BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23665_g6_i1 len=1038 path=[8341:0-88 19112:89-165 12396:166-180
7548:181-186 12416:187-198 19864:199-210 19887:211-212 7573:213-252
7613:253-267 19934:268-276 19943:277-278 725:279-312 759:313-770
1217:771-1037]

Length=1038
                                                                      Score     E

emb|CDO96796.1|  unnamed protein product                                271   8e-87   
ref|XP_009773140.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    270   5e-86   
ref|XP_009608555.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    268   1e-85   
ref|XP_006362411.1|  PREDICTED: uncharacterized protein LOC102591189    268   1e-85   
ref|XP_010052190.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    266   4e-85   
ref|XP_010279129.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    266   7e-85   
ref|XP_004233074.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    266   7e-85   
ref|XP_011085992.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    266   7e-85   
ref|XP_010655519.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    265   1e-84   
emb|CAN72178.1|  hypothetical protein VITISV_012478                     265   2e-84   Vitis vinifera
ref|XP_008358651.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    265   3e-84   
ref|XP_002522583.1|  conserved hypothetical protein                     264   4e-84   Ricinus communis
ref|XP_008225289.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    264   8e-84   
ref|XP_007025375.1|  Beta-lactamase-like protein ENSP00000383859        263   8e-84   
ref|XP_011008476.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    263   1e-83   
ref|XP_002305745.1|  hypothetical protein POPTR_0004s05610g             263   1e-83   Populus trichocarpa [western balsam poplar]
ref|XP_008371461.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    263   2e-83   
ref|XP_007212120.1|  hypothetical protein PRUPE_ppa012018mg             262   3e-83   
ref|XP_004151474.1|  PREDICTED: uncharacterized protein LOC101210225    261   1e-82   
ref|XP_004485894.1|  PREDICTED: uncharacterized protein LOC101502781    260   2e-82   
ref|XP_008465553.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    260   2e-82   
ref|XP_006467647.1|  PREDICTED: uncharacterized protein LOC102611919    261   2e-82   
gb|KGN65636.1|  hypothetical protein Csa_1G474480                       260   2e-82   
ref|XP_010109876.1|  hypothetical protein L484_003806                   260   2e-82   
ref|XP_011011486.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    259   3e-82   
ref|XP_010277024.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    259   4e-82   
ref|XP_002317421.1|  hypothetical protein POPTR_0011s07350g             258   6e-82   Populus trichocarpa [western balsam poplar]
ref|XP_006449503.1|  hypothetical protein CICLE_v10016772mg             259   9e-82   
ref|XP_009786006.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    257   2e-81   
gb|KDP21096.1|  hypothetical protein JCGZ_21567                         257   3e-81   
ref|XP_004174117.1|  PREDICTED: uncharacterized protein LOC101228453    257   4e-81   
gb|AFK49191.1|  unknown                                                 256   6e-81   
ref|XP_010052695.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    256   8e-81   
ref|XP_006348870.1|  PREDICTED: uncharacterized protein LOC102600485    255   9e-81   
ref|XP_011101384.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    255   1e-80   
ref|XP_009593391.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    254   2e-80   
ref|XP_009133547.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    254   3e-80   
ref|XP_002280666.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    254   4e-80   Vitis vinifera
ref|XP_003542999.1|  PREDICTED: uncharacterized protein LOC100778886    254   6e-80   
ref|XP_007021735.1|  Uncharacterized protein TCM_031777                 254   6e-80   
ref|XP_007148048.1|  hypothetical protein PHAVU_006G176100g             253   7e-80   
ref|XP_008342774.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    253   8e-80   
emb|CAN66524.1|  hypothetical protein VITISV_034969                     253   8e-80   Vitis vinifera
ref|XP_007048693.1|  Pleckstrin domain-containing family N member 1     254   1e-79   
gb|AES67378.2|  DUF640 family protein                                   252   1e-79   
ref|XP_003597127.1|  177 protein                                        253   1e-79   
ref|XP_010508549.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    252   2e-79   
ref|XP_006296565.1|  hypothetical protein CARUB_v100241591mg            252   2e-79   
ref|XP_010506094.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    252   2e-79   
ref|XP_003540402.1|  PREDICTED: uncharacterized protein LOC100802...    252   2e-79   
ref|XP_008368001.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    252   2e-79   
ref|XP_009334040.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    252   2e-79   
gb|KHN36698.1|  hypothetical protein glysoja_001429                     252   2e-79   
ref|NP_001237249.1|  uncharacterized protein LOC100306082               252   3e-79   
ref|XP_002879996.1|  hypothetical protein ARALYDRAFT_903634             251   3e-79   
ref|XP_006370148.1|  hypothetical protein POPTR_0001s40140g             251   3e-79   
gb|KDP35079.1|  hypothetical protein JCGZ_11031                         251   4e-79   
ref|XP_011013261.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    251   4e-79   
gb|ACJ85482.1|  unknown                                                 250   7e-79   Medicago truncatula
emb|CDY55387.1|  BnaA05g34250D                                          250   9e-79   
ref|NP_001235660.1|  uncharacterized protein LOC100306225               250   1e-78   
ref|XP_011015901.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    250   1e-78   
ref|NP_565978.1|  uncharacterized protein                               250   1e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004487154.1|  PREDICTED: uncharacterized protein LOC101499419    249   2e-78   
ref|XP_004293946.1|  PREDICTED: uncharacterized protein LOC101295...    250   2e-78   
ref|XP_010104392.1|  hypothetical protein L484_010344                   249   2e-78   
ref|XP_006411528.1|  hypothetical protein EUTSA_v10017308mg             249   2e-78   
gb|KHG07235.1|  Putative beta-lactamase-like 1                          249   2e-78   
ref|XP_007132855.1|  hypothetical protein PHAVU_011G130300g             249   2e-78   
ref|XP_006442502.1|  hypothetical protein CICLE_v10022456mg             249   3e-78   
emb|CDP15936.1|  unnamed protein product                                249   3e-78   
ref|XP_006446791.1|  hypothetical protein CICLE_v10016699mg             250   3e-78   
ref|XP_010525031.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    249   3e-78   
ref|XP_009142076.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    249   4e-78   
ref|XP_002530382.1|  conserved hypothetical protein                     249   4e-78   Ricinus communis
ref|XP_004243287.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    248   5e-78   
ref|XP_009142855.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    248   5e-78   
ref|XP_006469013.1|  PREDICTED: uncharacterized protein LOC102606613    248   5e-78   
ref|XP_007215057.1|  hypothetical protein PRUPE_ppa012217mg             248   1e-77   
ref|XP_007149738.1|  hypothetical protein PHAVU_005G095100g             247   1e-77   
ref|XP_003526225.1|  PREDICTED: uncharacterized protein LOC100815968    247   3e-77   
ref|XP_010108230.1|  hypothetical protein L484_018651                   247   3e-77   
ref|XP_002521586.1|  conserved hypothetical protein                     246   3e-77   Ricinus communis
ref|XP_002317458.1|  hypothetical protein POPTR_0011s11120g             246   4e-77   Populus trichocarpa [western balsam poplar]
emb|CDY14848.1|  BnaC04g48450D                                          246   5e-77   
ref|XP_009343797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    246   6e-77   
ref|XP_008381217.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    246   6e-77   
ref|XP_007212123.1|  hypothetical protein PRUPE_ppa012057mg             246   9e-77   
ref|XP_008226537.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    246   9e-77   
ref|XP_010327093.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    245   1e-76   
ref|XP_010524062.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    245   1e-76   
ref|XP_009626514.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    245   1e-76   
ref|XP_002285447.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    246   1e-76   Vitis vinifera
ref|XP_008448236.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    245   3e-76   
ref|XP_009339946.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    244   3e-76   
gb|AFK41138.1|  unknown                                                 243   4e-76   
ref|XP_011083008.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    243   6e-76   
gb|KDP34762.1|  hypothetical protein JCGZ_10542                         243   8e-76   
ref|XP_004294145.1|  PREDICTED: uncharacterized protein LOC101307097    243   1e-75   
ref|XP_002320411.1|  hypothetical protein POPTR_0014s13900g             242   2e-75   Populus trichocarpa [western balsam poplar]
ref|XP_010062813.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    242   2e-75   
ref|XP_004136831.1|  PREDICTED: uncharacterized protein LOC101208687    243   2e-75   
ref|XP_011033736.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    241   2e-75   
ref|XP_008455303.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    242   2e-75   
emb|CAN63025.1|  hypothetical protein VITISV_034817                     241   3e-75   Vitis vinifera
ref|XP_010035859.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    241   3e-75   
ref|XP_004303183.1|  PREDICTED: uncharacterized protein LOC101307414    242   4e-75   
gb|KHG29970.1|  Putative beta-lactamase-like 1                          240   6e-75   
ref|XP_003607586.1|  177 protein                                        241   6e-75   
ref|XP_003596364.1|  177 protein                                        241   6e-75   
ref|XP_006360044.1|  PREDICTED: uncharacterized protein LOC102584680    241   9e-75   
ref|XP_004489028.1|  PREDICTED: uncharacterized protein LOC101497242    240   1e-74   
gb|AFK47598.1|  unknown                                                 239   2e-74   
ref|XP_009622401.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    240   2e-74   
ref|XP_004248241.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    240   3e-74   
ref|XP_009790219.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    238   4e-74   
ref|XP_009790882.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    238   4e-74   
ref|XP_007149389.1|  hypothetical protein PHAVU_005G066200g             239   4e-74   
gb|AFK34719.1|  unknown                                                 238   5e-74   
gb|KHG25854.1|  Major vault                                             238   6e-74   
ref|XP_006592933.1|  PREDICTED: uncharacterized protein LOC100806...    238   1e-73   
ref|XP_010553628.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    237   1e-73   
ref|XP_006358940.1|  PREDICTED: uncharacterized protein LOC102602985    238   1e-73   
gb|EYU43335.1|  hypothetical protein MIMGU_mgv1a022623mg                237   1e-73   
ref|XP_011082761.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    237   2e-73   
ref|XP_002301561.2|  hypothetical protein POPTR_0002s22690g             236   2e-73   Populus trichocarpa [western balsam poplar]
gb|KGN47252.1|  hypothetical protein Csa_6G236080                       237   3e-73   
ref|XP_004150559.1|  PREDICTED: uncharacterized protein LOC101216601    238   3e-73   
ref|XP_004171262.1|  PREDICTED: uncharacterized LOC101216601            237   3e-73   
ref|NP_001237763.1|  uncharacterized protein LOC100527554               237   3e-73   
ref|XP_009770169.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    237   5e-73   
gb|EPS69070.1|  hypothetical protein M569_05697                         234   7e-73   
gb|KCW67509.1|  hypothetical protein EUGRSUZ_F01238                     236   7e-73   
ref|XP_010314085.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    235   8e-73   
ref|XP_011008166.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    234   1e-72   
gb|KHN36883.1|  hypothetical protein glysoja_001614                     235   1e-72   
ref|XP_011098044.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    233   2e-72   
gb|EYU28084.1|  hypothetical protein MIMGU_mgv1a022457mg                234   2e-72   
ref|XP_004516078.1|  PREDICTED: uncharacterized protein LOC101514778    234   2e-72   
ref|XP_006442831.1|  hypothetical protein CICLE_v10023710mg             239   3e-72   
emb|CDP06011.1|  unnamed protein product                                234   4e-72   
ref|XP_007133232.1|  hypothetical protein PHAVU_011G162700g             233   5e-72   
gb|AFK41155.1|  unknown                                                 231   6e-71   
ref|XP_010531928.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    230   7e-71   
ref|XP_009784769.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    231   8e-71   
ref|XP_006478612.1|  PREDICTED: probable disease resistance prote...    251   8e-71   
gb|EYU30777.1|  hypothetical protein MIMGU_mgv1a014751mg                229   2e-70   
ref|XP_004505495.1|  PREDICTED: uncharacterized protein LOC101509969    229   2e-70   
gb|EPS59921.1|  hypothetical protein M569_14884                         228   2e-70   
ref|XP_010540518.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    229   2e-70   
ref|XP_008463732.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    229   5e-70   
ref|XP_004146094.1|  PREDICTED: uncharacterized protein LOC101204141    229   5e-70   
gb|KGN55073.1|  hypothetical protein Csa_4G627230                       229   6e-70   
ref|XP_004171006.1|  PREDICTED: uncharacterized LOC101204141            228   6e-70   
gb|KDO64048.1|  hypothetical protein CISIN_1g0003541mg                  239   1e-69   
ref|XP_009774704.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    227   2e-69   
ref|XP_010324393.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    227   2e-69   
gb|EYU45022.1|  hypothetical protein MIMGU_mgv1a014215mg                226   6e-69   
ref|XP_007159450.1|  hypothetical protein PHAVU_002G238600g             225   6e-69   
ref|XP_004134659.1|  PREDICTED: uncharacterized protein LOC101214534    226   1e-68   
ref|XP_003539992.1|  PREDICTED: uncharacterized protein LOC100806134    224   1e-68   
ref|XP_008465528.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    225   2e-68   
ref|XP_003531069.1|  PREDICTED: uncharacterized protein LOC100798406    226   4e-68   
ref|XP_009587002.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    223   4e-68   
ref|XP_010529198.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   4e-68   
ref|XP_002973743.1|  hypothetical protein SELMODRAFT_36560              222   6e-68   
ref|XP_003531259.1|  PREDICTED: uncharacterized protein LOC100810655    222   8e-68   
ref|XP_006348309.1|  PREDICTED: uncharacterized protein LOC102581082    223   9e-68   
ref|XP_010549405.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    222   1e-67   
emb|CDX85083.1|  BnaC07g08230D                                          222   2e-67   
ref|XP_009108375.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    222   2e-67   
ref|XP_009102637.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    222   2e-67   
ref|XP_011098405.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    221   2e-67   
emb|CDX76510.1|  BnaA08g08900D                                          221   3e-67   
gb|EYU41125.1|  hypothetical protein MIMGU_mgv1a021620mg                220   4e-67   
emb|CDY34056.1|  BnaC03g62760D                                          221   5e-67   
dbj|BAI52974.1|  G1-like protein                                        222   5e-67   Selaginella moellendorffii
ref|XP_003537309.1|  PREDICTED: uncharacterized protein LOC100775798    222   8e-67   
ref|XP_008802142.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    220   9e-67   
emb|CDY69731.1|  BnaCnng65050D                                          220   1e-66   
ref|XP_010906808.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    220   1e-66   
ref|XP_003524092.1|  PREDICTED: uncharacterized protein LOC100775838    221   2e-66   
emb|CDY67351.1|  BnaCnng54640D                                          219   2e-66   
gb|KEH31304.1|  G1-like protein                                         221   2e-66   
ref|XP_002313971.1|  hypothetical protein POPTR_0009s07990g             220   3e-66   Populus trichocarpa [western balsam poplar]
gb|KFK42237.1|  hypothetical protein AALP_AA2G229400                    219   3e-66   
gb|EPS68444.1|  hypothetical protein M569_06326                         218   5e-66   
ref|XP_008649559.1|  PREDICTED: protein G1-like7                        222   5e-66   
ref|XP_010538562.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    218   6e-66   
ref|XP_011003514.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   6e-66   
ref|XP_004504735.1|  PREDICTED: uncharacterized protein LOC101506113    219   6e-66   
gb|KFK28531.1|  hypothetical protein AALP_AA7G008800                    218   6e-66   
emb|CDP09236.1|  unnamed protein product                                219   8e-66   
ref|NP_001143976.1|  uncharacterized protein LOC100276793               221   1e-65   Zea mays [maize]
ref|XP_009411199.1|  PREDICTED: protein G1-like7                        218   1e-65   
emb|CDX88480.1|  BnaC06g39240D                                          217   1e-65   
ref|XP_007016962.1|  Zinc finger protein ZFPM1                          219   1e-65   
ref|XP_006286146.1|  hypothetical protein CARUB_v10007704mg             217   2e-65   
ref|XP_009106595.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    216   2e-65   
ref|XP_010439831.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    216   2e-65   
ref|XP_009385358.1|  PREDICTED: protein G1-like7                        217   2e-65   
ref|XP_009383380.1|  PREDICTED: protein G1-like7                        216   3e-65   
ref|XP_006847407.1|  hypothetical protein AMTR_s00153p00047660          216   3e-65   
gb|KHN45745.1|  hypothetical protein glysoja_043995                     216   3e-65   
ref|XP_010434509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    216   4e-65   
gb|AES98763.2|  DUF640 family protein                                   217   4e-65   
ref|XP_002298496.1|  hypothetical protein POPTR_0001s28780g             217   5e-65   Populus trichocarpa [western balsam poplar]
ref|XP_004504297.1|  PREDICTED: uncharacterized protein LOC101498424    215   5e-65   
ref|XP_007159026.1|  hypothetical protein PHAVU_002G202200g             217   6e-65   
ref|NP_193596.1|  uncharacterized protein                               215   6e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008355077.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    216   7e-65   
ref|XP_010449492.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    215   7e-65   
ref|XP_003615805.1|  hypothetical protein MTR_5g072510                  217   9e-65   
ref|XP_009108056.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    215   1e-64   
ref|XP_002870033.1|  hypothetical protein ARALYDRAFT_914818             215   1e-64   
gb|KHG10505.1|  Error-prone DNA polymerase                              216   1e-64   
ref|XP_009398867.1|  PREDICTED: protein G1-like4                        215   1e-64   
gb|AAM64330.1|  unknown                                                 214   1e-64   Arabidopsis thaliana [mouse-ear cress]
emb|CDX78877.1|  BnaA01g09440D                                          214   2e-64   
ref|XP_010685918.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    216   2e-64   
ref|XP_006414079.1|  hypothetical protein EUTSA_v10027091mg             214   2e-64   
gb|EYU45980.1|  hypothetical protein MIMGU_mgv1a021801mg                214   2e-64   
ref|XP_010518804.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   3e-64   
ref|NP_565190.1|  protein LIGHT SENSITIVE HYPOCOTYLS 7                  214   3e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389954.1|  hypothetical protein EUTSA_v10019792mg             213   3e-64   
ref|XP_003638136.1|  hypothetical protein MTR_119s0026                  221   3e-64   
ref|XP_010043398.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   3e-64   
ref|XP_002889213.1|  At1g78815                                          213   4e-64   
ref|XP_003629770.1|  177 protein                                        213   4e-64   
ref|XP_010043397.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   4e-64   
gb|ABF83646.1|  At1g78815                                               213   4e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429720.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    213   6e-64   
ref|XP_010417489.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    213   6e-64   
ref|XP_009615590.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    213   9e-64   
gb|EPS74620.1|  hypothetical protein M569_00139                         211   1e-63   
emb|CDY26881.1|  BnaA02g19060D                                          212   1e-63   
ref|XP_006398272.1|  hypothetical protein EUTSA_v10001044mg             211   2e-63   
ref|XP_006282119.1|  hypothetical protein CARUB_v10028368mg             211   2e-63   
ref|XP_006443825.1|  hypothetical protein CICLE_v10022295mg             212   2e-63   
ref|XP_008804907.1|  PREDICTED: protein G1-like7                        213   2e-63   
emb|CDY14588.1|  BnaC02g25250D                                          211   2e-63   
ref|XP_010043396.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   2e-63   
ref|XP_009419635.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    212   3e-63   
ref|XP_009391700.1|  PREDICTED: protein G1-like7                        213   4e-63   
ref|XP_009354180.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    212   5e-63   
ref|XP_002892379.1|  hypothetical protein ARALYDRAFT_887918             211   6e-63   
ref|XP_009144329.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   8e-63   
ref|XP_010689830.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    210   8e-63   
ref|XP_010542671.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   9e-63   
ref|XP_002961823.1|  hypothetical protein SELMODRAFT_68566              209   1e-62   
emb|CDY01557.1|  BnaC07g35470D                                          209   1e-62   
ref|XP_006302860.1|  hypothetical protein CARUB_v10020990mg             209   1e-62   
ref|XP_011024904.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    211   1e-62   
ref|XP_010475462.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   1e-62   
ref|XP_002862737.1|  hypothetical protein ARALYDRAFT_920315             209   1e-62   
ref|XP_010906823.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    210   1e-62   
ref|XP_009128313.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   1e-62   
ref|XP_009763597.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   2e-62   
ref|XP_010487116.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   2e-62   
ref|XP_010457872.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   2e-62   
ref|XP_009611433.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   2e-62   
ref|XP_009136943.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   2e-62   
ref|NP_563780.1|  protein LIGHT SENSITIVE HYPOCOTYLS 6                  209   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002267312.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   2e-62   Vitis vinifera
ref|XP_010922606.1|  PREDICTED: protein G1-like7                        210   2e-62   
gb|KEH41129.1|  G1-like protein                                         209   2e-62   
ref|XP_006303356.1|  hypothetical protein CARUB_v10010340mg             209   2e-62   
ref|XP_009419675.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   3e-62   
ref|XP_009128817.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    208   4e-62   
ref|XP_006401075.1|  hypothetical protein EUTSA_v10014789mg             207   4e-62   
emb|CDY06030.1|  BnaA09g37500D                                          207   5e-62   
ref|XP_002879250.1|  hypothetical protein ARALYDRAFT_901988             208   5e-62   
ref|XP_009385214.1|  PREDICTED: protein G1-like7                        207   6e-62   
emb|CDY64755.1|  BnaCnng44770D                                          207   8e-62   
ref|XP_009412626.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    208   8e-62   
ref|XP_008657105.1|  PREDICTED: protein G1-like7                        208   9e-62   
ref|XP_006417846.1|  hypothetical protein EUTSA_v10009726mg             207   1e-61   
ref|XP_009132033.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   1e-61   
gb|KFK43023.1|  hypothetical protein AALP_AA1G068900                    207   1e-61   
ref|XP_004244278.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    206   2e-61   
ref|XP_010521971.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   2e-61   
emb|CDY10712.1|  BnaA05g12240D                                          205   2e-61   
emb|CDX87760.1|  BnaC02g31890D                                          205   4e-61   
ref|XP_008811689.1|  PREDICTED: protein G1-like7                        206   4e-61   
ref|XP_002863446.1|  hypothetical protein ARALYDRAFT_916864             205   4e-61   
emb|CDY59510.1|  BnaCnng35040D                                          205   5e-61   
ref|XP_009126748.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    205   5e-61   
emb|CDY32697.1|  BnaA02g07590D                                          204   5e-61   
ref|XP_006410079.1|  hypothetical protein EUTSA_v10017270mg             204   1e-60   
emb|CDY10247.1|  BnaC05g04900D                                          204   1e-60   
emb|CDY06675.1|  BnaA10g04540D                                          204   1e-60   
ref|XP_002866271.1|  hypothetical protein ARALYDRAFT_919048             204   1e-60   
ref|XP_009417987.1|  PREDICTED: protein G1-like7                        206   2e-60   
ref|NP_200658.1|  protein LIGHT SENSITIVE HYPOCOTYLS 5                  204   2e-60   
ref|XP_004239743.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    204   2e-60   
ref|XP_006281173.1|  hypothetical protein CARUB_v10027208mg             203   2e-60   
emb|CDO99243.1|  unnamed protein product                                203   2e-60   
gb|ABK21716.1|  unknown                                                 204   3e-60   
emb|CDY52287.1|  BnaA03g57800D                                          203   3e-60   
emb|CDY59064.1|  BnaAnng15760D                                          203   4e-60   
ref|XP_006345889.1|  PREDICTED: uncharacterized protein LOC102588665    203   5e-60   
emb|CDY32977.1|  BnaA10g11830D                                          202   6e-60   
ref|XP_009605797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   6e-60   
ref|XP_010264562.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   9e-60   
gb|EPS68159.1|  hypothetical protein M569_06614                         201   9e-60   
emb|CDY61050.1|  BnaCnng37250D                                          201   1e-59   
ref|XP_010453783.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   1e-59   
emb|CDY02038.1|  BnaC04g14630D                                          201   1e-59   
ref|XP_010443587.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   2e-59   
gb|KFK27377.1|  hypothetical protein AALP_AA8G375000                    201   2e-59   
ref|XP_009118463.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   2e-59   
ref|XP_009384790.1|  PREDICTED: protein G1-like7                        202   3e-59   
ref|XP_010483448.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   3e-59   
gb|EMS63732.1|  hypothetical protein TRIUR3_33566                       202   4e-59   
ref|XP_010907173.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   4e-59   
ref|XP_009118997.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   4e-59   
ref|XP_009120359.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   5e-59   
emb|CBI30686.3|  unnamed protein product                                199   5e-59   
ref|XP_009613005.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   5e-59   
ref|XP_006353047.1|  PREDICTED: uncharacterized protein LOC102583639    199   6e-59   
ref|XP_006350860.1|  PREDICTED: uncharacterized protein LOC102596443    201   6e-59   
ref|XP_009797641.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   6e-59   
ref|XP_004242504.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   6e-59   
gb|ABR18275.1|  unknown                                                 201   7e-59   
ref|XP_004233194.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   8e-59   
ref|XP_009762992.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   9e-59   
ref|XP_006354481.1|  PREDICTED: uncharacterized protein LOC102586971    200   1e-58   
ref|XP_002313621.2|  hypothetical protein POPTR_0009s15930g             199   1e-58   
ref|XP_009770526.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   1e-58   
ref|XP_007146820.1|  hypothetical protein PHAVU_006G072500g             199   2e-58   
ref|XP_010257059.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   2e-58   
ref|XP_011080720.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   2e-58   
gb|EPS66277.1|  hypothetical protein M569_08502                         196   2e-58   
ref|XP_011043717.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   2e-58   
emb|CDY21126.1|  BnaA01g33570D                                          198   4e-58   
ref|XP_009124995.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   4e-58   
ref|XP_008804103.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   4e-58   
ref|XP_003571880.1|  PREDICTED: protein G1-like5                        198   5e-58   
ref|XP_009629990.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   5e-58   
ref|XP_008439509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   5e-58   
ref|XP_008807164.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   5e-58   
ref|XP_006857299.1|  hypothetical protein AMTR_s00067p00052610          198   5e-58   
ref|NP_001176209.1|  Os10g0478000                                       198   6e-58   
gb|ACN41049.1|  unknown                                                 199   7e-58   
ref|XP_006361418.1|  PREDICTED: uncharacterized protein LOC102587546    197   8e-58   
ref|NP_173135.1|  uncharacterized protein                               196   9e-58   
ref|XP_010926891.1|  PREDICTED: protein G1-like1                        198   9e-58   
ref|XP_009387892.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   1e-57   
ref|XP_011091303.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   1e-57   
ref|XP_004236785.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   1e-57   
sp|Q941W1.1|G1L7_ORYSJ  RecName: Full=Protein G1-like7                  197   1e-57   
sp|A2XED8.1|G1L7_ORYSI  RecName: Full=Protein G1-like7                  197   1e-57   
ref|XP_009398447.1|  PREDICTED: protein G1-like4                        196   2e-57   
ref|XP_006845978.1|  hypothetical protein AMTR_s00155p00022580          197   2e-57   
ref|XP_008789168.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   2e-57   
ref|XP_009369632.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   2e-57   
ref|NP_001078202.2|  protein LIGHT SENSITIVE HYPOCOTYLS 4               196   2e-57   
ref|XP_007143862.1|  hypothetical protein PHAVU_007G108200g             196   2e-57   
ref|XP_007010574.1|  Uncharacterized protein TCM_044482                 209   3e-57   
gb|KFK39618.1|  hypothetical protein AALP_AA3G267200                    196   3e-57   
emb|CDY35523.1|  BnaA01g23890D                                          196   3e-57   
emb|CDY30000.1|  BnaC01g40080D                                          196   3e-57   
ref|XP_003567242.1|  PREDICTED: protein G1-like7                        196   3e-57   
ref|XP_007143863.1|  hypothetical protein PHAVU_007G108200g             196   3e-57   
ref|XP_009400810.1|  PREDICTED: protein G1-like4                        196   3e-57   
ref|XP_011004043.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   3e-57   
ref|XP_010905797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   3e-57   
ref|XP_008810562.1|  PREDICTED: protein G1-like4                        196   3e-57   
ref|XP_010488385.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   3e-57   
ref|XP_002306857.2|  hypothetical protein POPTR_0005s24730g             196   3e-57   
ref|XP_010934319.1|  PREDICTED: protein G1-like4                        195   4e-57   
ref|XP_009401942.1|  PREDICTED: protein G1-like4                        195   4e-57   
ref|NP_001048473.1|  Os02g0811000                                       197   4e-57   
ref|XP_010671018.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   4e-57   
ref|XP_002883419.1|  hypothetical protein ARALYDRAFT_898842             195   4e-57   
ref|XP_010522152.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   4e-57   
ref|XP_009336145.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   5e-57   
ref|XP_009362175.1|  PREDICTED: protein G1-like1 isoform X2             196   5e-57   
ref|XP_009362174.1|  PREDICTED: protein G1-like1 isoform X1             196   5e-57   
ref|XP_008356205.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    196   5e-57   
ref|XP_004490633.1|  PREDICTED: uncharacterized protein LOC101513114    196   5e-57   
ref|XP_004247736.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   5e-57   
ref|XP_009391974.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   5e-57   
ref|XP_004962398.1|  PREDICTED: skin secretory protein xP2-like         199   6e-57   
ref|XP_010488383.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   6e-57   
ref|XP_010466654.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   6e-57   
ref|XP_007022986.1|  Uncharacterized protein TCM_026988                 196   6e-57   
ref|XP_010512305.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   7e-57   
ref|XP_006406049.1|  hypothetical protein EUTSA_v10021563mg             194   7e-57   
ref|XP_006298606.1|  hypothetical protein CARUB_v10014690mg             195   7e-57   
ref|XP_002464485.1|  hypothetical protein SORBIDRAFT_01g019290          195   7e-57   
gb|KDO60474.1|  hypothetical protein CISIN_1g046561mg                   195   8e-57   
ref|XP_011085173.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   8e-57   
gb|KDP45779.1|  hypothetical protein JCGZ_17386                         196   8e-57   
gb|AFK46882.1|  unknown                                                 194   8e-57   
gb|KGN49491.1|  hypothetical protein Csa_6G526250                       194   8e-57   
ref|XP_004134890.1|  PREDICTED: uncharacterized protein LOC101208925    194   8e-57   
ref|XP_008674867.1|  PREDICTED: protein G1-like7                        195   8e-57   
ref|XP_002458704.1|  hypothetical protein SORBIDRAFT_03g038670          195   9e-57   
ref|XP_007211887.1|  hypothetical protein PRUPE_ppa010212mg             196   1e-56   
gb|AFK48050.1|  unknown                                                 194   1e-56   
ref|XP_003590857.1|  hypothetical protein MTR_1g075990                  194   1e-56   
ref|XP_010052568.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   1e-56   
ref|XP_010935915.1|  PREDICTED: protein G1-like4                        194   1e-56   
ref|XP_010937928.1|  PREDICTED: protein G1-like7                        196   1e-56   
ref|XP_010921009.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    196   1e-56   
ref|XP_010098512.1|  hypothetical protein L484_025951                   196   1e-56   
ref|XP_004970435.1|  PREDICTED: uncharacterized protein LOC101754104    194   1e-56   
ref|XP_007144887.1|  hypothetical protein PHAVU_007G192200g             194   2e-56   
ref|XP_010652376.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   2e-56   
ref|XP_002446786.1|  hypothetical protein SORBIDRAFT_06g022610          194   2e-56   
ref|XP_008793554.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   2e-56   
ref|XP_009402225.1|  PREDICTED: protein G1-like7                        194   2e-56   
ref|NP_001136927.1|  putative protein of unknown function (DUF640...    194   2e-56   
ref|XP_009772674.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   2e-56   
gb|EYU46446.1|  hypothetical protein MIMGU_mgv1a020501mg                193   2e-56   
ref|XP_010089535.1|  hypothetical protein L484_011699                   195   3e-56   
ref|XP_009603577.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   3e-56   
ref|XP_003537033.1|  PREDICTED: uncharacterized protein LOC100803605    194   3e-56   
ref|XP_006648081.1|  PREDICTED: uncharacterized protein LOC102709535    195   3e-56   
ref|XP_008438509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   3e-56   
emb|CAN67056.1|  hypothetical protein VITISV_036348                     192   3e-56   
ref|XP_006425133.1|  hypothetical protein CICLE_v10029262mg             194   3e-56   
ref|XP_008382857.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   3e-56   
ref|XP_004292213.1|  PREDICTED: uncharacterized protein LOC101301170    194   3e-56   
ref|XP_008235666.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   3e-56   
ref|XP_010557196.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   4e-56   
ref|XP_009399464.1|  PREDICTED: protein G1-like4                        193   4e-56   
ref|XP_010246796.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   4e-56   
ref|XP_010527402.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   4e-56   
ref|XP_009369473.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   4e-56   
ref|XP_008807719.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   4e-56   
ref|XP_004493783.1|  PREDICTED: uncharacterized protein LOC101490141    193   5e-56   
ref|XP_003536217.1|  PREDICTED: uncharacterized protein LOC100789...    192   5e-56   
ref|XP_011080055.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   5e-56   
ref|XP_006589267.1|  PREDICTED: uncharacterized protein LOC100789...    192   6e-56   
ref|XP_002278283.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   6e-56   
emb|CAN60458.1|  hypothetical protein VITISV_019556                     193   6e-56   
ref|XP_008225689.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    192   6e-56   
gb|KDO66991.1|  hypothetical protein CISIN_1g023835mg                   193   6e-56   
ref|XP_009353874.1|  PREDICTED: protein G1-like1                        193   7e-56   
ref|XP_010104757.1|  hypothetical protein L484_021447                   192   7e-56   
ref|NP_001159319.1|  uncharacterized protein LOC100304411               192   8e-56   
ref|XP_006488572.1|  PREDICTED: uncharacterized protein LOC102610331    192   8e-56   
gb|EYU43203.1|  hypothetical protein MIMGU_mgv1a013748mg                192   8e-56   
ref|XP_010023924.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   8e-56   
ref|XP_010262338.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   8e-56   
ref|XP_009780996.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   8e-56   
ref|XP_003566357.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   8e-56   
ref|XP_008785240.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    192   8e-56   
ref|XP_008808528.1|  PREDICTED: protein G1-like1                        193   8e-56   
ref|XP_010532649.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   9e-56   
gb|KEH23934.1|  G1-like protein                                         192   9e-56   
ref|XP_010557195.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   1e-55   
sp|Q6ATW6.1|G1L8_ORYSJ  RecName: Full=Protein G1-like8                  193   1e-55   
gb|EMT15017.1|  hypothetical protein F775_09728                         192   1e-55   
gb|KDP34854.1|  hypothetical protein JCGZ_09142                         192   1e-55   
ref|XP_007201372.1|  hypothetical protein PRUPE_ppa012142mg             191   1e-55   
ref|XP_004293717.1|  PREDICTED: uncharacterized protein LOC101301655    193   1e-55   
ref|XP_011028817.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   1e-55   
ref|XP_007050277.1|  IQ motif and SEC7 domain-containing protein 2      191   1e-55   
ref|XP_010650097.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   1e-55   
ref|XP_010262340.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   1e-55   
ref|XP_003521294.1|  PREDICTED: uncharacterized protein LOC100778...    192   1e-55   
ref|XP_004296375.1|  PREDICTED: uncharacterized protein LOC101303109    191   1e-55   
gb|KDO66990.1|  hypothetical protein CISIN_1g023835mg                   194   1e-55   
ref|NP_001235822.1|  uncharacterized protein LOC100527164               191   1e-55   
ref|XP_009403861.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   1e-55   
ref|XP_009594800.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   2e-55   
ref|NP_001143695.1|  putative protein of unknown function (DUF640...    193   2e-55   
dbj|BAJ89549.1|  predicted protein                                      191   2e-55   
ref|XP_008224344.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   2e-55   
ref|XP_010469755.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   2e-55   
sp|A2Y5N0.1|G1L8_ORYSI  RecName: Full=Protein G1-like8                  192   2e-55   
ref|XP_003599342.1|  hypothetical protein MTR_3g031830                  192   2e-55   
ref|XP_002441248.1|  hypothetical protein SORBIDRAFT_09g023120          192   2e-55   
ref|XP_008367221.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   2e-55   
emb|CDP03752.1|  unnamed protein product                                191   2e-55   
ref|XP_009407185.1|  PREDICTED: protein G1-like4                        191   2e-55   
gb|KDP40343.1|  hypothetical protein JCGZ_02341                         191   2e-55   
ref|XP_006378330.1|  hypothetical protein POPTR_0010s08140g             191   2e-55   
gb|KDP26521.1|  hypothetical protein JCGZ_17679                         191   2e-55   
ref|XP_010557118.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   2e-55   
ref|XP_002453010.1|  hypothetical protein SORBIDRAFT_04g036620          192   2e-55   
gb|KEH42512.1|  G1-like protein                                         192   2e-55   
ref|XP_008667635.1|  PREDICTED: uncharacterized protein LOC100275...    191   2e-55   
ref|XP_002440915.1|  hypothetical protein SORBIDRAFT_09g016440          195   2e-55   
ref|XP_010414174.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   2e-55   
ref|XP_003556381.1|  PREDICTED: uncharacterized protein LOC100806...    190   3e-55   
ref|XP_008681636.1|  PREDICTED: putative protein of unknown funct...    194   3e-55   
ref|XP_010510232.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   3e-55   
emb|CDY57087.1|  BnaA04g28750D                                          191   3e-55   
gb|KHN10748.1|  hypothetical protein glysoja_019179                     191   3e-55   
emb|CDY24755.1|  BnaC04g13600D                                          191   3e-55   
ref|XP_006410244.1|  hypothetical protein EUTSA_v10017162mg             191   3e-55   
emb|CBI21986.3|  unnamed protein product                                189   3e-55   
ref|XP_006606387.1|  PREDICTED: uncharacterized protein LOC100806...    190   3e-55   
ref|XP_004966292.1|  PREDICTED: uncharacterized protein LOC101766...    193   3e-55   
ref|XP_003552937.1|  PREDICTED: AT-rich interactive domain-contai...    192   3e-55   
ref|XP_003544306.1|  PREDICTED: uncharacterized protein LOC100780494    191   3e-55   



>emb|CDO96796.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   271 bits (694),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 148/173 (86%), Gaps = 10/173 (6%)
 Frame = +2

Query  125  EGSSRSADQ---------PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFL  277
            EGSSRS  +           LSRYESQKRRDWNTFGQYLKNQRPPVSLS CNCNHVLEFL
Sbjct  18   EGSSRSTGENHQQQPQTTTTLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLEFL  77

Query  278  RYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENN  457
            RYLDQFGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE N
Sbjct  78   RYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETN  137

Query  458  PFGNGAIRVYLREVKECQAKARGIPYkkkkkrkLNPVRGINDHNHNSTLKQSS  616
            PFGNGAIRVYLREVKECQAKARGIPYKKKKK+K NP++   DH+     KQS+
Sbjct  138  PFGNGAIRVYLREVKECQAKARGIPYKKKKKKK-NPIKLHEDHHQLKHFKQST  189



>ref|XP_009773140.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=188

 Score =   270 bits (689),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 144/157 (92%), Gaps = 7/157 (4%)
 Frame = +2

Query  125  EGSSRSADQ------PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYL  286
            EGSSRS  +       PLSRYESQKRRDWNTFGQYLKNQRPPV+LS CNCNHVLEFLRYL
Sbjct  14   EGSSRSGGEQLQQNPAPLSRYESQKRRDWNTFGQYLKNQRPPVALSQCNCNHVLEFLRYL  73

Query  287  DQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFG  466
            DQFGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFG
Sbjct  74   DQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFG  133

Query  467  NGAIRVYLREVKECQAKARGIPYkkkkkrkLN-PVRG  574
            NGAIR+YLREVKECQAKARGIPYKKKKKRKLN P++ 
Sbjct  134  NGAIRLYLREVKECQAKARGIPYKKKKKRKLNHPIKA  170



>ref|XP_009608555.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=187

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 143/156 (92%), Gaps = 6/156 (4%)
 Frame = +2

Query  125  EGSSRSADQ-----PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLD  289
            EGSSRS  +      PLSRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVLEFLRYLD
Sbjct  14   EGSSRSGGEQLQNPAPLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLEFLRYLD  73

Query  290  QFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGN  469
            QFGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGN
Sbjct  74   QFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGN  133

Query  470  GAIRVYLREVKECQAKARGIPYkkkkkrkL-NPVRG  574
            GAIR+YLREVKECQAKARGIPYKKKKKRKL NP++ 
Sbjct  134  GAIRLYLREVKECQAKARGIPYKKKKKRKLNNPIKA  169



>ref|XP_006362411.1| PREDICTED: uncharacterized protein LOC102591189 [Solanum tuberosum]
Length=191

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 140/152 (92%), Gaps = 7/152 (5%)
 Frame = +2

Query  128  GSSRSADQ-------PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYL  286
            GSSRS  +        PLSRYESQKRRDWNTFGQYLKNQRPPVSLS CNCNHVLEFLRYL
Sbjct  15   GSSRSGGEQLQNNNPAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLEFLRYL  74

Query  287  DQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFG  466
            DQFGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFG
Sbjct  75   DQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFG  134

Query  467  NGAIRVYLREVKECQAKARGIPYkkkkkrkLN  562
            NGAIR+YLREVKECQAKARGIPYKKKKKRKLN
Sbjct  135  NGAIRLYLREVKECQAKARGIPYKKKKKRKLN  166



>ref|XP_010052190.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Eucalyptus 
grandis]
 gb|KCW76110.1| hypothetical protein EUGRSUZ_D00487 [Eucalyptus grandis]
Length=177

 Score =   266 bits (681),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 134/147 (91%), Gaps = 7/147 (5%)
 Frame = +2

Query  116  TTAEGSSRSA-DQP------PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEF  274
              AEGSSRS  DQP      PLSRYESQKRRDWNTFGQYL+NQ+PPV+LS CNCNHVLEF
Sbjct  9    NIAEGSSRSVIDQPALPAPAPLSRYESQKRRDWNTFGQYLRNQKPPVALSQCNCNHVLEF  68

Query  275  LRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEN  454
            LRYLDQFGKTKVHL GCVFFGQ +PPAPCTCPLRQAWGSLDALIGRLRAAYEENGG+PEN
Sbjct  69   LRYLDQFGKTKVHLHGCVFFGQREPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGAPEN  128

Query  455  NPFGNGAIRVYLREVKECQAKARGIPY  535
            NPFGNGAIRVYLREVKECQAKARGIPY
Sbjct  129  NPFGNGAIRVYLREVKECQAKARGIPY  155



>ref|XP_010279129.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nelumbo 
nucifera]
Length=176

 Score =   266 bits (680),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 134/143 (94%), Gaps = 4/143 (3%)
 Frame = +2

Query  119  TAEGSSRSADQ----PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYL  286
            +AEGSSRSA +     PLSRYESQKRRDWNTFGQYLKNQRPPVSLS C+C+HVLEFLRYL
Sbjct  9    SAEGSSRSAGEQQQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCSCSHVLEFLRYL  68

Query  287  DQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFG  466
            DQFGKTKVHL GC+FFGQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPFG
Sbjct  69   DQFGKTKVHLQGCIFFGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFG  128

Query  467  NGAIRVYLREVKECQAKARGIPY  535
            +GAIRVYLREV+ECQAKARGIPY
Sbjct  129  SGAIRVYLREVRECQAKARGIPY  151



>ref|XP_004233074.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=191

 Score =   266 bits (681),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 140/154 (91%), Gaps = 7/154 (5%)
 Frame = +2

Query  122  AEGSSRSADQ-------PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLR  280
            + GSSRS  +        PLSRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVLEFLR
Sbjct  13   SAGSSRSGGEQLQNNNPAPLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLEFLR  72

Query  281  YLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNP  460
            YLDQFGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNP
Sbjct  73   YLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNP  132

Query  461  FGNGAIRVYLREVKECQAKARGIPYkkkkkrkLN  562
            FGNGAIR+YLREVKECQAKARGIPYKKKKKRKLN
Sbjct  133  FGNGAIRLYLREVKECQAKARGIPYKKKKKRKLN  166



>ref|XP_011085992.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=175

 Score =   266 bits (679),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 142/149 (95%), Gaps = 2/149 (1%)
 Frame = +2

Query  122  AEGSSRSADQ--PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQF  295
            ++ S+ ++DQ  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQF
Sbjct  9    SKDSNSASDQASPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQF  68

Query  296  GKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGA  475
            GKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFGNGA
Sbjct  69   GKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGA  128

Query  476  IRVYLREVKECQAKARGIPYkkkkkrkLN  562
            IRVYLREVK+ QAKARGIPYKKKKK+++N
Sbjct  129  IRVYLREVKDSQAKARGIPYKKKKKKRIN  157



>ref|XP_010655519.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Vitis 
vinifera]
 ref|XP_010655520.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Vitis 
vinifera]
Length=175

 Score =   265 bits (678),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 134/144 (93%), Gaps = 5/144 (3%)
 Frame = +2

Query  119  TAEGSSRSADQP-----PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRY  283
            +AEGSSRS  +P     PLSRYESQKRRDWNTFGQYLKNQRPPVSL+ C+CNHVLEFLRY
Sbjct  9    SAEGSSRSTGEPQQQPQPLSRYESQKRRDWNTFGQYLKNQRPPVSLAQCSCNHVLEFLRY  68

Query  284  LDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPF  463
            LDQFGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPF
Sbjct  69   LDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPF  128

Query  464  GNGAIRVYLREVKECQAKARGIPY  535
            GNGAIRVYLREV++CQ+KARGIPY
Sbjct  129  GNGAIRVYLREVRDCQSKARGIPY  152



>emb|CAN72178.1| hypothetical protein VITISV_012478 [Vitis vinifera]
Length=175

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 134/144 (93%), Gaps = 5/144 (3%)
 Frame = +2

Query  119  TAEGSSRSADQP-----PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRY  283
            +AEGSSRS  +P     PLSRYESQKRRDWNTFGQYLKNQRPPVSL+ C+CNHVLEFLRY
Sbjct  9    SAEGSSRSTGEPQQQPQPLSRYESQKRRDWNTFGQYLKNQRPPVSLAQCSCNHVLEFLRY  68

Query  284  LDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPF  463
            LDQFGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPF
Sbjct  69   LDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPF  128

Query  464  GNGAIRVYLREVKECQAKARGIPY  535
            GNGAIRVYLREV++CQ+KARGIPY
Sbjct  129  GNGAIRVYLREVRDCQSKARGIPY  152



>ref|XP_008358651.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009352770.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=190

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/153 (89%), Positives = 141/153 (92%), Gaps = 4/153 (3%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYLKNQ PPVSLSHCNCNHVL+FLRYLDQFGKTKVHL GCVFF
Sbjct  38   PLSRYESQKRRDWNTFGQYLKNQSPPVSLSHCNCNHVLDFLRYLDQFGKTKVHLHGCVFF  97

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFGNGAIRVYLREVKECQA
Sbjct  98   GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQA  157

Query  515  KARGIPYkkkkkrkLN-PVRGINDHNHNSTLKQ  610
            KARGIPYKKKKK+K N  ++ IND     TLKQ
Sbjct  158  KARGIPYKKKKKKKRNGQLKAIND---EGTLKQ  187



>ref|XP_002522583.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39883.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score =   264 bits (675),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 134/147 (91%), Gaps = 8/147 (5%)
 Frame = +2

Query  119  TAEGSSRSA-------DQP-PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEF  274
            +AEGSSRS         QP PLSRYESQKRRDWNTFGQYLKNQRPPVSLS CNCNHVL+F
Sbjct  9    SAEGSSRSGGDQQLIPHQPAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDF  68

Query  275  LRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEN  454
            LRYLDQFGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE 
Sbjct  69   LRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPET  128

Query  455  NPFGNGAIRVYLREVKECQAKARGIPY  535
            NPFGNGAIRVYLREV+ECQAKARGIPY
Sbjct  129  NPFGNGAIRVYLREVRECQAKARGIPY  155



>ref|XP_008225289.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Prunus 
mume]
Length=187

 Score =   264 bits (674),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYLKNQ PPVSLS CNCNHVL+FLRYLDQFGKTKVHL GCVFF
Sbjct  34   PLSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFF  93

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFGNGAIRVYLREVKECQA
Sbjct  94   GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQA  153

Query  515  KARGIPYkkkkkrkLNPVRGINDHNHNSTLKQ  610
            KARGIPYKKKKK++   ++ IND   N  LKQ
Sbjct  154  KARGIPYKKKKKKRNGQLKAINDEA-NKGLKQ  184



>ref|XP_007025375.1| Beta-lactamase-like protein ENSP00000383859 [Theobroma cacao]
 gb|EOY27997.1| Beta-lactamase-like protein ENSP00000383859 [Theobroma cacao]
Length=179

 Score =   263 bits (673),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 134/147 (91%), Gaps = 7/147 (5%)
 Frame = +2

Query  116  TTAEGSSRSA----DQP---PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEF  274
             +AEGSSRS+     QP   PLSRYESQKRRDWNTFGQYLKNQRPPV+LS CNCNHVL+F
Sbjct  8    ASAEGSSRSSGNHHQQPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVALSQCNCNHVLDF  67

Query  275  LRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEN  454
            LRYLDQFGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGS E 
Sbjct  68   LRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSSET  127

Query  455  NPFGNGAIRVYLREVKECQAKARGIPY  535
            NPFGNGAIRVYLREV+ECQAKARGIPY
Sbjct  128  NPFGNGAIRVYLREVRECQAKARGIPY  154



>ref|XP_011008476.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=177

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 131/145 (90%), Gaps = 6/145 (4%)
 Frame = +2

Query  119  TAEGSSRSA------DQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLR  280
            +AEGSSRS          PLSRYESQKRRDWNTFGQYLKNQRPPVSLS CNCNHVL+FLR
Sbjct  10   SAEGSSRSVGDHHQLQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLR  69

Query  281  YLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNP  460
            YLDQFGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAA+EE+GGS E NP
Sbjct  70   YLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAFEEHGGSAETNP  129

Query  461  FGNGAIRVYLREVKECQAKARGIPY  535
            FGNGAIRVYLREVKECQAKARGIPY
Sbjct  130  FGNGAIRVYLREVKECQAKARGIPY  154



>ref|XP_002305745.1| hypothetical protein POPTR_0004s05610g [Populus trichocarpa]
 gb|ABK93578.1| unknown [Populus trichocarpa]
 gb|EEE86256.1| hypothetical protein POPTR_0004s05610g [Populus trichocarpa]
Length=177

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 131/145 (90%), Gaps = 6/145 (4%)
 Frame = +2

Query  119  TAEGSSRSA------DQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLR  280
            +AEGSSRS          PLSRYESQKRRDWNTFGQYLKNQRPPVSLS CNCNHVL+FLR
Sbjct  10   SAEGSSRSGGDHHQLQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLR  69

Query  281  YLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNP  460
            YLDQFGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAA+EE+GGS E NP
Sbjct  70   YLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAFEEHGGSAETNP  129

Query  461  FGNGAIRVYLREVKECQAKARGIPY  535
            FGNGAIRVYLREVKECQAKARGIPY
Sbjct  130  FGNGAIRVYLREVKECQAKARGIPY  154



>ref|XP_008371461.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_008371462.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009349575.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
 ref|XP_009349639.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=187

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 139/152 (91%), Gaps = 5/152 (3%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYLKNQ PPVSLSHCNCNHVL+FLRYLDQFGKTKVHL GCVFF
Sbjct  38   PLSRYESQKRRDWNTFGQYLKNQSPPVSLSHCNCNHVLDFLRYLDQFGKTKVHLHGCVFF  97

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFGNGAIRVYLREVKECQA
Sbjct  98   GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQA  157

Query  515  KARGIPYkkkkkrkLNPVRGINDHNHNSTLKQ  610
            KARGIPYKKKKKR    ++ IN+     TLKQ
Sbjct  158  KARGIPYKKKKKRN-GQLKAINE----GTLKQ  184



>ref|XP_007212120.1| hypothetical protein PRUPE_ppa012018mg [Prunus persica]
 gb|EMJ13319.1| hypothetical protein PRUPE_ppa012018mg [Prunus persica]
Length=187

 Score =   262 bits (670),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYLKNQ PPVSLS CNCNHVL+FLRYLDQFGKTKVHL GCVFF
Sbjct  34   PLSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFF  93

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQPDPPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGSPE NPFGNGAIRVYLREVKECQA
Sbjct  94   GQPDPPAPCTCPLKQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQA  153

Query  515  KARGIPYkkkkkrkLNPVRGINDHNHNSTLKQ  610
            KARGIPYKKKKK++   ++ IND   N  LKQ
Sbjct  154  KARGIPYKKKKKKRNGQLKAINDEA-NKGLKQ  184



>ref|XP_004151474.1| PREDICTED: uncharacterized protein LOC101210225 [Cucumis sativus]
Length=187

 Score =   261 bits (666),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 127/141 (90%), Gaps = 1/141 (1%)
 Frame = +2

Query  116  TTAEGSSR-SADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  292
            T A  SSR +     LSRYESQKRRDWNTFGQYLKNQ P VSLS CNCNHVLEFLRYLDQ
Sbjct  10   TEAGSSSRATTTTAALSRYESQKRRDWNTFGQYLKNQTPAVSLSQCNCNHVLEFLRYLDQ  69

Query  293  FGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNG  472
            FGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFGNG
Sbjct  70   FGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNG  129

Query  473  AIRVYLREVKECQAKARGIPY  535
            AIRVYLREVKECQAKARGIPY
Sbjct  130  AIRVYLREVKECQAKARGIPY  150



>ref|XP_004485894.1| PREDICTED: uncharacterized protein LOC101502781 [Cicer arietinum]
Length=183

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 147/182 (81%), Gaps = 10/182 (5%)
 Frame = +2

Query  35   IRTVLLYPSMNSSSSTTHDGAppppppTTAEGSSRSADQPPLSRYESQKRRDWNTFGQYL  214
            + T +   ++ +SSST+        P  TA          PLSRYESQK+RDWNTFGQYL
Sbjct  1    MSTTMQNDAVQASSSTSRPNGADQQPTATA----------PLSRYESQKKRDWNTFGQYL  50

Query  215  KNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSL  394
            +NQ P VSLS CN NHVLEFLRYLDQFGKTKVHL GC+FFGQPDPPAPCTCPLRQAWGSL
Sbjct  51   RNQTPAVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQPDPPAPCTCPLRQAWGSL  110

Query  395  DALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKARGIPYkkkkkrkLNPVRG  574
            DALIGRLRAAYEE+GGSPENNPFG+GAIRVYLREVKECQ+KARGIPY KKKK+++  ++G
Sbjct  111  DALIGRLRAAYEEHGGSPENNPFGSGAIRVYLREVKECQSKARGIPYTKKKKKRITQIKG  170

Query  575  IN  580
             +
Sbjct  171  TH  172



>ref|XP_008465553.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=182

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/126 (96%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYLKNQ PPVSLS CNCNHVLEFLRYLDQFGKTKVHL GCVFFG
Sbjct  26   LSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFG  85

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFGNGAIRVYLREVKECQAK
Sbjct  86   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAK  145

Query  518  ARGIPY  535
            ARGIPY
Sbjct  146  ARGIPY  151



>ref|XP_006467647.1| PREDICTED: uncharacterized protein LOC102611919 [Citrus sinensis]
 gb|KDO77861.1| hypothetical protein CISIN_1g029090mg [Citrus sinensis]
Length=199

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYLKNQRPPVSLS C+CNHVL+FLRYLDQFGKTKVHL GCVFF
Sbjct  47   PLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCSCNHVLDFLRYLDQFGKTKVHLHGCVFF  106

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFGNGAIRVYLREV+ECQA
Sbjct  107  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQA  166

Query  515  KARGIPYkkkkkrkLNPVRGINDHNHNST  601
            KARGIPYKKKKK+K + ++  ND    S+
Sbjct  167  KARGIPYKKKKKKKYHQIKSNNDEPAKSS  195



>gb|KGN65636.1| hypothetical protein Csa_1G474480 [Cucumis sativus]
Length=186

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 127/141 (90%), Gaps = 1/141 (1%)
 Frame = +2

Query  116  TTAEGSSR-SADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  292
            T A  SSR +     LSRYESQKRRDWNTFGQYLKNQ P VSLS CNCNHVLEFLRYLDQ
Sbjct  10   TEAGSSSRATTTTAALSRYESQKRRDWNTFGQYLKNQTPAVSLSQCNCNHVLEFLRYLDQ  69

Query  293  FGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNG  472
            FGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFGNG
Sbjct  70   FGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNG  129

Query  473  AIRVYLREVKECQAKARGIPY  535
            AIRVYLREVKECQAKARGIPY
Sbjct  130  AIRVYLREVKECQAKARGIPY  150



>ref|XP_010109876.1| hypothetical protein L484_003806 [Morus notabilis]
 gb|EXC24829.1| hypothetical protein L484_003806 [Morus notabilis]
Length=194

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQK+RDWNTFGQYLKNQ PPV+LS CNCNHVL+FLRYLDQFGKTKVHL GCVFF
Sbjct  39   PLSRYESQKKRDWNTFGQYLKNQTPPVALSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFF  98

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFGNGAIRVYLREVKECQA
Sbjct  99   GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQA  158

Query  515  KARGIPY  535
            KARGIPY
Sbjct  159  KARGIPY  165



>ref|XP_011011486.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=177

 Score =   259 bits (662),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 132/145 (91%), Gaps = 6/145 (4%)
 Frame = +2

Query  119  TAEGSSRSAD-----QP-PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLR  280
            +AEGSSRS       QP PLSRYESQKRRDWNTFGQYLKNQRPPVSLS  NCNHVL+FLR
Sbjct  10   SAEGSSRSGSDHYQPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQSNCNHVLDFLR  69

Query  281  YLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNP  460
            YLDQFGKTKVHL GCVFFGQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGS E NP
Sbjct  70   YLDQFGKTKVHLHGCVFFGQPNPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSAETNP  129

Query  461  FGNGAIRVYLREVKECQAKARGIPY  535
            FGNGAIRVYLREVKECQAKARGIPY
Sbjct  130  FGNGAIRVYLREVKECQAKARGIPY  154



>ref|XP_010277024.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Nelumbo 
nucifera]
Length=182

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 130/144 (90%), Gaps = 6/144 (4%)
 Frame = +2

Query  122  AEGSSRSA------DQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRY  283
            AEGSSR           PLSRYESQKRRDWNTFGQYLKNQRPPVSLS CNC+HVL+FLRY
Sbjct  10   AEGSSRHGGGGEQQQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCSHVLDFLRY  69

Query  284  LDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPF  463
            LDQFGKTKVHL GCVFFGQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF
Sbjct  70   LDQFGKTKVHLQGCVFFGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPF  129

Query  464  GNGAIRVYLREVKECQAKARGIPY  535
            G+GAIRVYLREV+ECQAKARGIPY
Sbjct  130  GSGAIRVYLREVRECQAKARGIPY  153



>ref|XP_002317421.1| hypothetical protein POPTR_0011s07350g [Populus trichocarpa]
 gb|ABK94387.1| unknown [Populus trichocarpa]
 gb|EEE98033.1| hypothetical protein POPTR_0011s07350g [Populus trichocarpa]
Length=177

 Score =   258 bits (660),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 132/145 (91%), Gaps = 6/145 (4%)
 Frame = +2

Query  119  TAEGSSRSAD-----QP-PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLR  280
            +AEGSSRS       QP PLSRYESQKRRDWNTFGQYLKNQRPPVSLS  NCNHVL+FLR
Sbjct  10   SAEGSSRSGGDHYQPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQSNCNHVLDFLR  69

Query  281  YLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNP  460
            YLDQFGKTKVHL GCVFFGQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGS E NP
Sbjct  70   YLDQFGKTKVHLHGCVFFGQPNPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSAETNP  129

Query  461  FGNGAIRVYLREVKECQAKARGIPY  535
            FGNGAIRVYLREVKECQAKARGIPY
Sbjct  130  FGNGAIRVYLREVKECQAKARGIPY  154



>ref|XP_006449503.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 ref|XP_006449504.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 gb|ESR62743.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 gb|ESR62744.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
Length=199

 Score =   259 bits (661),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYLKNQRPPVSLS C+CNHVL+FLRYLDQFGKTKVHL GCVFF
Sbjct  47   PLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCSCNHVLDFLRYLDQFGKTKVHLHGCVFF  106

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFGNGAIRVYLREV+ECQA
Sbjct  107  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQA  166

Query  515  KARGIPYkkkkkrkLNPVRGINDHNHNSTLKQS  613
            KARGIPYKKKKK+K + ++  ND    S+ + +
Sbjct  167  KARGIPYKKKKKKKYHQIKPNNDEPAKSSRQST  199



>ref|XP_009786006.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=177

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 130/140 (93%), Gaps = 2/140 (1%)
 Frame = +2

Query  122  AEGSSRS-ADQPP-LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQF  295
             EGSSRS  DQP  LSRYESQKRRDWNTFGQYL+NQRPPVS+S CN NHVLEFLRYLDQF
Sbjct  11   VEGSSRSPGDQPATLSRYESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVLEFLRYLDQF  70

Query  296  GKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGA  475
            GKTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GA
Sbjct  71   GKTKVHLQGCIFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGA  130

Query  476  IRVYLREVKECQAKARGIPY  535
            IRVYLREVKECQ+KARGIPY
Sbjct  131  IRVYLREVKECQSKARGIPY  150



>gb|KDP21096.1| hypothetical protein JCGZ_21567 [Jatropha curcas]
Length=182

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 131/150 (87%), Gaps = 11/150 (7%)
 Frame = +2

Query  119  TAEGSSRSADQPPL-----------SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHV  265
            +AEGSSRS+                SRYESQKRRDWNTFGQYLKNQRPPVSLS CNCNHV
Sbjct  9    SAEGSSRSSGDHHHQQQQLPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHV  68

Query  266  LEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGS  445
            L+FLRYLDQFGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGS
Sbjct  69   LDFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGS  128

Query  446  PENNPFGNGAIRVYLREVKECQAKARGIPY  535
            PE NPFGNGAIRVYLREV+ECQAKARGIPY
Sbjct  129  PETNPFGNGAIRVYLREVRECQAKARGIPY  158



>ref|XP_004174117.1| PREDICTED: uncharacterized protein LOC101228453 [Cucumis sativus]
Length=191

 Score =   257 bits (656),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/126 (95%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYLKNQ P VSLS CNCNHVLEFLRYLDQFGKTKVHL GCVFFG
Sbjct  29   LSRYESQKRRDWNTFGQYLKNQTPAVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFG  88

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFGNGAIRVYLREVKECQAK
Sbjct  89   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQAK  148

Query  518  ARGIPY  535
            ARGIPY
Sbjct  149  ARGIPY  154



>gb|AFK49191.1| unknown [Medicago truncatula]
 gb|KEH36593.1| DUF640 family protein [Medicago truncatula]
Length=184

 Score =   256 bits (654),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 133/157 (85%), Gaps = 2/157 (1%)
 Frame = +2

Query  71   SSSTTHDGAppppppTTAEGSSR--SADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLS  244
            SSS  +D        +   GS +  +A   PLSRYESQK+RDWNTFGQYL+NQ PPVSLS
Sbjct  2    SSSMQNDTVQASSSSSRPGGSDQQPTAAVAPLSRYESQKKRDWNTFGQYLRNQSPPVSLS  61

Query  245  HCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAA  424
             CN NHVLEFLRYLDQFGKTKVHL GC+FFGQPDPPAPCTCPLRQAWGSLDALIGRLRAA
Sbjct  62   QCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAA  121

Query  425  YEENGGSPENNPFGNGAIRVYLREVKECQAKARGIPY  535
            YEE+GGSPENNPFG GAIRVYLREVKECQ+KARGIPY
Sbjct  122  YEEHGGSPENNPFGTGAIRVYLREVKECQSKARGIPY  158



>ref|XP_010052695.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Eucalyptus 
grandis]
 gb|KCW89641.1| hypothetical protein EUGRSUZ_A01916 [Eucalyptus grandis]
Length=176

 Score =   256 bits (653),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 132/143 (92%), Gaps = 4/143 (3%)
 Frame = +2

Query  119  TAE-GSSRS-ADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYL  286
            TAE GSSRS +DQ P+  SRYESQKRRDWNTFG YL+NQRPPV LS CNCNHVLEFLRYL
Sbjct  9    TAELGSSRSPSDQQPVAPSRYESQKRRDWNTFGHYLRNQRPPVPLSQCNCNHVLEFLRYL  68

Query  287  DQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFG  466
            DQFGKTKVHL GCVF+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF 
Sbjct  69   DQFGKTKVHLQGCVFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFA  128

Query  467  NGAIRVYLREVKECQAKARGIPY  535
            +GAIRVYLREV+ECQAKARGIPY
Sbjct  129  SGAIRVYLREVRECQAKARGIPY  151



>ref|XP_006348870.1| PREDICTED: uncharacterized protein LOC102600485 [Solanum tuberosum]
Length=173

 Score =   255 bits (652),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 129/140 (92%), Gaps = 2/140 (1%)
 Frame = +2

Query  122  AEGSSRS-ADQPPL-SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQF  295
             EGSSRS  DQP   SRYESQKRRDWNTFGQYL+NQRPPVS+S CN NHVLEFLRYLDQF
Sbjct  11   VEGSSRSPGDQPATPSRYESQKRRDWNTFGQYLRNQRPPVSMSQCNSNHVLEFLRYLDQF  70

Query  296  GKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGA  475
            GKTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GA
Sbjct  71   GKTKVHLQGCIFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGA  130

Query  476  IRVYLREVKECQAKARGIPY  535
            IRVYLREVKECQAKARGIPY
Sbjct  131  IRVYLREVKECQAKARGIPY  150



>ref|XP_011101384.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=183

 Score =   255 bits (652),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/126 (94%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYLKNQRPPV +S CNCNHVLEFLRYLDQFGKTKVHL GCVFFG
Sbjct  32   LSRYESQKRRDWNTFGQYLKNQRPPVPISQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFG  91

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFGNGAIRVYLREVK+CQAK
Sbjct  92   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKDCQAK  151

Query  518  ARGIPY  535
            ARGIPY
Sbjct  152  ARGIPY  157



>ref|XP_009593391.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
 ref|XP_009593396.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=177

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 130/140 (93%), Gaps = 2/140 (1%)
 Frame = +2

Query  122  AEGSSRS-ADQPP-LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQF  295
             +GSSRS  DQP  LSRYESQKRRDWNTFGQYL+NQRPPVS+S CN NHVLEFLRYLDQF
Sbjct  11   VQGSSRSPGDQPATLSRYESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVLEFLRYLDQF  70

Query  296  GKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGA  475
            GKTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GA
Sbjct  71   GKTKVHLQGCIFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGA  130

Query  476  IRVYLREVKECQAKARGIPY  535
            IRVYLREVKECQ+KARGIPY
Sbjct  131  IRVYLREVKECQSKARGIPY  150



>ref|XP_009133547.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Brassica 
rapa]
Length=177

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 127/134 (95%), Gaps = 2/134 (1%)
 Frame = +2

Query  140  SADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVH  313
            S  +PP+  SRYESQKRRDWNTFGQYLKNQRPPV +SHCNCNHVL+FLRYLDQFGKTKVH
Sbjct  15   SGSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCNCNHVLDFLRYLDQFGKTKVH  74

Query  314  LPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLR  493
            +PGC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIRVYLR
Sbjct  75   VPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLR  134

Query  494  EVKECQAKARGIPY  535
            EV+ECQAKARGIPY
Sbjct  135  EVRECQAKARGIPY  148



>ref|XP_002280666.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Vitis 
vinifera]
Length=167

 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 130/141 (92%), Gaps = 3/141 (2%)
 Frame = +2

Query  122  AEGSSRS-ADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  292
            AEGSSRS  DQ  +  SRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYLDQ
Sbjct  10   AEGSSRSPGDQQSVTPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQ  69

Query  293  FGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNG  472
            FGKTKVHL GC+FFGQP+PPAPCTCPLRQAWGSLDAL+GRLRAAYEENGGSPE NPF +G
Sbjct  70   FGKTKVHLQGCMFFGQPEPPAPCTCPLRQAWGSLDALVGRLRAAYEENGGSPETNPFASG  129

Query  473  AIRVYLREVKECQAKARGIPY  535
            AIR+YLREV+ECQ+KARGIPY
Sbjct  130  AIRIYLREVRECQSKARGIPY  150



>ref|XP_003542999.1| PREDICTED: uncharacterized protein LOC100778886 [Glycine max]
Length=181

 Score =   254 bits (648),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYLKNQ PPVSLS CN NHVLEFLRYLDQFGKTKVHL GC+FF
Sbjct  30   PLSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFF  89

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE GGSPE NPFG+GAIRVYLREVKECQA
Sbjct  90   GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEERGGSPETNPFGSGAIRVYLREVKECQA  149

Query  515  KARGIPY  535
            KARGIPY
Sbjct  150  KARGIPY  156



>ref|XP_007021735.1| Uncharacterized protein TCM_031777 [Theobroma cacao]
 gb|EOY13260.1| Uncharacterized protein TCM_031777 [Theobroma cacao]
Length=186

 Score =   254 bits (648),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 149/179 (83%), Gaps = 16/179 (9%)
 Frame = +2

Query  119  TAEGSSRSA-----------DQ---PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNC  256
             AEGSSRS            DQ   PPLSRYESQKRRDWNTFGQYL+NQRPPV+LS CN 
Sbjct  10   IAEGSSRSTAAAVAAAAAAADQQNPPPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNA  69

Query  257  NHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN  436
            NHVLEFLRYLDQFGKTKVHL GCVFFGQP+PP PCTCPLRQAWGSLDALIGRLRAAYEEN
Sbjct  70   NHVLEFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEEN  129

Query  437  GGSPENNPFGNGAIRVYLREVKECQAKARGIPYkkkkkrkLNPVRGINDHNHNSTLKQS  613
            GG PE NPF +GAIR+YLREV++ QAKARGIPYKKKKK++ NP++  N+ + + T++QS
Sbjct  130  GGLPETNPFASGAIRIYLREVRDSQAKARGIPYKKKKKKR-NPLKS-NEDSSSFTIQQS  186



>ref|XP_007148048.1| hypothetical protein PHAVU_006G176100g [Phaseolus vulgaris]
 gb|ESW20042.1| hypothetical protein PHAVU_006G176100g [Phaseolus vulgaris]
Length=183

 Score =   253 bits (647),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/136 (90%), Positives = 125/136 (92%), Gaps = 3/136 (2%)
 Frame = +2

Query  137  RSADQP---PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTK  307
            R   QP   PLSRYESQKRRDWNTFGQYLKNQ PPVSLS CN NHVLEFLRYLDQFGKTK
Sbjct  23   RHQQQPVPAPLSRYESQKRRDWNTFGQYLKNQTPPVSLSLCNFNHVLEFLRYLDQFGKTK  82

Query  308  VHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVY  487
            VHL GC+FFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFG+GAIRVY
Sbjct  83   VHLHGCIFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGSGAIRVY  142

Query  488  LREVKECQAKARGIPY  535
            LREVKECQAKARGIPY
Sbjct  143  LREVKECQAKARGIPY  158



>ref|XP_008342774.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009354254.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
 ref|XP_009348397.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=185

 Score =   253 bits (647),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 132/157 (84%), Gaps = 2/157 (1%)
 Frame = +2

Query  71   SSSTTHDGAppppppTTAEGSSRSADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLS  244
            S S + +        ++A GS     Q P   SRYESQKRRDWNTFGQYLKNQRPPV+LS
Sbjct  2    SDSMSRERGKDFVEGSSAGGSPNDDQQQPATPSRYESQKRRDWNTFGQYLKNQRPPVALS  61

Query  245  HCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAA  424
             CN NHVLEFLRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAA
Sbjct  62   QCNYNHVLEFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAA  121

Query  425  YEENGGSPENNPFGNGAIRVYLREVKECQAKARGIPY  535
            YEENGGSPENNPF +GAIRVYLREV+ECQAKARGIPY
Sbjct  122  YEENGGSPENNPFASGAIRVYLREVRECQAKARGIPY  158



>emb|CAN66524.1| hypothetical protein VITISV_034969 [Vitis vinifera]
Length=158

 Score =   253 bits (645),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 130/141 (92%), Gaps = 3/141 (2%)
 Frame = +2

Query  122  AEGSSRS-ADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  292
            AEGSSRS  DQ  +  SRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYLDQ
Sbjct  10   AEGSSRSPGDQQSVTPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQ  69

Query  293  FGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNG  472
            FGKTKVHL GC+FFGQP+PPAPCTCPLRQAWGSLDAL+GRLRAAYEENGGSPE NPF +G
Sbjct  70   FGKTKVHLQGCMFFGQPEPPAPCTCPLRQAWGSLDALVGRLRAAYEENGGSPETNPFASG  129

Query  473  AIRVYLREVKECQAKARGIPY  535
            AIR+YLREV+ECQ+KARGIPY
Sbjct  130  AIRIYLREVRECQSKARGIPY  150



>ref|XP_007048693.1| Pleckstrin domain-containing family N member 1 [Theobroma cacao]
 gb|EOX92850.1| Pleckstrin domain-containing family N member 1 [Theobroma cacao]
Length=212

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 139/178 (78%), Gaps = 8/178 (4%)
 Frame = +2

Query  17   SFSPPKIRTVLLYPSMNSSSSTTHDGAppppppTTAEGSSR----SADQPPL-SRYESQK  181
            +F+PP +   L Y +  S      +          AEGSSR       QP   SRYESQK
Sbjct  15   TFNPPNL---LPYLAKESLICIDQNEMSSERGKDVAEGSSRIPGDHQQQPATPSRYESQK  71

Query  182  RRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPC  361
            RRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYLDQFGKTKVHL GC+F+GQP+PPAPC
Sbjct  72   RRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPEPPAPC  131

Query  362  TCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKARGIPY  535
            TCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIRVYLREV+ECQAKARGIPY
Sbjct  132  TCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARGIPY  189



>gb|AES67378.2| DUF640 family protein [Medicago truncatula]
Length=167

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  122  AEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGK  301
            AEG S ++    LSRYESQKRRDWNTFGQYL N RPPV LSHCN NHVLEFLRYLDQFGK
Sbjct  9    AEGGSSTSQGITLSRYESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLDQFGK  68

Query  302  TKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIR  481
            TKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGG+PE NPF +GAIR
Sbjct  69   TKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFASGAIR  128

Query  482  VYLREVKECQAKARGIPY  535
            VYLREV+ECQAKARGIPY
Sbjct  129  VYLREVRECQAKARGIPY  146



>ref|XP_003597127.1| 177 protein [Medicago truncatula]
Length=186

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  122  AEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGK  301
            AEG S ++    LSRYESQKRRDWNTFGQYL N RPPV LSHCN NHVLEFLRYLDQFGK
Sbjct  9    AEGGSSTSQGITLSRYESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLDQFGK  68

Query  302  TKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIR  481
            TKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGG+PE NPF +GAIR
Sbjct  69   TKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFASGAIR  128

Query  482  VYLREVKECQAKARGIPY  535
            VYLREV+ECQAKARGIPY
Sbjct  129  VYLREVRECQAKARGIPY  146



>ref|XP_010508549.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010508550.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010517796.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010517797.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
Length=178

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 2/134 (1%)
 Frame = +2

Query  140  SADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVH  313
            S  +PP+  SRYESQKRRDWNTFGQYLKNQRPPV +SHC+CNHVL+FLRYLDQFGKTKVH
Sbjct  15   SGSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVH  74

Query  314  LPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLR  493
            +PGC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIRVYLR
Sbjct  75   VPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLR  134

Query  494  EVKECQAKARGIPY  535
            EV+ECQAKARGIPY
Sbjct  135  EVRECQAKARGIPY  148



>ref|XP_006296565.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 ref|XP_006296566.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 gb|EOA29463.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 gb|EOA29464.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
Length=178

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 2/134 (1%)
 Frame = +2

Query  140  SADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVH  313
            S  +PP+  SRYESQKRRDWNTFGQYLKNQRPPV +SHC+CNHVL+FLRYLDQFGKTKVH
Sbjct  15   SGSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVH  74

Query  314  LPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLR  493
            +PGC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIRVYLR
Sbjct  75   VPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLR  134

Query  494  EVKECQAKARGIPY  535
            EV+ECQAKARGIPY
Sbjct  135  EVRECQAKARGIPY  148



>ref|XP_010506094.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Camelina 
sativa]
 ref|XP_010506095.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Camelina 
sativa]
Length=178

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 2/134 (1%)
 Frame = +2

Query  140  SADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVH  313
            S  +PP+  SRYESQKRRDWNTFGQYLKNQRPPV +SHC+CNHVL+FLRYLDQFGKTKVH
Sbjct  15   SGSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVH  74

Query  314  LPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLR  493
            +PGC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIRVYLR
Sbjct  75   VPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLR  134

Query  494  EVKECQAKARGIPY  535
            EV+ECQAKARGIPY
Sbjct  135  EVRECQAKARGIPY  148



>ref|XP_003540402.1| PREDICTED: uncharacterized protein LOC100802937 isoform X1 [Glycine 
max]
 ref|XP_006592869.1| PREDICTED: uncharacterized protein LOC100802937 isoform X2 [Glycine 
max]
 gb|KHN27942.1| hypothetical protein glysoja_007674 [Glycine soja]
Length=175

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 5/143 (3%)
 Frame = +2

Query  122  AEGSSRSAD---QPP--LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYL  286
             EGSS   D   Q P  LSRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYL
Sbjct  10   GEGSSSPTDNYQQSPGTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYL  69

Query  287  DQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFG  466
            DQFGKTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF 
Sbjct  70   DQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFA  129

Query  467  NGAIRVYLREVKECQAKARGIPY  535
            +G+IRVYL+EV+ECQAKARGIPY
Sbjct  130  SGSIRVYLKEVRECQAKARGIPY  152



>ref|XP_008368001.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
Length=186

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 144/177 (81%), Gaps = 3/177 (2%)
 Frame = +2

Query  89   DGAppppppTTAEGSSRSADQPP--LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNH  262
            +G+      TT     +   QPP  LSRYESQKRRDWNTFGQYL+NQRPPV+LS  N NH
Sbjct  11   EGSSSASATTTDHQQQKQTSQPPAQLSRYESQKRRDWNTFGQYLRNQRPPVALSQSNSNH  70

Query  263  VLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGG  442
            VL+FLRYLDQFGKTKVH  GCVFFGQP+PP PCTCPLRQAWGSLDALIGRLRAAYEENGG
Sbjct  71   VLDFLRYLDQFGKTKVHAQGCVFFGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGG  130

Query  443  SPENNPFGNGAIRVYLREVKECQAKARGIPYkkkkkrkLNPVRGINDHNHNSTLKQS  613
             PE NPF +GAIRVYLREV++ QAKARGIPYKKKKK++ N ++   DHN N +++QS
Sbjct  131  LPETNPFASGAIRVYLREVRDSQAKARGIPYKKKKKKR-NLMKANLDHNPNISMQQS  186



>ref|XP_009334040.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=186

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 144/177 (81%), Gaps = 3/177 (2%)
 Frame = +2

Query  89   DGAppppppTTAEGSSRSADQPP--LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNH  262
            +G+      TT     +   QPP  LSRYESQKRRDWNTFGQYL+NQRPPV+LS  N NH
Sbjct  11   EGSSSASATTTDHQQQKQTSQPPTQLSRYESQKRRDWNTFGQYLRNQRPPVALSQSNSNH  70

Query  263  VLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGG  442
            VL+FLRYLDQFGKTKVH  GCVFFGQP+PP PCTCPLRQAWGSLDALIGRLRAAYEENGG
Sbjct  71   VLDFLRYLDQFGKTKVHAQGCVFFGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGG  130

Query  443  SPENNPFGNGAIRVYLREVKECQAKARGIPYkkkkkrkLNPVRGINDHNHNSTLKQS  613
             PE NPF +GAIRVYLREV++ QAKARGIPYKKKKK++ N ++   DHN N +++QS
Sbjct  131  LPETNPFASGAIRVYLREVRDSQAKARGIPYKKKKKKR-NLMKANLDHNPNISMQQS  186



>gb|KHN36698.1| hypothetical protein glysoja_001429 [Glycine soja]
Length=175

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 135/147 (92%), Gaps = 2/147 (1%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYLDQFGKTKVHL GC+F+G
Sbjct  27   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYG  86

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +G+IRVYL+E++ECQAK
Sbjct  87   QPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLKEIRECQAK  146

Query  518  ARGIPYkkkkkrkLNPVRGINDHNHNS  598
            ARGIPYKKKKK   NP +G ND + ++
Sbjct  147  ARGIPYKKKKKAS-NPSKG-NDESSST  171



>ref|NP_001237249.1| uncharacterized protein LOC100306082 [Glycine max]
 gb|ACU14083.1| unknown [Glycine max]
Length=181

 Score =   252 bits (643),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYLKNQ PPVSLS CN NHVLEFLRYLDQFGKTKVHL GC+FF
Sbjct  30   PLSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFF  89

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGS E NPFG+GAIRVYLREVKECQA
Sbjct  90   GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSAETNPFGSGAIRVYLREVKECQA  149

Query  515  KARGIPY  535
            KARGIPY
Sbjct  150  KARGIPY  156



>ref|XP_002879996.1| hypothetical protein ARALYDRAFT_903634 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56255.1| hypothetical protein ARALYDRAFT_903634 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score =   251 bits (642),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 2/134 (1%)
 Frame = +2

Query  140  SADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVH  313
            S  +PP+  SRYESQKRRDWNTFGQYLKNQRPPV +SHC+CNHVL+FLRYLDQFGKTKVH
Sbjct  15   SGSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVH  74

Query  314  LPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLR  493
            +PGC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIRVYLR
Sbjct  75   VPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEANPFASGAIRVYLR  134

Query  494  EVKECQAKARGIPY  535
            EV+ECQAKARGIPY
Sbjct  135  EVRECQAKARGIPY  148



>ref|XP_006370148.1| hypothetical protein POPTR_0001s40140g [Populus trichocarpa]
 gb|ERP66717.1| hypothetical protein POPTR_0001s40140g [Populus trichocarpa]
Length=176

 Score =   251 bits (642),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 129/146 (88%), Gaps = 7/146 (5%)
 Frame = +2

Query  119  TAEGSSRSA----DQ---PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFL  277
             AEGSSR+     DQ   PPLSRYESQKRRDWNTFGQYL+NQRPPV+LS CN NHVLEFL
Sbjct  9    VAEGSSRAVAMAPDQQNPPPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFL  68

Query  278  RYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENN  457
            RYLDQFGKTKVHL GCVFFGQP+PP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE N
Sbjct  69   RYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETN  128

Query  458  PFGNGAIRVYLREVKECQAKARGIPY  535
            PF +GAIRVYLREV++ QAKARGIPY
Sbjct  129  PFASGAIRVYLREVRDSQAKARGIPY  154



>gb|KDP35079.1| hypothetical protein JCGZ_11031 [Jatropha curcas]
Length=169

 Score =   251 bits (641),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 139/154 (90%), Gaps = 2/154 (1%)
 Frame = +2

Query  122  AEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGK  301
            AEGS+  A   P SRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYLDQFGK
Sbjct  10   AEGSNEQAAATP-SRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGK  68

Query  302  TKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIR  481
            TKVH+ GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIR
Sbjct  69   TKVHVQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIR  128

Query  482  VYLREVKECQAKARGIPYkkkkkrkLNPVRGIND  583
            VYLREV++CQAKARGIPYKKKKK+   P +GI++
Sbjct  129  VYLREVRDCQAKARGIPYKKKKKKP-TPSKGIDE  161



>ref|XP_011013261.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Populus 
euphratica]
Length=176

 Score =   251 bits (641),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 129/146 (88%), Gaps = 7/146 (5%)
 Frame = +2

Query  119  TAEGSSRSA----DQ---PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFL  277
             AEGSSR+     DQ   PPLSRYESQKRRDWNTFGQYL+NQRPPV+LS CN NHVLEFL
Sbjct  9    VAEGSSRAVALAPDQQNPPPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFL  68

Query  278  RYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENN  457
            RYLDQFGKTKVHL GCVFFGQP+PP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE N
Sbjct  69   RYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETN  128

Query  458  PFGNGAIRVYLREVKECQAKARGIPY  535
            PF +GAIRVYLREV++ QAKARGIPY
Sbjct  129  PFASGAIRVYLREVRDSQAKARGIPY  154



>gb|ACJ85482.1| unknown [Medicago truncatula]
 gb|AFK37885.1| unknown [Medicago truncatula]
Length=167

 Score =   250 bits (639),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +2

Query  122  AEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGK  301
            AEG S ++    LSRYESQKRRDWNTFGQYL N RPPV LSHCN NHVLEFLRYLDQFGK
Sbjct  9    AEGGSSTSQGITLSRYESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLDQFGK  68

Query  302  TKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIR  481
            TKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGG+PE NPF +GAIR
Sbjct  69   TKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGAPETNPFASGAIR  128

Query  482  VYLREVKECQAKARGIPY  535
            VYLREV+EC+AKARGIPY
Sbjct  129  VYLREVRECRAKARGIPY  146



>emb|CDY55387.1| BnaA05g34250D [Brassica napus]
Length=178

 Score =   250 bits (639),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 127/134 (95%), Gaps = 2/134 (1%)
 Frame = +2

Query  140  SADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVH  313
            S  +PP+  SRYESQKRRDWNTFGQYL+NQRPP+ +SHCNCNHVL+FLRYLDQFGKTKVH
Sbjct  15   SGSEPPVTPSRYESQKRRDWNTFGQYLRNQRPPLPMSHCNCNHVLDFLRYLDQFGKTKVH  74

Query  314  LPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLR  493
            +PGC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIRVYLR
Sbjct  75   VPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLR  134

Query  494  EVKECQAKARGIPY  535
            EV+ECQAKARGIP+
Sbjct  135  EVRECQAKARGIPF  148



>ref|NP_001235660.1| uncharacterized protein LOC100306225 [Glycine max]
 gb|ACU14309.1| unknown [Glycine max]
Length=175

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 134/147 (91%), Gaps = 2/147 (1%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYLDQFGKTKVHL GC+F+G
Sbjct  27   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYG  86

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PPAPCTCPLRQAWGSLDAL GRLRAAYEENGGSPE NPF +G+IRVYL+E++ECQAK
Sbjct  87   QPEPPAPCTCPLRQAWGSLDALTGRLRAAYEENGGSPETNPFASGSIRVYLKEIRECQAK  146

Query  518  ARGIPYkkkkkrkLNPVRGINDHNHNS  598
            ARGIPYKKKKK   NP +G ND + ++
Sbjct  147  ARGIPYKKKKKAS-NPSKG-NDESSST  171



>ref|XP_011015901.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Populus 
euphratica]
Length=176

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 129/146 (88%), Gaps = 7/146 (5%)
 Frame = +2

Query  119  TAEGSSRSA----DQ---PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFL  277
             AEGSSR+     DQ   PPLSRYESQKRRDWNTFGQYL+NQRPPV+LS CN NHVLEFL
Sbjct  9    VAEGSSRAVALAPDQQNPPPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFL  68

Query  278  RYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENN  457
            RYLDQFGKTKVH+ GCVFFGQP+PP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE N
Sbjct  69   RYLDQFGKTKVHVQGCVFFGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETN  128

Query  458  PFGNGAIRVYLREVKECQAKARGIPY  535
            PF +GAIRVYLREV++ QAKARGIPY
Sbjct  129  PFASGAIRVYLREVRDSQAKARGIPY  154



>ref|NP_565978.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_850374.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9S7R3.1|LSH10_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10; AltName: 
Full=Protein ORGAN BOUNDARY 10 [Arabidopsis thaliana]
 gb|AAF24517.1|AF218765_1 177 protein [Arabidopsis thaliana]
 gb|AAD22993.1| expressed protein [Arabidopsis thaliana]
 dbj|BAC43308.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43624.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39968.1| At2g42610 [Arabidopsis thaliana]
 gb|ABQ85148.1| unknown [Arabidopsis thaliana]
 gb|ABQ85149.1| unknown [Arabidopsis thaliana]
 gb|ABQ85150.1| unknown [Arabidopsis thaliana]
 gb|ABQ85151.1| unknown [Arabidopsis thaliana]
 gb|ABQ85152.1| unknown [Arabidopsis thaliana]
 gb|ABQ85153.1| unknown [Arabidopsis thaliana]
 gb|ABQ85154.1| unknown [Arabidopsis thaliana]
 gb|ABQ85155.1| unknown [Arabidopsis thaliana]
 gb|ABQ85156.1| unknown [Arabidopsis thaliana]
 gb|ABQ85157.1| unknown [Arabidopsis thaliana]
 gb|ABQ85158.1| unknown [Arabidopsis thaliana]
 gb|ABQ85159.1| unknown [Arabidopsis thaliana]
 gb|ABQ85160.1| unknown [Arabidopsis thaliana]
 gb|ABQ85161.1| unknown [Arabidopsis thaliana]
 gb|ABQ85162.1| unknown [Arabidopsis thaliana]
 gb|ABQ85163.1| unknown [Arabidopsis thaliana]
 gb|ABQ85164.1| unknown [Arabidopsis thaliana]
 gb|ABQ85165.1| unknown [Arabidopsis thaliana]
 gb|ABQ85166.1| unknown [Arabidopsis thaliana]
 gb|ABQ85167.1| unknown [Arabidopsis thaliana]
 gb|ABQ85168.1| unknown [Arabidopsis thaliana]
 gb|ABQ85169.1| unknown [Arabidopsis thaliana]
 gb|ABQ85170.1| unknown [Arabidopsis thaliana]
 gb|ABQ85171.1| unknown [Arabidopsis thaliana]
 gb|AEC10147.1| uncharacterized protein AT2G42610 [Arabidopsis thaliana]
 gb|AEC10148.1| uncharacterized protein AT2G42610 [Arabidopsis thaliana]
Length=177

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 126/134 (94%), Gaps = 2/134 (1%)
 Frame = +2

Query  140  SADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVH  313
            S  +PP+  SRYESQKRRDWNTFGQYLKNQRPPV +SHC+CNHVL+FLRYLDQFGKTKVH
Sbjct  15   SGSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVH  74

Query  314  LPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLR  493
            +PGC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPF +GAIRVYLR
Sbjct  75   VPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGPPETNPFASGAIRVYLR  134

Query  494  EVKECQAKARGIPY  535
            EV+ECQAKARGIPY
Sbjct  135  EVRECQAKARGIPY  148



>ref|XP_004487154.1| PREDICTED: uncharacterized protein LOC101499419 [Cicer arietinum]
Length=166

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYL NQRPP+ LSHCNCNHVLEFLRYLDQFGKTKVHL GC+FFG
Sbjct  19   LSRYESQKRRDWNTFGQYLNNQRPPIPLSHCNCNHVLEFLRYLDQFGKTKVHLQGCMFFG  78

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGS E NPF + AIRVYLREV+ECQAK
Sbjct  79   QPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFASSAIRVYLREVRECQAK  138

Query  518  ARGIPY  535
            ARGIPY
Sbjct  139  ARGIPY  144



>ref|XP_004293946.1| PREDICTED: uncharacterized protein LOC101295692 isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004293947.1| PREDICTED: uncharacterized protein LOC101295692 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=187

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYLKNQ PPV +SHC  NHVL+FLRYLDQFGKTKVHL  CVFFG
Sbjct  36   LSRYESQKRRDWNTFGQYLKNQTPPVPMSHCQFNHVLDFLRYLDQFGKTKVHLHCCVFFG  95

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GG+PE NPFGNGAIRVYLREVKECQAK
Sbjct  96   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGAPETNPFGNGAIRVYLREVKECQAK  155

Query  518  ARGIPYkkkkkrkLNPVRGIND  583
            ARGIPYKKKKKR+ N ++ I+D
Sbjct  156  ARGIPYKKKKKRRNNQLKAISD  177



>ref|XP_010104392.1| hypothetical protein L484_010344 [Morus notabilis]
 gb|EXC00237.1| hypothetical protein L484_010344 [Morus notabilis]
Length=173

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 139/161 (86%), Gaps = 2/161 (1%)
 Frame = +2

Query  122  AEGSSRSADQPPL-SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFG  298
            AEGS      P   SRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYLDQFG
Sbjct  10   AEGSGSDQPTPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFG  69

Query  299  KTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAI  478
            KTKVH+ GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPF +GAI
Sbjct  70   KTKVHVQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGFPETNPFASGAI  129

Query  479  RVYLREVKECQAKARGIPYkkkkkrkLNPVRGINDHNHNST  601
            RVYLREV+ECQAKARGIPYKKKKK+     +G NDH+ +S+
Sbjct  130  RVYLREVRECQAKARGIPYKKKKKKPDQITKG-NDHDESSS  169



>ref|XP_006411528.1| hypothetical protein EUTSA_v10017308mg [Eutrema salsugineum]
 gb|ESQ52981.1| hypothetical protein EUTSA_v10017308mg [Eutrema salsugineum]
Length=177

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 126/134 (94%), Gaps = 2/134 (1%)
 Frame = +2

Query  140  SADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVH  313
            S  +PP+  SRYESQKRRDWNTFGQYLKNQRP V +SHC+CNHVL+FLRYLDQFGKTKVH
Sbjct  15   SGSEPPVTPSRYESQKRRDWNTFGQYLKNQRPSVPMSHCSCNHVLDFLRYLDQFGKTKVH  74

Query  314  LPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLR  493
            +PGC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIRVYLR
Sbjct  75   VPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLR  134

Query  494  EVKECQAKARGIPY  535
            EV+ECQAKARGIPY
Sbjct  135  EVRECQAKARGIPY  148



>gb|KHG07235.1| Putative beta-lactamase-like 1 [Gossypium arboreum]
Length=175

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 128/144 (89%), Gaps = 5/144 (3%)
 Frame = +2

Query  119  TAEGSSRS--ADQ---PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRY  283
             AEG SR    DQ   P  SRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRY
Sbjct  9    IAEGPSRVNPGDQQLPPTPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRY  68

Query  284  LDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPF  463
            LDQFGKTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF
Sbjct  69   LDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPF  128

Query  464  GNGAIRVYLREVKECQAKARGIPY  535
             +GAIRVYLREV+ECQAKARGIPY
Sbjct  129  ASGAIRVYLREVRECQAKARGIPY  152



>ref|XP_007132855.1| hypothetical protein PHAVU_011G130300g [Phaseolus vulgaris]
 gb|ESW04849.1| hypothetical protein PHAVU_011G130300g [Phaseolus vulgaris]
Length=183

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYLDQFGKTKVHL GC+F+G
Sbjct  36   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYG  95

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +G+IRVYLREV+ECQAK
Sbjct  96   QPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAK  155

Query  518  ARGIPY  535
            ARGIPY
Sbjct  156  ARGIPY  161



>ref|XP_006442502.1| hypothetical protein CICLE_v10022456mg [Citrus clementina]
 ref|XP_006477739.1| PREDICTED: uncharacterized protein LOC102620640 [Citrus sinensis]
 gb|ESR55742.1| hypothetical protein CICLE_v10022456mg [Citrus clementina]
 gb|KDO47016.1| hypothetical protein CISIN_1g029917mg [Citrus sinensis]
Length=185

 Score =   249 bits (637),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 134/147 (91%), Gaps = 1/147 (1%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYL+NQRPPV+LS CN NHVL+FLRYLDQFGKTKVHL GCVFF
Sbjct  36   PLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLDFLRYLDQFGKTKVHLQGCVFF  95

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQP+PP PC+CPL+QAWGSLDALIGRLRAAYEENGG PE NPF +GAIR+YLREV++ QA
Sbjct  96   GQPEPPGPCSCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRIYLREVRDSQA  155

Query  515  KARGIPYkkkkkrkLNPVRGINDHNHN  595
            KARGIPYKKKKK+++  V+  NDH+ N
Sbjct  156  KARGIPYKKKKKKRMT-VKATNDHSSN  181



>emb|CDP15936.1| unnamed protein product [Coffea canephora]
Length=170

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTFGQYLKNQRPPV LS CN +HVLEFLRYLDQFGKTKVHL GC+F+GQ
Sbjct  21   SRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSSHVLEFLRYLDQFGKTKVHLQGCMFYGQ  80

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE+NPF +GAIRVYLREVKECQAKA
Sbjct  81   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPESNPFASGAIRVYLREVKECQAKA  140

Query  521  RGIPYkkkkkrkLNPVRGINDHNHNSTL  604
            RGIPYKKKKK+  +P  G  D   +S+L
Sbjct  141  RGIPYKKKKKKT-SPSGGKGDDESSSSL  167



>ref|XP_006446791.1| hypothetical protein CICLE_v10016699mg [Citrus clementina]
 gb|ESR60031.1| hypothetical protein CICLE_v10016699mg [Citrus clementina]
Length=209

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 136/176 (77%), Gaps = 5/176 (3%)
 Frame = +2

Query  23   SPPKIRTVLLYPSMNSSSSTTHDGAppppp-pTTAEGSS---RSADQPPL-SRYESQKRR  187
            SP KI   L   + N +       A         AEGSS       QP   SRYESQKRR
Sbjct  11   SPSKIDVCLSKTNQNLTYHLHQSQAMSSDRGKEIAEGSSDHHHQLQQPATPSRYESQKRR  70

Query  188  DWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTC  367
            DWNTFGQYLKNQRPPV LS C+CNHVL+FLRYLDQFGKTKVHL GC+F+GQP+PPAPCTC
Sbjct  71   DWNTFGQYLKNQRPPVPLSQCSCNHVLDFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTC  130

Query  368  PLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKARGIPY  535
            PLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIRVYLREV+ECQAKARGIPY
Sbjct  131  PLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKARGIPY  186



>ref|XP_010525031.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
 ref|XP_010525039.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=178

 Score =   249 bits (636),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +2

Query  116  TTAEGSSRSADQPPL-SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  292
            +  EG      QP   SRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYLDQ
Sbjct  10   SLMEGPGSGEQQPATPSRYESQKRRDWNTFGQYLKNQRPPVHLSQCNCNHVLDFLRYLDQ  69

Query  293  FGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNG  472
            FGKTKVH+PGC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF  G
Sbjct  70   FGKTKVHVPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEMNPFATG  129

Query  473  AIRVYLREVKECQAKARGIPY  535
            AIRVYLREV+ECQAKARGIPY
Sbjct  130  AIRVYLREVRECQAKARGIPY  150



>ref|XP_009142076.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Brassica 
rapa]
 emb|CDY47983.1| BnaA04g24610D [Brassica napus]
Length=176

 Score =   249 bits (635),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 125/134 (93%), Gaps = 2/134 (1%)
 Frame = +2

Query  140  SADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVH  313
            S  +PP+  SRYESQKRRDWNTFGQYLKNQRPPV +SHC+CNHVL+FLRYLDQFGKTKVH
Sbjct  15   SGSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVH  74

Query  314  LPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLR  493
            + GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF  GAIRVYLR
Sbjct  75   VFGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFATGAIRVYLR  134

Query  494  EVKECQAKARGIPY  535
            EV+ECQAKARGIPY
Sbjct  135  EVRECQAKARGIPY  148



>ref|XP_002530382.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32002.1| conserved hypothetical protein [Ricinus communis]
Length=197

 Score =   249 bits (637),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 136/149 (91%), Gaps = 1/149 (1%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            PPLSRYESQKRRDWNTFGQYL+NQRPPV+LS CN NHVL+FLRYLDQFGKTKVHL GCVF
Sbjct  46   PPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLDFLRYLDQFGKTKVHLQGCVF  105

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FGQP+PP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE NPF +GAIRV+LREV++ Q
Sbjct  106  FGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVHLREVRDSQ  165

Query  512  AKARGIPYkkkkkrkLNPVRGINDHNHNS  598
            AKARGIPYKKKKK++ NP++ I DH  +S
Sbjct  166  AKARGIPYKKKKKKR-NPMKAITDHESSS  193



>ref|XP_004243287.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=167

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTFGQYL+NQRPPVS+S CN NHVLEFLRYLDQFGKTKVHL GC+F+GQ
Sbjct  20   SRYESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  79

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIRVYLREVKECQAKA
Sbjct  80   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQAKA  139

Query  521  RGIPY  535
            RGIPY
Sbjct  140  RGIPY  144



>ref|XP_009142855.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142857.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142858.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142859.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142860.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
Length=178

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 127/134 (95%), Gaps = 2/134 (1%)
 Frame = +2

Query  140  SADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVH  313
            S  +PP+  SRYESQKRRDWNTFGQYL+NQRPP+ +SHCNCNHVL+FLR+LDQFGKTKVH
Sbjct  15   SGSEPPVTPSRYESQKRRDWNTFGQYLRNQRPPLPMSHCNCNHVLDFLRHLDQFGKTKVH  74

Query  314  LPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLR  493
            +PGC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIRVYLR
Sbjct  75   VPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLR  134

Query  494  EVKECQAKARGIPY  535
            EV+ECQAKARGIP+
Sbjct  135  EVRECQAKARGIPF  148



>ref|XP_006469013.1| PREDICTED: uncharacterized protein LOC102606613 [Citrus sinensis]
 gb|KDO63369.1| hypothetical protein CISIN_1g047785mg [Citrus sinensis]
Length=174

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 127/143 (89%), Gaps = 4/143 (3%)
 Frame = +2

Query  119  TAEGSS---RSADQPPL-SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYL  286
             AEGSS       QP   SRYESQKRRDWNTFGQYLKNQRPPV LS C+CNHVL+FLRYL
Sbjct  9    IAEGSSDHHHQLQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCSCNHVLDFLRYL  68

Query  287  DQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFG  466
            DQFGKTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF 
Sbjct  69   DQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFA  128

Query  467  NGAIRVYLREVKECQAKARGIPY  535
            +GAIRVYLREV+ECQAKARGIPY
Sbjct  129  SGAIRVYLREVRECQAKARGIPY  151



>ref|XP_007215057.1| hypothetical protein PRUPE_ppa012217mg [Prunus persica]
 ref|XP_008229093.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Prunus 
mume]
 gb|EMJ16256.1| hypothetical protein PRUPE_ppa012217mg [Prunus persica]
Length=179

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 133/148 (90%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTFGQYLKNQRPPV LS CN NHVLEFLRYLDQFGKTKVHL GC+F+GQ
Sbjct  30   SRYESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLRYLDQFGKTKVHLQGCMFYGQ  89

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIRVYLREV+ECQAKA
Sbjct  90   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQAKA  149

Query  521  RGIPYkkkkkrkLNPVRGINDHNHNSTL  604
            RGIPYKKKKK+     +G ND   +ST+
Sbjct  150  RGIPYKKKKKKPSP-SKGGNDDESSSTM  176



>ref|XP_007149738.1| hypothetical protein PHAVU_005G095100g [Phaseolus vulgaris]
 gb|AGV54192.1| hypothetical protein [Phaseolus vulgaris]
 gb|ESW21732.1| hypothetical protein PHAVU_005G095100g [Phaseolus vulgaris]
Length=165

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  128  GSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTK  307
            G   S+    LSRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYLDQFGKTK
Sbjct  10   GEGSSSPTGTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTK  69

Query  308  VHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVY  487
            VHL GCVF+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF   +IR+Y
Sbjct  70   VHLQGCVFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFATSSIRLY  129

Query  488  LREVKECQAKARGIPY  535
            L+E++ECQAKARGIPY
Sbjct  130  LKEIRECQAKARGIPY  145



>ref|XP_003526225.1| PREDICTED: uncharacterized protein LOC100815968 [Glycine max]
 gb|KHN33957.1| hypothetical protein glysoja_036764 [Glycine soja]
Length=179

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYLKNQRPPV LS CNCN VL+FLRYLDQFGKTKVHL GC+F+G
Sbjct  31   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNQVLDFLRYLDQFGKTKVHLQGCMFYG  90

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +G+IRVYLREV+ECQAK
Sbjct  91   QPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAK  150

Query  518  ARGIPY  535
            ARGIPY
Sbjct  151  ARGIPY  156



>ref|XP_010108230.1| hypothetical protein L484_018651 [Morus notabilis]
 gb|EXC18470.1| hypothetical protein L484_018651 [Morus notabilis]
Length=184

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = +2

Query  71   SSSTTHDGAppppppTTAEGSSRSADQPP-LSRYESQKRRDWNTFGQYLKNQRPPVSLSH  247
            SS+   D A      +  + +S +A QPP LSRYESQKRR W TFGQYL+NQRPPV+LS 
Sbjct  2    SSNKGKDAADGSSSSSRPQPASSTAQQPPPLSRYESQKRRGWETFGQYLRNQRPPVALSQ  61

Query  248  CNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAY  427
            CN NHVL+FLRYLDQFGKTKVHL GCVFFGQP+PP PC+CPLRQAWGSLDALIGRLRAAY
Sbjct  62   CNGNHVLDFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCSCPLRQAWGSLDALIGRLRAAY  121

Query  428  EENGGSPENNPFGNGAIRVYLREVKECQAKARGIPYkkkkkrkLNPVRGINDHNH  592
            EENGG PE NPF +GAIRVYLR+V++ QAKARGIPY KKKK++ N +   NDH+H
Sbjct  122  EENGGLPETNPFASGAIRVYLRDVRDSQAKARGIPYTKKKKKR-NLINKSNDHDH  175



>ref|XP_002521586.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40857.1| conserved hypothetical protein [Ricinus communis]
Length=174

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 127/141 (90%), Gaps = 3/141 (2%)
 Frame = +2

Query  122  AEGSSR--SADQPPL-SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  292
            AEGSS      QP   SRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYLDQ
Sbjct  10   AEGSSELHQQHQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQ  69

Query  293  FGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNG  472
            FGKTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +G
Sbjct  70   FGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASG  129

Query  473  AIRVYLREVKECQAKARGIPY  535
            AIRV+LREV++CQAKARGIPY
Sbjct  130  AIRVFLREVRDCQAKARGIPY  150



>ref|XP_002317458.1| hypothetical protein POPTR_0011s11120g [Populus trichocarpa]
 gb|EEE98070.1| hypothetical protein POPTR_0011s11120g [Populus trichocarpa]
Length=176

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 127/146 (87%), Gaps = 7/146 (5%)
 Frame = +2

Query  119  TAEGSSRSA----DQ---PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFL  277
             AEGSSR      DQ   PPLSRYESQKRRDWNTFGQYL+NQRPPV+LS CN N VL+FL
Sbjct  9    IAEGSSRGGANAPDQQSPPPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNANQVLDFL  68

Query  278  RYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENN  457
            RYLDQFGKTKVHL GCVFFGQP+PP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE N
Sbjct  69   RYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETN  128

Query  458  PFGNGAIRVYLREVKECQAKARGIPY  535
            PF +GAIRVYLREV++ QAKARGIPY
Sbjct  129  PFASGAIRVYLREVRDSQAKARGIPY  154



>emb|CDY14848.1| BnaC04g48450D [Brassica napus]
Length=177

 Score =   246 bits (627),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTFGQYLKNQRPPV +SHC+CNHVL+FLRYLDQFGKTKVH+ GC+F+GQ
Sbjct  24   SRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVFGCMFYGQ  83

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF  GAIRVYLREV+ECQAKA
Sbjct  84   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFATGAIRVYLREVRECQAKA  143

Query  521  RGIPY  535
            RGIPY
Sbjct  144  RGIPY  148



>ref|XP_009343797.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=181

 Score =   246 bits (628),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  116  TTAEGSSRSADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLD  289
            ++A GS     Q P   SRYESQKRRDWNTFGQYLKNQRPPV+LS  N NHVLEFLRYLD
Sbjct  13   SSAGGSLNDDQQQPATPSRYESQKRRDWNTFGQYLKNQRPPVALSQSNYNHVLEFLRYLD  72

Query  290  QFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGN  469
            QFGKTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPF +
Sbjct  73   QFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFAS  132

Query  470  GAIRVYLREVKECQAKARGIPY  535
            GAIRVYLREV+ECQA ARGIP+
Sbjct  133  GAIRVYLREVRECQAMARGIPF  154



>ref|XP_008381217.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
Length=181

 Score =   246 bits (628),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +2

Query  116  TTAEGSSRSADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLD  289
            ++A GS     Q P   SRYESQKRRDWNTFGQYLKNQRPPV+LS  N NHVLEFLRYLD
Sbjct  13   SSAGGSLNDDQQQPATPSRYESQKRRDWNTFGQYLKNQRPPVALSQSNYNHVLEFLRYLD  72

Query  290  QFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGN  469
            QFGKTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPF +
Sbjct  73   QFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFAS  132

Query  470  GAIRVYLREVKECQAKARGIPY  535
            GAIRVYLREV+ECQA ARGIP+
Sbjct  133  GAIRVYLREVRECQAMARGIPF  154



>ref|XP_007212123.1| hypothetical protein PRUPE_ppa012057mg [Prunus persica]
 gb|EMJ13322.1| hypothetical protein PRUPE_ppa012057mg [Prunus persica]
Length=185

 Score =   246 bits (627),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 135/152 (89%), Gaps = 1/152 (1%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYL+NQRPPV+LS  N NHVL+FLRYLDQFGKTKVHL GCVFFG
Sbjct  35   LSRYESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHLQGCVFFG  94

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PP PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPF +GAIRVYLREV++ QAK
Sbjct  95   QPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAK  154

Query  518  ARGIPYkkkkkrkLNPVRGINDHNHNSTLKQS  613
            ARGIPYKKKKK++ N ++   DHN N T+ QS
Sbjct  155  ARGIPYKKKKKKR-NLLKANLDHNPNFTMHQS  185



>ref|XP_008226537.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Prunus 
mume]
Length=186

 Score =   246 bits (627),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 135/152 (89%), Gaps = 1/152 (1%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYL+NQRPPV+LS  N NHVL+FLRYLDQFGKTKVHL GCVFFG
Sbjct  36   LSRYESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVLDFLRYLDQFGKTKVHLQGCVFFG  95

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PP PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPF +GAIRVYLREV++ QAK
Sbjct  96   QPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQAK  155

Query  518  ARGIPYkkkkkrkLNPVRGINDHNHNSTLKQS  613
            ARGIPYKKKKK++ N ++   DHN N T+ QS
Sbjct  156  ARGIPYKKKKKKR-NLLKANLDHNPNFTMHQS  186



>ref|XP_010327093.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=178

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 136/157 (87%), Gaps = 4/157 (3%)
 Frame = +2

Query  122  AEGSSRS--ADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQF  295
            AEGSSRS   DQPP SRYESQKRRDWNTF  YLKNQRPP+ L HC+ NHVLEFLRYLDQF
Sbjct  12   AEGSSRSPGRDQPP-SRYESQKRRDWNTFNHYLKNQRPPILLPHCHSNHVLEFLRYLDQF  70

Query  296  GKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGA  475
            GKTKVHL GC+F+GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGS E NPF +  
Sbjct  71   GKTKVHLLGCMFYGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSSETNPFASVG  130

Query  476  IRVYLREVKECQAKARGIPYkkkkkrkLN-PVRGIND  583
            IRVYLREVKECQAKARGI YKKK+K+  N P +G +D
Sbjct  131  IRVYLREVKECQAKARGIAYKKKQKKLANSPSKGDHD  167



>ref|XP_010524062.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=176

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYLDQFGKTKVH PGC+F+GQ
Sbjct  26   SRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHAPGCMFYGQ  85

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PPAPC CPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIRV+LREV+ECQAKA
Sbjct  86   PEPPAPCICPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVFLREVRECQAKA  145

Query  521  RGIPY  535
            RGIPY
Sbjct  146  RGIPY  150



>ref|XP_009626514.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=176

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 135/157 (86%), Gaps = 4/157 (3%)
 Frame = +2

Query  122  AEGSSRSADQPPL---SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  292
            AEGSSRS     +   SRYESQKRRDWNTF QYL+NQR P+ LS CN NHVLEFLRYLDQ
Sbjct  11   AEGSSRSPGDQSITTPSRYESQKRRDWNTFNQYLRNQRQPIPLSQCNSNHVLEFLRYLDQ  70

Query  293  FGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNG  472
            FGKTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF + 
Sbjct  71   FGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFAST  130

Query  473  AIRVYLREVKECQAKARGIPYkkkkkrkLNPVRGIND  583
            AIRVYLREVKECQAKARGI YKKK+K+  +P +G +D
Sbjct  131  AIRVYLREVKECQAKARGIAYKKKQKKA-SPSKGDDD  166



>ref|XP_002285447.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Vitis 
vinifera]
Length=220

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 133/164 (81%), Gaps = 2/164 (1%)
 Frame = +2

Query  44   VLLYPSMNSSSSTTHDGAppppppTTAEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQ  223
            +LL  S + SS+   D        ++AE   +    PPLSRYESQKRRDWNTFGQ+LKNQ
Sbjct  35   ILLGNSSDMSSNKGKDTGEGSSTRSSAEDQQQQP--PPLSRYESQKRRDWNTFGQFLKNQ  92

Query  224  RPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDAL  403
            RPPV+L+ CN N VL+FLRYLDQFGKTKVHL GCV+FGQP+PP PCTCPL+QAWGSLDAL
Sbjct  93   RPPVALAQCNSNQVLDFLRYLDQFGKTKVHLQGCVYFGQPEPPGPCTCPLKQAWGSLDAL  152

Query  404  IGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKARGIPY  535
            IGRLRAAYEENGG PE NPF +GAIR+YLREV++ QAKARG+PY
Sbjct  153  IGRLRAAYEENGGLPEKNPFASGAIRIYLREVRDSQAKARGVPY  196



>ref|XP_008448236.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=200

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 126/142 (89%), Gaps = 7/142 (5%)
 Frame = +2

Query  122  AEGSSRSADQPPL----SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLD  289
             EGSS S   PP     SRYESQKRRDWNTFGQYLKNQRPPV+LS CN NHVLEFLRYLD
Sbjct  16   GEGSSNS---PPTATTPSRYESQKRRDWNTFGQYLKNQRPPVALSQCNFNHVLEFLRYLD  72

Query  290  QFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGN  469
            QFGKTKVH+ GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPE NPF +
Sbjct  73   QFGKTKVHVQGCMFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFAS  132

Query  470  GAIRVYLREVKECQAKARGIPY  535
             +IRVYLREV+ECQAKARGIPY
Sbjct  133  ASIRVYLREVRECQAKARGIPY  154



>ref|XP_009339946.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Pyrus 
x bretschneideri]
Length=183

 Score =   244 bits (623),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 141/175 (81%), Gaps = 12/175 (7%)
 Frame = +2

Query  122  AEGSS----------RSADQPP-LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVL  268
            AEGSS          + A QP  LSRYESQKRRDWNTFGQYL+NQRPPV+LS  N NHVL
Sbjct  10   AEGSSSASATDHRQQKQASQPAQLSRYESQKRRDWNTFGQYLRNQRPPVALSQSNSNHVL  69

Query  269  EFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP  448
            +FLRYLDQFGKTKVHL GCVFFGQP+PP PCTCPLRQAWGSLDALIGRLRAAYEENGG P
Sbjct  70   DFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLP  129

Query  449  ENNPFGNGAIRVYLREVKECQAKARGIPYkkkkkrkLNPVRGINDHNHNSTLKQS  613
            E NPF  GAIRVYLREV++ QAKARGIPYKKKKK++      + D+N N +L QS
Sbjct  130  ETNPFATGAIRVYLREVRDSQAKARGIPYKKKKKKRKLMKANL-DNNPNISLHQS  183



>gb|AFK41138.1| unknown [Lotus japonicus]
Length=173

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 126/149 (85%), Gaps = 9/149 (6%)
 Frame = +2

Query  116  TTAEGSSRSADQ-----PP----LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVL  268
             ++ G   +ADQ     PP    LSRYESQKRRDWNTFGQYL NQRPPV LS CN NHV+
Sbjct  1    MSSSGKDLAADQGSSTSPPIGATLSRYESQKRRDWNTFGQYLNNQRPPVPLSQCNFNHVM  60

Query  269  EFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP  448
            EFLRYLDQFGKTKVHL GCV+FG P+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP
Sbjct  61   EFLRYLDQFGKTKVHLQGCVYFGMPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP  120

Query  449  ENNPFGNGAIRVYLREVKECQAKARGIPY  535
            E NPF +G IRVYLREV+ECQAKARGIPY
Sbjct  121  EANPFASGFIRVYLREVRECQAKARGIPY  149



>ref|XP_011083008.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Sesamum 
indicum]
Length=172

 Score =   243 bits (620),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTFGQ+LKNQRPPV+L  CN NHVL+FLRYLDQFGKTKVHL GC+F+GQ
Sbjct  25   SRYESQKRRDWNTFGQFLKNQRPPVALPQCNSNHVLDFLRYLDQFGKTKVHLQGCIFYGQ  84

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +GAIR+YLREVKECQAKA
Sbjct  85   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRIYLREVKECQAKA  144

Query  521  RGIPY  535
            RGIPY
Sbjct  145  RGIPY  149



>gb|KDP34762.1| hypothetical protein JCGZ_10542 [Jatropha curcas]
Length=184

 Score =   243 bits (620),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            PPLSRYESQKRRDWNTFGQYL+NQRPPV+L++CN  HVL+FLRYLDQFGKTKVHL GCVF
Sbjct  34   PPLSRYESQKRRDWNTFGQYLRNQRPPVTLANCNATHVLDFLRYLDQFGKTKVHLQGCVF  93

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FGQP+PP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE NPF +GAIRVYLREV++ Q
Sbjct  94   FGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQ  153

Query  512  AKARGIPYkkkkkrkLNPVRGIND  583
            AKARGIPYKKKKK++  P++  N+
Sbjct  154  AKARGIPYKKKKKKRNIPIKASNE  177



>ref|XP_004294145.1| PREDICTED: uncharacterized protein LOC101307097 [Fragaria vesca 
subsp. vesca]
Length=194

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 139/156 (89%), Gaps = 4/156 (3%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYL+NQRPPV+LS  N +HVL+FLRYLDQFGKTKVHL GCVFFG
Sbjct  40   LSRYESQKRRDWNTFGQYLRNQRPPVALSQSNSSHVLDFLRYLDQFGKTKVHLQGCVFFG  99

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PP PCTCPLRQAWGSLDALIGRLRAAYEENGG PE+NPF +GAIRVYLREV++ QAK
Sbjct  100  QPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPESNPFASGAIRVYLREVRDSQAK  159

Query  518  ARGIPYkkkkkrkLNPVRGINDHNHN---STLKQSS  616
            ARGIPYKKKKK++ N ++  +DH+ N   +T++Q S
Sbjct  160  ARGIPYKKKKKKR-NLIKANHDHSSNPNFTTMQQRS  194



>ref|XP_002320411.1| hypothetical protein POPTR_0014s13900g [Populus trichocarpa]
 gb|ABK93899.1| unknown [Populus trichocarpa]
 gb|EEE98726.1| hypothetical protein POPTR_0014s13900g [Populus trichocarpa]
Length=170

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  119  TAEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFG  298
             AEGSS +      SRYESQKRRDWNTFGQYLKNQRPPV LS CN NHVL+FLRYLDQFG
Sbjct  9    IAEGSSENQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFG  68

Query  299  KTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAI  478
            KTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGG+PE NPF N +I
Sbjct  69   KTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFANASI  128

Query  479  RVYLREVKECQAKARGIPY  535
            RVYLREV++ QAKARGIP+
Sbjct  129  RVYLREVRDYQAKARGIPH  147



>ref|XP_010062813.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 ref|XP_010062814.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 ref|XP_010062815.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 gb|KCW69948.1| hypothetical protein EUGRSUZ_F03266 [Eucalyptus grandis]
Length=182

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 126/149 (85%), Gaps = 10/149 (7%)
 Frame = +2

Query  119  TAEGSSRSADQP----------PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVL  268
             AEGSSRS   P          PLSRYESQKRRDWNTFGQYL+NQRPP++++  N NHVL
Sbjct  9    MAEGSSRSTASPNDQHHQQRVLPLSRYESQKRRDWNTFGQYLRNQRPPIAITQFNSNHVL  68

Query  269  EFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP  448
            +FLRYLDQFGKTKVHL GC++FGQP+PP PCTCPLRQAWGSLDALIGRLRAAYEENGG P
Sbjct  69   DFLRYLDQFGKTKVHLHGCIYFGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLP  128

Query  449  ENNPFGNGAIRVYLREVKECQAKARGIPY  535
            E NPF +G+IR+YLREVK+ QAKARGIPY
Sbjct  129  EANPFASGSIRMYLREVKDSQAKARGIPY  157



>ref|XP_004136831.1| PREDICTED: uncharacterized protein LOC101208687 [Cucumis sativus]
 ref|XP_004155471.1| PREDICTED: uncharacterized protein LOC101230404 [Cucumis sativus]
 gb|KGN43628.1| hypothetical protein Csa_7G048120 [Cucumis sativus]
Length=189

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYLKNQRPPV LSHCNCN VLEFLRYLDQFGKTKVH+ GC+F+GQ
Sbjct  32   SRYESQKRRDWNTFCQYLKNQRPPVPLSHCNCNQVLEFLRYLDQFGKTKVHIQGCMFYGQ  91

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGS E NPF +GAIRVYLR+V+ECQAKA
Sbjct  92   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFASGAIRVYLRDVRECQAKA  151

Query  521  RGIPY  535
            RGIPY
Sbjct  152  RGIPY  156



>ref|XP_011033736.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
 ref|XP_011033737.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
 ref|XP_011033738.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
Length=170

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  119  TAEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFG  298
             AEGSS +      SRYESQKRRDWNTFGQYLKNQRPPV LS CN NHVL+FLRYLDQFG
Sbjct  9    VAEGSSENQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFG  68

Query  299  KTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAI  478
            KTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGG+PE NPF N +I
Sbjct  69   KTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFANASI  128

Query  479  RVYLREVKECQAKARGIPY  535
            RVYLREV++ QAKARGIP+
Sbjct  129  RVYLREVRDYQAKARGIPH  147



>ref|XP_008455303.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Cucumis 
melo]
Length=188

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYLKNQRPPV LSHCNCN VLEFLRYLDQFGKTKVH+ GC+F+GQ
Sbjct  31   SRYESQKRRDWNTFCQYLKNQRPPVPLSHCNCNQVLEFLRYLDQFGKTKVHIQGCMFYGQ  90

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGS E NPF +GAIRVYLR+V+ECQAKA
Sbjct  91   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFASGAIRVYLRDVRECQAKA  150

Query  521  RGIPY  535
            RGIPY
Sbjct  151  RGIPY  155



>emb|CAN63025.1| hypothetical protein VITISV_034817 [Vitis vinifera]
Length=177

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 127/146 (87%), Gaps = 7/146 (5%)
 Frame = +2

Query  119  TAEGSS---RSADQ----PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFL  277
            T EGSS    + DQ    PPLSRYESQKRRDWNTFGQ+LKNQRPPV+L+ CN N VL+FL
Sbjct  8    TGEGSSTRSSAEDQQQQPPPLSRYESQKRRDWNTFGQFLKNQRPPVALAQCNSNQVLDFL  67

Query  278  RYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENN  457
            RYLDQFGKTKVHL GCV+FGQP+PP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE N
Sbjct  68   RYLDQFGKTKVHLQGCVYFGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPEKN  127

Query  458  PFGNGAIRVYLREVKECQAKARGIPY  535
            PF +GAIR+YLREV++ QAKARG+PY
Sbjct  128  PFASGAIRIYLREVRDSQAKARGVPY  153



>ref|XP_010035859.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Eucalyptus 
grandis]
 gb|KCW47341.1| hypothetical protein EUGRSUZ_K01128 [Eucalyptus grandis]
Length=174

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 125/141 (89%), Gaps = 3/141 (2%)
 Frame = +2

Query  122  AEGSSRS--ADQPPL-SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  292
             EGSSRS  +D P   SRYESQKRRDWN F QYLKNQRPPV LS CN  HVLEFLRYLDQ
Sbjct  10   VEGSSRSPGSDSPATPSRYESQKRRDWNAFIQYLKNQRPPVPLSQCNYTHVLEFLRYLDQ  69

Query  293  FGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNG  472
            FGKTKVH+ GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGG+PE NPF +G
Sbjct  70   FGKTKVHIQGCIFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFASG  129

Query  473  AIRVYLREVKECQAKARGIPY  535
            AIRVYLREV++CQ+KARGIPY
Sbjct  130  AIRVYLREVRDCQSKARGIPY  150



>ref|XP_004303183.1| PREDICTED: uncharacterized protein LOC101307414 [Fragaria vesca 
subsp. vesca]
Length=209

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTFGQYL+NQRPPV LS CN +HVLEFLRYLDQFGKTKVHL GC+F+GQ
Sbjct  38   SRYESQKRRDWNTFGQYLRNQRPPVPLSQCNYSHVLEFLRYLDQFGKTKVHLQGCMFYGQ  97

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGG+PE+NPF +GAIRVYLREV+ECQAKA
Sbjct  98   PEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGAPESNPFASGAIRVYLREVRECQAKA  157

Query  521  RGIPY  535
            RGIPY
Sbjct  158  RGIPY  162



>gb|KHG29970.1| Putative beta-lactamase-like 1 [Gossypium arboreum]
Length=161

 Score =   240 bits (612),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 125/140 (89%), Gaps = 7/140 (5%)
 Frame = +2

Query  119  TAEGSSRSA----DQP---PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFL  277
            +AEGSSRS+     QP   PLSRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FL
Sbjct  9    SAEGSSRSSGNHQQQPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFL  68

Query  278  RYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENN  457
            RYLDQFGKTKVHL GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE N
Sbjct  69   RYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETN  128

Query  458  PFGNGAIRVYLREVKECQAK  517
            PFGNGAIRVYLRE  + +A+
Sbjct  129  PFGNGAIRVYLREDDKAKAE  148



>ref|XP_003607586.1| 177 protein [Medicago truncatula]
 gb|AES89783.1| DUF640 family protein [Medicago truncatula]
Length=176

 Score =   241 bits (614),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +2

Query  125  EGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKT  304
            E SS +     LSRYESQKRRDWNTFGQYL N RPPV LS CN NHVL+FLRYLDQFGKT
Sbjct  16   ETSSTTISVATLSRYESQKRRDWNTFGQYLNNMRPPVPLSQCNSNHVLDFLRYLDQFGKT  75

Query  305  KVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRV  484
            KVH+ GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP+ NPF +G+IRV
Sbjct  76   KVHVQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPDTNPFASGSIRV  135

Query  485  YLREVKECQAKARGIPY  535
            YLRE++E QAKARGIPY
Sbjct  136  YLREIRESQAKARGIPY  152



>ref|XP_003596364.1| 177 protein [Medicago truncatula]
 gb|AES66615.1| DUF640 family protein [Medicago truncatula]
Length=178

 Score =   241 bits (614),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 127/149 (85%), Gaps = 10/149 (7%)
 Frame = +2

Query  119  TAEGSSRSA----------DQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVL  268
              EGSSRS+           Q PLSRYESQKRRDWNTFGQYL+NQRPPV+LS+CN NHVL
Sbjct  8    IVEGSSRSSIGDDQNQQQQQQIPLSRYESQKRRDWNTFGQYLRNQRPPVALSNCNSNHVL  67

Query  269  EFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP  448
            EFLRYLDQFGKTKVHL GC+FFGQ +PP PCTCPL+QAWGSLDALIGRLRAAYEENGG P
Sbjct  68   EFLRYLDQFGKTKVHLQGCLFFGQTEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLP  127

Query  449  ENNPFGNGAIRVYLREVKECQAKARGIPY  535
            E NPF +G+IR+YLREV++ QAKARGIPY
Sbjct  128  ETNPFASGSIRIYLREVRDSQAKARGIPY  156



>ref|XP_006360044.1| PREDICTED: uncharacterized protein LOC102584680 [Solanum tuberosum]
Length=207

 Score =   241 bits (616),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +2

Query  143  ADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPG  322
            A  P LSRYESQKRRDWNTFGQYLKNQRPPVSL  CN NHVL+FLRYLDQFGKTKVHL G
Sbjct  44   ASTPQLSRYESQKRRDWNTFGQYLKNQRPPVSLPQCNYNHVLDFLRYLDQFGKTKVHLHG  103

Query  323  CVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVK  502
            C+FFGQP+PP PCTCPLRQAWGSLDALIGRLRAAYEENGG  E NPF +GAIRVYLREV+
Sbjct  104  CLFFGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFASGAIRVYLREVR  163

Query  503  ECQAKARGIPY  535
            + QAKARGIPY
Sbjct  164  DSQAKARGIPY  174



>ref|XP_004489028.1| PREDICTED: uncharacterized protein LOC101497242 [Cicer arietinum]
Length=189

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYL+NQRPPV+LS CN NHVLEFLRYLDQFGKTKVHL GC+FF
Sbjct  42   PLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCLFF  101

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQ +PP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE NPF +G+IR+YLREV++ QA
Sbjct  102  GQVEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGSIRIYLREVRDSQA  161

Query  515  KARGIPY  535
            KARGIPY
Sbjct  162  KARGIPY  168



>gb|AFK47598.1| unknown [Lotus japonicus]
Length=179

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 140/170 (82%), Gaps = 9/170 (5%)
 Frame = +2

Query  119  TAEGSSRSADQP--------PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEF  274
             AEGSS ++D          PLSRYESQKRRDWNTFGQYL+NQRPPV+LS CN N VLEF
Sbjct  8    IAEGSSPASDHHHHQQQQQQPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLEF  67

Query  275  LRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEN  454
            LRYLDQFGKTKVH+ GC+FFGQ +PP PCTCPLRQAWGSLDALIGRLRAAYEENGG PE 
Sbjct  68   LRYLDQFGKTKVHVQGCLFFGQAEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPEA  127

Query  455  NPFGNGAIRVYLREVKECQAKARGIPYkkkkkrkLNPVRGINDHNHNSTL  604
            NPF +G IR+YLREV++ QAKARGIPYK+KKK++ N ++ + +   +S+L
Sbjct  128  NPFASGTIRLYLREVRDSQAKARGIPYKEKKKKR-NVMKAMTEGVSSSSL  176



>ref|XP_009622401.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=198

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTFGQYLKNQRPPV LS+CN NHVL+FL+YLDQFGKTKVHL GC+FFGQ
Sbjct  46   SRYESQKRRDWNTFGQYLKNQRPPVPLSNCNYNHVLDFLKYLDQFGKTKVHLHGCLFFGQ  105

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PP PCTCPLRQAWGSLDALIGRLRAAYEENGG PE+NPF +GAIRVYLREV++ QAKA
Sbjct  106  PEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPESNPFASGAIRVYLREVRDSQAKA  165

Query  521  RGIPY  535
            RGIPY
Sbjct  166  RGIPY  170



>ref|XP_004248241.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=213

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +2

Query  140  SADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLP  319
            S+  P LSRYESQKRRDWNTFGQYLKNQRPP+SL  CN NHVL+FLRYLDQFGKTKVHL 
Sbjct  49   SSSAPQLSRYESQKRRDWNTFGQYLKNQRPPISLPQCNYNHVLDFLRYLDQFGKTKVHLH  108

Query  320  GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREV  499
            GC+FFGQP+PP PCTCPLRQAWGSLDALIGRLRAAYEENGG  E NPF +GAIRVYLREV
Sbjct  109  GCLFFGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFASGAIRVYLREV  168

Query  500  KECQAKARGIPY  535
            ++ QAKARGIPY
Sbjct  169  RDSQAKARGIPY  180



>ref|XP_009790219.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=176

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 135/164 (82%), Gaps = 4/164 (2%)
 Frame = +2

Query  122  AEGSSRSADQPPL---SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  292
            AEGSSRS     +   SRYESQKRRDWNTF Q+L+NQR P+ LS CN NHVLEFL YLDQ
Sbjct  11   AEGSSRSPGDQSITTPSRYESQKRRDWNTFNQFLRNQRQPIPLSQCNGNHVLEFLGYLDQ  70

Query  293  FGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNG  472
            FGKTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF + 
Sbjct  71   FGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFAST  130

Query  473  AIRVYLREVKECQAKARGIPYkkkkkrkLNPVRGINDHNHNSTL  604
            AIRVYLREVKECQAKARGI YKKK+K+  +P  G +D +    L
Sbjct  131  AIRVYLREVKECQAKARGIAYKKKQKKA-SPSTGDDDSSSTGFL  173



>ref|XP_009790882.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=176

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 135/164 (82%), Gaps = 4/164 (2%)
 Frame = +2

Query  122  AEGSSRSADQPPL---SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  292
            AEGSSRS     +   SRYESQKRRDWNTF Q+L+NQR P+ LS CN NHVLEFL YLDQ
Sbjct  11   AEGSSRSPGDQSITTPSRYESQKRRDWNTFNQFLRNQRQPIPLSQCNDNHVLEFLGYLDQ  70

Query  293  FGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNG  472
            FGKTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF + 
Sbjct  71   FGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFAST  130

Query  473  AIRVYLREVKECQAKARGIPYkkkkkrkLNPVRGINDHNHNSTL  604
            AIRVYLREVKECQAKARGI YKKK+K+  +P  G +D +    L
Sbjct  131  AIRVYLREVKECQAKARGIAYKKKQKKA-SPSTGDDDSSSTGFL  173



>ref|XP_007149389.1| hypothetical protein PHAVU_005G066200g [Phaseolus vulgaris]
 gb|ESW21383.1| hypothetical protein PHAVU_005G066200g [Phaseolus vulgaris]
Length=179

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 125/149 (84%), Gaps = 10/149 (7%)
 Frame = +2

Query  119  TAEGSSRSADQP----------PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVL  268
             AEGSSR +             PLSRYESQKRRDWNTFGQYL+NQRPPV+LS C+ +HVL
Sbjct  8    VAEGSSRPSGGGDDQNQQQQQLPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCSSSHVL  67

Query  269  EFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP  448
            EFLRYLDQFGKTKVHL GC+FFGQ +PP PCTCPLRQAWGSLDALIGRLRAAYEENGG P
Sbjct  68   EFLRYLDQFGKTKVHLQGCLFFGQSEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLP  127

Query  449  ENNPFGNGAIRVYLREVKECQAKARGIPY  535
            E NPF +GAIRVYLREV++ QAKARGIPY
Sbjct  128  ETNPFASGAIRVYLREVRDSQAKARGIPY  156



>gb|AFK34719.1| unknown [Lotus japonicus]
Length=179

 Score =   238 bits (608),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 124/147 (84%), Gaps = 8/147 (5%)
 Frame = +2

Query  119  TAEGSSRSADQP--------PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEF  274
             AEGSS ++D          PLSRYESQKRRDWNTFGQYL+NQRPPV+LS CN N VLEF
Sbjct  8    IAEGSSPASDHHHHQQQQQQPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLEF  67

Query  275  LRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEN  454
            LRYLDQFGKTKVH+ GC+FFGQ +PP PCTCPLRQAWGSLDALIGRLRAAYEENGG PE 
Sbjct  68   LRYLDQFGKTKVHVQGCLFFGQAEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPEA  127

Query  455  NPFGNGAIRVYLREVKECQAKARGIPY  535
            NPF +G IR+YLREV++ QAKARGIPY
Sbjct  128  NPFASGTIRLYLREVRDSQAKARGIPY  154



>gb|KHG25854.1| Major vault [Gossypium arboreum]
Length=179

 Score =   238 bits (607),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 139/162 (86%), Gaps = 8/162 (5%)
 Frame = +2

Query  125  EGSSRSA------DQPP-LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRY  283
            EGSSRS       + PP LSRYESQKRRDW TFGQYL+N+RPPV++S CN NHVL+FL Y
Sbjct  12   EGSSRSVTAVVGVENPPRLSRYESQKRRDWITFGQYLRNRRPPVAISQCNANHVLDFLGY  71

Query  284  LDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPF  463
            LDQFGKTKVHL GC+FFGQP+PP PC C LRQAWGSLDALIGRLRAAYEENGGSPE NPF
Sbjct  72   LDQFGKTKVHLQGCMFFGQPEPPGPCACSLRQAWGSLDALIGRLRAAYEENGGSPETNPF  131

Query  464  GNGAIRVYLREVKECQAKARGIPYkkkkkrkLNPVRGINDHN  589
             NGAIR+YLREV++ QAKARGIPYKKKKK+K NP++G  D++
Sbjct  132  ANGAIRIYLREVRDSQAKARGIPYKKKKKKK-NPLKGNEDNS  172



>ref|XP_006592933.1| PREDICTED: uncharacterized protein LOC100806493 isoform X1 [Glycine 
max]
 ref|XP_006592934.1| PREDICTED: uncharacterized protein LOC100806493 isoform X2 [Glycine 
max]
Length=184

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +2

Query  149  QPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCV  328
            Q PLSRYESQKRRDWNTFGQYL+NQRPPV+LS C+ NHVLEFLRYLDQFGKTKVH  GC+
Sbjct  32   QLPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCSSNHVLEFLRYLDQFGKTKVHSQGCL  91

Query  329  FFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKEC  508
            FFGQ +PP PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPF +GAIRVYLREV++ 
Sbjct  92   FFGQTEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDS  151

Query  509  QAKARGIPY  535
            Q+KARGIPY
Sbjct  152  QSKARGIPY  160



>ref|XP_010553628.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
 ref|XP_010553707.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=170

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTFGQYLKNQRPP+ LS C+C+HVL+FLRYLDQFGKTKVH+PGC+F+GQ
Sbjct  27   SRYESQKRRDWNTFGQYLKNQRPPMPLSQCSCSHVLDFLRYLDQFGKTKVHVPGCMFYGQ  86

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PPAPC CPLRQAWGSLDALIGRLRAAYEENGG PE NPF +GAIR YL+EV++CQAKA
Sbjct  87   PEPPAPCICPLRQAWGSLDALIGRLRAAYEENGGPPETNPFASGAIRAYLKEVRDCQAKA  146

Query  521  RGIPY  535
            RGIPY
Sbjct  147  RGIPY  151



>ref|XP_006358940.1| PREDICTED: uncharacterized protein LOC102602985 [Solanum tuberosum]
Length=205

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            P LSRYESQKRRDWNTFGQYLKNQRPPV LS CN NHVLEFLRYLDQFGKTKVHL GC F
Sbjct  47   PQLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPF  106

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FGQP+PP PCTCPLRQAWGSLDALIGRLRAAYEENGG PENNPF +G+IRVYLREV++ Q
Sbjct  107  FGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRVYLREVRDFQ  166

Query  512  AKARGIPY  535
            AKARGI Y
Sbjct  167  AKARGISY  174



>gb|EYU43335.1| hypothetical protein MIMGU_mgv1a022623mg, partial [Erythranthe 
guttata]
Length=169

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 127/158 (80%), Gaps = 9/158 (6%)
 Frame = +2

Query  62   MNSSSSTTHDGAppppppTTAEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSL  241
            MNSS  T              EGSS S  +P LSRYESQKRRDWNTF QYLKNQ PP+SL
Sbjct  1    MNSSGKTV--------SKNPTEGSS-SNGRPSLSRYESQKRRDWNTFLQYLKNQNPPLSL  51

Query  242  SHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRA  421
             +C+ NHVLEFLRYLDQFGKTKVHL GC FFGQPDPP  CTCPLRQAWGSLDALIGRLRA
Sbjct  52   PNCSYNHVLEFLRYLDQFGKTKVHLHGCPFFGQPDPPGQCTCPLRQAWGSLDALIGRLRA  111

Query  422  AYEENGGSPENNPFGNGAIRVYLREVKECQAKARGIPY  535
            AYEE+GG PE NPFGNGAIRVYLREVKECQAKARGI +
Sbjct  112  AYEEHGGPPEGNPFGNGAIRVYLREVKECQAKARGILF  149



>ref|XP_011082761.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Sesamum 
indicum]
Length=182

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYL+NQRPPV+LS CN +HVL+F+RYLDQFGKTKVH+ GCVFFG
Sbjct  35   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCNYSHVLDFMRYLDQFGKTKVHIQGCVFFG  94

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPF NGAIRVYLREV++ QAK
Sbjct  95   QPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGVPETNPFANGAIRVYLREVRDSQAK  154

Query  518  ARGIPY  535
            ARGIPY
Sbjct  155  ARGIPY  160



>ref|XP_002301561.2| hypothetical protein POPTR_0002s22690g [Populus trichocarpa]
 gb|ABK94357.1| unknown [Populus trichocarpa]
 gb|EEE80834.2| hypothetical protein POPTR_0002s22690g [Populus trichocarpa]
Length=170

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  119  TAEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFG  298
             AEGS  +      SRYESQKRRDWNTFGQYLKNQRPPV LS CN NHVL+FLRYLDQFG
Sbjct  9    IAEGSIENQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFG  68

Query  299  KTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAI  478
            KTKVHL  C+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGG+ E NPF N +I
Sbjct  69   KTKVHLQSCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTLETNPFANASI  128

Query  479  RVYLREVKECQAKARGIPY  535
            RVYLREVK+ QAKARGIP+
Sbjct  129  RVYLREVKDYQAKARGIPH  147



>gb|KGN47252.1| hypothetical protein Csa_6G236080 [Cucumis sativus]
Length=205

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 5/141 (4%)
 Frame = +2

Query  122  AEGSSRS---ADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  292
             EGSS+S   A  P  SRYESQKRRDWNTFGQYLKNQRP V+LS CN NHVLEFLRYLDQ
Sbjct  16   GEGSSKSPPRATTP--SRYESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRYLDQ  73

Query  293  FGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNG  472
            FGKTKVH+ GC+F+G P+PP+PCTCPL+QAWGSLDALIGRLRAAYEENGGSPE NPF   
Sbjct  74   FGKTKVHVQGCMFYGHPEPPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFATA  133

Query  473  AIRVYLREVKECQAKARGIPY  535
            +IR+YLR+V+ECQAKARGIPY
Sbjct  134  SIRLYLRQVRECQAKARGIPY  154



>ref|XP_004150559.1| PREDICTED: uncharacterized protein LOC101216601 [Cucumis sativus]
Length=226

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 5/141 (4%)
 Frame = +2

Query  122  AEGSSRS---ADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  292
             EGSS+S   A  P  SRYESQKRRDWNTFGQYLKNQRP V+LS CN NHVLEFLRYLDQ
Sbjct  16   GEGSSKSPPRATTP--SRYESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRYLDQ  73

Query  293  FGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNG  472
            FGKTKVH+ GC+F+G P+PP+PCTCPL+QAWGSLDALIGRLRAAYEENGGSPE NPF   
Sbjct  74   FGKTKVHVQGCMFYGHPEPPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFATA  133

Query  473  AIRVYLREVKECQAKARGIPY  535
            +IR+YLR+V+ECQAKARGIPY
Sbjct  134  SIRLYLRQVRECQAKARGIPY  154



>ref|XP_004171262.1| PREDICTED: uncharacterized LOC101216601 [Cucumis sativus]
Length=206

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 5/141 (4%)
 Frame = +2

Query  122  AEGSSRS---ADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  292
             EGSS+S   A  P  SRYESQKRRDWNTFGQYLKNQRP V+LS CN NHVLEFLRYLDQ
Sbjct  16   GEGSSKSPPRATTP--SRYESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRYLDQ  73

Query  293  FGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNG  472
            FGKTKVH+ GC+F+G P+PP+PCTCPL+QAWGSLDALIGRLRAAYEENGGSPE NPF   
Sbjct  74   FGKTKVHVQGCMFYGHPEPPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFATA  133

Query  473  AIRVYLREVKECQAKARGIPY  535
            +IR+YLR+V+ECQAKARGIPY
Sbjct  134  SIRLYLRQVRECQAKARGIPY  154



>ref|NP_001237763.1| uncharacterized protein LOC100527554 [Glycine max]
 gb|ACU16651.1| unknown [Glycine max]
Length=194

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYL+NQRPPV+LS C+ NHVLEFLRYLDQFGKTKVH  GC+FF
Sbjct  44   PLSRYESQKRRDWNTFGQYLRNQRPPVALSQCSSNHVLEFLRYLDQFGKTKVHSQGCLFF  103

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQ +PP PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPF +G IRVYLREV++ QA
Sbjct  104  GQTEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGTIRVYLREVRDSQA  163

Query  515  KARGIPY  535
            KARGIPY
Sbjct  164  KARGIPY  170



>ref|XP_009770169.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=206

 Score =   237 bits (604),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  164  RYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQP  343
            RYESQKRRDWNTFGQYLKNQRPPV LS+CN NHVL+FLRYLDQFGKTKVHL GC+FFGQP
Sbjct  49   RYESQKRRDWNTFGQYLKNQRPPVPLSNCNYNHVLDFLRYLDQFGKTKVHLHGCLFFGQP  108

Query  344  DPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKAR  523
            DPP PCTCPLRQAWGSLDALIGRLRAAYEENGG P +NPF +GAIRVYLRE+++ QAKAR
Sbjct  109  DPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPVSNPFASGAIRVYLREIRDSQAKAR  168

Query  524  GIPYkkkkkrkLN  562
            GIPYKKKKK+K+N
Sbjct  169  GIPYKKKKKKKIN  181



>gb|EPS69070.1| hypothetical protein M569_05697, partial [Genlisea aurea]
Length=131

 Score =   234 bits (596),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTFGQ+L+NQRPPV+LS CN NHVL+FLRYLDQFGKT+VH  GC+F+GQ
Sbjct  4    SRYESQKRRDWNTFGQFLRNQRPPVALSQCNINHVLDFLRYLDQFGKTRVHAQGCIFYGQ  63

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PPAPC CPL+QAWGSLDALIGRLRAAYEENGGSPE NPF + AIRV+LRE+KECQAKA
Sbjct  64   PEPPAPCGCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASAAIRVFLREIKECQAKA  123

Query  521  RGIPY  535
            RGIPY
Sbjct  124  RGIPY  128



>gb|KCW67509.1| hypothetical protein EUGRSUZ_F01238 [Eucalyptus grandis]
 gb|KCW67510.1| hypothetical protein EUGRSUZ_F01238 [Eucalyptus grandis]
Length=184

 Score =   236 bits (601),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 122/145 (84%), Gaps = 8/145 (6%)
 Frame = +2

Query  125  EGSSRSA----DQPP----LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLR  280
            EGSSRS     D  P    LSRYESQKRRDWNTFGQYL NQRPPV++S CN  HVLEFLR
Sbjct  13   EGSSRSVAPSGDHLPQPTQLSRYESQKRRDWNTFGQYLSNQRPPVAISQCNSTHVLEFLR  72

Query  281  YLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNP  460
            YLDQFGKTKVH  GCV+FGQP+PP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE NP
Sbjct  73   YLDQFGKTKVHFNGCVYFGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNP  132

Query  461  FGNGAIRVYLREVKECQAKARGIPY  535
            F + +IRVYLREV++ QAKARGIPY
Sbjct  133  FASSSIRVYLREVRDSQAKARGIPY  157



>ref|XP_010314085.1| PREDICTED: LOW QUALITY PROTEIN: protein LIGHT-DEPENDENT SHORT 
HYPOCOTYLS 10, partial [Solanum lycopersicum]
Length=171

 Score =   235 bits (599),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYLKNQRPPV LS CN NHVLEFLRYLDQFGKTKVHL GC FFG
Sbjct  15   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPFFG  74

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PP PCTCPLRQAWGSLDALIGRLRAAYEENGG PENNPF +GAIRVYLREV++ QAK
Sbjct  75   QPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGAIRVYLREVRDFQAK  134

Query  518  ARGIPY  535
            ARGI Y
Sbjct  135  ARGICY  140



>ref|XP_011008166.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008167.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008168.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008170.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=170

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +2

Query  119  TAEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFG  298
             AEGS  +      SRYESQKRRDWNTFGQYLKNQRPPV LS CN NHVL+FLRYLDQFG
Sbjct  9    IAEGSIENQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDFLRYLDQFG  68

Query  299  KTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAI  478
            KTKVHL GC+F+GQP+PPAPCTCPLRQAW SLDALIGRLRAAYEENGG+ E NPF N +I
Sbjct  69   KTKVHLQGCMFYGQPEPPAPCTCPLRQAWCSLDALIGRLRAAYEENGGTLETNPFANASI  128

Query  479  RVYLREVKECQAKARGIPY  535
            RVYLREVK+ QAKARGIP+
Sbjct  129  RVYLREVKDYQAKARGIPH  147



>gb|KHN36883.1| hypothetical protein glysoja_001614 [Glycine soja]
Length=193

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYL+NQRPPV+LS C+ NHVLEFLRYLDQFGKTKVH  GC+FF
Sbjct  43   PLSRYESQKRRDWNTFGQYLRNQRPPVALSQCSSNHVLEFLRYLDQFGKTKVHSQGCLFF  102

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQ +PP PCTCPLRQAWGSLDALIGRLRAAYEENGG PE NPF +G IRVYLREV++ QA
Sbjct  103  GQTEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGTIRVYLREVRDSQA  162

Query  515  KARGIPY  535
            KARGIPY
Sbjct  163  KARGIPY  169



>ref|XP_011098044.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like, 
partial [Sesamum indicum]
Length=157

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 121/141 (86%), Gaps = 3/141 (2%)
 Frame = +2

Query  122  AEGSSRSADQPPL---SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  292
            AEGSS   D       SRYESQKRRDWNTFGQ+L+NQRPPV+LS C+  HVLEFLRYLDQ
Sbjct  8    AEGSSCGGDPAAATTPSRYESQKRRDWNTFGQFLRNQRPPVALSQCSSGHVLEFLRYLDQ  67

Query  293  FGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNG  472
            FGKTKVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGG  E NPF + 
Sbjct  68   FGKTKVHLQGCIFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGPQETNPFASS  127

Query  473  AIRVYLREVKECQAKARGIPY  535
            AIR+YLREVKE QAKARGIPY
Sbjct  128  AIRIYLREVKESQAKARGIPY  148



>gb|EYU28084.1| hypothetical protein MIMGU_mgv1a022457mg [Erythranthe guttata]
Length=176

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 139/155 (90%), Gaps = 2/155 (1%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            PPLSRYESQKRRDWNTFGQYLKNQRPPVSL  CNCNHVLEFLRYLDQFGKTKVH+ GCVF
Sbjct  19   PPLSRYESQKRRDWNTFGQYLKNQRPPVSLPQCNCNHVLEFLRYLDQFGKTKVHVHGCVF  78

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FGQP PPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFGNG+IRVYLREVK+CQ
Sbjct  79   FGQPAPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGSIRVYLREVKDCQ  138

Query  512  AKARGIPYkkkkkrkLNPVRGINDHNHNSTLKQSS  616
            AKARGIPYKKKKKRK+N    I  H  +  +K +S
Sbjct  139  AKARGIPYKKKKKRKIN--HPIKTHQQDELIKNNS  171



>ref|XP_004516078.1| PREDICTED: uncharacterized protein LOC101514778 [Cicer arietinum]
Length=179

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYL+NQRPPV+LS CN N VL+FLRYLDQFGKTKVH+ GC+FFG
Sbjct  28   LSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLDFLRYLDQFGKTKVHVQGCIFFG  87

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            Q +PPAPCTCPL+QAWGSLDALIGRLRAAYEENGG PE NPF +GAIR+YLR+V++ QAK
Sbjct  88   QVEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRLYLRQVRDSQAK  147

Query  518  ARGIPY  535
            ARGIPY
Sbjct  148  ARGIPY  153



>ref|XP_006442831.1| hypothetical protein CICLE_v10023710mg [Citrus clementina]
 gb|ESR56071.1| hypothetical protein CICLE_v10023710mg [Citrus clementina]
Length=332

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYLKNQRPPV LS C+ +HVLEFLRYLDQFGKTKVHL GC+F+G
Sbjct  183  LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCSSSHVLEFLRYLDQFGKTKVHLQGCMFYG  242

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +G +RV+L EV+E QAK
Sbjct  243  QPNPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGEMRVFLGEVRERQAK  302

Query  518  ARGIPYkkkkkrkLN  562
            ARGIPYKKKK+ KL+
Sbjct  303  ARGIPYKKKKRMKLS  317



>emb|CDP06011.1| unnamed protein product [Coffea canephora]
Length=200

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYL+NQRPPV LS CN NHVL+FLRYLDQFGKTKVHL GCVFFG
Sbjct  50   LSRYESQKRRDWNTFGQYLRNQRPPVPLSQCNFNHVLDFLRYLDQFGKTKVHLQGCVFFG  109

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
             P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGG P+ NPF +GAIRVYLREV++ QAK
Sbjct  110  HPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPDKNPFASGAIRVYLREVRDSQAK  169

Query  518  ARGIPY  535
            ARGIPY
Sbjct  170  ARGIPY  175



>ref|XP_007133232.1| hypothetical protein PHAVU_011G162700g [Phaseolus vulgaris]
 gb|AGV54196.1| 177 protein [Phaseolus vulgaris]
 gb|ESW05226.1| hypothetical protein PHAVU_011G162700g [Phaseolus vulgaris]
Length=187

 Score =   233 bits (595),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYL+NQRPPV+LS CN N VL+FLRYLDQFGKTKVH  GC+FF
Sbjct  38   PLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLDFLRYLDQFGKTKVHAQGCLFF  97

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQ +PP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE NPF +GAIRVYLREV++ QA
Sbjct  98   GQVEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQA  157

Query  515  KARGIPY  535
            KARGIPY
Sbjct  158  KARGIPY  164



>gb|AFK41155.1| unknown [Lotus japonicus]
Length=185

 Score =   231 bits (588),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 129/149 (87%), Gaps = 5/149 (3%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQK+RDWNTFGQYL+NQRPPV+LS CN NHVLEFLRYLDQFGKTKVH  GC+FF
Sbjct  35   PLSRYESQKKRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHSQGCLFF  94

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQ +PP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE NPF +G+IRV+L EV++ QA
Sbjct  95   GQTEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGSIRVHLHEVRDFQA  154

Query  515  KARGIPYkkkkkrkLNPVRGINDHNHNST  601
            KARGIPYKKKKK      R + +HN +S+
Sbjct  155  KARGIPYKKKKK-----KRNVINHNGDSS  178



>ref|XP_010531928.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Tarenaya 
hassleriana]
Length=183

 Score =   230 bits (587),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 128/153 (84%), Gaps = 5/153 (3%)
 Frame = +2

Query  119  TAEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFG  298
             AEGSS      PLSRYESQKRRDWNTF QYL+NQRPPV +S CN N++L+FLRYLDQFG
Sbjct  13   VAEGSSPQ----PLSRYESQKRRDWNTFCQYLRNQRPPVHISQCNTNNILDFLRYLDQFG  68

Query  299  KTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAI  478
            KTKVHL GCVFFGQPDP   C CPLRQAWGSLDALIGRLRAAYEENGG PE NPF  G I
Sbjct  69   KTKVHLQGCVFFGQPDPSGQCNCPLRQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGI  128

Query  479  RVYLREVKECQAKARGIPYkkkkkrkLNPVRGI  577
            RVYLREV++ QAKARG+PYKKKKKR+ NP +G 
Sbjct  129  RVYLREVRDSQAKARGVPYKKKKKRR-NPAKGT  160



>ref|XP_009784769.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=196

 Score =   231 bits (588),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            P LSRYESQKRRDWNTFG YLKN RPP+ LS CN NHVLEFLRYLDQFGKTKVHL GC F
Sbjct  41   PQLSRYESQKRRDWNTFGHYLKNLRPPIPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPF  100

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FGQP+PP PC CPLRQAWGSLDALIGRLRAAYEENGG PENNPF +G+IR+YLREV++ Q
Sbjct  101  FGQPEPPGPCACPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRIYLREVRDFQ  160

Query  512  AKARGIPY  535
            AKARGI Y
Sbjct  161  AKARGISY  168



>ref|XP_006478612.1| PREDICTED: probable disease resistance protein At4g27220-like 
isoform X1 [Citrus sinensis]
Length=1622

 Score =   251 bits (642),  Expect = 8e-71, Method: Composition-based stats.
 Identities = 115/143 (80%), Positives = 124/143 (87%), Gaps = 5/143 (3%)
 Frame = +2

Query  122   AEGSS---RSADQPPL--SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYL  286
             AEGSS   +   Q P+  SRYE QKRRDWNTFGQYLKNQRPPV LS C+ +HVLEFLRYL
Sbjct  1464  AEGSSDHHQQQQQHPMTPSRYELQKRRDWNTFGQYLKNQRPPVPLSQCSSSHVLEFLRYL  1523

Query  287   DQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFG  466
             D FGK KVHL GC+F+GQP+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF 
Sbjct  1524  DPFGKIKVHLQGCMFYGQPNPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFA  1583

Query  467   NGAIRVYLREVKECQAKARGIPY  535
             +G IRVYLREV+ECQAKARGIPY
Sbjct  1584  SGEIRVYLREVRECQAKARGIPY  1606



>gb|EYU30777.1| hypothetical protein MIMGU_mgv1a014751mg [Erythranthe guttata]
Length=179

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 130/160 (81%), Gaps = 5/160 (3%)
 Frame = +2

Query  122  AEGSSRSADQPPL-----SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYL  286
            AEGSS      P      SRYESQKRRDWNTFGQ+L+N RP V ++ CN +HVL+F+RYL
Sbjct  6    AEGSSSWGGGDPAAAATPSRYESQKRRDWNTFGQFLRNMRPAVGVAQCNSSHVLDFMRYL  65

Query  287  DQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFG  466
            DQFGKTKVH  GC F+GQP+PPAPCTCPLRQAWGSLDAL+GRLRAAYEENGGSPE+NPF 
Sbjct  66   DQFGKTKVHSQGCTFYGQPEPPAPCTCPLRQAWGSLDALVGRLRAAYEENGGSPESNPFA  125

Query  467  NGAIRVYLREVKECQAKARGIPYkkkkkrkLNPVRGINDH  586
            + +IR+YLREVKECQ+KARGIPY KKKK+   P R  +D 
Sbjct  126  SSSIRMYLREVKECQSKARGIPYNKKKKKPGAPARNHDDE  165



>ref|XP_004505495.1| PREDICTED: uncharacterized protein LOC101509969 [Cicer arietinum]
Length=165

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYLK Q+PPV L HCN N+VL+FLRYLDQFGKTKVH+ GC+F+G
Sbjct  22   LSRYESQKRRDWNTFGQYLKTQKPPVPLVHCNSNNVLDFLRYLDQFGKTKVHIQGCMFYG  81

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
             P+PPAPC+CPLRQAWGSLDALIGRLRAAYEENGGSP  NPF   +IR+YLREV+ECQA 
Sbjct  82   NPEPPAPCSCPLRQAWGSLDALIGRLRAAYEENGGSPHTNPFATSSIRLYLREVRECQAL  141

Query  518  ARGIPY  535
            ARGIPY
Sbjct  142  ARGIPY  147



>gb|EPS59921.1| hypothetical protein M569_14884, partial [Genlisea aurea]
Length=143

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTF QYLKNQRPPV L HCN +HVL+F+RYLDQFGKTKVHL GCVFFG
Sbjct  11   LSRYESQKRRDWNTFRQYLKNQRPPVPLEHCNYSHVLDFMRYLDQFGKTKVHLRGCVFFG  70

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QPDP   CTCPLRQAWGSLDAL+GRLRAAYE NGGS E NPF +GAIRVYLREV++ QAK
Sbjct  71   QPDPDGACTCPLRQAWGSLDALVGRLRAAYEGNGGSQETNPFADGAIRVYLREVRDLQAK  130

Query  518  ARGIPY  535
            ARGIPY
Sbjct  131  ARGIPY  136



>ref|XP_010540518.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
Length=179

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  143  ADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPG  322
            A Q  LSRYESQKRRDWNTFGQYLKNQRPPVS +  + NHV++FL+YLDQFGKTKVH  G
Sbjct  9    AQQQQLSRYESQKRRDWNTFGQYLKNQRPPVSFAQLSFNHVIDFLKYLDQFGKTKVHHHG  68

Query  323  CVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVK  502
            CVFFGQPDPP PCTCPL+QAWGSLDALIGRLRAA+EE+GGS + NPFGNGAIRVYLREV+
Sbjct  69   CVFFGQPDPPGPCTCPLKQAWGSLDALIGRLRAAFEEHGGSSDQNPFGNGAIRVYLREVR  128

Query  503  ECQAKARGIPY  535
            + Q+KARGI Y
Sbjct  129  DSQSKARGIQY  139



>ref|XP_008463732.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=199

 Score =   229 bits (583),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +2

Query  125  EGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKT  304
            E    +A  P +SRYESQKRRDW TFGQYL+NQRPP+++S CN +HVLEFLRYLDQFGKT
Sbjct  46   ERGDEAAPTPVISRYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKT  105

Query  305  KVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRV  484
            KVHL GC FFG+P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGGS + NPF +GAIRV
Sbjct  106  KVHLNGCGFFGEPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRV  165

Query  485  YLREVKECQAKARGIPY  535
            YLREV++ Q+KARGIPY
Sbjct  166  YLREVRDSQSKARGIPY  182



>ref|XP_004146094.1| PREDICTED: uncharacterized protein LOC101204141 [Cucumis sativus]
Length=204

 Score =   229 bits (583),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  131  SSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKV  310
            +S     P +SRYESQKRRDW TFGQYL+NQRPP+++S CN +HVLEFLRYLDQFGKTKV
Sbjct  50   TSSVVGAPVISRYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKV  109

Query  311  HLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYL  490
            HL GC FFG+P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGGS + NPF +GAIRVYL
Sbjct  110  HLNGCGFFGEPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYL  169

Query  491  REVKECQAKARGIPY  535
            REV++ Q+KARGIPY
Sbjct  170  REVRDSQSKARGIPY  184



>gb|KGN55073.1| hypothetical protein Csa_4G627230 [Cucumis sativus]
Length=201

 Score =   229 bits (583),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  131  SSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKV  310
            +S     P +SRYESQKRRDW TFGQYL+NQRPP+++S CN +HVLEFLRYLDQFGKTKV
Sbjct  50   TSSVVGAPVISRYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKV  109

Query  311  HLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYL  490
            HL GC FFG+P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGGS + NPF +GAIRVYL
Sbjct  110  HLNGCGFFGEPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYL  169

Query  491  REVKECQAKARGIPY  535
            REV++ Q+KARGIPY
Sbjct  170  REVRDSQSKARGIPY  184



>ref|XP_004171006.1| PREDICTED: uncharacterized LOC101204141, partial [Cucumis sativus]
Length=200

 Score =   228 bits (582),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  131  SSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKV  310
            +S     P +SRYESQKRRDW TFGQYL+NQRPP+++S CN +HVLEFLRYLDQFGKTKV
Sbjct  51   TSSVVGAPVISRYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKV  110

Query  311  HLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYL  490
            HL GC FFG+P+P  PCTCPLRQAWGSLDALIGRLRAAYEENGGS + NPF +GAIRVYL
Sbjct  111  HLNGCGFFGEPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYL  170

Query  491  REVKECQAKARGIPY  535
            REV++ Q+KARGIPY
Sbjct  171  REVRDSQSKARGIPY  185



>gb|KDO64048.1| hypothetical protein CISIN_1g0003541mg, partial [Citrus sinensis]
Length=553

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYE QKRRDWNTFGQYLKNQRPPV LS C+ +HVLEFLRYLD FGK KVHL GC+F+GQ
Sbjct  413  SRYELQKRRDWNTFGQYLKNQRPPVPLSQCSSSHVLEFLRYLDPFGKIKVHLQGCMFYGQ  472

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +G IRVYLREV+ECQAKA
Sbjct  473  PNPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGEIRVYLREVRECQAKA  532

Query  521  RGIPY  535
            RGIPY
Sbjct  533  RGIPY  537



>ref|XP_009774704.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=190

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 126/150 (84%), Gaps = 4/150 (3%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            P LSRYESQKRRDW TFGQYLKN +PPV LS+CN NHVL+FLRYLDQFGKTKVHL GCVF
Sbjct  35   PQLSRYESQKRRDWTTFGQYLKNHKPPVPLSNCNYNHVLDFLRYLDQFGKTKVHLHGCVF  94

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FG+ +   PCTCPLRQAWGSLDALIGRLRAAYEENGG  E NPF N AIR+YLREV++ Q
Sbjct  95   FGESEQGGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREVRDSQ  154

Query  512  AKARGIPYkkkkkrkLNPVRGINDHNHNST  601
            AKARGIPYKKKKKRK+     IN  N+N T
Sbjct  155  AKARGIPYKKKKKRKIQ----INSSNNNET  180



>ref|XP_010324393.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like isoform 
X1 [Solanum lycopersicum]
Length=199

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            P LSRYESQKRRDWNTFGQYLKN +PPV L  CN NHVL+FLRYLDQFGKTKVHL GCVF
Sbjct  37   PQLSRYESQKRRDWNTFGQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKTKVHLNGCVF  96

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FGQ +   PCTCPLRQAWGSLDALIGRLRAAYEENGG  E NPF N AIR+YLREV++ Q
Sbjct  97   FGQVEQVGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREVRDSQ  156

Query  512  AKARGIPY  535
            AKARGIPY
Sbjct  157  AKARGIPY  164



>gb|EYU45022.1| hypothetical protein MIMGU_mgv1a014215mg [Erythranthe guttata]
Length=197

 Score =   226 bits (576),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTFGQYL+NQRPPV L  CN +HVLEF+RYLDQFGKTKVH  GC FFGQ
Sbjct  41   SRYESQKRRDWNTFGQYLRNQRPPVGLPQCNYSHVLEFMRYLDQFGKTKVHGQGCPFFGQ  100

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+P  PC CPLRQAWGSLDAL+GRLRAAYEENGGS E NPF NGAIRVYLREV++ QAKA
Sbjct  101  PEPAGPCACPLRQAWGSLDALVGRLRAAYEENGGSQETNPFANGAIRVYLREVRDSQAKA  160

Query  521  RGIPY  535
            RGIPY
Sbjct  161  RGIPY  165



>ref|XP_007159450.1| hypothetical protein PHAVU_002G238600g [Phaseolus vulgaris]
 gb|ESW31444.1| hypothetical protein PHAVU_002G238600g [Phaseolus vulgaris]
Length=179

 Score =   225 bits (574),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  143  ADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPG  322
            ++Q PLSRYESQKRRDWNTFGQYLKNQ PPV+LS CN NHVL+FLRYLDQFGKTKVHL G
Sbjct  24   SNQQPLSRYESQKRRDWNTFGQYLKNQSPPVALSQCNFNHVLDFLRYLDQFGKTKVHLHG  83

Query  323  CVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVK  502
            C+FFGQP PPAPC CPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFG G+IRVYLREVK
Sbjct  84   CIFFGQPTPPAPCACPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGGGSIRVYLREVK  143

Query  503  ECQAKARGIPY  535
            ECQAKARGIPY
Sbjct  144  ECQAKARGIPY  154



>ref|XP_004134659.1| PREDICTED: uncharacterized protein LOC101214534 [Cucumis sativus]
 ref|XP_004170980.1| PREDICTED: uncharacterized protein LOC101226112 [Cucumis sativus]
 gb|KGN49306.1| hypothetical protein Csa_6G519580 [Cucumis sativus]
Length=208

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYLKNQ PPVSLSHCNCNHVLEFLRYLDQFGKT+VH  GCVFF
Sbjct  40   PLSRYESQKRRDWNTFGQYLKNQTPPVSLSHCNCNHVLEFLRYLDQFGKTRVHSHGCVFF  99

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQPDPPAPC CPL+QAWGSLDALIGRLRAAYEE+GGSPE NPFGNGAIR YLREVKE QA
Sbjct  100  GQPDPPAPCPCPLKQAWGSLDALIGRLRAAYEEHGGSPEGNPFGNGAIRTYLREVKESQA  159

Query  515  KARGIPY  535
            KARGIPY
Sbjct  160  KARGIPY  166



>ref|XP_003539992.1| PREDICTED: uncharacterized protein LOC100806134 [Glycine max]
Length=177

 Score =   224 bits (571),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYLDQFGKTKVHL GC+F+G
Sbjct  30   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYG  89

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PPAPC CPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +G+IRVYLREV+ECQAK
Sbjct  90   QPEPPAPCACPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAK  149

Query  518  ARGIPY  535
            ARGI Y
Sbjct  150  ARGIAY  155



>ref|XP_008465528.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=210

 Score =   225 bits (574),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYLKNQ PPVSLSHCNCNHVLEFLRYLDQFGKT+VH  GCVFF
Sbjct  44   PLSRYESQKRRDWNTFGQYLKNQTPPVSLSHCNCNHVLEFLRYLDQFGKTRVHSHGCVFF  103

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQPDPPAPC CPL+QAWGSLDALIGRLRAAYEE+GGSPE NPFGNGAIR YLREVKE QA
Sbjct  104  GQPDPPAPCPCPLKQAWGSLDALIGRLRAAYEEHGGSPEGNPFGNGAIRTYLREVKESQA  163

Query  515  KARGIPY  535
            KARGIPY
Sbjct  164  KARGIPY  170



>ref|XP_003531069.1| PREDICTED: uncharacterized protein LOC100798406 [Glycine max]
Length=247

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 126/151 (83%), Gaps = 2/151 (1%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            PPLSRYESQKRRDWNTFGQYLKN RPP++LS C+  HVLEFLRYLDQFGKTKVH   C +
Sbjct  44   PPLSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAETCGY  103

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FG   PP PC CPLRQAWGSLDALIGRLRAA+EENGG+PE NPFG  A+R+YLREV++ Q
Sbjct  104  FGNSHPPGPCACPLRQAWGSLDALIGRLRAAFEENGGAPEMNPFGTRAVRLYLREVRDAQ  163

Query  512  AKARGIPYkkkkkrkLNPVRGINDHNHNSTL  604
            AKARGI Y+KKK+R   P +  +DH+H++ +
Sbjct  164  AKARGIAYEKKKRR--KPQQSGHDHDHDAMM  192



>ref|XP_009587002.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=180

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = +2

Query  149  QPP-LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGC  325
            QPP LSRY SQKRRDWNTFGQYLKN +PPV LS+CN NHVL FLRYLDQFGKTKVHL GC
Sbjct  23   QPPQLSRYVSQKRRDWNTFGQYLKNHKPPVPLSNCNYNHVLHFLRYLDQFGKTKVHLHGC  82

Query  326  VFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKE  505
            +FFG+ +   PCTCPLRQAWGSLDALIGRLRAAYEENGG  E NPF N AIR+YLREV++
Sbjct  83   IFFGESEQTEPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREVRD  142

Query  506  CQAKARGIPY  535
             QAKARGI Y
Sbjct  143  SQAKARGISY  152



>ref|XP_010529198.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010529199.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010529200.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010532377.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010532378.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010532379.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
Length=208

 Score =   224 bits (571),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 1/126 (1%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYLK+Q PPVS+S  + +HVL FL+YLDQFGKTKVH P CVFFGQ
Sbjct  43   SRYESQKRRDWNTFLQYLKSQNPPVSMSQFDYSHVLSFLKYLDQFGKTKVHHPSCVFFGQ  102

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKECQAK  517
            PDPPAPCTCPLRQAWGSLDALIGRLRAAYEE+ GGSPENNPFGNGAIRV+LRE++E QA+
Sbjct  103  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGGSPENNPFGNGAIRVHLREMRESQAR  162

Query  518  ARGIPY  535
            ARGIPY
Sbjct  163  ARGIPY  168



>ref|XP_002973743.1| hypothetical protein SELMODRAFT_36560, partial [Selaginella moellendorffii]
 ref|XP_002975792.1| hypothetical protein SELMODRAFT_36559, partial [Selaginella moellendorffii]
 gb|EFJ23421.1| hypothetical protein SELMODRAFT_36559, partial [Selaginella moellendorffii]
 gb|EFJ25403.1| hypothetical protein SELMODRAFT_36560, partial [Selaginella moellendorffii]
Length=153

 Score =   222 bits (565),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +2

Query  116  TTAEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQF  295
            + A+ ++ S+ Q P SRYE+QKRRDWNTFGQYLKN RPP++LS C+  HVLEFLRYLDQF
Sbjct  6    SRADANASSSQQAPPSRYEAQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQF  65

Query  296  GKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGA  475
            GKTK+H P C FFG   PPAPC CPLRQAWGSLDALIGRLRAA+EE+GG PE+NPFG  A
Sbjct  66   GKTKIHAPACPFFGLAHPPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARA  125

Query  476  IRVYLREVKECQAKARGIPY  535
            +R+YLREV+E QAKARGI Y
Sbjct  126  VRLYLREVREMQAKARGIAY  145



>ref|XP_003531259.1| PREDICTED: uncharacterized protein LOC100810655 [Glycine max]
 gb|KHN47994.1| hypothetical protein glysoja_015464 [Glycine soja]
Length=167

 Score =   222 bits (565),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTFGQYL+NQ PPV LS CN NHVL+FLRYLDQFGKTKVHL GC+FF
Sbjct  16   PLSRYESQKRRDWNTFGQYLRNQSPPVPLSQCNFNHVLDFLRYLDQFGKTKVHLHGCIFF  75

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            GQP PPAPC CPLRQAWGSLDALIGRLRAAYEE+GGSPE NPFG GAIRVYLREVKECQA
Sbjct  76   GQPTPPAPCACPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGGGAIRVYLREVKECQA  135

Query  515  KARGIPY  535
            KARGIPY
Sbjct  136  KARGIPY  142



>ref|XP_006348309.1| PREDICTED: uncharacterized protein LOC102581082 [Solanum tuberosum]
Length=191

 Score =   223 bits (567),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            P LSRYESQKRRDWNTFGQYLKN +PPV L  CN NHVL+FLRYLDQFGKTKVHL GCVF
Sbjct  42   PQLSRYESQKRRDWNTFGQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKTKVHLNGCVF  101

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FGQ +   PCTCPL+QAWGSLDALIGRLRAAYEENGG  E NPF N AIR++LREV++ Q
Sbjct  102  FGQVEQVGPCTCPLKQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIHLREVRDSQ  161

Query  512  AKARGIPY  535
            AKARGIPY
Sbjct  162  AKARGIPY  169



>ref|XP_010549405.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=190

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQK RDWNTFGQYL NQRPPVS++  N NHV+ FL+YLDQFGKTKVH  GC FFG
Sbjct  24   LSRYESQKLRDWNTFGQYLNNQRPPVSVTQFNFNHVINFLKYLDQFGKTKVHHHGCAFFG  83

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QPDPP PCTCPL+QAWGSLDALIGRLRAAYEE+GGSP  NPFGNGAIRVYLREV++ Q+K
Sbjct  84   QPDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGSPGLNPFGNGAIRVYLREVRDSQSK  143

Query  518  ARGIPY  535
            ARGI Y
Sbjct  144  ARGIQY  149



>emb|CDX85083.1| BnaC07g08230D [Brassica napus]
Length=199

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYE+QKRRDWNTFGQYL+N RPP+SLS C+  HVLEFLRYLDQFGKTKVH+  C FFG
Sbjct  46   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHMQICPFFG  105

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
             P+PPAPCTCPLRQAWGSLDALIGRLRAA+EENGGSPE NPFG  A+R+YLREV++ QAK
Sbjct  106  HPNPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  165

Query  518  ARGIPY  535
            ARGI Y
Sbjct  166  ARGISY  171



>ref|XP_009108375.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Brassica 
rapa]
 ref|XP_009108376.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Brassica 
rapa]
Length=193

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = +2

Query  149  QPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCV  328
            Q PLSRYESQKRRDWNTF QYLK+Q PP+ +S  +  HVL FLRYLDQFGKTKVH   CV
Sbjct  34   QQPLSRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACV  93

Query  329  FFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKE  505
            FFGQPDPP PCTCPL+QAWGSLDALIGRLRAAYEE+ GGSP+ NPF NG+IRV+LREV+E
Sbjct  94   FFGQPDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRE  153

Query  506  CQAKARGIPYkkkkkrkL--NPVRGINDHNHNSTLKQSS  616
             QAKARGIPY+KK +RK+  + V    D  ++ST  QSS
Sbjct  154  SQAKARGIPYRKKNRRKIKNDGVVARKDVANSSTHNQSS  192



>ref|XP_009102637.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Brassica 
rapa]
 emb|CDX77531.1| BnaA07g06690D [Brassica napus]
Length=199

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYE+QKRRDWNTFGQYL+N RPP+SLS C+  HVLEFLRYLDQFGKTKVH+  C FFG
Sbjct  46   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHMQICPFFG  105

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
             P+PPAPCTCPLRQAWGSLDALIGRLRAA+EENGGSPE NPFG  A+R+YLREV++ QAK
Sbjct  106  HPNPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  165

Query  518  ARGIPY  535
            ARGI Y
Sbjct  166  ARGISY  171



>ref|XP_011098405.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=173

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = +2

Query  179  KRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAP  358
            KRRDWNTFGQYL+NQRPPV L  CN +HVL+FLRYLDQFGKTKVH+ GCVFFGQP+P  P
Sbjct  24   KRRDWNTFGQYLRNQRPPVGLPQCNYSHVLDFLRYLDQFGKTKVHVQGCVFFGQPEPAGP  83

Query  359  CTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKARGIPY  535
            C+CPLRQAWGSLDALIGRLRAAYEENGG+ E NPF NGAIRVYLREV+E QAKARGIPY
Sbjct  84   CSCPLRQAWGSLDALIGRLRAAYEENGGAAETNPFANGAIRVYLREVRESQAKARGIPY  142



>emb|CDX76510.1| BnaA08g08900D [Brassica napus]
Length=193

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = +2

Query  149  QPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCV  328
            Q PLSRYESQKRRDWNTF QYLK+Q PP+ +S  +  HVL FLRYLDQFGKTKVH   CV
Sbjct  34   QQPLSRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACV  93

Query  329  FFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKE  505
            FFGQPDPP PCTCPL+QAWGSLDALIGRLRAAYEE+ GGSP+ NPF NG+IRV+LREV+E
Sbjct  94   FFGQPDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRE  153

Query  506  CQAKARGIPY  535
             QAKARGIPY
Sbjct  154  SQAKARGIPY  163



>gb|EYU41125.1| hypothetical protein MIMGU_mgv1a021620mg [Erythranthe guttata]
Length=170

 Score =   220 bits (561),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +2

Query  119  TAEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFG  298
            ++EGSS  +    LSRYESQKRRDWNTFGQ+L+NQRP V L HCN +HVL+FLRYLDQFG
Sbjct  8    SSEGSSPPSAAATLSRYESQKRRDWNTFGQFLRNQRPSVGLPHCNSSHVLDFLRYLDQFG  67

Query  299  KTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAI  478
            KTKVHL GCVF+GQP+PPAPC CPL+QAWGSLDALIGRLRAAYEENGGSPE+NPF +GAI
Sbjct  68   KTKVHLQGCVFYGQPEPPAPCACPLKQAWGSLDALIGRLRAAYEENGGSPESNPFASGAI  127

Query  479  RVYLREVKECQAKARGIPY  535
            R+YLREVKECQ+KARGIPY
Sbjct  128  RIYLREVKECQSKARGIPY  146



>emb|CDY34056.1| BnaC03g62760D [Brassica napus]
Length=193

 Score =   221 bits (562),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = +2

Query  149  QPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCV  328
            Q PLSRYESQKRRDWNTF QYLK+Q PP  +S  +  HVL FLRYLDQFGKTKVH   CV
Sbjct  34   QQPLSRYESQKRRDWNTFIQYLKSQNPPQMMSQFDYTHVLSFLRYLDQFGKTKVHHQACV  93

Query  329  FFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKE  505
            FFGQPDPP PCTCPL+QAWGSLDALIGRLRAAYEE+ GGSP+ NPF NG+IRV+LREV+E
Sbjct  94   FFGQPDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRE  153

Query  506  CQAKARGIPY  535
             QAKARGIPY
Sbjct  154  SQAKARGIPY  163



>dbj|BAI52974.1| G1-like protein [Selaginella moellendorffii]
Length=225

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +2

Query  116  TTAEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQF  295
            + A+ ++ S+ Q P SRYE+QKRRDWNTFGQYLKN RPP++LS C+  HVLEFLRYLDQF
Sbjct  21   SRADANASSSQQAPPSRYEAQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQF  80

Query  296  GKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGA  475
            GKTK+H P C FFG   PPAPC CPLRQAWGSLDALIGRLRAA+EE+GG PE+NPFG  A
Sbjct  81   GKTKIHAPACPFFGLAHPPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARA  140

Query  476  IRVYLREVKECQAKARGIPY  535
            +R+YLREV+E QAKARGI Y
Sbjct  141  VRLYLREVREMQAKARGIAY  160



>ref|XP_003537309.1| PREDICTED: uncharacterized protein LOC100775798 [Glycine max]
Length=235

 Score =   222 bits (565),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 131/170 (77%), Gaps = 9/170 (5%)
 Frame = +2

Query  26   PPKIRTVLLYPSMNSSSSTTHDGAppppppTTAEGSSRSADQPPLSRYESQKRRDWNTFG  205
            PP+  +V   P   SS+  T   AP     T  EGSS +    PLSRYESQKRRDWNTF 
Sbjct  11   PPQPTSVEAPPPSGSSAPATSAPAP-----TQPEGSSPA----PLSRYESQKRRDWNTFL  61

Query  206  QYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAW  385
            QYL+N RPP++L+ C+  HV+EFL+YLDQFGKTKVH+ GC +FG P+PPAPCTCPL+QAW
Sbjct  62   QYLQNHRPPLTLARCSGAHVIEFLKYLDQFGKTKVHVTGCPYFGHPNPPAPCTCPLKQAW  121

Query  386  GSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKARGIPY  535
            GSLDALIGRLRAAYEENGG PE+NPFG  A+R  LREV+E QAKARGIPY
Sbjct  122  GSLDALIGRLRAAYEENGGRPESNPFGARAVRTCLREVREGQAKARGIPY  171



>ref|XP_008802142.1| PREDICTED: LOW QUALITY PROTEIN: protein G1-like4 [Phoenix dactylifera]
Length=189

 Score =   220 bits (560),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            P  SRYESQKRRDWNTFGQYLKN RPP++LS C+  HVLEFLRYLDQFGKTKVH   C F
Sbjct  39   PSPSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPF  98

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FG P+PPAPC+CPLRQAWGSLDALIGRLRAAYEENGG PE+NPFG  A+R+YLREV+E Q
Sbjct  99   FGHPNPPAPCSCPLRQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRLYLREVRELQ  158

Query  512  AKARGIPY  535
            AKARGI Y
Sbjct  159  AKARGISY  166



>emb|CDY69731.1| BnaCnng65050D [Brassica napus]
Length=195

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYE+QKRRDWNTFGQYL+N RPP+SLS C+  HVLEFLRYLDQFGKTKVH   C FFG
Sbjct  45   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFG  104

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
             P+PPAPCTCPLRQAWGSLDALIGRLRAA+EENGGSPE NPFG  A+R+YLREV++ QAK
Sbjct  105  HPNPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  164

Query  518  ARGIPY  535
            ARGI Y
Sbjct  165  ARGISY  170



>ref|XP_010906808.1| PREDICTED: LOW QUALITY PROTEIN: protein G1-like4 [Elaeis guineensis]
Length=198

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 125/159 (79%), Gaps = 4/159 (3%)
 Frame = +2

Query  59   SMNSSSSTTHDGAppppppTTAEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVS  238
            S ++SSS+ H GA    P  +   S   +     SRYESQKRRDWNTFGQYLKN RPP++
Sbjct  21   SPHASSSSGHTGATSSSPSPSPSPSPSPSP----SRYESQKRRDWNTFGQYLKNHRPPLT  76

Query  239  LSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLR  418
            LS C+  HVLEFLRYLDQFGKTKVH   C FFG P+PPAPC+CPLRQAWGSLDALIGRLR
Sbjct  77   LSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHPNPPAPCSCPLRQAWGSLDALIGRLR  136

Query  419  AAYEENGGSPENNPFGNGAIRVYLREVKECQAKARGIPY  535
            AAYEENGG PE+NPFG  A+R+YLREV+E QAKARGI Y
Sbjct  137  AAYEENGGRPESNPFGARAVRLYLREVRELQAKARGISY  175



>ref|XP_003524092.1| PREDICTED: uncharacterized protein LOC100775838 [Glycine max]
Length=236

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 124/155 (80%), Gaps = 1/155 (1%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            PPLSRYESQKRRDWNTFGQYLKN RPP++LS C+  HVLEFLRYLDQFGKTKVH   C +
Sbjct  43   PPLSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAETCAY  102

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FG   PP PC CPLRQAWGSLDALIGRLRAA+EENGG+PE NPFG  A+R+YLREV++ Q
Sbjct  103  FGNSHPPGPCACPLRQAWGSLDALIGRLRAAFEENGGTPEMNPFGTRAVRLYLREVRDAQ  162

Query  512  AKARGIPYkkkkkrkLNPVRGINDHNHNSTLKQSS  616
            AKARGI Y+KKK+R   P    +DH+    +  SS
Sbjct  163  AKARGIAYEKKKRRN-KPQHSGHDHHDEVMVNYSS  196



>emb|CDY67351.1| BnaCnng54640D [Brassica napus]
Length=193

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTF QYLK+Q PP+ +S  +  HVL FLRYLDQFGKTKVH   CVFF
Sbjct  34   PLSRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFF  93

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKECQ  511
            GQPDPP PCTCPL+QAWGSLDALIGRLRAAYEE+ GGSP+ NPF NG+IRV+LREV+E Q
Sbjct  94   GQPDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQ  153

Query  512  AKARGIPY  535
            AKARGIPY
Sbjct  154  AKARGIPY  161



>gb|KEH31304.1| G1-like protein [Medicago truncatula]
Length=234

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 125/154 (81%), Gaps = 4/154 (3%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            PPLSRYESQKRRDWNTFGQYLKN RPP++LS C+  HVLEFLRYLDQFGKTKVH   C +
Sbjct  42   PPLSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHSENCAY  101

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FG   PP PC CPL+QAWGSLDALIGRLRAA+EENGGS E NPFG  A+R+YLREV++ Q
Sbjct  102  FGNSHPPGPCPCPLKQAWGSLDALIGRLRAAFEENGGSQEMNPFGARAVRLYLREVRDAQ  161

Query  512  AKARGIPYkkkkkrkLNPVRGINDHNHNSTLKQS  613
            AKARGI Y+KKK++KLN     N  N + T+ Q+
Sbjct  162  AKARGIGYEKKKRKKLNQ----NQQNGSMTMVQN  191



>ref|XP_002313971.1| hypothetical protein POPTR_0009s07990g [Populus trichocarpa]
 gb|EEE87926.1| hypothetical protein POPTR_0009s07990g [Populus trichocarpa]
Length=223

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 119/137 (87%), Gaps = 3/137 (2%)
 Frame = +2

Query  125  EGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKT  304
            EGSS  A   P SRYESQKRRDWNTF QYLKN +PP++L+ C+  HV+EFL+YLDQFGKT
Sbjct  38   EGSSPPA---PPSRYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKT  94

Query  305  KVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRV  484
            KVH+ GC +FG P+PPAPC+CPL+QAWGSLDALIGRLRAAYEENGG PE+NPFG  A+R+
Sbjct  95   KVHITGCPYFGHPNPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRI  154

Query  485  YLREVKECQAKARGIPY  535
            YLREV+E QAKARGIPY
Sbjct  155  YLREVREGQAKARGIPY  171



>gb|KFK42237.1| hypothetical protein AALP_AA2G229400 [Arabis alpina]
Length=200

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTF QYL+NQ+PPV +S C  NH+L+FL+YLDQFGKTKVH+ GCVFFG
Sbjct  42   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFG  101

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            Q +PP  C CPL+QAWGSLDALIGRLRAAYEENGG PE NPF  G IRV+LREV++ QAK
Sbjct  102  QVEPPGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAK  161

Query  518  ARGIPY-kkkkkrkLNPVRGINDHNHNSTLKQSS  616
            ARG+PY K+KKK+K NP+R  +D    +    SS
Sbjct  162  ARGVPYKKRKKKKKRNPMRSHDDEGGGTMGTSSS  195



>gb|EPS68444.1| hypothetical protein M569_06326 [Genlisea aurea]
Length=181

 Score =   218 bits (555),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            PLSRYESQKRRDWNTF QYL+NQRPPVSL  CN  HVLEF+RYLDQFGKTKVH+ GCVFF
Sbjct  28   PLSRYESQKRRDWNTFRQYLRNQRPPVSLGQCNGGHVLEFMRYLDQFGKTKVHVRGCVFF  87

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            G+P+P + CTCP+RQAWGSLDAL+GRLRAAYE +GG+ E NPF + AIR YL+EV+E QA
Sbjct  88   GRPEPDSACTCPVRQAWGSLDALVGRLRAAYEGSGGAQERNPFADAAIRRYLKEVRETQA  147

Query  515  KARGIPY  535
            KARGIPY
Sbjct  148  KARGIPY  154



>ref|XP_008649559.1| PREDICTED: protein G1-like7 [Zea mays]
 gb|AFW77771.1| putative protein of unknown function (DUF640) domain family protein 
[Zea mays]
Length=301

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTF QYL+N +PP++L+ C+  HV+EFLRYLDQFGKTKVH  GC +FG
Sbjct  81   LSRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHAEGCAYFG  140

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PPAPCTCPLRQAWGSLDALIGRLRAAYEE+GG PE+NPF   A+R+YLR+V+E QAK
Sbjct  141  QPNPPAPCTCPLRQAWGSLDALIGRLRAAYEESGGRPESNPFAAKAVRIYLRDVREAQAK  200

Query  518  ARGIPY  535
            ARGIPY
Sbjct  201  ARGIPY  206



>ref|XP_010538562.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
Length=198

 Score =   218 bits (556),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 114/127 (90%), Gaps = 1/127 (1%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTF QYLK+Q PPVS S  + +HVL FL+YLDQFGKTKVH   CVFFG
Sbjct  33   LSRYESQKRRDWNTFLQYLKSQNPPVSTSRFDYSHVLSFLQYLDQFGKTKVHDQACVFFG  92

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKECQA  514
            QP+PPAPCTCPLRQAWGSLDALIGRLRAAYEE+ GGSPENNPFGNGAIRV+LREV+E QA
Sbjct  93   QPNPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGGSPENNPFGNGAIRVHLREVREAQA  152

Query  515  KARGIPY  535
            +ARGI +
Sbjct  153  RARGITH  159



>ref|XP_011003514.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 [Populus 
euphratica]
Length=220

 Score =   219 bits (558),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 119/137 (87%), Gaps = 3/137 (2%)
 Frame = +2

Query  125  EGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKT  304
            EGSS  A   P SRYESQKRRDWNTF QYLKN +PP++L+ C+  HV+EFL+YLDQFGKT
Sbjct  36   EGSSPPA---PPSRYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKT  92

Query  305  KVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRV  484
            KVH+ GC +FG P+PPAPC+CPL+QAWGSLDALIGRLRAAYEENGG PE+NPFG  A+R+
Sbjct  93   KVHITGCPYFGHPNPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRI  152

Query  485  YLREVKECQAKARGIPY  535
            YLREV+E QAKARGIPY
Sbjct  153  YLREVREGQAKARGIPY  169



>ref|XP_004504735.1| PREDICTED: uncharacterized protein LOC101506113 [Cicer arietinum]
Length=236

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            PPLSRYESQKRRDWNTFGQYLKN RPP++LS C+  HVLEFLRYLDQFGKTKVH   C +
Sbjct  43   PPLSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHSENCAY  102

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FG  +PP PC CPL+QAWGSLDALIGRLRAA+EENGGSPE NPFG  A+R+YLREV++ Q
Sbjct  103  FGNSNPPGPCPCPLKQAWGSLDALIGRLRAAFEENGGSPEINPFGARAVRLYLREVRDAQ  162

Query  512  AKARGIPY  535
            AKARGI Y
Sbjct  163  AKARGIGY  170



>gb|KFK28531.1| hypothetical protein AALP_AA7G008800 [Arabis alpina]
Length=194

 Score =   218 bits (555),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYLK+Q PP+ +S  +  HVL FLRYLDQFGKTKVH   CVFFGQ
Sbjct  39   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  98

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKECQAK  517
            PDPP PCTCPLRQAWGSLDALIGRLRAAYEE+ GGSPE NPF NG+IRV+LREV+E QAK
Sbjct  99   PDPPGPCTCPLRQAWGSLDALIGRLRAAYEEHGGGSPETNPFANGSIRVHLREVRESQAK  158

Query  518  ARGIPY  535
            ARGIPY
Sbjct  159  ARGIPY  164



>emb|CDP09236.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   219 bits (557),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = +2

Query  125  EGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKT  304
            EG   S   PP SRYESQKRRDWNTF QYL+N +PP++L+ C+  HV+EFL+YLDQFGKT
Sbjct  28   EGVGGSTAAPP-SRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLKYLDQFGKT  86

Query  305  KVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRV  484
            KVH+ GC +FG P+PPAPC CPL+QAWGSLDALIGRLRAAYEENGG PE+NPFG  A+R+
Sbjct  87   KVHVAGCPYFGHPNPPAPCQCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRI  146

Query  485  YLREVKECQAKARGIPY  535
            YLREV+E QAKARGIPY
Sbjct  147  YLREVRESQAKARGIPY  163



>ref|NP_001143976.1| uncharacterized protein LOC100276793 [Zea mays]
 gb|ACG36867.1| hypothetical protein [Zea mays]
Length=305

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTF QYL+N +PP++L+ C+  HV+EFLRYLDQFGKTKVH  GC +FG
Sbjct  83   LSRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHAEGCAYFG  142

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PPAPCTCPLRQAWGSLDALIGRLRAAYEE+GG PE+NPF   A+R+YLR+V+E QAK
Sbjct  143  QPNPPAPCTCPLRQAWGSLDALIGRLRAAYEESGGRPESNPFAAKAVRIYLRDVREAQAK  202

Query  518  ARGIPY  535
            ARGIPY
Sbjct  203  ARGIPY  208



>ref|XP_009411199.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=221

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 123/149 (83%), Gaps = 2/149 (1%)
 Frame = +2

Query  128  GSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTK  307
            G  R+A  P  SRYESQKRRDWNTF QYL+N +PP++L+ C+  HV+EFLRYLDQFGKTK
Sbjct  38   GPPRAATTP--SRYESQKRRDWNTFLQYLRNHKPPLALARCSGAHVIEFLRYLDQFGKTK  95

Query  308  VHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVY  487
            VH PGC F+G P PP PC CPLRQAWGSLDALIGRLRAAYEE+GG+PE NPF   A+R+Y
Sbjct  96   VHAPGCAFYGHPSPPGPCACPLRQAWGSLDALIGRLRAAYEESGGTPETNPFAARAVRIY  155

Query  488  LREVKECQAKARGIPYkkkkkrkLNPVRG  574
            LR+V+E QAKARGIPY+KKK+++  P  G
Sbjct  156  LRDVRESQAKARGIPYEKKKRKRAPPAAG  184



>emb|CDX88480.1| BnaC06g39240D [Brassica napus]
Length=185

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            P LSRYESQKRRDWNTF QYL+NQ PPV +S C  NH+L+FL+YLDQFGKTKVH+ GCVF
Sbjct  31   PALSRYESQKRRDWNTFCQYLRNQHPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVF  90

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FGQ +P   C CPL+QAWGSLDALIGRLRAAYEENGG PE NPF  G IRV+LREV++ Q
Sbjct  91   FGQVEPAGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQ  150

Query  512  AKARGIPYkkkkkrkLNPVR  571
            AKARG+PYKK+KK+K NP++
Sbjct  151  AKARGVPYKKRKKKKRNPMK  170



>ref|XP_007016962.1| Zinc finger protein ZFPM1 [Theobroma cacao]
 gb|EOY34581.1| Zinc finger protein ZFPM1 [Theobroma cacao]
Length=241

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  164  RYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQP  343
            RYESQKRRDWNTF QYLKN +PP++L+ C+  HV+EFL+YLDQFGKTKVH+ GC +FG P
Sbjct  53   RYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHP  112

Query  344  DPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKAR  523
            +PPAPC+CPL+QAWGSLDALIGRLRAAYEENGG PE+NPFG  A+R+YLREV+E QAKAR
Sbjct  113  NPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGAKAVRIYLREVREGQAKAR  172

Query  524  GIPY  535
            GIPY
Sbjct  173  GIPY  176



>ref|XP_006286146.1| hypothetical protein CARUB_v10007704mg [Capsella rubella]
 gb|EOA19044.1| hypothetical protein CARUB_v10007704mg [Capsella rubella]
Length=191

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 127/155 (82%), Gaps = 3/155 (2%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYLK+Q PP+ +S  +  HVL FLRYLDQFGKTKVH   CVFFGQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHQQACVFFGQ  95

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKECQAK  517
            PDPP PCTCPL+QAWGSLDALIGRLRAAYEE+ GGSP+ NPF NG+IRV+LREV+E QAK
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAK  155

Query  518  ARGIPY-kkkkkrkLNPVRGI-NDHNHNSTLKQSS  616
            ARGIPY KKK+++  N V  I  D  ++S L QSS
Sbjct  156  ARGIPYRKKKRRKIKNDVVAIKKDVANSSVLNQSS  190



>ref|XP_009106595.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Brassica 
rapa]
 emb|CDX87432.1| BnaA07g34410D [Brassica napus]
Length=190

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTF QYL+NQ+PPV +S C  NH+L+FL+YLDQFGKTKVH+ GCVFFG
Sbjct  38   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFG  97

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            Q +P   C CPL+QAWGSLDALIGRLRAAYEENGG PE NPF  G IRV+LREV++ QAK
Sbjct  98   QVEPAGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAK  157

Query  518  ARGIPYkkkkkrkLNPVR  571
            ARG+PYKK+KK+K NP++
Sbjct  158  ARGVPYKKRKKKKRNPMK  175



>ref|XP_010439831.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Camelina 
sativa]
Length=191

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYLK+Q PP+ +S  +  HVL FLRYLDQFGKTKVH   CVFFGQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKECQAK  517
            PDPP PCTCPL+QAWGSLDALIGRLRAAYEE+ GGSP+ NPF NG+IRV+LREV+E QAK
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAK  155

Query  518  ARGIPY  535
            ARGIPY
Sbjct  156  ARGIPY  161



>ref|XP_009385358.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=210

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = +2

Query  128  GSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTK  307
            G  R A     SRYESQKRRDWNTF QYL+N +PP++L+ C+  HV+EFLRYLDQFGKTK
Sbjct  25   GPQRGAAAAAPSRYESQKRRDWNTFLQYLRNHKPPLALARCSGAHVIEFLRYLDQFGKTK  84

Query  308  VHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVY  487
            VH PGC F+G   PP PC CPLRQAWGSLDALIGRLRAAYEE+GG+PE NPF   A+R+Y
Sbjct  85   VHAPGCAFYGHASPPGPCACPLRQAWGSLDALIGRLRAAYEESGGTPETNPFAARAVRIY  144

Query  488  LREVKECQAKARGIPY  535
            LR+V+E QAKARGIPY
Sbjct  145  LRDVRESQAKARGIPY  160



>ref|XP_009383380.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=200

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYL+N +PP+ L+ C+  HV+EFLRYLDQFGKTKVHL GC F+G 
Sbjct  26   SRYESQKRRDWNTFLQYLRNHKPPLVLTRCSGAHVIEFLRYLDQFGKTKVHLSGCAFYGH  85

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P PPAPCTCPLRQAWGSLDALIGRLRAAYEE+GGSPE NPF   A+R++LR+V++ QAKA
Sbjct  86   PSPPAPCTCPLRQAWGSLDALIGRLRAAYEESGGSPETNPFAARAVRIFLRDVRDSQAKA  145

Query  521  RGIPY  535
            RGIPY
Sbjct  146  RGIPY  150



>ref|XP_006847407.1| hypothetical protein AMTR_s00153p00047660 [Amborella trichopoda]
 gb|ERN08988.1| hypothetical protein AMTR_s00153p00047660 [Amborella trichopoda]
Length=203

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +2

Query  134  SRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVH  313
            + S+   P SRYESQKRRDWNTF QYLKN +PP+SLS C+  HV+EFL+YLDQFGKTKVH
Sbjct  30   AESSSPAPPSRYESQKRRDWNTFLQYLKNHKPPLSLSRCSGAHVIEFLKYLDQFGKTKVH  89

Query  314  LPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLR  493
            L GC +FG P PP PC CPL+QAWGSLDALIGRLRAAYEENGG P+ NPFG  A+R+YLR
Sbjct  90   LVGCPYFGHPSPPNPCACPLKQAWGSLDALIGRLRAAYEENGGRPDANPFGARAVRIYLR  149

Query  494  EVKECQAKARGIPY  535
            EV+E QAKARGIPY
Sbjct  150  EVRESQAKARGIPY  163



>gb|KHN45745.1| hypothetical protein glysoja_043995 [Glycine soja]
Length=178

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTFGQYLKNQRPPV LS CNCNHVL+FLRYLDQFGKTKVHL GC+F+G
Sbjct  30   LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMFYG  89

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PPAPC CPLRQAWGSLDALIGRLRAAYEENGGSPE NPF +G+IRVYLREV+ECQAK
Sbjct  90   QPEPPAPCACPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRECQAK  149

Query  518  ARGIPY  535
            AR + +
Sbjct  150  ARALAF  155



>ref|XP_010434509.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Camelina 
sativa]
Length=191

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYLK+Q PP+ +S  +  HVL FLRYLDQFGKTKVH   CVFFGQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKECQAK  517
            PDPP PCTCPL+QAWGSLDALIGRLRAAYEE+ GGSP+ NPF NG+IRV+LREV+E QAK
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAK  155

Query  518  ARGIPY  535
            ARGIPY
Sbjct  156  ARGIPY  161



>gb|AES98763.2| DUF640 family protein [Medicago truncatula]
Length=225

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  119  TAEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFG  298
            TA+    S   P  SRYESQKRRDWNTF QYL+N +PP++L+ C+  HV+EFL+YLDQFG
Sbjct  22   TAQPQPSSPATPTPSRYESQKRRDWNTFQQYLRNHKPPLTLALCSGAHVIEFLKYLDQFG  81

Query  299  KTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAI  478
            KTKVH+ GC +FGQP+PP+PC CPL+QAWGSLDALIGRLRAA+EENGG PE+NPFG  A+
Sbjct  82   KTKVHVIGCPYFGQPNPPSPCACPLKQAWGSLDALIGRLRAAFEENGGKPESNPFGTRAV  141

Query  479  RVYLREVKECQAKARGIPY  535
            R+YLREVK+ QAKARG+PY
Sbjct  142  RIYLREVKDGQAKARGVPY  160



>ref|XP_002298496.1| hypothetical protein POPTR_0001s28780g [Populus trichocarpa]
 gb|EEE83301.1| hypothetical protein POPTR_0001s28780g [Populus trichocarpa]
Length=228

 Score =   217 bits (552),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 119/137 (87%), Gaps = 3/137 (2%)
 Frame = +2

Query  125  EGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKT  304
            EGSS  A   P SRYESQKRRDWNTF QY+KN +PP++L+ C+  HV+EFL+YLDQFGKT
Sbjct  38   EGSSPPA---PPSRYESQKRRDWNTFLQYIKNHKPPLTLARCSGAHVIEFLKYLDQFGKT  94

Query  305  KVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRV  484
            KVH+ GC +FG P+PPAPC+CPL+QAWGSLDALIGRLRAAYEENGG PE+NPFG  A+R+
Sbjct  95   KVHITGCPYFGHPNPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGLPESNPFGARAVRI  154

Query  485  YLREVKECQAKARGIPY  535
            YLREV+E QAKARGIPY
Sbjct  155  YLREVREGQAKARGIPY  171



>ref|XP_004504297.1| PREDICTED: uncharacterized protein LOC101498424 [Cicer arietinum]
Length=185

 Score =   215 bits (548),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +2

Query  122  AEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGK  301
            A  S+    Q PLSRYESQKRRDWNTFGQYLK Q PPV LS+CN NHVL+FLRYLDQFGK
Sbjct  15   ASSSTNHQQQQPLSRYESQKRRDWNTFGQYLKTQNPPVPLSNCNFNHVLDFLRYLDQFGK  74

Query  302  TKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIR  481
            TKVHL  C+FFGQP PPAPC CPL+QAWGSLDALIGRLRAAYEE+GGSPE NPFG G IR
Sbjct  75   TKVHLHTCIFFGQPTPPAPCACPLKQAWGSLDALIGRLRAAYEEHGGSPETNPFGGGPIR  134

Query  482  VYLREVKECQAKARGIPY  535
            VYLREVK+ Q KARGIPY
Sbjct  135  VYLREVKDSQQKARGIPY  152



>ref|XP_007159026.1| hypothetical protein PHAVU_002G202200g [Phaseolus vulgaris]
 gb|ESW31020.1| hypothetical protein PHAVU_002G202200g [Phaseolus vulgaris]
Length=230

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +2

Query  137  RSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHL  316
            R    PPLSRYESQKRRDWNTFGQYLKN RPP++LS C+  HVLEFLRYLDQFGKTKVH 
Sbjct  33   RVCVSPPLSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHA  92

Query  317  PGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLRE  496
              C FFG   PP PC+CPL+QAWGSLDALIGRLRAA+EE+GG+PE NPFG  A+R+YLRE
Sbjct  93   ETCAFFGNSHPPGPCSCPLKQAWGSLDALIGRLRAAFEEHGGAPEMNPFGTRAVRLYLRE  152

Query  497  VKECQAKARGIPY  535
            V++ QAKARGI Y
Sbjct  153  VRDAQAKARGIAY  165



>ref|NP_193596.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SN52.1|LSH9_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9; AltName: 
Full=Protein ORGAN BOUNDARY 9 [Arabidopsis thaliana]
 emb|CAB37446.1| putative protein [Arabidopsis thaliana]
 emb|CAB78863.1| putative protein [Arabidopsis thaliana]
 gb|AAR24223.1| At4g18610 [Arabidopsis thaliana]
 gb|AAT35235.1| At4g18610 [Arabidopsis thaliana]
 gb|AEE84068.1| uncharacterized protein AT4G18610 [Arabidopsis thaliana]
Length=191

 Score =   215 bits (548),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYLK+Q PP+ +S  +  HVL FLRYLDQFGKTKVH   CVFFGQ
Sbjct  36   SRYESQKRRDWNTFVQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKECQAK  517
            PDPP PCTCPL+QAWGSLDALIGRLRAAYEE+ GGSP+ NPF NG+IRV+LREV+E QAK
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAK  155

Query  518  ARGIPY  535
            ARGIPY
Sbjct  156  ARGIPY  161



>ref|XP_008355077.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Malus 
domestica]
Length=228

 Score =   216 bits (551),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  140  SADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLP  319
            SA   P SRYESQKRRDWNTF QYLKN +PP++L+ C+  HV+EFL+YLDQFGKTKVH  
Sbjct  41   SASPAPPSRYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHAA  100

Query  320  GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREV  499
            GC +FG  +PPAPC CPL+QAWGSLDALIGRLRAAYEENGG PE+NPFG  A+R+YLREV
Sbjct  101  GCPYFGHQNPPAPCACPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLREV  160

Query  500  KECQAKARGIPY  535
            +E QAKARGIPY
Sbjct  161  REGQAKARGIPY  172



>ref|XP_010449492.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Camelina 
sativa]
Length=192

 Score =   215 bits (548),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYLK+Q PP+ +S  +  HVL FLRYLDQFGKTKVH   CVFFGQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKECQAK  517
            PDPP PCTCPL+QAWGSLDALIGRLRAAYEE+ GGSP+ NPF NG+IRV+LREV+E QAK
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAK  155

Query  518  ARGIPY  535
            ARGIPY
Sbjct  156  ARGIPY  161



>ref|XP_003615805.1| hypothetical protein MTR_5g072510 [Medicago truncatula]
Length=257

 Score =   217 bits (553),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +2

Query  119  TAEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFG  298
            TA+    S   P  SRYESQKRRDWNTF QYL+N +PP++L+ C+  HV+EFL+YLDQFG
Sbjct  22   TAQPQPSSPATPTPSRYESQKRRDWNTFQQYLRNHKPPLTLALCSGAHVIEFLKYLDQFG  81

Query  299  KTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAI  478
            KTKVH+ GC +FGQP+PP+PC CPL+QAWGSLDALIGRLRAA+EENGG PE+NPFG  A+
Sbjct  82   KTKVHVIGCPYFGQPNPPSPCACPLKQAWGSLDALIGRLRAAFEENGGKPESNPFGTRAV  141

Query  479  RVYLREVKECQAKARGIPY  535
            R+YLREVK+ QAKARG+PY
Sbjct  142  RIYLREVKDGQAKARGVPY  160



>ref|XP_009108056.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Brassica 
rapa]
Length=195

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYE+QKRRDWNTFGQYL+N RPP+SLS C   HVLEFLRYLDQFGKTKVH   C FFG
Sbjct  45   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCGGAHVLEFLRYLDQFGKTKVHTQLCPFFG  104

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
              +PPAPC CPLRQAWGSLDALIGRLRAA+EENGGSPE NPFG  A+R+YLREV++ QAK
Sbjct  105  HANPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  164

Query  518  ARGIPY  535
            ARGI Y
Sbjct  165  ARGISY  170



>ref|XP_002870033.1| hypothetical protein ARALYDRAFT_914818 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46292.1| hypothetical protein ARALYDRAFT_914818 [Arabidopsis lyrata subsp. 
lyrata]
Length=191

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYLK+Q PP+ +S  +  HVL FLRYLDQFGKTKVH   CVFFGQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKECQAK  517
            PDPP PCTCPL+QAWGSLDALIGRLRAAYEE+ GGSP+ NPF NG+IRV+LREV+E QAK
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDANPFANGSIRVHLREVRESQAK  155

Query  518  ARGIPY  535
            ARGIPY
Sbjct  156  ARGIPY  161



>gb|KHG10505.1| Error-prone DNA polymerase [Gossypium arboreum]
Length=238

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = +2

Query  164  RYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQP  343
            RYESQKRRDWNTF QYLKN +PP++L+ C+  HV+EFL+YLDQFGKTKVH+ GC +FG P
Sbjct  52   RYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHP  111

Query  344  DPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKAR  523
            +PPAPC+CPL+QAWGSLDALIGRLRAAYEENGG PE+NPF   A+R+YLREV+E QAKAR
Sbjct  112  NPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFAARAVRIYLREVREGQAKAR  171

Query  524  GIPY  535
            GIPY
Sbjct  172  GIPY  175



>ref|XP_009398867.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
Length=206

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  164  RYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQP  343
            RYESQKRRDWNTFGQYL+N RPP+SLS C+ +HVLEFLRYLDQFGKTK+H   C FFG  
Sbjct  43   RYESQKRRDWNTFGQYLRNHRPPLSLSQCSSSHVLEFLRYLDQFGKTKIHTHLCPFFGNS  102

Query  344  DPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKAR  523
            +PPAPC CPLRQAWGSLDALIGRLRAAYEENGG PE+NPFG  AIR+YLREV+E Q+KAR
Sbjct  103  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPESNPFGARAIRLYLREVREVQSKAR  162

Query  524  GIPY  535
            GI Y
Sbjct  163  GISY  166



>gb|AAM64330.1| unknown [Arabidopsis thaliana]
Length=195

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            P LSRYESQKRRDWNTF QYL+NQ+PPV +S C  NH+L+FL+YLDQFGKTKVH+ GCVF
Sbjct  36   PALSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVF  95

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FGQ +P   C CPL+QAWGSLDALIGRLRAA+EENGG PE NPF  G IRV+LREV++ Q
Sbjct  96   FGQVEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQ  155

Query  512  AKARGIPY  535
            AKARG+PY
Sbjct  156  AKARGVPY  163



>emb|CDX78877.1| BnaA01g09440D [Brassica napus]
Length=196

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = +2

Query  164  RYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQP  343
            RYESQKRRDWNTF QYLK+Q PP+ +S  +  HVL FLRYLDQFGKTKVH   CVFFGQP
Sbjct  40   RYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQP  99

Query  344  DPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKECQAKA  520
            DPP PCTCPL+QAWGSLDALIGRLRAAYEE+ GGSP+ NPF NG+IRV+LREV+E QAKA
Sbjct  100  DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQAKA  159

Query  521  RGIPY  535
            RGIPY
Sbjct  160  RGIPY  164



>ref|XP_010685918.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 [Beta vulgaris 
subsp. vulgaris]
Length=258

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYL+N +PP+SLS C+  HV+EFL+YLDQFGKTKVH+ GC +FG 
Sbjct  76   SRYESQKRRDWNTFLQYLRNHKPPLSLSRCSGAHVIEFLKYLDQFGKTKVHITGCPYFGH  135

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PP+PC CPL+QAWGSLDALIGRLRAAYEENGG PE+NPFG  A+R+YLREV+E QAKA
Sbjct  136  PNPPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLREVRESQAKA  195

Query  521  RGIPY  535
            RGIPY
Sbjct  196  RGIPY  200



>ref|XP_006414079.1| hypothetical protein EUTSA_v10027091mg [Eutrema salsugineum]
 gb|ESQ55532.1| hypothetical protein EUTSA_v10027091mg [Eutrema salsugineum]
Length=193

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 110/126 (87%), Gaps = 1/126 (1%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYLK+Q PP+ +S  +  HVL FLRYLDQFGKTKVH   CVF+GQ
Sbjct  38   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHQQACVFYGQ  97

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKECQAK  517
            PDPP PCTCPL+QAWGSLDALIGRLRAAYEE+ GGSP+ NPF NG+IR++LREV+E QAK
Sbjct  98   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRIHLREVRESQAK  157

Query  518  ARGIPY  535
            ARGIPY
Sbjct  158  ARGIPY  163



>gb|EYU45980.1| hypothetical protein MIMGU_mgv1a021801mg [Erythranthe guttata]
Length=201

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  164  RYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQP  343
            RYESQKRRDWNTF QYL+N +PP++L+ C+  HV+EFL+YLDQFGKTKVH+ GC +FGQP
Sbjct  43   RYESQKRRDWNTFQQYLRNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHVTGCPYFGQP  102

Query  344  DPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKAR  523
            DPPAPC C L+QAWGSLDALIGRLRAAYEENGG P+ NPFG  A+R+YLREV+E QAKAR
Sbjct  103  DPPAPCACQLKQAWGSLDALIGRLRAAYEENGGRPDTNPFGAKAVRIYLREVRESQAKAR  162

Query  524  GIPY  535
            GIPY
Sbjct  163  GIPY  166



>ref|XP_010518804.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010518805.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
 ref|XP_010518806.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
Length=195

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = +2

Query  164  RYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQP  343
            RYESQKRRDWNTF QYLK+Q+PP+S+S    +HVL FL YLDQFGKTKVH   CVFFGQP
Sbjct  38   RYESQKRRDWNTFLQYLKSQKPPISMSQFEYSHVLSFLNYLDQFGKTKVHNQACVFFGQP  97

Query  344  DPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKECQAKA  520
            DPPA CTCPLRQAWGSLDALIGRLRAAYEE+ GGS E+NPF NGAIRV+LREVKE Q++A
Sbjct  98   DPPAACTCPLRQAWGSLDALIGRLRAAYEEHGGGSTESNPFANGAIRVHLREVKESQSRA  157

Query  521  RGIPY  535
            RGIPY
Sbjct  158  RGIPY  162



>ref|NP_565190.1| protein LIGHT SENSITIVE HYPOCOTYLS 7 [Arabidopsis thaliana]
 sp|Q9ZVA0.1|LSH7_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7; AltName: 
Full=Protein ORGAN BOUNDARY 7 [Arabidopsis thaliana]
 gb|AAC83029.1| Strong similarity to T16B12.3 gi|3746060 unknown protein from 
Arabidopsis thaliana BAC gb|AC005311 [Arabidopsis thaliana]
 gb|AEE36158.1| uncharacterized protein AT1G78815 [Arabidopsis thaliana]
Length=195

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTF QYL+NQ+PPV +S C  NH+L+FL+YLDQFGKTKVH+ GCVFFG
Sbjct  38   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFG  97

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            Q +P   C CPL+QAWGSLDALIGRLRAA+EENGG PE NPF  G IRV+LREV++ QAK
Sbjct  98   QVEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAK  157

Query  518  ARGIPY  535
            ARG+PY
Sbjct  158  ARGVPY  163



>ref|XP_006389954.1| hypothetical protein EUTSA_v10019792mg [Eutrema salsugineum]
 gb|ESQ27240.1| hypothetical protein EUTSA_v10019792mg [Eutrema salsugineum]
Length=188

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTF QYL+NQ+PPV +S C  NH+L+FL+YLDQFGKTKVH+ GCVFFG
Sbjct  32   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFG  91

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            Q +P   C CPL+QAWGSLDALIGRLRAAYEENGG PE NPF  G IRV+LREV++ QAK
Sbjct  92   QVEPAGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQAK  151

Query  518  ARGIPY  535
            ARG+PY
Sbjct  152  ARGVPY  157



>ref|XP_003638136.1| hypothetical protein MTR_119s0026 [Medicago truncatula]
Length=420

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 125/154 (81%), Gaps = 4/154 (3%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            PPLSRYESQKRRDWNTFGQYLKN RPP++LS C+  HVLEFLRYLDQFGKTKVH   C +
Sbjct  42   PPLSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHSENCAY  101

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FG   PP PC CPL+QAWGSLDALIGRLRAA+EENGGS E NPFG  A+R+YLREV++ Q
Sbjct  102  FGNSHPPGPCPCPLKQAWGSLDALIGRLRAAFEENGGSQEMNPFGARAVRLYLREVRDAQ  161

Query  512  AKARGIPYkkkkkrkLNPVRGINDHNHNSTLKQS  613
            AKARGI Y+KKK++KLN     N  N + T+ Q+
Sbjct  162  AKARGIGYEKKKRKKLNQ----NQQNGSITMVQN  191



>ref|XP_010043398.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 isoform 
X3 [Eucalyptus grandis]
 gb|KCW85401.1| hypothetical protein EUGRSUZ_B02224 [Eucalyptus grandis]
Length=204

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 130/171 (76%), Gaps = 7/171 (4%)
 Frame = +2

Query  23   SPPKIRTVLLYPSMNSSSSTTHDGAppppppTTAEGSSRSADQPPLSRYESQKRRDWNTF  202
            SPP    VL+ P+ ++++ T       P P +  E ++ +A  PP SRYESQKRRDWNTF
Sbjct  10   SPPDPHGVLVVPTTSTTAETI------PGPSSPQEAAAAAAASPP-SRYESQKRRDWNTF  62

Query  203  GQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQA  382
             QYL+N +PP++L+ C+   VLEFL+YLDQFGKTKVH+ GC FFG P PP PC CPL+QA
Sbjct  63   LQYLQNHKPPLTLARCSGAQVLEFLKYLDQFGKTKVHMNGCPFFGNPTPPGPCACPLKQA  122

Query  383  WGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKARGIPY  535
            WGSLDALIGRLRAA+EENGG PE NPF   A+R+YLREVKE QAKARGIPY
Sbjct  123  WGSLDALIGRLRAAFEENGGRPELNPFAARAVRIYLREVKEGQAKARGIPY  173



>ref|XP_002889213.1| At1g78815 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65472.1| At1g78815 [Arabidopsis lyrata subsp. lyrata]
Length=191

 Score =   213 bits (543),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTF QYL+NQ+PPV +S C  NH+L+FL+YLDQFGKTKVH+ GCVFFG
Sbjct  34   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFG  93

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            Q +P   C CPL+QAWGSLDALIGRLRAA+EENGG PE NPF  G IRV+LREV++ QAK
Sbjct  94   QVEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAK  153

Query  518  ARGIPY  535
            ARG+PY
Sbjct  154  ARGVPY  159



>ref|XP_003629770.1| 177 protein [Medicago truncatula]
 gb|AET04246.1| DUF640 family protein [Medicago truncatula]
Length=185

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = +2

Query  149  QPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCV  328
            Q PLSRYESQKRRDWNTF QYLK+Q P V LSHCN NHVL+FLRYLDQFGKTKVH  GC+
Sbjct  26   QQPLSRYESQKRRDWNTFNQYLKSQNPLVPLSHCNFNHVLDFLRYLDQFGKTKVHFQGCI  85

Query  329  FFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKEC  508
            FFGQP PPAPC CPL+QAWGSLDALIGRLRAAYEENGGS E NPF  GAIRVYLREVK+ 
Sbjct  86   FFGQPTPPAPCACPLKQAWGSLDALIGRLRAAYEENGGSSETNPFAGGAIRVYLREVKDS  145

Query  509  QAKARGIPYkkkkkrkLN-PVRGINDHNHNSTLKQ  610
            Q KARGIPYKKKKK+K N  ++G    +  + +KQ
Sbjct  146  QQKARGIPYKKKKKKKKNYQIKGTTQADQGACVKQ  180



>ref|XP_010043397.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 isoform 
X2 [Eucalyptus grandis]
 gb|KCW85400.1| hypothetical protein EUGRSUZ_B02224 [Eucalyptus grandis]
Length=225

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 130/171 (76%), Gaps = 7/171 (4%)
 Frame = +2

Query  23   SPPKIRTVLLYPSMNSSSSTTHDGAppppppTTAEGSSRSADQPPLSRYESQKRRDWNTF  202
            SPP    VL+ P+ ++++ T       P P +  E ++ +A  PP SRYESQKRRDWNTF
Sbjct  10   SPPDPHGVLVVPTTSTTAETI------PGPSSPQEAAAAAAASPP-SRYESQKRRDWNTF  62

Query  203  GQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQA  382
             QYL+N +PP++L+ C+   VLEFL+YLDQFGKTKVH+ GC FFG P PP PC CPL+QA
Sbjct  63   LQYLQNHKPPLTLARCSGAQVLEFLKYLDQFGKTKVHMNGCPFFGNPTPPGPCACPLKQA  122

Query  383  WGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKARGIPY  535
            WGSLDALIGRLRAA+EENGG PE NPF   A+R+YLREVKE QAKARGIPY
Sbjct  123  WGSLDALIGRLRAAFEENGGRPELNPFAARAVRIYLREVKEGQAKARGIPY  173



>gb|ABF83646.1| At1g78815 [Arabidopsis thaliana]
Length=195

 Score =   213 bits (543),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTF QYL+NQ+PPV +S C  NH+L+FL+YLDQFGKTKVH+ GCVFFG
Sbjct  38   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFG  97

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            Q +P   C CPL+QAWGSLDALIGRLRAA+EENGG PE NPF  G IRV+LREV++ QAK
Sbjct  98   QVEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAK  157

Query  518  ARGIPY  535
            ARG+PY
Sbjct  158  ARGVPY  163



>ref|XP_010429720.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Camelina 
sativa]
Length=193

 Score =   213 bits (542),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTF QYL+NQ+PPV +S C  NH+L+FL+YLDQFGKTKVH+ GCVFFG
Sbjct  36   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFG  95

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            Q +P   C CPL+QAWGSLDALIGRLRAA+EENGG PE NPF  G IRV+LREV++ QAK
Sbjct  96   QVEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAK  155

Query  518  ARGIPY  535
            ARG+PY
Sbjct  156  ARGVPY  161



>ref|XP_010417489.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Camelina 
sativa]
Length=196

 Score =   213 bits (542),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTF QYL+NQ+PPV +S C  NH+L+FL+YLDQFGKTKVH+ GCVFFG
Sbjct  39   LSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFG  98

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            Q +P   C CPL+QAWGSLDALIGRLRAA+EENGG PE NPF  G IRV+LREV++ QAK
Sbjct  99   QVEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQAK  158

Query  518  ARGIPY  535
            ARG+PY
Sbjct  159  ARGVPY  164



>ref|XP_009615590.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=194

 Score =   213 bits (541),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            P LSRYESQKRRDWNTFGQYLKN RPP+ LS CN NHVLEFLRYLDQFGKTKVHL GC F
Sbjct  39   PQLSRYESQKRRDWNTFGQYLKNLRPPIPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPF  98

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            FGQP+PPAPC CPLRQAWGSLDALIGRLRAAYEENGG PENNPF +G+IR+YLREV++ Q
Sbjct  99   FGQPEPPAPCACPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRIYLREVRDFQ  158

Query  512  AKARGIPY  535
            AKARGI Y
Sbjct  159  AKARGISY  166



>gb|EPS74620.1| hypothetical protein M569_00139, partial [Genlisea aurea]
Length=171

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYL+N +PP++L  C+  HV+EFL+YLDQFGKTKVH+ GC +FG+
Sbjct  29   SRYESQKRRDWNTFQQYLRNHKPPLTLGRCSGAHVIEFLKYLDQFGKTKVHVAGCPYFGE  88

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PPA C CPL+QAWGSLDALIGRLRAAYEENGG  E+NPFG  A+R+YLREV+E QAKA
Sbjct  89   PNPPASCACPLKQAWGSLDALIGRLRAAYEENGGRQESNPFGAKAVRIYLREVRESQAKA  148

Query  521  RGIPY  535
            RG+PY
Sbjct  149  RGVPY  153



>emb|CDY26881.1| BnaA02g19060D [Brassica napus]
Length=191

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQK+RDWNTF QYL+NQ+PPV +S C  NH+L+FL+YLDQFGKTKVH  GCVFFG
Sbjct  33   LSRYESQKKRDWNTFCQYLRNQQPPVHVSQCGSNHILDFLQYLDQFGKTKVHAHGCVFFG  92

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            Q +P   C CPL+QAWGSLDALIGRLRAAYEENGG PE NPF  G IRV+L+EV++ QAK
Sbjct  93   QVEPSGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLKEVRDSQAK  152

Query  518  ARGIPY--kkkkkrkLNPVRGIND  583
            ARG+PY  +KKKK+K NP+R  +D
Sbjct  153  ARGVPYKKRKKKKKKRNPIRSDHD  176



>ref|XP_006398272.1| hypothetical protein EUTSA_v10001044mg [Eutrema salsugineum]
 gb|ESQ39725.1| hypothetical protein EUTSA_v10001044mg [Eutrema salsugineum]
Length=180

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            P LSRYESQKRRDWNTF QYLK   PP   S  +  HVL FL YLDQFGKTKVH   C F
Sbjct  26   PQLSRYESQKRRDWNTFLQYLKTLNPPEKTSQFDHTHVLSFLNYLDQFGKTKVHHQACAF  85

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKEC  508
            FGQPDPP+PCTCPL+QAWGSLDALIGRLRAAYEE+ GGS +NNPFGNG+IR+YLREV+E 
Sbjct  86   FGQPDPPSPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSSDNNPFGNGSIRIYLREVRES  145

Query  509  QAKARGIPY  535
            QAKARGIPY
Sbjct  146  QAKARGIPY  154



>ref|XP_006282119.1| hypothetical protein CARUB_v10028368mg [Capsella rubella]
 gb|EOA15017.1| hypothetical protein CARUB_v10028368mg [Capsella rubella]
Length=169

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 111/127 (87%), Gaps = 1/127 (1%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTF QYLK   PP+++S  +  HVL FL+YLDQFGKTKVH   CVFFG
Sbjct  28   LSRYESQKRRDWNTFLQYLKTLNPPMAISIFDHTHVLSFLKYLDQFGKTKVHNQVCVFFG  87

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEN-GGSPENNPFGNGAIRVYLREVKECQA  514
            QPDPP PCTCPL+QAWGSLDALIGRLRAAYEE+ GGS ENNPFGNG+IR+YLREV++ QA
Sbjct  88   QPDPPLPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSSENNPFGNGSIRIYLREVRQFQA  147

Query  515  KARGIPY  535
            KARGIPY
Sbjct  148  KARGIPY  154



>ref|XP_006443825.1| hypothetical protein CICLE_v10022295mg [Citrus clementina]
 ref|XP_006479528.1| PREDICTED: uncharacterized protein LOC102612277 [Citrus sinensis]
 gb|ESR57065.1| hypothetical protein CICLE_v10022295mg [Citrus clementina]
Length=204

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  164  RYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQP  343
            RYE+QKRRDWNTFGQYLKN RPP+SLS C+  HVLEFLRYLDQFGKTKVH P C F+G  
Sbjct  52   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHQ  111

Query  344  DPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKAR  523
            +PPAPC CPLRQAWGSLDALIGRLRAA+EENGG PE NPFG  A+R+YLREV++ Q+KAR
Sbjct  112  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDVQSKAR  171

Query  524  GIPY  535
            GI Y
Sbjct  172  GISY  175



>ref|XP_008804907.1| PREDICTED: protein G1-like7 [Phoenix dactylifera]
Length=229

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYL+N +PP++L+ C+  HV+EFLRYLDQFGKTKVH  GC FFGQ
Sbjct  43   SRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHNAGCTFFGQ  102

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P+PP PC CPL+QAWGSLDALIGRLRAAYEE+GG PE NPF   A+R+YLREV+E QAKA
Sbjct  103  PNPPGPCACPLKQAWGSLDALIGRLRAAYEESGGRPEANPFAARAVRIYLREVRESQAKA  162

Query  521  RGIPY  535
            RG+PY
Sbjct  163  RGVPY  167



>emb|CDY14588.1| BnaC02g25250D [Brassica napus]
Length=190

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQK+RDWNTF QYL+NQ+PPV +S C  NH+L+FL+YLDQFGKTKVH  GCVFFG
Sbjct  33   LSRYESQKKRDWNTFCQYLRNQQPPVHVSQCGSNHILDFLQYLDQFGKTKVHAHGCVFFG  92

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            Q +P   C CPL+QAWGSLDALIGRLRAAYEENGG PE NPF  G IRV+L+EV++ QAK
Sbjct  93   QVEPSGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLKEVRDSQAK  152

Query  518  ARGIPY-kkkkkrkLNPVRGIND  583
            ARG+PY K+KKK+K NP+R  +D
Sbjct  153  ARGVPYKKRKKKKKRNPMRSDHD  175



>ref|XP_010043396.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 isoform 
X1 [Eucalyptus grandis]
Length=278

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 130/171 (76%), Gaps = 7/171 (4%)
 Frame = +2

Query  23   SPPKIRTVLLYPSMNSSSSTTHDGAppppppTTAEGSSRSADQPPLSRYESQKRRDWNTF  202
            SPP    VL+ P+ ++++ T       P P +  E ++ +A  PP SRYESQKRRDWNTF
Sbjct  10   SPPDPHGVLVVPTTSTTAETI------PGPSSPQEAAAAAAASPP-SRYESQKRRDWNTF  62

Query  203  GQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQA  382
             QYL+N +PP++L+ C+   VLEFL+YLDQFGKTKVH+ GC FFG P PP PC CPL+QA
Sbjct  63   LQYLQNHKPPLTLARCSGAQVLEFLKYLDQFGKTKVHMNGCPFFGNPTPPGPCACPLKQA  122

Query  383  WGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKARGIPY  535
            WGSLDALIGRLRAA+EENGG PE NPF   A+R+YLREVKE QAKARGIPY
Sbjct  123  WGSLDALIGRLRAAFEENGGRPELNPFAARAVRIYLREVKEGQAKARGIPY  173



>ref|XP_009419635.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Musa 
acuminata subsp. malaccensis]
Length=213

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWN+FGQYL+N RPP+ LS C+  HVLEFLRYLDQFGKTKVH  GC FFG 
Sbjct  22   SRYESQKRRDWNSFGQYLRNHRPPLELSRCSGAHVLEFLRYLDQFGKTKVHTAGCPFFGH  81

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
            P PPAPCTCPLRQAWGSLD+L+GRLRAA+EE+GG PE NPF   A+R+YLREV++ QAKA
Sbjct  82   PQPPAPCTCPLRQAWGSLDSLVGRLRAAFEEDGGQPEVNPFAARAVRLYLREVRDSQAKA  141

Query  521  RGIPY  535
            RGI Y
Sbjct  142  RGIAY  146



>ref|XP_009391700.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=240

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +2

Query  158  LSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFG  337
            LSRYESQKRRDWNTF QYLKN +PP++L+ C+  HV+EFL+YLDQFGKTKVH PGC FFG
Sbjct  46   LSRYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHSPGCTFFG  105

Query  338  QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAK  517
            QP+PPA C CPL+QAWGSLDALIGRLRAAYEENGG  E+NPF   A+R YLREV+E  +K
Sbjct  106  QPNPPASCACPLKQAWGSLDALIGRLRAAYEENGGRQESNPFAARAVRSYLREVRESHSK  165

Query  518  ARGIPY  535
            ARGIPY
Sbjct  166  ARGIPY  171



>ref|XP_009354180.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 [Pyrus 
x bretschneideri]
Length=228

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  164  RYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQP  343
            RYESQKRRDWNTF QYLKN +PP++L+ C+  HV+EFL+YLDQFGKTKVH  GC +FG  
Sbjct  49   RYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHAAGCPYFGHQ  108

Query  344  DPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKAR  523
            +PPAPC CPL+QAWGSLDALIGRLRAAYEENGG PE+NPFG  A+R+YLREV+E QAKAR
Sbjct  109  NPPAPCACPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLREVREGQAKAR  168

Query  524  GIPY  535
            GIPY
Sbjct  169  GIPY  172



>ref|XP_002892379.1| hypothetical protein ARALYDRAFT_887918 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68638.1| hypothetical protein ARALYDRAFT_887918 [Arabidopsis lyrata subsp. 
lyrata]
Length=198

 Score =   211 bits (536),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  161  SRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQ  340
            SRYESQKRRDWNTF QYLKN +PP++LS C+  HV+EFL+YLDQFGKTKVH+  C +FG 
Sbjct  32   SRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACPYFGH  91

Query  341  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQAKA  520
              PP+PC+CPL+QAWGSLDALIGRLRAAYEENGG P++NPF   A+R+YLREV+E QAKA
Sbjct  92   QQPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFATRAVRIYLREVRESQAKA  151

Query  521  RGIPY  535
            RGIPY
Sbjct  152  RGIPY  156



>ref|XP_009144329.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Brassica 
rapa]
Length=165

 Score =   209 bits (532),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = +2

Query  140  SADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLP  319
            +A  PPLSRYESQKRRDWNTF QYL+N +PP++L+ C+  HVLEFL+YLDQFGKTKVH+ 
Sbjct  17   TASAPPLSRYESQKRRDWNTFLQYLRNHKPPLTLTLCSGAHVLEFLKYLDQFGKTKVHVT  76

Query  320  GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREV  499
             C FFG  DP +PC CP +QAWGSLD+LIGRLRAAYEENGG PE NPF   A+R+YLREV
Sbjct  77   TCFFFGHSDPTSPCACPHKQAWGSLDSLIGRLRAAYEENGGRPETNPFAARAVRIYLREV  136

Query  500  KECQAKARGIPY  535
            K  QAKARGI Y
Sbjct  137  KGSQAKARGITY  148



>ref|XP_010689830.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Beta 
vulgaris subsp. vulgaris]
Length=188

 Score =   210 bits (534),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  152  PPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVF  331
            P  SRYESQKRRDWNTFGQYL+NQ PPV LS C C+HVL+FLRYLDQFGKTKVH+PGC+F
Sbjct  21   PTPSRYESQKRRDWNTFGQYLRNQHPPVPLSQCTCHHVLDFLRYLDQFGKTKVHVPGCMF  80

Query  332  FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQ  511
            +GQP+PPAPC CPLRQAWGSLDALIGRLRAAYEENGG PE NPF   AIRVYLREV+ECQ
Sbjct  81   YGQPEPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGPPETNPFAGSAIRVYLREVRECQ  140

Query  512  AKARGIPY  535
            AKARGIPY
Sbjct  141  AKARGIPY  148



>ref|XP_010542671.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Tarenaya 
hassleriana]
Length=187

 Score =   209 bits (533),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 124/158 (78%), Gaps = 2/158 (1%)
 Frame = +2

Query  62   MNSSSSTTHDGAppppppTTAEGSSRSADQPPLSRYESQKRRDWNTFGQYLKNQRPPVSL  241
            M+S+SS  +   P P     A  +  S+ QP  SRYESQKRRDW+TF QYLKN +PP++L
Sbjct  1    MDSASSGFNRPDPGPSSSAVASVAESSSQQP--SRYESQKRRDWSTFLQYLKNHKPPLTL  58

Query  242  SHCNCNHVLEFLRYLDQFGKTKVHLPGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRA  421
            S C+  HV+EFL+YLDQFGKTKVH+  C +FG  +PP+PC CPL+QAWGSLDALIGRLRA
Sbjct  59   SWCSGAHVIEFLKYLDQFGKTKVHVTACPYFGHQNPPSPCACPLKQAWGSLDALIGRLRA  118

Query  422  AYEENGGSPENNPFGNGAIRVYLREVKECQAKARGIPY  535
            AYEENGG P++NPF   A+R+YLREV+E QAKARGIPY
Sbjct  119  AYEENGGRPDSNPFAARAVRIYLREVREGQAKARGIPY  156



>ref|XP_002961823.1| hypothetical protein SELMODRAFT_68566, partial [Selaginella moellendorffii]
 ref|XP_002980828.1| hypothetical protein SELMODRAFT_58613, partial [Selaginella moellendorffii]
 gb|EFJ18013.1| hypothetical protein SELMODRAFT_58613, partial [Selaginella moellendorffii]
 gb|EFJ37083.1| hypothetical protein SELMODRAFT_68566, partial [Selaginella moellendorffii]
Length=173

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  155  PLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLPGCVFF  334
            P SRYE+QKRRDWNTFGQYL+N RPP++L  C+  +VLEFLRYLDQFGKTK+H P C FF
Sbjct  25   PPSRYEAQKRRDWNTFGQYLRNHRPPLTLPRCSGANVLEFLRYLDQFGKTKIHAPACPFF  84

Query  335  GQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRVYLREVKECQA  514
            G   PPAPC CPLRQAWGSLDALIGRLRAA+EE+GG PE+NPFG  A+R+YLREV+E QA
Sbjct  85   GIAHPPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARAVRLYLREVREMQA  144

Query  515  KARGIPY  535
            KARGI Y
Sbjct  145  KARGIAY  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2419911105472