESGGRPESNPFAAKAVRIYLRDVREAQAKARG  205

Query  703  IPY  711
            IPY
Sbjct  206  IPY  208



>gb|KHG10505.1| Error-prone DNA polymerase [Gossypium arboreum]
Length=238

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVH+ GC YFG P 
Sbjct  53   YESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHPN  112

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC+CPL+QAWGSLDALIGRLRAA+EENGG PESNPFA  A+R+YLREVR+ Q+KARG
Sbjct  113  PPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFAARAVRIYLREVREGQAKARG  172

Query  703  IPY  711
            IPY
Sbjct  173  IPY  175



>ref|XP_004504735.1| PREDICTED: uncharacterized protein LOC101506113 [Cicer arietinum]
Length=236

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKN RPP+ L RC+  HVL+FLRYLDQFGKTKVH + C YFG   
Sbjct  48   YESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHSENCAYFGNSN  107

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC CPL+QAWGSLDALIGRLRAAFEENGG PE NPF   A+RLYLREVRDAQ+KARG
Sbjct  108  PPGPCPCPLKQAWGSLDALIGRLRAAFEENGGSPEINPFGARAVRLYLREVRDAQAKARG  167

Query  703  IPY  711
            I Y
Sbjct  168  IGY  170



>ref|XP_010906808.1| PREDICTED: LOW QUALITY PROTEIN: protein G1-like4 [Elaeis guineensis]
Length=198

 Score =   207 bits (527),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKN RPP+ L RC+  HVL+FLRYLDQFGKTKVH Q C +FG P 
Sbjct  53   YESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHPN  112

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC+CPLRQAWGSLDALIGRLRAA+EENGG PESNPF   A+RLYLREVR+ Q+KARG
Sbjct  113  PPAPCSCPLRQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRLYLREVRELQAKARG  172

Query  703  IPY  711
            I Y
Sbjct  173  ISY  175



>gb|KHG29970.1| Putative beta-lactamase-like 1 [Gossypium arboreum]
Length=161

 Score =   206 bits (524),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHL GC++FGQP+
Sbjct  32   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPD  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSK  693
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF   AIR+YLRE   A+++
Sbjct  92   PPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREDDKAKAE  148



>ref|XP_009128313.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Brassica 
rapa]
Length=191

 Score =   207 bits (526),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QK+RDWNTF QYL+NQ+PPV + +C  NH+LDFL+YLDQFGKTKVH  GC++FGQ E
Sbjct  36   YESQKKRDWNTFCQYLRNQQPPVHVSQCGSNHILDFLQYLDQFGKTKVHAHGCVFFGQVE  95

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P+G C CPL+QAWGSLDAL GRLRAA+EENGGLPE NPFAG  IR++L+EVRD+Q+KARG
Sbjct  96   PSGQCNCPLKQAWGSLDALSGRLRAAYEENGGLPERNPFAGGGIRVFLKEVRDSQAKARG  155

Query  703  IPY  711
            +PY
Sbjct  156  VPY  158



>ref|XP_007016962.1| Zinc finger protein ZFPM1 [Theobroma cacao]
 gb|EOY34581.1| Zinc finger protein ZFPM1 [Theobroma cacao]
Length=241

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVH+ GC YFG P 
Sbjct  54   YESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHPN  113

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC+CPL+QAWGSLDALIGRLRAA+EENGG PESNPF   A+R+YLREVR+ Q+KARG
Sbjct  114  PPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGAKAVRIYLREVREGQAKARG  173

Query  703  IPY  711
            IPY
Sbjct  174  IPY  176



>ref|XP_008802142.1| PREDICTED: LOW QUALITY PROTEIN: protein G1-like4 [Phoenix dactylifera]
Length=189

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKN RPP+ L RC+  HVL+FLRYLDQFGKTKVH Q C +FG P 
Sbjct  44   YESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHPN  103

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC+CPLRQAWGSLDALIGRLRAA+EENGG PESNPF   A+RLYLREVR+ Q+KARG
Sbjct  104  PPAPCSCPLRQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRLYLREVRELQAKARG  163

Query  703  IPY  711
            I Y
Sbjct  164  ISY  166



>ref|XP_009419635.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Musa 
acuminata subsp. malaccensis]
Length=213

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWN+FGQYL+N RPP+ L RC+  HVL+FLRYLDQFGKTKVH  GC +FG P+
Sbjct  24   YESQKRRDWNSFGQYLRNHRPPLELSRCSGAHVLEFLRYLDQFGKTKVHTAGCPFFGHPQ  83

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLD+L+GRLRAAFEE+GG PE NPFA  A+RLYLREVRD+Q+KARG
Sbjct  84   PPAPCTCPLRQAWGSLDSLVGRLRAAFEEDGGQPEVNPFAARAVRLYLREVRDSQAKARG  143

Query  703  IPY  711
            I Y
Sbjct  144  IAY  146



>ref|XP_010549405.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=190

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QK RDWNTFGQYL NQRPPV + + N+NHV++FL+YLDQFGKTKVH  GC +FGQP+
Sbjct  27   YESQKLRDWNTFGQYLNNQRPPVSVTQFNFNHVINFLKYLDQFGKTKVHHHGCAFFGQPD  86

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPCTCPL+QAWGSLDALIGRLRAA+EE+GG P  NPF   AIR+YLREVRD+QSKARG
Sbjct  87   PPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGSPGLNPFGNGAIRVYLREVRDSQSKARG  146

Query  703  IPY  711
            I Y
Sbjct  147  IQY  149



>ref|XP_009383380.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=200

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L RC+  HV++FLRYLDQFGKTKVHL GC ++G P 
Sbjct  28   YESQKRRDWNTFLQYLRNHKPPLVLTRCSGAHVIEFLRYLDQFGKTKVHLSGCAFYGHPS  87

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPLRQAWGSLDALIGRLRAA+EE+GG PE+NPFA  A+R++LR+VRD+Q+KARG
Sbjct  88   PPAPCTCPLRQAWGSLDALIGRLRAAYEESGGSPETNPFAARAVRIFLRDVRDSQAKARG  147

Query  703  IPY  711
            IPY
Sbjct  148  IPY  150



>ref|XP_009615590.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=194

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 129/151 (85%), Gaps = 1/151 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKN RPP+PL +CNYNHVL+FLRYLDQFGKTKVHL GC +FGQPE
Sbjct  44   YESQKRRDWNTFGQYLKNLRPPIPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPFFGQPE  103

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPLRQAWGSLDALIGRLRAA+EENGGLPE+NPFA  +IR+YLREVRD Q+KARG
Sbjct  104  PPAPCACPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRIYLREVRDFQAKARG  163

Query  703  IPYkkkkkkknnalpkpnnDE-TPSFQMQSS  792
            I YKKKKKK+   +    N E T +FQ+Q S
Sbjct  164  ISYKKKKKKRKLQINASTNAEATATFQLQFS  194



>gb|KEH31304.1| G1-like protein [Medicago truncatula]
Length=234

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKN RPP+ L RC+  HVL+FLRYLDQFGKTKVH + C YFG   
Sbjct  47   YESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHSENCAYFGNSH  106

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC CPL+QAWGSLDALIGRLRAAFEENGG  E NPF   A+RLYLREVRDAQ+KARG
Sbjct  107  PPGPCPCPLKQAWGSLDALIGRLRAAFEENGGSQEMNPFGARAVRLYLREVRDAQAKARG  166

Query  703  IPY  711
            I Y
Sbjct  167  IGY  169



>ref|XP_002313971.1| hypothetical protein POPTR_0009s07990g [Populus trichocarpa]
 gb|EEE87926.1| hypothetical protein POPTR_0009s07990g [Populus trichocarpa]
Length=223

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVH+ GC YFG P 
Sbjct  49   YESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHPN  108

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC+CPL+QAWGSLDALIGRLRAA+EENGG PESNPF   A+R+YLREVR+ Q+KARG
Sbjct  109  PPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLREVREGQAKARG  168

Query  703  IPY  711
            IPY
Sbjct  169  IPY  171



>ref|XP_002298496.1| hypothetical protein POPTR_0001s28780g [Populus trichocarpa]
 gb|EEE83301.1| hypothetical protein POPTR_0001s28780g [Populus trichocarpa]
Length=228

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QY+KN +PP+ L RC+  HV++FL+YLDQFGKTKVH+ GC YFG P 
Sbjct  49   YESQKRRDWNTFLQYIKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHPN  108

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC+CPL+QAWGSLDALIGRLRAA+EENGGLPESNPF   A+R+YLREVR+ Q+KARG
Sbjct  109  PPAPCSCPLKQAWGSLDALIGRLRAAYEENGGLPESNPFGARAVRIYLREVREGQAKARG  168

Query  703  IPY  711
            IPY
Sbjct  169  IPY  171



>ref|XP_009108056.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Brassica 
rapa]
Length=195

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE QKRRDWNTFGQYL+N RPP+ L RC   HVL+FLRYLDQFGKTKVH Q C +FG   
Sbjct  48   YENQKRRDWNTFGQYLRNHRPPLSLSRCGGAHVLEFLRYLDQFGKTKVHTQLCPFFGHAN  107

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPLRQAWGSLDALIGRLRAAFEENGG PE+NPF   A+RLYLREVRD+Q+KARG
Sbjct  108  PPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAKARG  167

Query  703  IPY  711
            I Y
Sbjct  168  ISY  170



>ref|XP_011003514.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 [Populus 
euphratica]
Length=220

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVH+ GC YFG P 
Sbjct  47   YESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHPN  106

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC+CPL+QAWGSLDALIGRLRAA+EENGG PESNPF   A+R+YLREVR+ Q+KARG
Sbjct  107  PPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLREVREGQAKARG  166

Query  703  IPY  711
            IPY
Sbjct  167  IPY  169



>ref|XP_007159026.1| hypothetical protein PHAVU_002G202200g [Phaseolus vulgaris]
 gb|ESW31020.1| hypothetical protein PHAVU_002G202200g [Phaseolus vulgaris]
Length=230

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKN RPP+ L RC+  HVL+FLRYLDQFGKTKVH + C +FG   
Sbjct  43   YESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAETCAFFGNSH  102

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC+CPL+QAWGSLDALIGRLRAAFEE+GG PE NPF   A+RLYLREVRDAQ+KARG
Sbjct  103  PPGPCSCPLKQAWGSLDALIGRLRAAFEEHGGAPEMNPFGTRAVRLYLREVRDAQAKARG  162

Query  703  IPY  711
            I Y
Sbjct  163  IAY  165



>gb|KFK28531.1| hypothetical protein AALP_AA7G008800 [Arabis alpina]
Length=194

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLK+Q PP+ + + +Y HVL FLRYLDQFGKTKVH Q C++FGQP+
Sbjct  41   YESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQPD  100

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGLPESNPFAGSAIRLYLREVRDAQSKAR  699
            P GPCTCPLRQAWGSLDALIGRLRAA+EE+ GG PE+NPFA  +IR++LREVR++Q+KAR
Sbjct  101  PPGPCTCPLRQAWGSLDALIGRLRAAYEEHGGGSPETNPFANGSIRVHLREVRESQAKAR  160

Query  700  GIPY  711
            GIPY
Sbjct  161  GIPY  164



>ref|XP_003531259.1| PREDICTED: uncharacterized protein LOC100810655 [Glycine max]
 gb|KHN47994.1| hypothetical protein glysoja_015464 [Glycine soja]
Length=167

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+NQ PPVPL +CN+NHVLDFLRYLDQFGKTKVHL GC++FGQP 
Sbjct  20   YESQKRRDWNTFGQYLRNQSPPVPLSQCNFNHVLDFLRYLDQFGKTKVHLHGCIFFGQPT  79

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF G AIR+YLREV++ Q+KARG
Sbjct  80   PPAPCACPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGGGAIRVYLREVKECQAKARG  139

Query  703  IPY  711
            IPY
Sbjct  140  IPY  142



>ref|XP_008804907.1| PREDICTED: protein G1-like7 [Phoenix dactylifera]
Length=229

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L RC+  HV++FLRYLDQFGKTKVH  GC +FGQP 
Sbjct  45   YESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHNAGCTFFGQPN  104

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC CPL+QAWGSLDALIGRLRAA+EE+GG PE+NPFA  A+R+YLREVR++Q+KARG
Sbjct  105  PPGPCACPLKQAWGSLDALIGRLRAAYEESGGRPEANPFAARAVRIYLREVRESQAKARG  164

Query  703  IPY  711
            +PY
Sbjct  165  VPY  167



>ref|XP_008657105.1| PREDICTED: protein G1-like7 [Zea mays]
 gb|AFW84710.1| putative protein of unknown function (DUF640) domain family protein 
[Zea mays]
Length=208

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N RPP+ L RC+  HV++FLRYLDQFGKTKVH  GC Y+GQ  
Sbjct  34   YESQKRRDWNTFLQYLRNHRPPLTLARCSGAHVIEFLRYLDQFGKTKVHAAGCAYYGQRA  93

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC CPLRQAWGSLDALIGRLRAA+EE+G  PESNP A  A+R+YLREVRD+Q+KARG
Sbjct  94   PPGPCPCPLRQAWGSLDALIGRLRAAYEESGRTPESNPLAARAVRIYLREVRDSQAKARG  153

Query  703  IPY  711
            IPY
Sbjct  154  IPY  156



>ref|XP_009411199.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=221

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L RC+  HV++FLRYLDQFGKTKVH  GC ++G P 
Sbjct  49   YESQKRRDWNTFLQYLRNHKPPLALARCSGAHVIEFLRYLDQFGKTKVHAPGCAFYGHPS  108

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC CPLRQAWGSLDALIGRLRAA+EE+GG PE+NPFA  A+R+YLR+VR++Q+KARG
Sbjct  109  PPGPCACPLRQAWGSLDALIGRLRAAYEESGGTPETNPFAARAVRIYLRDVRESQAKARG  168

Query  703  IPY  711
            IPY
Sbjct  169  IPY  171



>gb|AES98763.2| DUF640 family protein [Medicago truncatula]
Length=225

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L  C+  HV++FL+YLDQFGKTKVH+ GC YFGQP 
Sbjct  38   YESQKRRDWNTFQQYLRNHKPPLTLALCSGAHVIEFLKYLDQFGKTKVHVIGCPYFGQPN  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPL+QAWGSLDALIGRLRAAFEENGG PESNPF   A+R+YLREV+D Q+KARG
Sbjct  98   PPSPCACPLKQAWGSLDALIGRLRAAFEENGGKPESNPFGTRAVRIYLREVKDGQAKARG  157

Query  703  IPY  711
            +PY
Sbjct  158  VPY  160



>ref|XP_009385358.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=210

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L RC+  HV++FLRYLDQFGKTKVH  GC ++G   
Sbjct  38   YESQKRRDWNTFLQYLRNHKPPLALARCSGAHVIEFLRYLDQFGKTKVHAPGCAFYGHAS  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC CPLRQAWGSLDALIGRLRAA+EE+GG PE+NPFA  A+R+YLR+VR++Q+KARG
Sbjct  98   PPGPCACPLRQAWGSLDALIGRLRAAYEESGGTPETNPFAARAVRIYLRDVRESQAKARG  157

Query  703  IPY  711
            IPY
Sbjct  158  IPY  160



>ref|XP_006847407.1| hypothetical protein AMTR_s00153p00047660 [Amborella trichopoda]
 gb|ERN08988.1| hypothetical protein AMTR_s00153p00047660 [Amborella trichopoda]
Length=203

 Score =   202 bits (515),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVHL GC YFG P 
Sbjct  41   YESQKRRDWNTFLQYLKNHKPPLSLSRCSGAHVIEFLKYLDQFGKTKVHLVGCPYFGHPS  100

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPL+QAWGSLDALIGRLRAA+EENGG P++NPF   A+R+YLREVR++Q+KARG
Sbjct  101  PPNPCACPLKQAWGSLDALIGRLRAAYEENGGRPDANPFGARAVRIYLREVRESQAKARG  160

Query  703  IPY  711
            IPY
Sbjct  161  IPY  163



>emb|CDP09236.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L RC+  HV++FL+YLDQFGKTKVH+ GC YFG P 
Sbjct  41   YESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHVAGCPYFGHPN  100

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPL+QAWGSLDALIGRLRAA+EENGG PESNPF   A+R+YLREVR++Q+KARG
Sbjct  101  PPAPCQCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLREVRESQAKARG  160

Query  703  IPY  711
            IPY
Sbjct  161  IPY  163



>ref|XP_002973743.1| hypothetical protein SELMODRAFT_36560, partial [Selaginella moellendorffii]
 ref|XP_002975792.1| hypothetical protein SELMODRAFT_36559, partial [Selaginella moellendorffii]
 gb|EFJ23421.1| hypothetical protein SELMODRAFT_36559, partial [Selaginella moellendorffii]
 gb|EFJ25403.1| hypothetical protein SELMODRAFT_36560, partial [Selaginella moellendorffii]
Length=153

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YEAQKRRDWNTFGQYLKN RPP+ L RC+  HVL+FLRYLDQFGKTK+H   C +FG   
Sbjct  23   YEAQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGKTKIHAPACPFFGLAH  82

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPLRQAWGSLDALIGRLRAAFEE+GG PESNPF   A+RLYLREVR+ Q+KARG
Sbjct  83   PPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARAVRLYLREVREMQAKARG  142

Query  703  IPY  711
            I Y
Sbjct  143  IAY  145



>ref|XP_010922606.1| PREDICTED: protein G1-like7 [Elaeis guineensis]
Length=225

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L RC+  HV++FLRYLDQFGKTKVH  GC +FGQP 
Sbjct  41   YESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHNAGCTFFGQPN  100

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC CPL+QAWGSLDALIGRLRAA+EE+GG PE+NPFA  A+R+YLREVR++Q+KARG
Sbjct  101  PPGPCACPLKQAWGSLDALIGRLRAAYEESGGRPEANPFAARAVRIYLREVRESQAKARG  160

Query  703  IPY  711
            +PY
Sbjct  161  VPY  163



>ref|XP_010475462.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Camelina 
sativa]
Length=196

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVH+  C YFG  +
Sbjct  34   YESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQQ  93

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC+CPL+QAWGSLDALIGRLRAA+EENGG P+SNPFA  A+R+YLREVR++Q+KARG
Sbjct  94   PPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKARG  153

Query  703  IPY  711
            IPY
Sbjct  154  IPY  156



>ref|XP_006417846.1| hypothetical protein EUTSA_v10009726mg [Eutrema salsugineum]
 gb|ESQ36199.1| hypothetical protein EUTSA_v10009726mg [Eutrema salsugineum]
Length=200

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVH+  C YFG  +
Sbjct  36   YESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAVCPYFGHQQ  95

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPL+QAWGSLDALIGRLRAA+EENGG P+SNPFA  A+R+YLREVR++Q+KARG
Sbjct  96   PPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKARG  155

Query  703  IPYkkkkkkknnalpkpnnDETPSFQM  783
            IPY+KKK+K+   +     D  PS Q+
Sbjct  156  IPYEKKKRKRPPTVSTVRVDVAPSRQI  182



>ref|XP_003615805.1| hypothetical protein MTR_5g072510 [Medicago truncatula]
Length=257

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L  C+  HV++FL+YLDQFGKTKVH+ GC YFGQP 
Sbjct  38   YESQKRRDWNTFQQYLRNHKPPLTLALCSGAHVIEFLKYLDQFGKTKVHVIGCPYFGQPN  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPL+QAWGSLDALIGRLRAAFEENGG PESNPF   A+R+YLREV+D Q+KARG
Sbjct  98   PPSPCACPLKQAWGSLDALIGRLRAAFEENGGKPESNPFGTRAVRIYLREVKDGQAKARG  157

Query  703  IPY  711
            +PY
Sbjct  158  VPY  160



>ref|XP_010487116.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 [Camelina 
sativa]
Length=196

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVH+  C YFG  +
Sbjct  34   YESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQQ  93

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC+CPL+QAWGSLDALIGRLRAA+EENGG P+SNPFA  A+R+YLREVR++Q+KARG
Sbjct  94   PPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKARG  153

Query  703  IPY  711
            IPY
Sbjct  154  IPY  156



>ref|XP_002892379.1| hypothetical protein ARALYDRAFT_887918 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68638.1| hypothetical protein ARALYDRAFT_887918 [Arabidopsis lyrata subsp. 
lyrata]
Length=198

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVH+  C YFG  +
Sbjct  34   YESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQQ  93

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC+CPL+QAWGSLDALIGRLRAA+EENGG P+SNPFA  A+R+YLREVR++Q+KARG
Sbjct  94   PPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFATRAVRIYLREVRESQAKARG  153

Query  703  IPY  711
            IPY
Sbjct  154  IPY  156



>ref|NP_563780.1| protein LIGHT SENSITIVE HYPOCOTYLS 6 [Arabidopsis thaliana]
 sp|Q9LMK2.1|LSH6_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6; AltName: 
Full=Protein ORGAN BOUNDARY 6 [Arabidopsis thaliana]
 gb|AAF82211.1|AC067971_19 Strong similarity to an unknown protein At2g31160 gi|3746060 
from Arabidopsis thaliana BAC F7F1 gb|AC005311. EST gb|AI998165 
comes from this gene [Arabidopsis thaliana]
 gb|AAM63916.1| unknown [Arabidopsis thaliana]
 gb|AAO41893.1| unknown protein [Arabidopsis thaliana]
 gb|AAV84524.1| At1g07090 [Arabidopsis thaliana]
 gb|ABD42982.1| At1g07090 [Arabidopsis thaliana]
 gb|AEE28076.1| uncharacterized protein AT1G07090 [Arabidopsis thaliana]
Length=196

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVH+  C YFG  +
Sbjct  32   YESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQQ  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC+CPL+QAWGSLDALIGRLRAA+EENGG P+SNPFA  A+R+YLREVR++Q+KARG
Sbjct  92   PPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>ref|XP_003537309.1| PREDICTED: uncharacterized protein LOC100775798 [Glycine max]
Length=235

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N RPP+ L RC+  HV++FL+YLDQFGKTKVH+ GC YFG P 
Sbjct  49   YESQKRRDWNTFLQYLQNHRPPLTLARCSGAHVIEFLKYLDQFGKTKVHVTGCPYFGHPN  108

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PCTCPL+QAWGSLDALIGRLRAA+EENGG PESNPF   A+R  LREVR+ Q+KARG
Sbjct  109  PPAPCTCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRTCLREVREGQAKARG  168

Query  703  IPY  711
            IPY
Sbjct  169  IPY  171



>gb|EPS68444.1| hypothetical protein M569_06326 [Genlisea aurea]
Length=181

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+NQRPPV L +CN  HVL+F+RYLDQFGKTKVH++GC++FG+PE
Sbjct  32   YESQKRRDWNTFRQYLRNQRPPVSLGQCNGGHVLEFMRYLDQFGKTKVHVRGCVFFGRPE  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P   CTCP+RQAWGSLDAL+GRLRAA+E +GG  E NPFA +AIR YL+EVR+ Q+KARG
Sbjct  92   PDSACTCPVRQAWGSLDALVGRLRAAYEGSGGAQERNPFADAAIRRYLKEVRETQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>ref|XP_006303356.1| hypothetical protein CARUB_v10010340mg [Capsella rubella]
 gb|EOA36254.1| hypothetical protein CARUB_v10010340mg [Capsella rubella]
Length=198

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVH+  C YFG  +
Sbjct  35   YESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQQ  94

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC+CPL+QAWGSLDALIGRLRAA+EENGG P+SNPFA  A+R+YLREVR++Q+KARG
Sbjct  95   PPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRESQAKARG  154

Query  703  IPY  711
            IPY
Sbjct  155  IPY  157



>emb|CDY10247.1| BnaC05g04900D [Brassica napus]
Length=198

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVH+  C YFG  +
Sbjct  33   YESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVATCPYFGHQQ  92

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPL+QAWGSLDALIGRLRAA+EE+GG P+SNPFA  A+R+YLREVR++Q+KARG
Sbjct  93   PPSPCACPLKQAWGSLDALIGRLRAAYEEHGGRPDSNPFAARAVRIYLREVRESQAKARG  152

Query  703  IPYkkkkkkknnalpkpnnDETPSFQMQ  786
            IPY+KKK+K+   +     D  PS Q +
Sbjct  153  IPYEKKKRKRAPTVTTARIDVAPSRQSE  180



>ref|XP_010457872.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Camelina 
sativa]
Length=196

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVH+  C YFG  +
Sbjct  34   YESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGHQQ  93

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC+CPL+QAWGSLDALIGRLRAA+EENGG P+SNPFA  A+R+YLREVR+ Q+KARG
Sbjct  94   PPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVRETQAKARG  153

Query  703  IPY  711
            IPY
Sbjct  154  IPY  156



>ref|XP_010043398.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 isoform 
X3 [Eucalyptus grandis]
 gb|KCW85401.1| hypothetical protein EUGRSUZ_B02224 [Eucalyptus grandis]
Length=204

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L RC+   VL+FL+YLDQFGKTKVH+ GC +FG P 
Sbjct  51   YESQKRRDWNTFLQYLQNHKPPLTLARCSGAQVLEFLKYLDQFGKTKVHMNGCPFFGNPT  110

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC CPL+QAWGSLDALIGRLRAAFEENGG PE NPFA  A+R+YLREV++ Q+KARG
Sbjct  111  PPGPCACPLKQAWGSLDALIGRLRAAFEENGGRPELNPFAARAVRIYLREVKEGQAKARG  170

Query  703  IPY  711
            IPY
Sbjct  171  IPY  173



>emb|CDY06675.1| BnaA10g04540D [Brassica napus]
Length=198

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVH+  C YFG  +
Sbjct  33   YESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVATCPYFGHQQ  92

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPL+QAWGSLDALIGRLRAA+EE+GG P+SNPFA  A+R+YLREVR++Q+KARG
Sbjct  93   PPSPCACPLKQAWGSLDALIGRLRAAYEEHGGRPDSNPFAARAVRIYLREVRESQAKARG  152

Query  703  IPYkkkkkkknnalpkpnnDETPSFQMQ  786
            IPY+KKK+K+   +     D  PS Q +
Sbjct  153  IPYEKKKRKRAPTVTTARIDVAPSRQSE  180



>ref|XP_010043397.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 isoform 
X2 [Eucalyptus grandis]
 gb|KCW85400.1| hypothetical protein EUGRSUZ_B02224 [Eucalyptus grandis]
Length=225

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L RC+   VL+FL+YLDQFGKTKVH+ GC +FG P 
Sbjct  51   YESQKRRDWNTFLQYLQNHKPPLTLARCSGAQVLEFLKYLDQFGKTKVHMNGCPFFGNPT  110

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC CPL+QAWGSLDALIGRLRAAFEENGG PE NPFA  A+R+YLREV++ Q+KARG
Sbjct  111  PPGPCACPLKQAWGSLDALIGRLRAAFEENGGRPELNPFAARAVRIYLREVKEGQAKARG  170

Query  703  IPY  711
            IPY
Sbjct  171  IPY  173



>gb|EYU41125.1| hypothetical protein MIMGU_mgv1a021620mg [Erythranthe guttata]
Length=170

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQ+L+NQRP V LP CN +HVLDFLRYLDQFGKTKVHLQGC+++GQPE
Sbjct  24   YESQKRRDWNTFGQFLRNQRPSVGLPHCNSSHVLDFLRYLDQFGKTKVHLQGCVFYGQPE  83

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPL+QAWGSLDALIGRLRAA+EENGG PESNPFA  AIR+YLREV++ QSKARG
Sbjct  84   PPAPCACPLKQAWGSLDALIGRLRAAYEENGGSPESNPFASGAIRIYLREVKECQSKARG  143

Query  703  IPY  711
            IPY
Sbjct  144  IPY  146



>gb|EYU45980.1| hypothetical protein MIMGU_mgv1a021801mg [Erythranthe guttata]
Length=201

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L RC+  HV++FL+YLDQFGKTKVH+ GC YFGQP+
Sbjct  44   YESQKRRDWNTFQQYLRNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHVTGCPYFGQPD  103

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC C L+QAWGSLDALIGRLRAA+EENGG P++NPF   A+R+YLREVR++Q+KARG
Sbjct  104  PPAPCACQLKQAWGSLDALIGRLRAAYEENGGRPDTNPFGAKAVRIYLREVRESQAKARG  163

Query  703  IPY  711
            IPY
Sbjct  164  IPY  166



>ref|XP_010906823.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Elaeis 
guineensis]
Length=218

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L RC+  HV++FLRYLDQFGKTKVH  GC +FG P 
Sbjct  37   YESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHNAGCAFFGHPN  96

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC CPL+QAWGSLDALIGRLRAA+EE+GG PE+NPFA  A+R+YLREVR++Q+KARG
Sbjct  97   PPGPCACPLKQAWGSLDALIGRLRAAYEESGGRPEANPFAARAVRIYLREVRESQAKARG  156

Query  703  IPY  711
            IPY
Sbjct  157  IPY  159



>ref|XP_004504297.1| PREDICTED: uncharacterized protein LOC101498424 [Cicer arietinum]
Length=185

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLK Q PPVPL  CN+NHVLDFLRYLDQFGKTKVHL  C++FGQP 
Sbjct  30   YESQKRRDWNTFGQYLKTQNPPVPLSNCNFNHVLDFLRYLDQFGKTKVHLHTCIFFGQPT  89

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPL+QAWGSLDALIGRLRAA+EE+GG PE+NPF G  IR+YLREV+D+Q KARG
Sbjct  90   PPAPCACPLKQAWGSLDALIGRLRAAYEEHGGSPETNPFGGGPIRVYLREVKDSQQKARG  149

Query  703  IPY  711
            IPY
Sbjct  150  IPY  152



>ref|XP_006443825.1| hypothetical protein CICLE_v10022295mg [Citrus clementina]
 ref|XP_006479528.1| PREDICTED: uncharacterized protein LOC102612277 [Citrus sinensis]
 gb|ESR57065.1| hypothetical protein CICLE_v10022295mg [Citrus clementina]
Length=204

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE QKRRDWNTFGQYLKN RPP+ L RC+  HVL+FLRYLDQFGKTKVH   C ++G   
Sbjct  53   YENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHQN  112

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPLRQAWGSLDALIGRLRAAFEENGG PE+NPF   A+RLYLREVRD QSKARG
Sbjct  113  PPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDVQSKARG  172

Query  703  IPY  711
            I Y
Sbjct  173  ISY  175



>ref|XP_010439831.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Camelina 
sativa]
Length=191

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLK+Q PP+ + + +Y HVL FLRYLDQFGKTKVH Q C++FGQP+
Sbjct  38   YESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQPD  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGLPESNPFAGSAIRLYLREVRDAQSKAR  699
            P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GG P++NPFA  +IR++LREVR++Q+KAR
Sbjct  98   PPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKAR  157

Query  700  GIPY  711
            GIPY
Sbjct  158  GIPY  161



>ref|XP_006286146.1| hypothetical protein CARUB_v10007704mg [Capsella rubella]
 gb|EOA19044.1| hypothetical protein CARUB_v10007704mg [Capsella rubella]
Length=191

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLK+Q PP+ + + +Y HVL FLRYLDQFGKTKVH Q C++FGQP+
Sbjct  38   YESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHQQACVFFGQPD  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGLPESNPFAGSAIRLYLREVRDAQSKAR  699
            P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GG P++NPFA  +IR++LREVR++Q+KAR
Sbjct  98   PPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKAR  157

Query  700  GIPY  711
            GIPY
Sbjct  158  GIPY  161



>ref|XP_010685918.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 [Beta vulgaris 
subsp. vulgaris]
Length=258

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L RC+  HV++FL+YLDQFGKTKVH+ GC YFG P 
Sbjct  78   YESQKRRDWNTFLQYLRNHKPPLSLSRCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHPN  137

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPL+QAWGSLDALIGRLRAA+EENGG PESNPF   A+R+YLREVR++Q+KARG
Sbjct  138  PPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLREVRESQAKARG  197

Query  703  IPY  711
            IPY
Sbjct  198  IPY  200



>gb|KHN45745.1| hypothetical protein glysoja_043995 [Glycine soja]
Length=178

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQRPPVPL +CN NHVLDFLRYLDQFGKTKVHLQGCM++GQPE
Sbjct  33   YESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPE  92

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPLRQAWGSLDALIGRLRAA+EENGG PE+NPFA  +IR+YLREVR+ Q+KAR 
Sbjct  93   PPAPCACPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAKARA  152

Query  703  IPY  711
            + +
Sbjct  153  LAF  155



>ref|XP_009398867.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
Length=206

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYL+N RPP+ L +C+ +HVL+FLRYLDQFGKTK+H   C +FG   
Sbjct  44   YESQKRRDWNTFGQYLRNHRPPLSLSQCSSSHVLEFLRYLDQFGKTKIHTHLCPFFGNSN  103

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPLRQAWGSLDALIGRLRAA+EENGG PESNPF   AIRLYLREVR+ QSKARG
Sbjct  104  PPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPESNPFGARAIRLYLREVREVQSKARG  163

Query  703  IPY  711
            I Y
Sbjct  164  ISY  166



>ref|XP_003629770.1| 177 protein [Medicago truncatula]
 gb|AET04246.1| DUF640 family protein [Medicago truncatula]
Length=185

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLK+Q P VPL  CN+NHVLDFLRYLDQFGKTKVH QGC++FGQP 
Sbjct  32   YESQKRRDWNTFNQYLKSQNPLVPLSHCNFNHVLDFLRYLDQFGKTKVHFQGCIFFGQPT  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPL+QAWGSLDALIGRLRAA+EENGG  E+NPFAG AIR+YLREV+D+Q KARG
Sbjct  92   PPAPCACPLKQAWGSLDALIGRLRAAYEENGGSSETNPFAGGAIRVYLREVKDSQQKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>emb|CDX78877.1| BnaA01g09440D [Brassica napus]
Length=196

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLK+Q PP+ + + +Y HVL FLRYLDQFGKTKVH Q C++FGQP+
Sbjct  41   YESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQPD  100

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGLPESNPFAGSAIRLYLREVRDAQSKAR  699
            P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GG P++NPFA  +IR++LREVR++Q+KAR
Sbjct  101  PPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKAR  160

Query  700  GIPY  711
            GIPY
Sbjct  161  GIPY  164



>ref|NP_193596.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SN52.1|LSH9_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9; AltName: 
Full=Protein ORGAN BOUNDARY 9 [Arabidopsis thaliana]
 emb|CAB37446.1| putative protein [Arabidopsis thaliana]
 emb|CAB78863.1| putative protein [Arabidopsis thaliana]
 gb|AAR24223.1| At4g18610 [Arabidopsis thaliana]
 gb|AAT35235.1| At4g18610 [Arabidopsis thaliana]
 gb|AEE84068.1| uncharacterized protein AT4G18610 [Arabidopsis thaliana]
Length=191

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLK+Q PP+ + + +Y HVL FLRYLDQFGKTKVH Q C++FGQP+
Sbjct  38   YESQKRRDWNTFVQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQPD  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGLPESNPFAGSAIRLYLREVRDAQSKAR  699
            P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GG P++NPFA  +IR++LREVR++Q+KAR
Sbjct  98   PPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKAR  157

Query  700  GIPY  711
            GIPY
Sbjct  158  GIPY  161



>dbj|BAI52974.1| G1-like protein [Selaginella moellendorffii]
Length=225

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YEAQKRRDWNTFGQYLKN RPP+ L RC+  HVL+FLRYLDQFGKTK+H   C +FG   
Sbjct  38   YEAQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGKTKIHAPACPFFGLAH  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPLRQAWGSLDALIGRLRAAFEE+GG PESNPF   A+RLYLREVR+ Q+KARG
Sbjct  98   PPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARAVRLYLREVREMQAKARG  157

Query  703  IPY  711
            I Y
Sbjct  158  IAY  160



>ref|XP_009108375.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Brassica 
rapa]
 ref|XP_009108376.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Brassica 
rapa]
Length=193

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLK+Q PP+ + + +Y HVL FLRYLDQFGKTKVH Q C++FGQP+
Sbjct  40   YESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQPD  99

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGLPESNPFAGSAIRLYLREVRDAQSKAR  699
            P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GG P++NPFA  +IR++LREVR++Q+KAR
Sbjct  100  PPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKAR  159

Query  700  GIPY  711
            GIPY
Sbjct  160  GIPY  163



>gb|KEH41129.1| G1-like protein [Medicago truncatula]
Length=214

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE QKRRDWNTFGQYL+N RPP+ L RC+  HVL+FLRYLDQFGKTKVH   C ++G P 
Sbjct  66   YENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTLICPFYGHPN  125

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P   C CPLRQAWGSLDALIGRLRAAFEENGG PE+NPF   A+RLYLREVRD+Q+KARG
Sbjct  126  PPASCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDSQAKARG  185

Query  703  IPY  711
            I Y
Sbjct  186  ISY  188



>ref|XP_010434509.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Camelina 
sativa]
Length=191

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLK+Q PP+ + + +Y HVL FLRYLDQFGKTKVH Q C++FGQP+
Sbjct  38   YESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQPD  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGLPESNPFAGSAIRLYLREVRDAQSKAR  699
            P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GG P++NPFA  +IR++LREVR++Q+KAR
Sbjct  98   PPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKAR  157

Query  700  GIPY  711
            GIPY
Sbjct  158  GIPY  161



>ref|XP_007159450.1| hypothetical protein PHAVU_002G238600g [Phaseolus vulgaris]
 gb|ESW31444.1| hypothetical protein PHAVU_002G238600g [Phaseolus vulgaris]
Length=179

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKNQ PPV L +CN+NHVLDFLRYLDQFGKTKVHL GC++FGQP 
Sbjct  32   YESQKRRDWNTFGQYLKNQSPPVALSQCNFNHVLDFLRYLDQFGKTKVHLHGCIFFGQPT  91

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPLRQAWGSLDALIGRLRAA+EE+GG PE+NPF G +IR+YLREV++ Q+KARG
Sbjct  92   PPAPCACPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGGGSIRVYLREVKECQAKARG  151

Query  703  IPY  711
            IPY
Sbjct  152  IPY  154



>emb|CDY67351.1| BnaCnng54640D [Brassica napus]
Length=193

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLK+Q PP+ + + +Y HVL FLRYLDQFGKTKVH Q C++FGQP+
Sbjct  38   YESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQPD  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGLPESNPFAGSAIRLYLREVRDAQSKAR  699
            P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GG P++NPFA  +IR++LREVR++Q+KAR
Sbjct  98   PPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKAR  157

Query  700  GIPY  711
            GIPY
Sbjct  158  GIPY  161



>emb|CDY01557.1| BnaC07g35470D [Brassica napus]
Length=191

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 111/124 (90%), Gaps = 1/124 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLK+Q PP+ +P+ +Y HVL FLRYLDQFGKTKVH Q C++FGQP+
Sbjct  41   YESQKRRDWNTFIQYLKSQNPPLLMPQFDYTHVLCFLRYLDQFGKTKVHQQACVFFGQPD  100

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGLPESNPFAGSAIRLYLREVRDAQSKAR  699
            P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GG P++NPFA  +IR++LREVR++Q+KAR
Sbjct  101  PPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKAR  160

Query  700  GIPY  711
            GIPY
Sbjct  161  GIPY  164



>emb|CDX76510.1| BnaA08g08900D [Brassica napus]
Length=193

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLK+Q PP+ + + +Y HVL FLRYLDQFGKTKVH Q C++FGQP+
Sbjct  40   YESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQPD  99

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGLPESNPFAGSAIRLYLREVRDAQSKAR  699
            P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GG P++NPFA  +IR++LREVR++Q+KAR
Sbjct  100  PPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKAR  159

Query  700  GIPY  711
            GIPY
Sbjct  160  GIPY  163



>ref|XP_010449492.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Camelina 
sativa]
Length=192

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLK+Q PP+ + + +Y HVL FLRYLDQFGKTKVH Q C++FGQP+
Sbjct  38   YESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQPD  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGLPESNPFAGSAIRLYLREVRDAQSKAR  699
            P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GG P++NPFA  +IR++LREVR++Q+KAR
Sbjct  98   PPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKAR  157

Query  700  GIPY  711
            GIPY
Sbjct  158  GIPY  161



>ref|XP_002870033.1| hypothetical protein ARALYDRAFT_914818 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46292.1| hypothetical protein ARALYDRAFT_914818 [Arabidopsis lyrata subsp. 
lyrata]
Length=191

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLK+Q PP+ + + +Y HVL FLRYLDQFGKTKVH Q C++FGQP+
Sbjct  38   YESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQPD  97

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEEN-GGLPESNPFAGSAIRLYLREVRDAQSKAR  699
            P GPCTCPL+QAWGSLDALIGRLRAA+EE+ GG P++NPFA  +IR++LREVR++Q+KAR
Sbjct  98   PPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDANPFANGSIRVHLREVRESQAKAR  157

Query  700  GIPY  711
            GIPY
Sbjct  158  GIPY  161



>ref|XP_003638136.1| hypothetical protein MTR_119s0026 [Medicago truncatula]
Length=420

 Score =   207 bits (526),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTFGQYLKN RPP+ L RC+  HVL+FLRYLDQFGKTKVH + C YFG   
Sbjct  47   YESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHSENCAYFGNSH  106

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P GPC CPL+QAWGSLDALIGRLRAAFEENGG  E NPF   A+RLYLREVRDAQ+KARG
Sbjct  107  PPGPCPCPLKQAWGSLDALIGRLRAAFEENGGSQEMNPFGARAVRLYLREVRDAQAKARG  166

Query  703  IPY  711
            I Y
Sbjct  167  IGY  169



>ref|XP_006401075.1| hypothetical protein EUTSA_v10014789mg [Eutrema salsugineum]
 gb|ESQ42528.1| hypothetical protein EUTSA_v10014789mg [Eutrema salsugineum]
Length=183

 Score =   199 bits (506),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYLKN +PP+ L RC+  HV++FL+YLDQFGKTKVH+  C +FG+P 
Sbjct  20   YESQKRRDWNTFLQYLKNHKPPLSLSRCSGAHVIEFLKYLDQFGKTKVHVVACPFFGEPN  79

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEE-NGGLPESNPFAGSAIRLYLREVRDAQSKAR  699
            P   CTCPL+QAWGSLDALIGRLRAAFEE  GGLPESNPFA  A+R+YL+EVR++Q+KAR
Sbjct  80   PPAQCTCPLKQAWGSLDALIGRLRAAFEEIGGGLPESNPFAAKAVRIYLKEVRESQAKAR  139

Query  700  GIPY  711
            GIPY
Sbjct  140  GIPY  143



>ref|XP_002961823.1| hypothetical protein SELMODRAFT_68566, partial [Selaginella moellendorffii]
 ref|XP_002980828.1| hypothetical protein SELMODRAFT_58613, partial [Selaginella moellendorffii]
 gb|EFJ18013.1| hypothetical protein SELMODRAFT_58613, partial [Selaginella moellendorffii]
 gb|EFJ37083.1| hypothetical protein SELMODRAFT_68566, partial [Selaginella moellendorffii]
Length=173

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YEAQKRRDWNTFGQYL+N RPP+ LPRC+  +VL+FLRYLDQFGKTK+H   C +FG   
Sbjct  29   YEAQKRRDWNTFGQYLRNHRPPLTLPRCSGANVLEFLRYLDQFGKTKIHAPACPFFGIAH  88

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P  PC CPLRQAWGSLDALIGRLRAAFEE+GG PESNPF   A+RLYLREVR+ Q+KARG
Sbjct  89   PPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARAVRLYLREVREMQAKARG  148

Query  703  IPY  711
            I Y
Sbjct  149  IAY  151



>gb|EPS74620.1| hypothetical protein M569_00139, partial [Genlisea aurea]
Length=171

 Score =   199 bits (505),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  343  YEAQKRRDWNTFGQYLKNQRPPVPLPRCNYNHVLDFLRYLDQFGKTKVHLQGCMYFGQPE  522
            YE+QKRRDWNTF QYL+N +PP+ L RC+  HV++FL+YLDQFGKTKVH+ GC YFG+P 
Sbjct  31   YESQKRRDWNTFQQYLRNHKPPLTLGRCSGAHVIEFLKYLDQFGKTKVHVAGCPYFGEPN  90

Query  523  PAGPCTCPLRQAWGSLDALIGRLRAAFEENGGLPESNPFAGSAIRLYLREVRDAQSKARG  702
            P   C CPL+QAWGSLDALIGRLRAA+EENGG  ESNPF   A+R+YLREVR++Q+KARG
Sbjct  91   PPASCACPLKQAWGSLDALIGRLRAAYEENGGRQESNPFGAKAVRIYLREVRESQAKARG  150

Query  703  IPY  711
            +PY
Sbjct  151  VPY  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3252526653460