BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23665_g4_i1 len=1000 path=[16407:0-145 620:146-146 621:147-190
12632:191-301 12742:302-389 6960:390-397 20136:398-414 13522:415-746
6417:747-770 6441:771-999]

Length=1000
                                                                      Score     E

ref|XP_006348870.1|  PREDICTED: uncharacterized protein LOC102600485    270   1e-86   
ref|XP_004243287.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    268   4e-86   
ref|XP_009786006.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    266   3e-85   
ref|XP_009626514.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    265   1e-84   
ref|XP_009593391.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    264   2e-84   
ref|XP_002280666.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    262   9e-84   Vitis vinifera
emb|CAN66524.1|  hypothetical protein VITISV_034969                     261   2e-83   Vitis vinifera
ref|XP_007215057.1|  hypothetical protein PRUPE_ppa012217mg             262   2e-83   
ref|XP_007048693.1|  Pleckstrin domain-containing family N member 1     263   2e-83   
gb|KDP35079.1|  hypothetical protein JCGZ_11031                         260   7e-83   
ref|XP_008342774.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    260   1e-82   
ref|XP_006446791.1|  hypothetical protein CICLE_v10016699mg             260   2e-82   
ref|XP_006469013.1|  PREDICTED: uncharacterized protein LOC102606613    259   3e-82   
ref|XP_009790882.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    259   3e-82   
ref|XP_009790219.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    259   3e-82   
ref|XP_010104392.1|  hypothetical protein L484_010344                   258   3e-82   
ref|XP_010052695.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    258   4e-82   
gb|KHG07235.1|  Putative beta-lactamase-like 1                          258   4e-82   
ref|XP_008381217.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    258   5e-82   
ref|XP_002320411.1|  hypothetical protein POPTR_0014s13900g             258   5e-82   Populus trichocarpa [western balsam poplar]
ref|XP_009343797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    258   5e-82   
ref|XP_011083008.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    258   6e-82   
ref|XP_011033736.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    257   9e-82   
ref|XP_010035859.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    257   1e-81   
ref|XP_002521586.1|  conserved hypothetical protein                     257   1e-81   Ricinus communis
ref|XP_002301561.2|  hypothetical protein POPTR_0002s22690g             254   1e-80   Populus trichocarpa [western balsam poplar]
ref|XP_011008166.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    253   6e-80   
gb|KHN36698.1|  hypothetical protein glysoja_001429                     253   6e-80   
ref|XP_011098044.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    251   2e-79   
ref|XP_006370148.1|  hypothetical protein POPTR_0001s40140g             251   4e-79   
ref|NP_001235660.1|  uncharacterized protein LOC100306225               251   4e-79   
ref|XP_011013261.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    251   5e-79   
gb|AES67378.2|  DUF640 family protein                                   250   5e-79   
ref|XP_003597127.1|  177 protein                                        251   6e-79   
ref|XP_003540402.1|  PREDICTED: uncharacterized protein LOC100802...    250   9e-79   
ref|XP_011015901.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    249   1e-78   
gb|ACJ85482.1|  unknown                                                 248   3e-78   Medicago truncatula
ref|XP_009133547.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    248   4e-78   
ref|XP_010525031.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    248   4e-78   
ref|XP_002317458.1|  hypothetical protein POPTR_0011s11120g             248   8e-78   Populus trichocarpa [western balsam poplar]
ref|XP_010279129.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    246   2e-77   
ref|XP_009339946.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    246   3e-77   
ref|XP_007149738.1|  hypothetical protein PHAVU_005G095100g             245   4e-77   
ref|XP_006442502.1|  hypothetical protein CICLE_v10022456mg             246   4e-77   
emb|CDY14848.1|  BnaC04g48450D                                          246   5e-77   
emb|CDY55387.1|  BnaA05g34250D                                          246   5e-77   
ref|XP_004487154.1|  PREDICTED: uncharacterized protein LOC101499419    244   9e-77   
ref|XP_010506094.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    245   1e-76   
ref|XP_010508549.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    245   1e-76   
ref|XP_006296565.1|  hypothetical protein CARUB_v100241591mg            244   1e-76   
emb|CDP15936.1|  unnamed protein product                                244   1e-76   
ref|XP_008368001.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    245   1e-76   
ref|XP_008448236.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    245   1e-76   
ref|XP_007021735.1|  Uncharacterized protein TCM_031777                 244   2e-76   
ref|XP_004303183.1|  PREDICTED: uncharacterized protein LOC101307414    245   2e-76   
ref|XP_009142076.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    244   2e-76   
ref|XP_006411528.1|  hypothetical protein EUTSA_v10017308mg             244   2e-76   
ref|XP_009142855.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    244   2e-76   
ref|XP_002879996.1|  hypothetical protein ARALYDRAFT_903634             243   4e-76   
ref|XP_010524062.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    243   4e-76   
ref|XP_009334040.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    243   4e-76   
ref|NP_565978.1|  uncharacterized protein                               243   6e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007132855.1|  hypothetical protein PHAVU_011G130300g             242   1e-75   
ref|XP_010277024.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    242   1e-75   
ref|XP_007212123.1|  hypothetical protein PRUPE_ppa012057mg             241   2e-75   
gb|AFK41138.1|  unknown                                                 241   3e-75   
ref|XP_008226537.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    241   3e-75   
ref|XP_002522583.1|  conserved hypothetical protein                     240   5e-75   Ricinus communis
ref|XP_003526225.1|  PREDICTED: uncharacterized protein LOC100815968    239   1e-74   
gb|EPS69070.1|  hypothetical protein M569_05697                         237   2e-74   
ref|XP_010655519.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    239   2e-74   
emb|CAN72178.1|  hypothetical protein VITISV_012478                     239   2e-74   Vitis vinifera
ref|XP_010052190.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    239   2e-74   
ref|XP_004516078.1|  PREDICTED: uncharacterized protein LOC101514778    239   2e-74   
ref|XP_003607586.1|  177 protein                                        238   3e-74   
ref|XP_010327093.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    238   7e-74   
ref|XP_009773140.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    238   1e-73   
ref|XP_006442831.1|  hypothetical protein CICLE_v10023710mg             242   1e-73   
emb|CDO96796.1|  unnamed protein product                                237   1e-73   
gb|KDO64048.1|  hypothetical protein CISIN_1g0003541mg                  248   2e-73   
ref|XP_007025375.1|  Beta-lactamase-like protein ENSP00000383859        236   2e-73   
ref|XP_006362411.1|  PREDICTED: uncharacterized protein LOC102591189    237   2e-73   
ref|XP_010553628.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    236   2e-73   
ref|XP_003596364.1|  177 protein                                        236   3e-73   
ref|XP_004233074.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    236   3e-73   
ref|XP_002285447.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    237   4e-73   Vitis vinifera
ref|XP_009608555.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    235   6e-73   
ref|XP_010109876.1|  hypothetical protein L484_003806                   236   6e-73   
gb|KDP21096.1|  hypothetical protein JCGZ_21567                         235   6e-73   
ref|XP_004151474.1|  PREDICTED: uncharacterized protein LOC101210225    235   8e-73   
ref|XP_004150559.1|  PREDICTED: uncharacterized protein LOC101216601    236   8e-73   
gb|KGN47252.1|  hypothetical protein Csa_6G236080                       236   8e-73   
ref|XP_004171262.1|  PREDICTED: uncharacterized LOC101216601            236   9e-73   
ref|XP_010062813.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    234   1e-72   
gb|KHG25854.1|  Major vault                                             234   1e-72   
gb|KGN65636.1|  hypothetical protein Csa_1G474480                       234   1e-72   
ref|XP_010108230.1|  hypothetical protein L484_018651                   234   1e-72   
ref|XP_004489028.1|  PREDICTED: uncharacterized protein LOC101497242    234   2e-72   
ref|XP_004485894.1|  PREDICTED: uncharacterized protein LOC101502781    234   2e-72   
gb|AFK47598.1|  unknown                                                 234   2e-72   
ref|XP_002530382.1|  conserved hypothetical protein                     234   3e-72   Ricinus communis
emb|CAN63025.1|  hypothetical protein VITISV_034817                     233   3e-72   Vitis vinifera
ref|XP_008465553.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    233   4e-72   
ref|XP_011008476.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    233   5e-72   
gb|AFK34719.1|  unknown                                                 233   5e-72   
ref|XP_002305745.1|  hypothetical protein POPTR_0004s05610g             233   5e-72   Populus trichocarpa [western balsam poplar]
ref|XP_003542999.1|  PREDICTED: uncharacterized protein LOC100778886    233   7e-72   
ref|XP_007148048.1|  hypothetical protein PHAVU_006G176100g             232   1e-71   
ref|XP_002317421.1|  hypothetical protein POPTR_0011s07350g             232   1e-71   Populus trichocarpa [western balsam poplar]
gb|AFK49191.1|  unknown                                                 232   1e-71   
gb|KDP34762.1|  hypothetical protein JCGZ_10542                         232   1e-71   
ref|XP_004505495.1|  PREDICTED: uncharacterized protein LOC101509969    231   1e-71   
ref|XP_011011486.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    231   1e-71   
ref|XP_007212120.1|  hypothetical protein PRUPE_ppa012018mg             232   1e-71   
gb|EYU30777.1|  hypothetical protein MIMGU_mgv1a014751mg                231   2e-71   
gb|KCW67509.1|  hypothetical protein EUGRSUZ_F01238                     231   3e-71   
ref|XP_011101384.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    231   3e-71   
ref|XP_007149389.1|  hypothetical protein PHAVU_005G066200g             231   3e-71   
ref|NP_001237249.1|  uncharacterized protein LOC100306082               231   3e-71   
ref|XP_008225289.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    231   4e-71   
ref|XP_004136831.1|  PREDICTED: uncharacterized protein LOC101208687    231   4e-71   
ref|NP_001237763.1|  uncharacterized protein LOC100527554               231   5e-71   
ref|XP_006592933.1|  PREDICTED: uncharacterized protein LOC100806...    230   5e-71   
ref|XP_008455303.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    230   6e-71   
ref|XP_004294145.1|  PREDICTED: uncharacterized protein LOC101307097    230   6e-71   
ref|XP_008371461.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    230   6e-71   
ref|XP_011085992.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    229   7e-71   
ref|XP_004174117.1|  PREDICTED: uncharacterized protein LOC101228453    230   7e-71   
ref|XP_008358651.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    229   1e-70   
ref|XP_006467647.1|  PREDICTED: uncharacterized protein LOC102611919    229   2e-70   
ref|XP_011082761.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    229   2e-70   
ref|XP_006478612.1|  PREDICTED: probable disease resistance prote...    249   2e-70   
ref|XP_006449503.1|  hypothetical protein CICLE_v10016772mg             229   3e-70   
ref|XP_007133232.1|  hypothetical protein PHAVU_011G162700g             228   4e-70   
gb|KHG29970.1|  Putative beta-lactamase-like 1                          227   6e-70   
gb|KHN36883.1|  hypothetical protein glysoja_001614                     228   9e-70   
ref|XP_004248241.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    227   3e-69   
ref|XP_006360044.1|  PREDICTED: uncharacterized protein LOC102584680    226   5e-69   
gb|AFK41155.1|  unknown                                                 224   9e-69   
ref|XP_009622401.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    225   9e-69   
ref|XP_004146094.1|  PREDICTED: uncharacterized protein LOC101204141    225   9e-69   
gb|KGN55073.1|  hypothetical protein Csa_4G627230                       225   1e-68   
ref|XP_004171006.1|  PREDICTED: uncharacterized LOC101204141            225   1e-68   
ref|XP_006358940.1|  PREDICTED: uncharacterized protein LOC102602985    224   2e-68   
ref|XP_010314085.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    223   2e-68   
emb|CDP06011.1|  unnamed protein product                                223   5e-68   
ref|XP_008463732.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    223   5e-68   
ref|XP_010531928.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    222   8e-68   
ref|XP_004293946.1|  PREDICTED: uncharacterized protein LOC101295...    221   2e-67   
ref|XP_009770169.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    220   1e-66   
ref|XP_003539992.1|  PREDICTED: uncharacterized protein LOC100806134    217   5e-66   
gb|EYU41125.1|  hypothetical protein MIMGU_mgv1a021620mg                216   1e-65   
ref|XP_009784769.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    217   1e-65   
gb|EYU45022.1|  hypothetical protein MIMGU_mgv1a014215mg                215   5e-65   
gb|KHN45745.1|  hypothetical protein glysoja_043995                     214   1e-64   
ref|XP_009383380.1|  PREDICTED: protein G1-like7                        215   1e-64   
gb|EYU43335.1|  hypothetical protein MIMGU_mgv1a022623mg                213   3e-64   
ref|XP_009411199.1|  PREDICTED: protein G1-like7                        212   2e-63   
ref|XP_011098405.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    210   3e-63   
ref|XP_009587002.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   1e-62   
ref|XP_006303356.1|  hypothetical protein CARUB_v10010340mg             209   1e-62   
ref|XP_010324393.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   1e-62   
emb|CDX85083.1|  BnaC07g08230D                                          209   2e-62   
ref|XP_009102637.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   2e-62   
ref|XP_010540518.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    208   2e-62   
gb|EPS59921.1|  hypothetical protein M569_14884                         206   3e-62   
ref|XP_008802142.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    207   3e-62   
gb|KFK42237.1|  hypothetical protein AALP_AA2G229400                    208   4e-62   
ref|XP_009385358.1|  PREDICTED: protein G1-like7                        208   5e-62   
emb|CDY69731.1|  BnaCnng65050D                                          207   6e-62   
ref|XP_009774704.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   6e-62   
ref|XP_006348309.1|  PREDICTED: uncharacterized protein LOC102581082    207   7e-62   
ref|XP_010549405.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   8e-62   
ref|XP_002313971.1|  hypothetical protein POPTR_0009s07990g             208   9e-62   Populus trichocarpa [western balsam poplar]
ref|XP_010457872.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   1e-61   
ref|XP_010475462.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   1e-61   
ref|XP_010487116.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   1e-61   
ref|XP_002892379.1|  hypothetical protein ARALYDRAFT_887918             207   1e-61   
ref|XP_011003514.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   2e-61   
gb|EYU28084.1|  hypothetical protein MIMGU_mgv1a022457mg                205   2e-61   
ref|NP_563780.1|  protein LIGHT SENSITIVE HYPOCOTYLS 6                  206   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009419635.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    206   4e-61   
ref|XP_004244278.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    204   4e-61   
emb|CDP09236.1|  unnamed protein product                                206   4e-61   
ref|XP_006389954.1|  hypothetical protein EUTSA_v10019792mg             205   4e-61   
ref|XP_006847407.1|  hypothetical protein AMTR_s00153p00047660          205   4e-61   
ref|NP_565190.1|  protein LIGHT SENSITIVE HYPOCOTYLS 7                  205   5e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003531259.1|  PREDICTED: uncharacterized protein LOC100810655    204   6e-61   
ref|XP_010906808.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    205   6e-61   
ref|XP_009106595.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    204   6e-61   
gb|AAM64330.1|  unknown                                                 204   7e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889213.1|  At1g78815                                          204   7e-61   
emb|CDX88480.1|  BnaC06g39240D                                          204   8e-61   
gb|ABF83646.1|  At1g78815                                               204   8e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KFK43023.1|  hypothetical protein AALP_AA1G068900                    204   8e-61   
gb|AES98763.2|  DUF640 family protein                                   205   9e-61   
ref|XP_010429720.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    204   9e-61   
ref|XP_010417489.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    204   1e-60   
ref|XP_006302860.1|  hypothetical protein CARUB_v10020990mg             204   1e-60   
ref|XP_002298496.1|  hypothetical protein POPTR_0001s28780g             205   1e-60   Populus trichocarpa [western balsam poplar]
ref|XP_007159450.1|  hypothetical protein PHAVU_002G238600g             203   1e-60   
ref|XP_006417846.1|  hypothetical protein EUTSA_v10009726mg             204   1e-60   
emb|CDY52287.1|  BnaA03g57800D                                          204   2e-60   
ref|XP_006414079.1|  hypothetical protein EUTSA_v10027091mg             203   2e-60   
ref|XP_003615805.1|  hypothetical protein MTR_5g072510                  205   2e-60   
ref|XP_009398867.1|  PREDICTED: protein G1-like4                        204   2e-60   
ref|XP_010439831.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    203   2e-60   
ref|XP_002973743.1|  hypothetical protein SELMODRAFT_36560              202   3e-60   
ref|XP_009118463.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    203   3e-60   
gb|EPS68444.1|  hypothetical protein M569_06326                         202   3e-60   
gb|KFK28531.1|  hypothetical protein AALP_AA7G008800                    203   3e-60   
ref|XP_006286146.1|  hypothetical protein CARUB_v10007704mg             202   3e-60   
ref|NP_193596.1|  uncharacterized protein                               202   3e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CDY67351.1|  BnaCnng54640D                                          202   4e-60   
ref|XP_009108375.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   4e-60   
ref|XP_010434509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   4e-60   
ref|XP_010449492.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   4e-60   
ref|XP_009108056.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   5e-60   
emb|CDX76510.1|  BnaA08g08900D                                          202   5e-60   
ref|XP_008649559.1|  PREDICTED: protein G1-like7                        206   7e-60   
emb|CDY59064.1|  BnaAnng15760D                                          202   9e-60   
ref|NP_001143976.1|  uncharacterized protein LOC100276793               205   9e-60   Zea mays [maize]
ref|XP_008355077.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   1e-59   
emb|CDY14588.1|  BnaC02g25250D                                          201   1e-59   
emb|CDY34056.1|  BnaC03g62760D                                          201   1e-59   
emb|CDX78877.1|  BnaA01g09440D                                          201   1e-59   
emb|CDY26881.1|  BnaA02g19060D                                          201   1e-59   
ref|XP_010043398.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   2e-59   
ref|XP_010685918.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    203   2e-59   
ref|XP_002267312.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   2e-59   Vitis vinifera
dbj|BAI52974.1|  G1-like protein                                        202   2e-59   Selaginella moellendorffii
ref|XP_002870033.1|  hypothetical protein ARALYDRAFT_914818             201   2e-59   
ref|XP_003537309.1|  PREDICTED: uncharacterized protein LOC100775798    202   3e-59   
ref|XP_008804907.1|  PREDICTED: protein G1-like7                        202   3e-59   
gb|KHG10505.1|  Error-prone DNA polymerase                              202   3e-59   
ref|XP_009385214.1|  PREDICTED: protein G1-like7                        201   3e-59   
ref|XP_004504735.1|  PREDICTED: uncharacterized protein LOC101506113    202   3e-59   
ref|XP_010043397.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   4e-59   
ref|XP_007016962.1|  Zinc finger protein ZFPM1                          201   6e-59   
ref|XP_011024904.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   7e-59   
ref|XP_010043396.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   8e-59   
ref|XP_009136943.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   8e-59   
gb|EYU45980.1|  hypothetical protein MIMGU_mgv1a021801mg                199   9e-59   
ref|XP_009128313.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   2e-58   
ref|XP_010922606.1|  PREDICTED: protein G1-like7                        199   2e-58   
ref|XP_010689830.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   2e-58   
emb|CBI21986.3|  unnamed protein product                                197   2e-58   
ref|XP_008811689.1|  PREDICTED: protein G1-like7                        199   2e-58   
ref|XP_010906823.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   3e-58   
ref|XP_002862737.1|  hypothetical protein ARALYDRAFT_920315             197   3e-58   
ref|XP_010518804.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   5e-58   
ref|XP_010538562.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   5e-58   
emb|CDY64755.1|  BnaCnng44770D                                          197   7e-58   
gb|EPS74620.1|  hypothetical protein M569_00139                         196   7e-58   
emb|CDY01557.1|  BnaC07g35470D                                          197   8e-58   
emb|CDY10712.1|  BnaA05g12240D                                          196   8e-58   
gb|EPS68159.1|  hypothetical protein M569_06614                         195   9e-58   
ref|XP_003531069.1|  PREDICTED: uncharacterized protein LOC100798406    198   1e-57   
gb|KEH41129.1|  G1-like protein                                         197   1e-57   
ref|XP_003524092.1|  PREDICTED: uncharacterized protein LOC100775838    197   1e-57   
ref|XP_002879250.1|  hypothetical protein ARALYDRAFT_901988             196   1e-57   
ref|XP_007159026.1|  hypothetical protein PHAVU_002G202200g             197   1e-57   
ref|XP_008657105.1|  PREDICTED: protein G1-like7                        196   1e-57   
ref|XP_010542671.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   2e-57   
ref|XP_010529198.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   2e-57   
ref|XP_009615590.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   2e-57   
gb|KEH31304.1|  G1-like protein                                         197   2e-57   
ref|XP_006401075.1|  hypothetical protein EUTSA_v10014789mg             194   4e-57   
ref|XP_009412626.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   5e-57   
ref|XP_006443825.1|  hypothetical protein CICLE_v10022295mg             195   5e-57   
ref|NP_200658.1|  protein LIGHT SENSITIVE HYPOCOTYLS 5                  193   9e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002961823.1|  hypothetical protein SELMODRAFT_68566              193   9e-57   
emb|CDY02038.1|  BnaC04g14630D                                          193   9e-57   
ref|XP_002866271.1|  hypothetical protein ARALYDRAFT_919048             193   1e-56   
ref|XP_008465528.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   1e-56   
ref|XP_009132033.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   1e-56   
ref|XP_009144329.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   2e-56   
ref|XP_003629770.1|  177 protein                                        193   2e-56   
ref|XP_004134659.1|  PREDICTED: uncharacterized protein LOC101214534    194   2e-56   
emb|CDY06675.1|  BnaA10g04540D                                          193   2e-56   
emb|CDY10247.1|  BnaC05g04900D                                          193   2e-56   
ref|XP_006410079.1|  hypothetical protein EUTSA_v10017270mg             193   2e-56   
ref|XP_011043717.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   2e-56   
ref|XP_004504297.1|  PREDICTED: uncharacterized protein LOC101498424    192   3e-56   
ref|XP_007010574.1|  Uncharacterized protein TCM_044482                 206   3e-56   
ref|XP_002313621.2|  hypothetical protein POPTR_0009s15930g             192   3e-56   
ref|XP_009354180.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   4e-56   
ref|NP_173135.1|  uncharacterized protein                               191   4e-56   
ref|XP_009391700.1|  PREDICTED: protein G1-like7                        194   5e-56   
ref|XP_006353047.1|  PREDICTED: uncharacterized protein LOC102583639    191   6e-56   
ref|XP_010521971.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   9e-56   
ref|XP_009605797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   1e-55   
ref|XP_006281173.1|  hypothetical protein CARUB_v10027208mg             190   2e-55   
ref|XP_009611433.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    191   2e-55   
ref|XP_003638136.1|  hypothetical protein MTR_119s0026                  197   2e-55   
ref|XP_004233194.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   2e-55   
ref|XP_010453783.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   3e-55   
ref|XP_010443587.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   3e-55   
ref|XP_004239743.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   3e-55   
ref|XP_009763597.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   4e-55   
ref|XP_010483448.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   4e-55   
ref|XP_006282119.1|  hypothetical protein CARUB_v10028368mg             189   5e-55   
ref|XP_009417987.1|  PREDICTED: protein G1-like7                        191   5e-55   
ref|XP_009118997.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   5e-55   
ref|XP_009419675.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    190   7e-55   
gb|EMT15017.1|  hypothetical protein F775_09728                         189   8e-55   
emb|CDY32977.1|  BnaA10g11830D                                          188   9e-55   
gb|KFK27377.1|  hypothetical protein AALP_AA8G375000                    188   9e-55   
ref|XP_009124995.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    189   1e-54   
ref|XP_006398272.1|  hypothetical protein EUTSA_v10001044mg             188   1e-54   
ref|XP_009770526.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   1e-54   
ref|XP_009128817.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    188   1e-54   
emb|CDY06030.1|  BnaA09g37500D                                          188   1e-54   
emb|CDY21126.1|  BnaA01g33570D                                          188   1e-54   
emb|CDO99243.1|  unnamed protein product                                187   1e-54   
ref|XP_006845978.1|  hypothetical protein AMTR_s00155p00022580          189   2e-54   
ref|XP_006354481.1|  PREDICTED: uncharacterized protein LOC102586971    188   2e-54   
emb|CDY32697.1|  BnaA02g07590D                                          187   2e-54   
ref|XP_009126748.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   2e-54   
emb|CDY59510.1|  BnaCnng35040D                                          187   2e-54   
ref|XP_006857299.1|  hypothetical protein AMTR_s00067p00052610          188   3e-54   
ref|XP_009398447.1|  PREDICTED: protein G1-like4                        187   5e-54   
ref|XP_006345889.1|  PREDICTED: uncharacterized protein LOC102588665    187   6e-54   
gb|EMS63732.1|  hypothetical protein TRIUR3_33566                       188   6e-54   
ref|XP_009772674.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   6e-54   
ref|XP_003581429.1|  PREDICTED: protein G1-like4                        187   6e-54   
ref|XP_011091303.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    187   6e-54   
ref|XP_009120359.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   7e-54   
emb|CDY30000.1|  BnaC01g40080D                                          186   8e-54   
ref|XP_009603577.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   9e-54   
ref|XP_008667635.1|  PREDICTED: uncharacterized protein LOC100275...    186   1e-53   
dbj|BAJ89549.1|  predicted protein                                      186   1e-53   
gb|EPS66277.1|  hypothetical protein M569_08502                         183   1e-53   
emb|CDX87760.1|  BnaC02g31890D                                          185   2e-53   
ref|XP_003544306.1|  PREDICTED: uncharacterized protein LOC100780494    186   2e-53   
ref|XP_003552937.1|  PREDICTED: AT-rich interactive domain-contai...    187   2e-53   
emb|CDY61050.1|  BnaCnng37250D                                          185   2e-53   
ref|XP_002446786.1|  hypothetical protein SORBIDRAFT_06g022610          185   2e-53   
ref|XP_002454193.1|  hypothetical protein SORBIDRAFT_04g026450          186   2e-53   
ref|NP_001142538.1|  uncharacterized protein LOC100274783               185   3e-53   
ref|NP_001145392.1|  putative protein of unknown function (DUF640...    185   3e-53   
ref|XP_008676897.1|  PREDICTED: uncharacterized protein LOC100274...    185   3e-53   
ref|NP_001053313.1|  Os04g0516200                                       185   3e-53   
ref|XP_009613005.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   3e-53   
ref|XP_006350860.1|  PREDICTED: uncharacterized protein LOC102596443    185   5e-53   
ref|XP_004236785.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   5e-53   
ref|XP_006361418.1|  PREDICTED: uncharacterized protein LOC102587546    184   5e-53   
ref|XP_009762992.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    186   5e-53   
ref|XP_010264562.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   6e-53   
ref|XP_004953146.1|  PREDICTED: uncharacterized protein LOC101777...    184   6e-53   
ref|XP_004242504.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    185   6e-53   
ref|XP_003571880.1|  PREDICTED: protein G1-like5                        184   6e-53   
ref|XP_002863446.1|  hypothetical protein ARALYDRAFT_916864             183   7e-53   
ref|XP_006377748.1|  hypothetical protein POPTR_0011s11120g             182   7e-53   
ref|XP_007146820.1|  hypothetical protein PHAVU_006G072500g             185   7e-53   
ref|XP_009400810.1|  PREDICTED: protein G1-like4                        184   9e-53   
ref|XP_010497623.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   1e-52   
ref|XP_009797641.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   1e-52   
dbj|BAD22522.1|  hypothetical protein                                   185   1e-52   
gb|EAZ31342.1|  hypothetical protein OsJ_15463                          184   1e-52   
ref|XP_004976223.1|  PREDICTED: uncharacterized protein LOC101784...    183   1e-52   
ref|NP_001047471.1|  Os02g0623400                                       184   1e-52   
ref|NP_001046002.1|  Os02g0166800                                       183   1e-52   
ref|XP_003575389.1|  PREDICTED: protein G1-like3                        183   1e-52   
ref|XP_004247736.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   1e-52   
ref|XP_006652517.1|  PREDICTED: uncharacterized protein LOC102706933    183   1e-52   
ref|XP_009399464.1|  PREDICTED: protein G1-like4                        183   2e-52   
gb|EPS67535.1|  hypothetical protein M569_07240                         181   2e-52   
emb|CDY35523.1|  BnaA01g23890D                                          182   2e-52   
ref|XP_008674867.1|  PREDICTED: protein G1-like7                        183   2e-52   
ref|XP_009629990.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    184   2e-52   
ref|XP_009384186.1|  PREDICTED: protein G1-like1                        184   2e-52   
gb|KDP34854.1|  hypothetical protein JCGZ_09142                         183   2e-52   
ref|XP_010532649.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   3e-52   
sp|Q941W1.1|G1L7_ORYSJ  RecName: Full=Protein G1-like7                  183   3e-52   
sp|A2XED8.1|G1L7_ORYSI  RecName: Full=Protein G1-like7                  183   3e-52   
ref|XP_006468373.1|  PREDICTED: uncharacterized protein LOC102627798    184   3e-52   
ref|XP_004970435.1|  PREDICTED: uncharacterized protein LOC101754104    182   3e-52   
gb|KFK39618.1|  hypothetical protein AALP_AA3G267200                    182   3e-52   
gb|EMT15276.1|  hypothetical protein F775_21904                         182   3e-52   
ref|XP_007142170.1|  hypothetical protein PHAVU_008G258200g             182   4e-52   
ref|NP_001159319.1|  uncharacterized protein LOC100304411               182   4e-52   
ref|XP_010527402.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   4e-52   
ref|XP_008807164.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    183   4e-52   
ref|XP_002306857.2|  hypothetical protein POPTR_0005s24730g             182   4e-52   
ref|XP_003560443.1|  PREDICTED: protein G1-like1                        184   4e-52   
ref|XP_006406049.1|  hypothetical protein EUTSA_v10021563mg             182   5e-52   
ref|XP_011004043.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   5e-52   
ref|XP_002317078.1|  hypothetical protein POPTR_0011s16010g             183   5e-52   
ref|XP_009410038.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   6e-52   
ref|XP_010052568.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    181   6e-52   
ref|XP_008438509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    181   6e-52   
ref|XP_003590857.1|  hypothetical protein MTR_1g075990                  181   7e-52   
gb|AFK48050.1|  unknown                                                 181   8e-52   
ref|XP_010488385.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    181   8e-52   
ref|XP_010510232.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   8e-52   
gb|EPS74320.1|  hypothetical protein M569_00435                         180   8e-52   
ref|XP_010907173.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   9e-52   
ref|XP_010923781.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   9e-52   
ref|XP_009399257.1|  PREDICTED: protein G1-like1                        182   9e-52   
ref|XP_010522152.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   9e-52   
ref|XP_010469755.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   9e-52   
ref|XP_010414174.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   9e-52   
ref|NP_001078202.2|  protein LIGHT SENSITIVE HYPOCOTYLS 4               181   1e-51   
ref|XP_008810562.1|  PREDICTED: protein G1-like4                        181   1e-51   
ref|XP_009403861.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   1e-51   
emb|CDX86199.1|  BnaA06g29160D                                          181   1e-51   
ref|XP_009401942.1|  PREDICTED: protein G1-like4                        181   1e-51   
ref|XP_001760807.1|  predicted protein                                  179   1e-51   
ref|XP_007143862.1|  hypothetical protein PHAVU_007G108200g             181   1e-51   
ref|XP_010488383.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    181   1e-51   
ref|XP_007143863.1|  hypothetical protein PHAVU_007G108200g             181   1e-51   
ref|XP_010466654.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    181   1e-51   
ref|XP_002883419.1|  hypothetical protein ARALYDRAFT_898842             181   1e-51   
ref|XP_008439509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    180   1e-51   
ref|XP_011080720.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    181   1e-51   
ref|XP_011040543.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   1e-51   
emb|CDY10790.1|  BnaA05g11460D                                          181   1e-51   
ref|XP_010926891.1|  PREDICTED: protein G1-like1                        182   1e-51   
ref|XP_010512305.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    180   2e-51   
emb|CDM84812.1|  unnamed protein product                                181   2e-51   
ref|XP_006410244.1|  hypothetical protein EUTSA_v10017162mg             181   2e-51   
ref|XP_002458704.1|  hypothetical protein SORBIDRAFT_03g038670          181   2e-51   
ref|XP_002533787.1|  conserved hypothetical protein                     182   2e-51   
ref|XP_002271024.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    181   2e-51   
ref|XP_006295008.1|  hypothetical protein CARUB_v10024080mg             181   2e-51   
ref|NP_001176209.1|  Os10g0478000                                       181   2e-51   
ref|XP_007022986.1|  Uncharacterized protein TCM_026988                 181   2e-51   
gb|ABK21716.1|  unknown                                                 181   2e-51   
emb|CDY24755.1|  BnaC04g13600D                                          181   2e-51   
ref|XP_006298606.1|  hypothetical protein CARUB_v10014690mg             180   2e-51   
ref|XP_002862787.1|  hypothetical protein ARALYDRAFT_497295             181   2e-51   
ref|XP_009144232.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    180   2e-51   
emb|CDY57087.1|  BnaA04g28750D                                          181   2e-51   
emb|CDY57024.1|  BnaA09g03420D                                          180   2e-51   
ref|XP_006293520.1|  hypothetical protein CARUB_v10024036mg             181   2e-51   
ref|XP_010905797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    180   2e-51   
gb|KEH23934.1|  G1-like protein                                         181   3e-51   
emb|CDY15426.1|  BnaC04g41970D                                          181   3e-51   
ref|XP_010934319.1|  PREDICTED: protein G1-like4                        179   3e-51   
ref|XP_002278283.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    181   3e-51   
emb|CAN60458.1|  hypothetical protein VITISV_019556                     181   3e-51   
ref|XP_002464485.1|  hypothetical protein SORBIDRAFT_01g019290          180   3e-51   
ref|XP_010246796.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    179   3e-51   
ref|NP_565716.1|  uncharacterized protein                               180   3e-51   
ref|XP_009369632.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    180   3e-51   
ref|XP_004497868.1|  PREDICTED: uncharacterized protein LOC101506...    180   4e-51   
ref|XP_009129837.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    179   4e-51   
ref|XP_009144231.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    180   4e-51   
ref|XP_008804103.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    182   4e-51   
ref|XP_008808528.1|  PREDICTED: protein G1-like1                        181   4e-51   
ref|XP_004296375.1|  PREDICTED: uncharacterized protein LOC101303109    179   5e-51   
ref|XP_010069122.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    179   5e-51   
ref|XP_002879309.1|  hypothetical protein ARALYDRAFT_344884             181   5e-51   
ref|XP_006352738.1|  PREDICTED: uncharacterized protein LOC102585062    179   5e-51   
ref|XP_010935915.1|  PREDICTED: protein G1-like4                        179   5e-51   
emb|CDY52479.1|  BnaC07g49400D                                          179   5e-51   
ref|XP_009141136.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    181   5e-51   
ref|NP_001131560.1|  putative protein of unknown function (DUF640...    179   6e-51   
ref|XP_003567242.1|  PREDICTED: protein G1-like7                        179   6e-51   
ref|XP_003536217.1|  PREDICTED: uncharacterized protein LOC100789...    179   6e-51   
ref|XP_006589267.1|  PREDICTED: uncharacterized protein LOC100789...    179   6e-51   
ref|XP_002449332.1|  hypothetical protein SORBIDRAFT_05g008160          193   7e-51   
ref|XP_006410245.1|  hypothetical protein EUTSA_v10017162mg             180   7e-51   
ref|XP_010098512.1|  hypothetical protein L484_025951                   180   8e-51   
ref|NP_001048473.1|  Os02g0811000                                       180   8e-51   
emb|CAN67056.1|  hypothetical protein VITISV_036348                     178   8e-51   
ref|XP_011005316.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    180   8e-51   
ref|XP_010671018.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    179   8e-51   
ref|XP_008789168.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    181   8e-51   
ref|XP_004242364.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    179   8e-51   
ref|XP_010652376.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    178   9e-51   
gb|EEE55616.1|  hypothetical protein OsJ_03942                          178   9e-51   
gb|ABR18275.1|  unknown                                                 179   1e-50   
gb|KGN49491.1|  hypothetical protein Csa_6G526250                       178   1e-50   
ref|XP_009120360.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    178   1e-50   
ref|XP_004490633.1|  PREDICTED: uncharacterized protein LOC101513114    179   1e-50   
ref|XP_010023924.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    178   1e-50   
ref|XP_010650097.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    178   1e-50   
ref|XP_009402225.1|  PREDICTED: protein G1-like7                        179   1e-50   
ref|XP_006648081.1|  PREDICTED: uncharacterized protein LOC102709535    179   1e-50   
ref|XP_004493783.1|  PREDICTED: uncharacterized protein LOC101490141    178   1e-50   
ref|XP_006395017.1|  hypothetical protein EUTSA_v10004974mg             178   1e-50   
ref|XP_004962398.1|  PREDICTED: skin secretory protein xP2-like         181   1e-50   
ref|XP_009780996.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    177   1e-50   
ref|XP_009384790.1|  PREDICTED: protein G1-like7                        179   1e-50   
ref|XP_010469892.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    178   1e-50   
gb|ACN41049.1|  unknown                                                 179   1e-50   
ref|XP_001765087.1|  predicted protein                                  176   2e-50   
ref|XP_004134890.1|  PREDICTED: uncharacterized protein LOC101208925    177   2e-50   
ref|XP_010510405.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    178   2e-50   
ref|XP_010089535.1|  hypothetical protein L484_011699                   179   2e-50   
gb|KFK31223.1|  hypothetical protein AALP_AA6G084400                    179   2e-50   
ref|XP_010557196.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    178   2e-50   
ref|XP_010104757.1|  hypothetical protein L484_021447                   178   2e-50   
ref|XP_007144887.1|  hypothetical protein PHAVU_007G192200g             178   2e-50   
ref|XP_008661390.1|  PREDICTED: putative protein of unknown funct...    177   2e-50   
gb|KDP45779.1|  hypothetical protein JCGZ_17386                         179   2e-50   
emb|CDY52505.1|  BnaAnng11520D                                          177   2e-50   
ref|XP_006606387.1|  PREDICTED: uncharacterized protein LOC100806...    177   2e-50   



>ref|XP_006348870.1| PREDICTED: uncharacterized protein LOC102600485 [Solanum tuberosum]
Length=173

 Score =   270 bits (689),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/141 (92%), Positives = 135/141 (96%), Gaps = 4/141 (3%)
 Frame = +1

Query  70   SFDRGKDLAEGS---PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVL  240
            +FDRGK+L EGS   PGD  PATPSRYESQKRRDWNTFGQYLRNQRPPV++SQCNSNHVL
Sbjct  3    NFDRGKELVEGSSRSPGD-QPATPSRYESQKRRDWNTFGQYLRNQRPPVSMSQCNSNHVL  61

Query  241  EFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSP  420
            EFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSP
Sbjct  62   EFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP  121

Query  421  ETNPFASGAIRVYLREVKECQ  483
            ETNPFASGAIRVYLREVKECQ
Sbjct  122  ETNPFASGAIRVYLREVKECQ  142



>ref|XP_004243287.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=167

 Score =   268 bits (686),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 133/138 (96%), Gaps = 4/138 (3%)
 Frame = +1

Query  70   SFDRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFL  249
            +FDRGK+L EGS    SPATPSRYESQKRRDWNTFGQYLRNQRPPV++SQCNSNHVLEFL
Sbjct  3    NFDRGKELVEGS----SPATPSRYESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVLEFL  58

Query  250  RYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETN  429
            RYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPETN
Sbjct  59   RYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETN  118

Query  430  PFASGAIRVYLREVKECQ  483
            PFASGAIRVYLREVKECQ
Sbjct  119  PFASGAIRVYLREVKECQ  136



>ref|XP_009786006.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=177

 Score =   266 bits (681),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 134/141 (95%), Gaps = 4/141 (3%)
 Frame = +1

Query  70   SFDRGKDLAEGS---PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVL  240
            +FDRGK+L EGS   PGD  PAT SRYESQKRRDWNTFGQYLRNQRPPV++SQCNSNHVL
Sbjct  3    NFDRGKELVEGSSRSPGD-QPATLSRYESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVL  61

Query  241  EFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSP  420
            EFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSP
Sbjct  62   EFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP  121

Query  421  ETNPFASGAIRVYLREVKECQ  483
            ETNPFASGAIRVYLREVKECQ
Sbjct  122  ETNPFASGAIRVYLREVKECQ  142



>ref|XP_009626514.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=176

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 130/141 (92%), Gaps = 3/141 (2%)
 Frame = +1

Query  70   SFDRGKDLAEGS---PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVL  240
            S DRGKDLAEGS   PGD S  TPSRYESQKRRDWNTF QYLRNQR P+ LSQCNSNHVL
Sbjct  3    SSDRGKDLAEGSSRSPGDQSITTPSRYESQKRRDWNTFNQYLRNQRQPIPLSQCNSNHVL  62

Query  241  EFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSP  420
            EFLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSP
Sbjct  63   EFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP  122

Query  421  ETNPFASGAIRVYLREVKECQ  483
            ETNPFAS AIRVYLREVKECQ
Sbjct  123  ETNPFASTAIRVYLREVKECQ  143



>ref|XP_009593391.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
 ref|XP_009593396.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=177

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 134/141 (95%), Gaps = 4/141 (3%)
 Frame = +1

Query  70   SFDRGKDLAEGS---PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVL  240
            +FDRGK+L +GS   PGD  PAT SRYESQKRRDWNTFGQYLRNQRPPV++SQCNSNHVL
Sbjct  3    NFDRGKELVQGSSRSPGD-QPATLSRYESQKRRDWNTFGQYLRNQRPPVSISQCNSNHVL  61

Query  241  EFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSP  420
            EFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSP
Sbjct  62   EFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP  121

Query  421  ETNPFASGAIRVYLREVKECQ  483
            ETNPFASGAIRVYLREVKECQ
Sbjct  122  ETNPFASGAIRVYLREVKECQ  142



>ref|XP_002280666.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Vitis 
vinifera]
Length=167

 Score =   262 bits (670),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 132/142 (93%), Gaps = 3/142 (2%)
 Frame = +1

Query  67   MSFDRGKDLAEGS---PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHV  237
            MS +RGKDLAEGS   PGD    TPSRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHV
Sbjct  1    MSSERGKDLAEGSSRSPGDQQSVTPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHV  60

Query  238  LEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGS  417
            L+FLRYLDQFGKTKVHLQGC+F+GQPEPPAPCTCPL+QAWGSLDAL+GRLRAAYEENGGS
Sbjct  61   LDFLRYLDQFGKTKVHLQGCMFFGQPEPPAPCTCPLRQAWGSLDALVGRLRAAYEENGGS  120

Query  418  PETNPFASGAIRVYLREVKECQ  483
            PETNPFASGAIR+YLREV+ECQ
Sbjct  121  PETNPFASGAIRIYLREVRECQ  142



>emb|CAN66524.1| hypothetical protein VITISV_034969 [Vitis vinifera]
Length=158

 Score =   261 bits (668),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 132/142 (93%), Gaps = 3/142 (2%)
 Frame = +1

Query  67   MSFDRGKDLAEGS---PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHV  237
            MS +RGKDLAEGS   PGD    TPSRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHV
Sbjct  1    MSSERGKDLAEGSSRSPGDQQSVTPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHV  60

Query  238  LEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGS  417
            L+FLRYLDQFGKTKVHLQGC+F+GQPEPPAPCTCPL+QAWGSLDAL+GRLRAAYEENGGS
Sbjct  61   LDFLRYLDQFGKTKVHLQGCMFFGQPEPPAPCTCPLRQAWGSLDALVGRLRAAYEENGGS  120

Query  418  PETNPFASGAIRVYLREVKECQ  483
            PETNPFASGAIR+YLREV+ECQ
Sbjct  121  PETNPFASGAIRIYLREVRECQ  142



>ref|XP_007215057.1| hypothetical protein PRUPE_ppa012217mg [Prunus persica]
 ref|XP_008229093.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Prunus 
mume]
 gb|EMJ16256.1| hypothetical protein PRUPE_ppa012217mg [Prunus persica]
Length=179

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 133/146 (91%), Gaps = 7/146 (5%)
 Frame = +1

Query  67   MSFDRGKDLAEGS-----PGDT--SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MS +RGKD A+GS     PGD    PATPSRYESQKRRDWNTFGQYL+NQRPPV LSQCN
Sbjct  1    MSAERGKDFADGSSSAGSPGDDHQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCN  60

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
             NHVLEFLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEE
Sbjct  61   YNHVLEFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEE  120

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGGSPETNPFASGAIRVYLREV+ECQ
Sbjct  121  NGGSPETNPFASGAIRVYLREVRECQ  146



>ref|XP_007048693.1| Pleckstrin domain-containing family N member 1 [Theobroma cacao]
 gb|EOX92850.1| Pleckstrin domain-containing family N member 1 [Theobroma cacao]
Length=212

 Score =   263 bits (672),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 5/144 (3%)
 Frame = +1

Query  67   MSFDRGKDLAEGS---PGD--TSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSN  231
            MS +RGKD+AEGS   PGD    PATPSRYESQKRRDWNTFGQYL+NQRPPV LSQCN N
Sbjct  38   MSSERGKDVAEGSSRIPGDHQQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCN  97

Query  232  HVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENG  411
            HVL+FLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENG
Sbjct  98   HVLDFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENG  157

Query  412  GSPETNPFASGAIRVYLREVKECQ  483
            GSPETNPFASGAIRVYLREV+ECQ
Sbjct  158  GSPETNPFASGAIRVYLREVRECQ  181



>gb|KDP35079.1| hypothetical protein JCGZ_11031 [Jatropha curcas]
Length=169

 Score =   260 bits (665),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 1/139 (1%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEF  246
            MS DRGKDLAEGS  + + ATPSRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHVL+F
Sbjct  1    MSGDRGKDLAEGS-NEQAAATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDF  59

Query  247  LRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPET  426
            LRYLDQFGKTKVH+QGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPET
Sbjct  60   LRYLDQFGKTKVHVQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPET  119

Query  427  NPFASGAIRVYLREVKECQ  483
            NPFASGAIRVYLREV++CQ
Sbjct  120  NPFASGAIRVYLREVRDCQ  138



>ref|XP_008342774.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009354254.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
 ref|XP_009348397.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=185

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 131/146 (90%), Gaps = 7/146 (5%)
 Frame = +1

Query  67   MSFDRGKDLAEGS-----PGDTS--PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MS +RGKD  EGS     P D    PATPSRYESQKRRDWNTFGQYL+NQRPPVALSQCN
Sbjct  5    MSRERGKDFVEGSSAGGSPNDDQQQPATPSRYESQKRRDWNTFGQYLKNQRPPVALSQCN  64

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
             NHVLEFLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEE
Sbjct  65   YNHVLEFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEE  124

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGGSPE NPFASGAIRVYLREV+ECQ
Sbjct  125  NGGSPENNPFASGAIRVYLREVRECQ  150



>ref|XP_006446791.1| hypothetical protein CICLE_v10016699mg [Citrus clementina]
 gb|ESR60031.1| hypothetical protein CICLE_v10016699mg [Citrus clementina]
Length=209

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 131/143 (92%), Gaps = 4/143 (3%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGD----TSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNH  234
            MS DRGK++AEGS         PATPSRYESQKRRDWNTFGQYL+NQRPPV LSQC+ NH
Sbjct  36   MSSDRGKEIAEGSSDHHHQLQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCSCNH  95

Query  235  VLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGG  414
            VL+FLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG
Sbjct  96   VLDFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGG  155

Query  415  SPETNPFASGAIRVYLREVKECQ  483
            SPETNPFASGAIRVYLREV+ECQ
Sbjct  156  SPETNPFASGAIRVYLREVRECQ  178



>ref|XP_006469013.1| PREDICTED: uncharacterized protein LOC102606613 [Citrus sinensis]
 gb|KDO63369.1| hypothetical protein CISIN_1g047785mg [Citrus sinensis]
Length=174

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 131/143 (92%), Gaps = 4/143 (3%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGD----TSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNH  234
            MS DRGK++AEGS         PATPSRYESQKRRDWNTFGQYL+NQRPPV LSQC+ NH
Sbjct  1    MSSDRGKEIAEGSSDHHHQLQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCSCNH  60

Query  235  VLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGG  414
            VL+FLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG
Sbjct  61   VLDFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGG  120

Query  415  SPETNPFASGAIRVYLREVKECQ  483
            SPETNPFASGAIRVYLREV+ECQ
Sbjct  121  SPETNPFASGAIRVYLREVRECQ  143



>ref|XP_009790882.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=176

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 128/141 (91%), Gaps = 3/141 (2%)
 Frame = +1

Query  70   SFDRGKDLAEGS---PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVL  240
            S DRGKDLAEGS   PGD S  TPSRYESQKRRDWNTF Q+LRNQR P+ LSQCN NHVL
Sbjct  3    SSDRGKDLAEGSSRSPGDQSITTPSRYESQKRRDWNTFNQFLRNQRQPIPLSQCNDNHVL  62

Query  241  EFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSP  420
            EFL YLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSP
Sbjct  63   EFLGYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP  122

Query  421  ETNPFASGAIRVYLREVKECQ  483
            ETNPFAS AIRVYLREVKECQ
Sbjct  123  ETNPFASTAIRVYLREVKECQ  143



>ref|XP_009790219.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=176

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 128/141 (91%), Gaps = 3/141 (2%)
 Frame = +1

Query  70   SFDRGKDLAEGS---PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVL  240
            S DRGKDLAEGS   PGD S  TPSRYESQKRRDWNTF Q+LRNQR P+ LSQCN NHVL
Sbjct  3    SSDRGKDLAEGSSRSPGDQSITTPSRYESQKRRDWNTFNQFLRNQRQPIPLSQCNGNHVL  62

Query  241  EFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSP  420
            EFL YLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSP
Sbjct  63   EFLGYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP  122

Query  421  ETNPFASGAIRVYLREVKECQ  483
            ETNPFAS AIRVYLREVKECQ
Sbjct  123  ETNPFASTAIRVYLREVKECQ  143



>ref|XP_010104392.1| hypothetical protein L484_010344 [Morus notabilis]
 gb|EXC00237.1| hypothetical protein L484_010344 [Morus notabilis]
Length=173

 Score =   258 bits (660),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 130/140 (93%), Gaps = 1/140 (1%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDT-SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLE  243
            MS DRGK  AEGS  D  +PATPSRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHVL+
Sbjct  1    MSIDRGKGFAEGSGSDQPTPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLD  60

Query  244  FLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPE  423
            FLRYLDQFGKTKVH+QGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG PE
Sbjct  61   FLRYLDQFGKTKVHVQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGFPE  120

Query  424  TNPFASGAIRVYLREVKECQ  483
            TNPFASGAIRVYLREV+ECQ
Sbjct  121  TNPFASGAIRVYLREVRECQ  140



>ref|XP_010052695.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Eucalyptus 
grandis]
 gb|KCW89641.1| hypothetical protein EUGRSUZ_A01916 [Eucalyptus grandis]
Length=176

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 128/143 (90%), Gaps = 4/143 (3%)
 Frame = +1

Query  67   MSFDRGKDLAE----GSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNH  234
            MS +RGK+ AE     SP D  P  PSRYESQKRRDWNTFG YLRNQRPPV LSQCN NH
Sbjct  1    MSSERGKETAELGSSRSPSDQQPVAPSRYESQKRRDWNTFGHYLRNQRPPVPLSQCNCNH  60

Query  235  VLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGG  414
            VLEFLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG
Sbjct  61   VLEFLRYLDQFGKTKVHLQGCVFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGG  120

Query  415  SPETNPFASGAIRVYLREVKECQ  483
            SPETNPFASGAIRVYLREV+ECQ
Sbjct  121  SPETNPFASGAIRVYLREVRECQ  143



>gb|KHG07235.1| Putative beta-lactamase-like 1 [Gossypium arboreum]
Length=175

 Score =   258 bits (660),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 133/144 (92%), Gaps = 5/144 (3%)
 Frame = +1

Query  67   MSFDRGKDLAEG----SPGDTS-PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSN  231
            MS +RGKD+AEG    +PGD   P TPSRYESQKRRDWNTFGQYL+NQRPPV LSQCN N
Sbjct  1    MSSERGKDIAEGPSRVNPGDQQLPPTPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCN  60

Query  232  HVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENG  411
            HVL+FLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENG
Sbjct  61   HVLDFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENG  120

Query  412  GSPETNPFASGAIRVYLREVKECQ  483
            GSPETNPFASGAIRVYLREV+ECQ
Sbjct  121  GSPETNPFASGAIRVYLREVRECQ  144



>ref|XP_008381217.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
Length=181

 Score =   258 bits (660),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 130/146 (89%), Gaps = 7/146 (5%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTS-------PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MS +RGKD AEGS    S       PATPSRYESQKRRDWNTFGQYL+NQRPPVALSQ N
Sbjct  1    MSRERGKDFAEGSSAGGSLNDDQQQPATPSRYESQKRRDWNTFGQYLKNQRPPVALSQSN  60

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
             NHVLEFLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEE
Sbjct  61   YNHVLEFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEE  120

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGGSPE NPFASGAIRVYLREV+ECQ
Sbjct  121  NGGSPENNPFASGAIRVYLREVRECQ  146



>ref|XP_002320411.1| hypothetical protein POPTR_0014s13900g [Populus trichocarpa]
 gb|ABK93899.1| unknown [Populus trichocarpa]
 gb|EEE98726.1| hypothetical protein POPTR_0014s13900g [Populus trichocarpa]
Length=170

 Score =   258 bits (659),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEF  246
            MS +RGKD+AEGS  +  PATPSRYESQKRRDWNTFGQYL+NQRPPV LSQCNSNHVL+F
Sbjct  1    MSRERGKDIAEGSSENQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDF  60

Query  247  LRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPET  426
            LRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG+PET
Sbjct  61   LRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPET  120

Query  427  NPFASGAIRVYLREVKECQ  483
            NPFA+ +IRVYLREV++ Q
Sbjct  121  NPFANASIRVYLREVRDYQ  139



>ref|XP_009343797.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=181

 Score =   258 bits (660),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 130/146 (89%), Gaps = 7/146 (5%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTS-------PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MS +RGKD AEGS    S       PATPSRYESQKRRDWNTFGQYL+NQRPPVALSQ N
Sbjct  1    MSGERGKDFAEGSSAGGSLNDDQQQPATPSRYESQKRRDWNTFGQYLKNQRPPVALSQSN  60

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
             NHVLEFLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEE
Sbjct  61   YNHVLEFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEE  120

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGGSPE NPFASGAIRVYLREV+ECQ
Sbjct  121  NGGSPENNPFASGAIRVYLREVRECQ  146



>ref|XP_011083008.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Sesamum 
indicum]
Length=172

 Score =   258 bits (659),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 130/141 (92%), Gaps = 4/141 (3%)
 Frame = +1

Query  73   FDRGKDLAEGSPGDTSPAT----PSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVL  240
             +RGKDLAEGSP    PA     PSRYESQKRRDWNTFGQ+L+NQRPPVAL QCNSNHVL
Sbjct  1    MERGKDLAEGSPSGGDPAAAAAAPSRYESQKRRDWNTFGQFLKNQRPPVALPQCNSNHVL  60

Query  241  EFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSP  420
            +FLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSP
Sbjct  61   DFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSP  120

Query  421  ETNPFASGAIRVYLREVKECQ  483
            ETNPFASGAIR+YLREVKECQ
Sbjct  121  ETNPFASGAIRIYLREVKECQ  141



>ref|XP_011033736.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
 ref|XP_011033737.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
 ref|XP_011033738.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Populus 
euphratica]
Length=170

 Score =   257 bits (657),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEF  246
            MS +RGKD+AEGS  +  PATPSRYESQKRRDWNTFGQYL+NQRPPV LSQCNSNHVL+F
Sbjct  1    MSRERGKDVAEGSSENQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDF  60

Query  247  LRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPET  426
            LRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG+PET
Sbjct  61   LRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPET  120

Query  427  NPFASGAIRVYLREVKECQ  483
            NPFA+ +IRVYLREV++ Q
Sbjct  121  NPFANASIRVYLREVRDYQ  139



>ref|XP_010035859.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Eucalyptus 
grandis]
 gb|KCW47341.1| hypothetical protein EUGRSUZ_K01128 [Eucalyptus grandis]
Length=174

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 129/142 (91%), Gaps = 3/142 (2%)
 Frame = +1

Query  67   MSFDRGKDLAEGS---PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHV  237
            MS +RGKD  EGS   PG  SPATPSRYESQKRRDWN F QYL+NQRPPV LSQCN  HV
Sbjct  1    MSSERGKDPVEGSSRSPGSDSPATPSRYESQKRRDWNAFIQYLKNQRPPVPLSQCNYTHV  60

Query  238  LEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGS  417
            LEFLRYLDQFGKTKVH+QGCIFYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG+
Sbjct  61   LEFLRYLDQFGKTKVHIQGCIFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGT  120

Query  418  PETNPFASGAIRVYLREVKECQ  483
            PETNPFASGAIRVYLREV++CQ
Sbjct  121  PETNPFASGAIRVYLREVRDCQ  142



>ref|XP_002521586.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40857.1| conserved hypothetical protein [Ricinus communis]
Length=174

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 131/142 (92%), Gaps = 3/142 (2%)
 Frame = +1

Query  67   MSFDRGKDLAEGSP---GDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHV  237
            MS +RGKDLAEGS        PATPSRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHV
Sbjct  1    MSGERGKDLAEGSSELHQQHQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHV  60

Query  238  LEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGS  417
            L+FLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGS
Sbjct  61   LDFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGS  120

Query  418  PETNPFASGAIRVYLREVKECQ  483
            PETNPFASGAIRV+LREV++CQ
Sbjct  121  PETNPFASGAIRVFLREVRDCQ  142



>ref|XP_002301561.2| hypothetical protein POPTR_0002s22690g [Populus trichocarpa]
 gb|ABK94357.1| unknown [Populus trichocarpa]
 gb|EEE80834.2| hypothetical protein POPTR_0002s22690g [Populus trichocarpa]
Length=170

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEF  246
            MS +RGKD+AEGS  +  PATPSRYESQKRRDWNTFGQYL+NQRPPV LSQCNSNHVL+F
Sbjct  1    MSRERGKDIAEGSIENQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDF  60

Query  247  LRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPET  426
            LRYLDQFGKTKVHLQ C+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG+ ET
Sbjct  61   LRYLDQFGKTKVHLQSCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTLET  120

Query  427  NPFASGAIRVYLREVKECQ  483
            NPFA+ +IRVYLREVK+ Q
Sbjct  121  NPFANASIRVYLREVKDYQ  139



>ref|XP_011008166.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008167.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008168.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
 ref|XP_011008170.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=170

 Score =   253 bits (645),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEF  246
            MS +RGKD+AEGS  +  PATPSRYESQKRRDWNTFGQYL+NQRPPV LSQCNSNHVL+F
Sbjct  1    MSRERGKDIAEGSIENQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSNHVLDF  60

Query  247  LRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPET  426
            LRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAW SLDALIGRLRAAYEENGG+ ET
Sbjct  61   LRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWCSLDALIGRLRAAYEENGGTLET  120

Query  427  NPFASGAIRVYLREVKECQ  483
            NPFA+ +IRVYLREVK+ Q
Sbjct  121  NPFANASIRVYLREVKDYQ  139



>gb|KHN36698.1| hypothetical protein glysoja_001429 [Glycine soja]
Length=175

 Score =   253 bits (646),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 5/144 (3%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDT-----SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSN  231
            MS   GKDL EGS   T     SP T SRYESQKRRDWNTFGQYL+NQRPPV LSQCN N
Sbjct  1    MSSSSGKDLGEGSSSPTENYQQSPGTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCN  60

Query  232  HVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENG  411
            HVL+FLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENG
Sbjct  61   HVLDFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENG  120

Query  412  GSPETNPFASGAIRVYLREVKECQ  483
            GSPETNPFASG+IRVYL+E++ECQ
Sbjct  121  GSPETNPFASGSIRVYLKEIRECQ  144



>ref|XP_011098044.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like, 
partial [Sesamum indicum]
Length=157

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 126/140 (90%), Gaps = 3/140 (2%)
 Frame = +1

Query  73   FDRGKDLAEGSPGDTSPA---TPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLE  243
             DRGKDLAEGS     PA   TPSRYESQKRRDWNTFGQ+LRNQRPPVALSQC+S HVLE
Sbjct  1    MDRGKDLAEGSSCGGDPAAATTPSRYESQKRRDWNTFGQFLRNQRPPVALSQCSSGHVLE  60

Query  244  FLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPE  423
            FLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG  E
Sbjct  61   FLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGPQE  120

Query  424  TNPFASGAIRVYLREVKECQ  483
            TNPFAS AIR+YLREVKE Q
Sbjct  121  TNPFASSAIRIYLREVKESQ  140



>ref|XP_006370148.1| hypothetical protein POPTR_0001s40140g [Populus trichocarpa]
 gb|ERP66717.1| hypothetical protein POPTR_0001s40140g [Populus trichocarpa]
Length=176

 Score =   251 bits (640),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 129/146 (88%), Gaps = 7/146 (5%)
 Frame = +1

Query  67   MSFDRGKDLAEGS-------PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MS ++GKD+AEGS       P   +P   SRYESQKRRDWNTFGQYLRNQRPPVALSQCN
Sbjct  1    MSSNKGKDVAEGSSRAVAMAPDQQNPPPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  60

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
            +NHVLEFLRYLDQFGKTKVHLQGC+F+GQPEPP PCTCPLKQAWGSLDALIGRLRAAYEE
Sbjct  61   ANHVLEFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEE  120

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGG PETNPFASGAIRVYLREV++ Q
Sbjct  121  NGGLPETNPFASGAIRVYLREVRDSQ  146



>ref|NP_001235660.1| uncharacterized protein LOC100306225 [Glycine max]
 gb|ACU14309.1| unknown [Glycine max]
Length=175

 Score =   251 bits (640),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 127/144 (88%), Gaps = 5/144 (3%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDT-----SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSN  231
            MS   GKDL EGS   T     SP T SRYESQKRRDWNTFGQYL+NQRPPV LSQCN N
Sbjct  1    MSSSSGKDLGEGSSSPTEDYQQSPGTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCN  60

Query  232  HVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENG  411
            HVL+FLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDAL GRLRAAYEENG
Sbjct  61   HVLDFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALTGRLRAAYEENG  120

Query  412  GSPETNPFASGAIRVYLREVKECQ  483
            GSPETNPFASG+IRVYL+E++ECQ
Sbjct  121  GSPETNPFASGSIRVYLKEIRECQ  144



>ref|XP_011013261.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Populus 
euphratica]
Length=176

 Score =   251 bits (640),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 129/146 (88%), Gaps = 7/146 (5%)
 Frame = +1

Query  67   MSFDRGKDLAEGS-------PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MS ++GKD+AEGS       P   +P   SRYESQKRRDWNTFGQYLRNQRPPVALSQCN
Sbjct  1    MSSNKGKDVAEGSSRAVALAPDQQNPPPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  60

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
            +NHVLEFLRYLDQFGKTKVHLQGC+F+GQPEPP PCTCPLKQAWGSLDALIGRLRAAYEE
Sbjct  61   ANHVLEFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEE  120

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGG PETNPFASGAIRVYLREV++ Q
Sbjct  121  NGGLPETNPFASGAIRVYLREVRDSQ  146



>gb|AES67378.2| DUF640 family protein [Medicago truncatula]
Length=167

 Score =   250 bits (639),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +1

Query  82   GKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLD  261
            GKDLAEG    +   T SRYESQKRRDWNTFGQYL N RPPV LS CNSNHVLEFLRYLD
Sbjct  5    GKDLAEGGSSTSQGITLSRYESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLD  64

Query  262  QFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFAS  441
            QFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG+PETNPFAS
Sbjct  65   QFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFAS  124

Query  442  GAIRVYLREVKECQ  483
            GAIRVYLREV+ECQ
Sbjct  125  GAIRVYLREVRECQ  138



>ref|XP_003597127.1| 177 protein [Medicago truncatula]
Length=186

 Score =   251 bits (640),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +1

Query  82   GKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLD  261
            GKDLAEG    +   T SRYESQKRRDWNTFGQYL N RPPV LS CNSNHVLEFLRYLD
Sbjct  5    GKDLAEGGSSTSQGITLSRYESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLD  64

Query  262  QFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFAS  441
            QFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG+PETNPFAS
Sbjct  65   QFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGTPETNPFAS  124

Query  442  GAIRVYLREVKECQ  483
            GAIRVYLREV+ECQ
Sbjct  125  GAIRVYLREVRECQ  138



>ref|XP_003540402.1| PREDICTED: uncharacterized protein LOC100802937 isoform X1 [Glycine 
max]
 ref|XP_006592869.1| PREDICTED: uncharacterized protein LOC100802937 isoform X2 [Glycine 
max]
 gb|KHN27942.1| hypothetical protein glysoja_007674 [Glycine soja]
Length=175

 Score =   250 bits (638),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 126/144 (88%), Gaps = 5/144 (3%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDT-----SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSN  231
            MS    KD  EGS   T     SP T SRYESQKRRDWNTFGQYL+NQRPPV LSQCN N
Sbjct  1    MSSSSSKDFGEGSSSPTDNYQQSPGTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCN  60

Query  232  HVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENG  411
            HVL+FLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENG
Sbjct  61   HVLDFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENG  120

Query  412  GSPETNPFASGAIRVYLREVKECQ  483
            GSPETNPFASG+IRVYL+EV+ECQ
Sbjct  121  GSPETNPFASGSIRVYLKEVRECQ  144



>ref|XP_011015901.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Populus 
euphratica]
Length=176

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 129/146 (88%), Gaps = 7/146 (5%)
 Frame = +1

Query  67   MSFDRGKDLAEGS-------PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MS ++GKD+AEGS       P   +P   SRYESQKRRDWNTFGQYLRNQRPPVALSQCN
Sbjct  1    MSSNKGKDVAEGSSRAVALAPDQQNPPPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  60

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
            +NHVLEFLRYLDQFGKTKVH+QGC+F+GQPEPP PCTCPLKQAWGSLDALIGRLRAAYEE
Sbjct  61   ANHVLEFLRYLDQFGKTKVHVQGCVFFGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEE  120

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGG PETNPFASGAIRVYLREV++ Q
Sbjct  121  NGGLPETNPFASGAIRVYLREVRDSQ  146



>gb|ACJ85482.1| unknown [Medicago truncatula]
 gb|AFK37885.1| unknown [Medicago truncatula]
Length=167

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +1

Query  82   GKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLD  261
            GKDLAEG    +   T SRYESQKRRDWNTFGQYL N RPPV LS CNSNHVLEFLRYLD
Sbjct  5    GKDLAEGGSSTSQGITLSRYESQKRRDWNTFGQYLNNLRPPVPLSHCNSNHVLEFLRYLD  64

Query  262  QFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFAS  441
            QFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG+PETNPFAS
Sbjct  65   QFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGAPETNPFAS  124

Query  442  GAIRVYLREVKECQ  483
            GAIRVYLREV+EC+
Sbjct  125  GAIRVYLREVRECR  138



>ref|XP_009133547.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Brassica 
rapa]
Length=177

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/136 (86%), Positives = 124/136 (91%), Gaps = 1/136 (1%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRY  255
            DRGK L E S G   P TPSRYESQKRRDWNTFGQYL+NQRPPV +S CN NHVL+FLRY
Sbjct  6    DRGKSLMESS-GSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCNCNHVLDFLRY  64

Query  256  LDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  435
            LDQFGKTKVH+ GC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPETNPF
Sbjct  65   LDQFGKTKVHVPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPF  124

Query  436  ASGAIRVYLREVKECQ  483
            ASGAIRVYLREV+ECQ
Sbjct  125  ASGAIRVYLREVRECQ  140



>ref|XP_010525031.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
 ref|XP_010525039.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=178

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 127/139 (91%), Gaps = 1/139 (1%)
 Frame = +1

Query  70   SFDRGKDLAEG-SPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEF  246
            S +RGK L EG   G+  PATPSRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHVL+F
Sbjct  4    SGERGKSLMEGPGSGEQQPATPSRYESQKRRDWNTFGQYLKNQRPPVHLSQCNCNHVLDF  63

Query  247  LRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPET  426
            LRYLDQFGKTKVH+ GC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPE 
Sbjct  64   LRYLDQFGKTKVHVPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEM  123

Query  427  NPFASGAIRVYLREVKECQ  483
            NPFA+GAIRVYLREV+ECQ
Sbjct  124  NPFATGAIRVYLREVRECQ  142



>ref|XP_002317458.1| hypothetical protein POPTR_0011s11120g [Populus trichocarpa]
 gb|EEE98070.1| hypothetical protein POPTR_0011s11120g [Populus trichocarpa]
Length=176

 Score =   248 bits (632),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 128/146 (88%), Gaps = 7/146 (5%)
 Frame = +1

Query  67   MSFDRGKDLAEGS-------PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MS ++GKD+AEGS       P   SP   SRYESQKRRDWNTFGQYLRNQRPPVALSQCN
Sbjct  1    MSSNKGKDIAEGSSRGGANAPDQQSPPPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  60

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
            +N VL+FLRYLDQFGKTKVHLQGC+F+GQPEPP PCTCPLKQAWGSLDALIGRLRAAYEE
Sbjct  61   ANQVLDFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEE  120

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGG PETNPFASGAIRVYLREV++ Q
Sbjct  121  NGGLPETNPFASGAIRVYLREVRDSQ  146



>ref|XP_010279129.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nelumbo 
nucifera]
Length=176

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 128/143 (90%), Gaps = 4/143 (3%)
 Frame = +1

Query  67   MSFDRGKDLAEGS---PGDTSPATP-SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNH  234
            MS  R KD AEGS    G+   + P SRYESQKRRDWNTFGQYL+NQRPPV+LSQC+ +H
Sbjct  1    MSTGRAKDSAEGSSRSAGEQQQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCSCSH  60

Query  235  VLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGG  414
            VLEFLRYLDQFGKTKVHLQGCIF+GQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG
Sbjct  61   VLEFLRYLDQFGKTKVHLQGCIFFGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGG  120

Query  415  SPETNPFASGAIRVYLREVKECQ  483
            SPETNPF SGAIRVYLREV+ECQ
Sbjct  121  SPETNPFGSGAIRVYLREVRECQ  143



>ref|XP_009339946.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Pyrus 
x bretschneideri]
Length=183

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 129/150 (86%), Gaps = 11/150 (7%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTS-----------PATPSRYESQKRRDWNTFGQYLRNQRPPVAL  213
            MS ++GKD+AEGS   ++           PA  SRYESQKRRDWNTFGQYLRNQRPPVAL
Sbjct  1    MSTNKGKDIAEGSSSASATDHRQQKQASQPAQLSRYESQKRRDWNTFGQYLRNQRPPVAL  60

Query  214  SQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRA  393
            SQ NSNHVL+FLRYLDQFGKTKVHLQGC+F+GQPEPP PCTCPL+QAWGSLDALIGRLRA
Sbjct  61   SQSNSNHVLDFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPLRQAWGSLDALIGRLRA  120

Query  394  AYEENGGSPETNPFASGAIRVYLREVKECQ  483
            AYEENGG PETNPFA+GAIRVYLREV++ Q
Sbjct  121  AYEENGGLPETNPFATGAIRVYLREVRDSQ  150



>ref|XP_007149738.1| hypothetical protein PHAVU_005G095100g [Phaseolus vulgaris]
 gb|AGV54192.1| hypothetical protein [Phaseolus vulgaris]
 gb|ESW21732.1| hypothetical protein PHAVU_005G095100g [Phaseolus vulgaris]
Length=165

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 125/139 (90%), Gaps = 2/139 (1%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEF  246
            MS   GKDL EGS   T   T SRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHVL+F
Sbjct  1    MSSSSGKDLGEGSSSPT--GTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDF  58

Query  247  LRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPET  426
            LRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPET
Sbjct  59   LRYLDQFGKTKVHLQGCVFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPET  118

Query  427  NPFASGAIRVYLREVKECQ  483
            NPFA+ +IR+YL+E++ECQ
Sbjct  119  NPFATSSIRLYLKEIRECQ  137



>ref|XP_006442502.1| hypothetical protein CICLE_v10022456mg [Citrus clementina]
 ref|XP_006477739.1| PREDICTED: uncharacterized protein LOC102620640 [Citrus sinensis]
 gb|ESR55742.1| hypothetical protein CICLE_v10022456mg [Citrus clementina]
 gb|KDO47016.1| hypothetical protein CISIN_1g029917mg [Citrus sinensis]
Length=185

 Score =   246 bits (628),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 130/154 (84%), Gaps = 15/154 (10%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTS---------------PATPSRYESQKRRDWNTFGQYLRNQRP  201
            MS ++GK++AEGS   +S               PA  SRYESQKRRDWNTFGQYLRNQRP
Sbjct  1    MSSNKGKEVAEGSSSRSSTIATAAVAAASDQQSPAPLSRYESQKRRDWNTFGQYLRNQRP  60

Query  202  PVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIG  381
            PVALSQCNSNHVL+FLRYLDQFGKTKVHLQGC+F+GQPEPP PC+CPLKQAWGSLDALIG
Sbjct  61   PVALSQCNSNHVLDFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCSCPLKQAWGSLDALIG  120

Query  382  RLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            RLRAAYEENGG PETNPFASGAIR+YLREV++ Q
Sbjct  121  RLRAAYEENGGLPETNPFASGAIRIYLREVRDSQ  154



>emb|CDY14848.1| BnaC04g48450D [Brassica napus]
Length=177

 Score =   246 bits (627),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 125/136 (92%), Gaps = 1/136 (1%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRY  255
            DRGK+  E S G  +P TPSRYESQKRRDWNTFGQYL+NQRPPV +S C+ NHVL+FLRY
Sbjct  6    DRGKNFMESS-GSETPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRY  64

Query  256  LDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  435
            LDQFGKTKVH+ GC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPETNPF
Sbjct  65   LDQFGKTKVHVFGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPF  124

Query  436  ASGAIRVYLREVKECQ  483
            A+GAIRVYLREV+ECQ
Sbjct  125  ATGAIRVYLREVRECQ  140



>emb|CDY55387.1| BnaA05g34250D [Brassica napus]
Length=178

 Score =   246 bits (627),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 123/136 (90%), Gaps = 1/136 (1%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRY  255
            DRGK   E S G   P TPSRYESQKRRDWNTFGQYLRNQRPP+ +S CN NHVL+FLRY
Sbjct  6    DRGKSSMESS-GSEPPVTPSRYESQKRRDWNTFGQYLRNQRPPLPMSHCNCNHVLDFLRY  64

Query  256  LDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  435
            LDQFGKTKVH+ GC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPETNPF
Sbjct  65   LDQFGKTKVHVPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPF  124

Query  436  ASGAIRVYLREVKECQ  483
            ASGAIRVYLREV+ECQ
Sbjct  125  ASGAIRVYLREVRECQ  140



>ref|XP_004487154.1| PREDICTED: uncharacterized protein LOC101499419 [Cicer arietinum]
Length=166

 Score =   244 bits (624),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 122/134 (91%), Gaps = 2/134 (1%)
 Frame = +1

Query  82   GKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLD  261
            GK++ EG  G TSP T SRYESQKRRDWNTFGQYL NQRPP+ LS CN NHVLEFLRYLD
Sbjct  5    GKEIVEG--GSTSPITLSRYESQKRRDWNTFGQYLNNQRPPIPLSHCNCNHVLEFLRYLD  62

Query  262  QFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFAS  441
            QFGKTKVHLQGC+F+GQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGS ETNPFAS
Sbjct  63   QFGKTKVHLQGCMFFGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFAS  122

Query  442  GAIRVYLREVKECQ  483
             AIRVYLREV+ECQ
Sbjct  123  SAIRVYLREVRECQ  136



>ref|XP_010506094.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Camelina 
sativa]
 ref|XP_010506095.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Camelina 
sativa]
Length=178

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 124/136 (91%), Gaps = 1/136 (1%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRY  255
            +RGK L E S G   P TPSRYESQKRRDWNTFGQYL+NQRPPV +S C+ NHVL+FLRY
Sbjct  6    ERGKSLMESS-GSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRY  64

Query  256  LDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  435
            LDQFGKTKVH+ GC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPETNPF
Sbjct  65   LDQFGKTKVHVPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPF  124

Query  436  ASGAIRVYLREVKECQ  483
            ASGAIRVYLREV+ECQ
Sbjct  125  ASGAIRVYLREVRECQ  140



>ref|XP_010508549.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010508550.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010517796.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010517797.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
Length=178

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 124/136 (91%), Gaps = 1/136 (1%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRY  255
            +RGK L E S G   P TPSRYESQKRRDWNTFGQYL+NQRPPV +S C+ NHVL+FLRY
Sbjct  6    ERGKSLMESS-GSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRY  64

Query  256  LDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  435
            LDQFGKTKVH+ GC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPETNPF
Sbjct  65   LDQFGKTKVHVPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPF  124

Query  436  ASGAIRVYLREVKECQ  483
            ASGAIRVYLREV+ECQ
Sbjct  125  ASGAIRVYLREVRECQ  140



>ref|XP_006296565.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 ref|XP_006296566.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 gb|EOA29463.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 gb|EOA29464.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
Length=178

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 124/136 (91%), Gaps = 1/136 (1%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRY  255
            +RGK L E S G   P TPSRYESQKRRDWNTFGQYL+NQRPPV +S C+ NHVL+FLRY
Sbjct  6    ERGKSLMESS-GSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRY  64

Query  256  LDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  435
            LDQFGKTKVH+ GC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPETNPF
Sbjct  65   LDQFGKTKVHVPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPF  124

Query  436  ASGAIRVYLREVKECQ  483
            ASGAIRVYLREV+ECQ
Sbjct  125  ASGAIRVYLREVRECQ  140



>emb|CDP15936.1| unnamed protein product [Coffea canephora]
Length=170

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = +1

Query  124  ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIF  303
            A PSRYESQKRRDWNTFGQYL+NQRPPV LSQCNS+HVLEFLRYLDQFGKTKVHLQGC+F
Sbjct  18   AAPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNSSHVLEFLRYLDQFGKTKVHLQGCMF  77

Query  304  YGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            YGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPE+NPFASGAIRVYLREVKECQ
Sbjct  78   YGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPESNPFASGAIRVYLREVKECQ  137



>ref|XP_008368001.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
Length=186

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 128/153 (84%), Gaps = 14/153 (9%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTS--------------PATPSRYESQKRRDWNTFGQYLRNQRPP  204
            MS ++GKD+AEGS   ++              PA  SRYESQKRRDWNTFGQYLRNQRPP
Sbjct  1    MSTNKGKDVAEGSSSASATTTDHQQQKQTSQPPAQLSRYESQKRRDWNTFGQYLRNQRPP  60

Query  205  VALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGR  384
            VALSQ NSNHVL+FLRYLDQFGKTKVH QGC+F+GQPEPP PCTCPL+QAWGSLDALIGR
Sbjct  61   VALSQSNSNHVLDFLRYLDQFGKTKVHAQGCVFFGQPEPPGPCTCPLRQAWGSLDALIGR  120

Query  385  LRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            LRAAYEENGG PETNPFASGAIRVYLREV++ Q
Sbjct  121  LRAAYEENGGLPETNPFASGAIRVYLREVRDSQ  153



>ref|XP_008448236.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=200

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 123/134 (92%), Gaps = 1/134 (1%)
 Frame = +1

Query  85   KDLAEGSPGDTSPAT-PSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLD  261
            K+  EGS      AT PSRYESQKRRDWNTFGQYL+NQRPPVALSQCN NHVLEFLRYLD
Sbjct  13   KEYGEGSSNSPPTATTPSRYESQKRRDWNTFGQYLKNQRPPVALSQCNFNHVLEFLRYLD  72

Query  262  QFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFAS  441
            QFGKTKVH+QGC+FYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFAS
Sbjct  73   QFGKTKVHVQGCMFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFAS  132

Query  442  GAIRVYLREVKECQ  483
             +IRVYLREV+ECQ
Sbjct  133  ASIRVYLREVRECQ  146



>ref|XP_007021735.1| Uncharacterized protein TCM_031777 [Theobroma cacao]
 gb|EOY13260.1| Uncharacterized protein TCM_031777 [Theobroma cacao]
Length=186

 Score =   244 bits (624),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 129/153 (84%), Gaps = 14/153 (9%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDT--------------SPATPSRYESQKRRDWNTFGQYLRNQRPP  204
            MS ++GK++AEGS   T              +P   SRYESQKRRDWNTFGQYLRNQRPP
Sbjct  2    MSINKGKEIAEGSSRSTAAAVAAAAAAADQQNPPPLSRYESQKRRDWNTFGQYLRNQRPP  61

Query  205  VALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGR  384
            VALSQCN+NHVLEFLRYLDQFGKTKVHLQGC+F+GQPEPP PCTCPL+QAWGSLDALIGR
Sbjct  62   VALSQCNANHVLEFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPLRQAWGSLDALIGR  121

Query  385  LRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            LRAAYEENGG PETNPFASGAIR+YLREV++ Q
Sbjct  122  LRAAYEENGGLPETNPFASGAIRIYLREVRDSQ  154



>ref|XP_004303183.1| PREDICTED: uncharacterized protein LOC101307414 [Fragaria vesca 
subsp. vesca]
Length=209

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 129/154 (84%), Gaps = 15/154 (10%)
 Frame = +1

Query  67   MSFDRGKDLAEGS----------PGD-----TSPATPSRYESQKRRDWNTFGQYLRNQRP  201
            MS DRGK  + G           P D       PATPSRYESQKRRDWNTFGQYLRNQRP
Sbjct  1    MSHDRGKAFSGGDGSSSGYSSPSPTDHHEQQQQPATPSRYESQKRRDWNTFGQYLRNQRP  60

Query  202  PVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIG  381
            PV LSQCN +HVLEFLRYLDQFGKTKVHLQGC+FYGQPEPPAPCTCPL+QAWGSLDALIG
Sbjct  61   PVPLSQCNYSHVLEFLRYLDQFGKTKVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIG  120

Query  382  RLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            RLRAAYEENGG+PE+NPFASGAIRVYLREV+ECQ
Sbjct  121  RLRAAYEENGGAPESNPFASGAIRVYLREVRECQ  154



>ref|XP_009142076.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Brassica 
rapa]
 emb|CDY47983.1| BnaA04g24610D [Brassica napus]
Length=176

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 124/136 (91%), Gaps = 1/136 (1%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRY  255
            DRGK+  E S G   P TPSRYESQKRRDWNTFGQYL+NQRPPV +S C+ NHVL+FLRY
Sbjct  6    DRGKNFMESS-GSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRY  64

Query  256  LDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  435
            LDQFGKTKVH+ GC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPETNPF
Sbjct  65   LDQFGKTKVHVFGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPF  124

Query  436  ASGAIRVYLREVKECQ  483
            A+GAIRVYLREV+ECQ
Sbjct  125  ATGAIRVYLREVRECQ  140



>ref|XP_006411528.1| hypothetical protein EUTSA_v10017308mg [Eutrema salsugineum]
 gb|ESQ52981.1| hypothetical protein EUTSA_v10017308mg [Eutrema salsugineum]
Length=177

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 123/136 (90%), Gaps = 1/136 (1%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRY  255
            DRGK L E S G   P TPSRYESQKRRDWNTFGQYL+NQRP V +S C+ NHVL+FLRY
Sbjct  6    DRGKSLMESS-GSEPPVTPSRYESQKRRDWNTFGQYLKNQRPSVPMSHCSCNHVLDFLRY  64

Query  256  LDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  435
            LDQFGKTKVH+ GC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPETNPF
Sbjct  65   LDQFGKTKVHVPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPF  124

Query  436  ASGAIRVYLREVKECQ  483
            ASGAIRVYLREV+ECQ
Sbjct  125  ASGAIRVYLREVRECQ  140



>ref|XP_009142855.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142857.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142858.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142859.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
 ref|XP_009142860.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Brassica 
rapa]
Length=178

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 123/136 (90%), Gaps = 1/136 (1%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRY  255
            DRGK   E S G   P TPSRYESQKRRDWNTFGQYLRNQRPP+ +S CN NHVL+FLR+
Sbjct  6    DRGKSSMESS-GSEPPVTPSRYESQKRRDWNTFGQYLRNQRPPLPMSHCNCNHVLDFLRH  64

Query  256  LDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  435
            LDQFGKTKVH+ GC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPETNPF
Sbjct  65   LDQFGKTKVHVPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPF  124

Query  436  ASGAIRVYLREVKECQ  483
            ASGAIRVYLREV+ECQ
Sbjct  125  ASGAIRVYLREVRECQ  140



>ref|XP_002879996.1| hypothetical protein ARALYDRAFT_903634 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56255.1| hypothetical protein ARALYDRAFT_903634 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 124/136 (91%), Gaps = 1/136 (1%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRY  255
            +RGK+L E S G   P TPSRYESQKRRDWNTFGQYL+NQRPPV +S C+ NHVL+FLRY
Sbjct  6    ERGKNLMESS-GSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRY  64

Query  256  LDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  435
            LDQFGKTKVH+ GC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPE NPF
Sbjct  65   LDQFGKTKVHVPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEANPF  124

Query  436  ASGAIRVYLREVKECQ  483
            ASGAIRVYLREV+ECQ
Sbjct  125  ASGAIRVYLREVRECQ  140



>ref|XP_010524062.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=176

 Score =   243 bits (620),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 123/136 (90%), Gaps = 1/136 (1%)
 Frame = +1

Query  79   RGKDLAEGS-PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRY  255
            RGK L EGS  G+    TPSRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHVL+FLRY
Sbjct  7    RGKSLMEGSGSGEQQSVTPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRY  66

Query  256  LDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  435
            LDQFGKTKVH  GC+FYGQPEPPAPC CPL+QAWGSLDALIGRLRAAYEENGGSPETNPF
Sbjct  67   LDQFGKTKVHAPGCMFYGQPEPPAPCICPLRQAWGSLDALIGRLRAAYEENGGSPETNPF  126

Query  436  ASGAIRVYLREVKECQ  483
            ASGAIRV+LREV+ECQ
Sbjct  127  ASGAIRVFLREVRECQ  142



>ref|XP_009334040.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=186

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 127/153 (83%), Gaps = 14/153 (9%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTS--------------PATPSRYESQKRRDWNTFGQYLRNQRPP  204
            MS ++GKD+AEGS   ++              P   SRYESQKRRDWNTFGQYLRNQRPP
Sbjct  1    MSTNKGKDIAEGSSSASATTTDHQQQKQTSQPPTQLSRYESQKRRDWNTFGQYLRNQRPP  60

Query  205  VALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGR  384
            VALSQ NSNHVL+FLRYLDQFGKTKVH QGC+F+GQPEPP PCTCPL+QAWGSLDALIGR
Sbjct  61   VALSQSNSNHVLDFLRYLDQFGKTKVHAQGCVFFGQPEPPGPCTCPLRQAWGSLDALIGR  120

Query  385  LRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            LRAAYEENGG PETNPFASGAIRVYLREV++ Q
Sbjct  121  LRAAYEENGGLPETNPFASGAIRVYLREVRDSQ  153



>ref|NP_565978.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_850374.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9S7R3.1|LSH10_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10; AltName: 
Full=Protein ORGAN BOUNDARY 10 [Arabidopsis thaliana]
 gb|AAF24517.1|AF218765_1 177 protein [Arabidopsis thaliana]
 gb|AAD22993.1| expressed protein [Arabidopsis thaliana]
 dbj|BAC43308.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43624.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39968.1| At2g42610 [Arabidopsis thaliana]
 gb|ABQ85148.1| unknown [Arabidopsis thaliana]
 gb|ABQ85149.1| unknown [Arabidopsis thaliana]
 gb|ABQ85150.1| unknown [Arabidopsis thaliana]
 gb|ABQ85151.1| unknown [Arabidopsis thaliana]
 gb|ABQ85152.1| unknown [Arabidopsis thaliana]
 gb|ABQ85153.1| unknown [Arabidopsis thaliana]
 gb|ABQ85154.1| unknown [Arabidopsis thaliana]
 gb|ABQ85155.1| unknown [Arabidopsis thaliana]
 gb|ABQ85156.1| unknown [Arabidopsis thaliana]
 gb|ABQ85157.1| unknown [Arabidopsis thaliana]
 gb|ABQ85158.1| unknown [Arabidopsis thaliana]
 gb|ABQ85159.1| unknown [Arabidopsis thaliana]
 gb|ABQ85160.1| unknown [Arabidopsis thaliana]
 gb|ABQ85161.1| unknown [Arabidopsis thaliana]
 gb|ABQ85162.1| unknown [Arabidopsis thaliana]
 gb|ABQ85163.1| unknown [Arabidopsis thaliana]
 gb|ABQ85164.1| unknown [Arabidopsis thaliana]
 gb|ABQ85165.1| unknown [Arabidopsis thaliana]
 gb|ABQ85166.1| unknown [Arabidopsis thaliana]
 gb|ABQ85167.1| unknown [Arabidopsis thaliana]
 gb|ABQ85168.1| unknown [Arabidopsis thaliana]
 gb|ABQ85169.1| unknown [Arabidopsis thaliana]
 gb|ABQ85170.1| unknown [Arabidopsis thaliana]
 gb|ABQ85171.1| unknown [Arabidopsis thaliana]
 gb|AEC10147.1| uncharacterized protein AT2G42610 [Arabidopsis thaliana]
 gb|AEC10148.1| uncharacterized protein AT2G42610 [Arabidopsis thaliana]
Length=177

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 123/136 (90%), Gaps = 1/136 (1%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRY  255
            +RGK L E S G   P TPSRYESQKRRDWNTFGQYL+NQRPPV +S C+ NHVL+FLRY
Sbjct  6    ERGKSLMESS-GSEPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRY  64

Query  256  LDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  435
            LDQFGKTKVH+ GC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG PETNPF
Sbjct  65   LDQFGKTKVHVPGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGPPETNPF  124

Query  436  ASGAIRVYLREVKECQ  483
            ASGAIRVYLREV+ECQ
Sbjct  125  ASGAIRVYLREVRECQ  140



>ref|XP_007132855.1| hypothetical protein PHAVU_011G130300g [Phaseolus vulgaris]
 gb|ESW04849.1| hypothetical protein PHAVU_011G130300g [Phaseolus vulgaris]
Length=183

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 118/122 (97%), Gaps = 0/122 (0%)
 Frame = +1

Query  118  SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGC  297
            SP T SRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHVL+FLRYLDQFGKTKVHLQGC
Sbjct  32   SPVTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGC  91

Query  298  IFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKE  477
            +FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPETNPFASG+IRVYLREV+E
Sbjct  92   MFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRE  151

Query  478  CQ  483
            CQ
Sbjct  152  CQ  153



>ref|XP_010277024.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Nelumbo 
nucifera]
Length=182

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 128/145 (88%), Gaps = 6/145 (4%)
 Frame = +1

Query  67   MSFDRGKDLAEGSP-----GDTSPATP-SRYESQKRRDWNTFGQYLRNQRPPVALSQCNS  228
            MS +  KD AEGS      G+   + P SRYESQKRRDWNTFGQYL+NQRPPV+LSQCN 
Sbjct  1    MSTEGAKDCAEGSSRHGGGGEQQQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNC  60

Query  229  NHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN  408
            +HVL+FLRYLDQFGKTKVHLQGC+F+GQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEEN
Sbjct  61   SHVLDFLRYLDQFGKTKVHLQGCVFFGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEEN  120

Query  409  GGSPETNPFASGAIRVYLREVKECQ  483
            GGSPETNPF SGAIRVYLREV+ECQ
Sbjct  121  GGSPETNPFGSGAIRVYLREVRECQ  145



>ref|XP_007212123.1| hypothetical protein PRUPE_ppa012057mg [Prunus persica]
 gb|EMJ13322.1| hypothetical protein PRUPE_ppa012057mg [Prunus persica]
Length=185

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 129/151 (85%), Gaps = 12/151 (8%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTS------------PATPSRYESQKRRDWNTFGQYLRNQRPPVA  210
            MS ++GKD+AEGS   ++            PA  SRYESQKRRDWNTFGQYLRNQRPPVA
Sbjct  2    MSTNKGKDVAEGSSSASAAAADQQQLKQAQPAQLSRYESQKRRDWNTFGQYLRNQRPPVA  61

Query  211  LSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLR  390
            LSQ NSNHVL+FLRYLDQFGKTKVHLQGC+F+GQPEPP PCTCPL+QAWGSLDALIGRLR
Sbjct  62   LSQSNSNHVLDFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPLRQAWGSLDALIGRLR  121

Query  391  AAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            AAYEENGG PETNPFASGAIRVYLREV++ Q
Sbjct  122  AAYEENGGLPETNPFASGAIRVYLREVRDSQ  152



>gb|AFK41138.1| unknown [Lotus japonicus]
Length=173

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 121/137 (88%), Gaps = 3/137 (2%)
 Frame = +1

Query  82   GKDLAEGSPGDTSP---ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLR  252
            GKDLA      TSP   AT SRYESQKRRDWNTFGQYL NQRPPV LSQCN NHV+EFLR
Sbjct  5    GKDLAADQGSSTSPPIGATLSRYESQKRRDWNTFGQYLNNQRPPVPLSQCNFNHVMEFLR  64

Query  253  YLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNP  432
            YLDQFGKTKVHLQGC+++G PEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPE NP
Sbjct  65   YLDQFGKTKVHLQGCVYFGMPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEANP  124

Query  433  FASGAIRVYLREVKECQ  483
            FASG IRVYLREV+ECQ
Sbjct  125  FASGFIRVYLREVRECQ  141



>ref|XP_008226537.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Prunus 
mume]
Length=186

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 129/152 (85%), Gaps = 13/152 (9%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTS-------------PATPSRYESQKRRDWNTFGQYLRNQRPPV  207
            MS ++GKD+AEGS   ++             PA  SRYESQKRRDWNTFGQYLRNQRPPV
Sbjct  2    MSTNKGKDVAEGSSSASAAAAADQQQLKQAQPAQLSRYESQKRRDWNTFGQYLRNQRPPV  61

Query  208  ALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRL  387
            ALSQ NSNHVL+FLRYLDQFGKTKVHLQGC+F+GQPEPP PCTCPL+QAWGSLDALIGRL
Sbjct  62   ALSQSNSNHVLDFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPLRQAWGSLDALIGRL  121

Query  388  RAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            RAAYEENGG PETNPFASGAIRVYLREV++ Q
Sbjct  122  RAAYEENGGLPETNPFASGAIRVYLREVRDSQ  153



>ref|XP_002522583.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39883.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 8/147 (5%)
 Frame = +1

Query  67   MSFDRGKDLAEGSP---GDTS-----PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQC  222
            MS D+ KD AEGS    GD       PA  SRYESQKRRDWNTFGQYL+NQRPPV+LSQC
Sbjct  1    MSGDKPKDSAEGSSRSGGDQQLIPHQPAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQC  60

Query  223  NSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYE  402
            N NHVL+FLRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYE
Sbjct  61   NCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYE  120

Query  403  ENGGSPETNPFASGAIRVYLREVKECQ  483
            E+GGSPETNPF +GAIRVYLREV+ECQ
Sbjct  121  EHGGSPETNPFGNGAIRVYLREVRECQ  147



>ref|XP_003526225.1| PREDICTED: uncharacterized protein LOC100815968 [Glycine max]
 gb|KHN33957.1| hypothetical protein glysoja_036764 [Glycine soja]
Length=179

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +1

Query  118  SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGC  297
            SP T SRYESQKRRDWNTFGQYL+NQRPPV LSQCN N VL+FLRYLDQFGKTKVHLQGC
Sbjct  27   SPVTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNQVLDFLRYLDQFGKTKVHLQGC  86

Query  298  IFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKE  477
            +FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPETNPFASG+IRVYLREV+E
Sbjct  87   MFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRE  146

Query  478  CQ  483
            CQ
Sbjct  147  CQ  148



>gb|EPS69070.1| hypothetical protein M569_05697, partial [Genlisea aurea]
Length=131

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = +1

Query  124  ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIF  303
            A PSRYESQKRRDWNTFGQ+LRNQRPPVALSQCN NHVL+FLRYLDQFGKT+VH QGCIF
Sbjct  1    AAPSRYESQKRRDWNTFGQFLRNQRPPVALSQCNINHVLDFLRYLDQFGKTRVHAQGCIF  60

Query  304  YGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            YGQPEPPAPC CPLKQAWGSLDALIGRLRAAYEENGGSPETNPFAS AIRV+LRE+KECQ
Sbjct  61   YGQPEPPAPCGCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASAAIRVFLREIKECQ  120



>ref|XP_010655519.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Vitis 
vinifera]
 ref|XP_010655520.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Vitis 
vinifera]
Length=175

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 126/144 (88%), Gaps = 5/144 (3%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDT-----SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSN  231
            MS DR +D AEGS   T      P   SRYESQKRRDWNTFGQYL+NQRPPV+L+QC+ N
Sbjct  1    MSNDRKRDSAEGSSRSTGEPQQQPQPLSRYESQKRRDWNTFGQYLKNQRPPVSLAQCSCN  60

Query  232  HVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENG  411
            HVLEFLRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+G
Sbjct  61   HVLEFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHG  120

Query  412  GSPETNPFASGAIRVYLREVKECQ  483
            GSPETNPF +GAIRVYLREV++CQ
Sbjct  121  GSPETNPFGNGAIRVYLREVRDCQ  144



>emb|CAN72178.1| hypothetical protein VITISV_012478 [Vitis vinifera]
Length=175

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 126/144 (88%), Gaps = 5/144 (3%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDT-----SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSN  231
            MS DR +D AEGS   T      P   SRYESQKRRDWNTFGQYL+NQRPPV+L+QC+ N
Sbjct  1    MSNDRKRDSAEGSSRSTGEPQQQPQPLSRYESQKRRDWNTFGQYLKNQRPPVSLAQCSCN  60

Query  232  HVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENG  411
            HVLEFLRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+G
Sbjct  61   HVLEFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHG  120

Query  412  GSPETNPFASGAIRVYLREVKECQ  483
            GSPETNPF +GAIRVYLREV++CQ
Sbjct  121  GSPETNPFGNGAIRVYLREVRDCQ  144



>ref|XP_010052190.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Eucalyptus 
grandis]
 gb|KCW76110.1| hypothetical protein EUGRSUZ_D00487 [Eucalyptus grandis]
Length=177

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 123/140 (88%), Gaps = 7/140 (5%)
 Frame = +1

Query  85   KDLAEGS-------PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLE  243
            +++AEGS       P   +PA  SRYESQKRRDWNTFGQYLRNQ+PPVALSQCN NHVLE
Sbjct  8    RNIAEGSSRSVIDQPALPAPAPLSRYESQKRRDWNTFGQYLRNQKPPVALSQCNCNHVLE  67

Query  244  FLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPE  423
            FLRYLDQFGKTKVHL GC+F+GQ EPPAPCTCPL+QAWGSLDALIGRLRAAYEENGG+PE
Sbjct  68   FLRYLDQFGKTKVHLHGCVFFGQREPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGAPE  127

Query  424  TNPFASGAIRVYLREVKECQ  483
             NPF +GAIRVYLREVKECQ
Sbjct  128  NNPFGNGAIRVYLREVKECQ  147



>ref|XP_004516078.1| PREDICTED: uncharacterized protein LOC101514778 [Cicer arietinum]
Length=179

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 7/142 (5%)
 Frame = +1

Query  79   RGKDLAEGSPGDTSPATP-------SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHV  237
            +GKD+AEGS  D  P          SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSN V
Sbjct  4    KGKDIAEGSSADHPPQHSQQQPPPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNQV  63

Query  238  LEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGS  417
            L+FLRYLDQFGKTKVH+QGCIF+GQ EPPAPCTCPLKQAWGSLDALIGRLRAAYEENGG 
Sbjct  64   LDFLRYLDQFGKTKVHVQGCIFFGQVEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGL  123

Query  418  PETNPFASGAIRVYLREVKECQ  483
            PETNPFASGAIR+YLR+V++ Q
Sbjct  124  PETNPFASGAIRLYLRQVRDSQ  145



>ref|XP_003607586.1| 177 protein [Medicago truncatula]
 gb|AES89783.1| DUF640 family protein [Medicago truncatula]
Length=176

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 122/135 (90%), Gaps = 1/135 (1%)
 Frame = +1

Query  82   GKDLA-EGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYL  258
            GK+L  E S    S AT SRYESQKRRDWNTFGQYL N RPPV LSQCNSNHVL+FLRYL
Sbjct  10   GKNLEQETSSTTISVATLSRYESQKRRDWNTFGQYLNNMRPPVPLSQCNSNHVLDFLRYL  69

Query  259  DQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFA  438
            DQFGKTKVH+QGC+FYGQPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSP+TNPFA
Sbjct  70   DQFGKTKVHVQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPDTNPFA  129

Query  439  SGAIRVYLREVKECQ  483
            SG+IRVYLRE++E Q
Sbjct  130  SGSIRVYLREIRESQ  144



>ref|XP_010327093.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=178

 Score =   238 bits (606),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 121/138 (88%), Gaps = 5/138 (4%)
 Frame = +1

Query  79   RGKDLAEGS---PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFL  249
            RGKDLAEGS   PG   P  PSRYESQKRRDWNTF  YL+NQRPP+ L  C+SNHVLEFL
Sbjct  7    RGKDLAEGSSRSPGRDQP--PSRYESQKRRDWNTFNHYLKNQRPPILLPHCHSNHVLEFL  64

Query  250  RYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETN  429
            RYLDQFGKTKVHL GC+FYGQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEENGGS ETN
Sbjct  65   RYLDQFGKTKVHLLGCMFYGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSSETN  124

Query  430  PFASGAIRVYLREVKECQ  483
            PFAS  IRVYLREVKECQ
Sbjct  125  PFASVGIRVYLREVKECQ  142



>ref|XP_009773140.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=188

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 122/140 (87%), Gaps = 6/140 (4%)
 Frame = +1

Query  82   GKDLAEGSPGD------TSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLE  243
             K+L EGS          +PA  SRYESQKRRDWNTFGQYL+NQRPPVALSQCN NHVLE
Sbjct  9    AKELPEGSSRSGGEQLQQNPAPLSRYESQKRRDWNTFGQYLKNQRPPVALSQCNCNHVLE  68

Query  244  FLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPE  423
            FLRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPE
Sbjct  69   FLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPE  128

Query  424  TNPFASGAIRVYLREVKECQ  483
             NPF +GAIR+YLREVKECQ
Sbjct  129  NNPFGNGAIRLYLREVKECQ  148



>ref|XP_006442831.1| hypothetical protein CICLE_v10023710mg [Citrus clementina]
 gb|ESR56071.1| hypothetical protein CICLE_v10023710mg [Citrus clementina]
Length=332

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 125/144 (87%), Gaps = 5/144 (3%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTS-----PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSN  231
            +S DRGK +AEGS          P T SRYESQKRRDWNTFGQYL+NQRPPV LSQC+S+
Sbjct  157  LSDDRGKKIAEGSSDHHHHQQQHPTTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCSSS  216

Query  232  HVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENG  411
            HVLEFLRYLDQFGKTKVHLQGC+FYGQP PPAPCTCPL+QAWGSLDALIGRLRAAYEENG
Sbjct  217  HVLEFLRYLDQFGKTKVHLQGCMFYGQPNPPAPCTCPLRQAWGSLDALIGRLRAAYEENG  276

Query  412  GSPETNPFASGAIRVYLREVKECQ  483
            GSPETNPFASG +RV+L EV+E Q
Sbjct  277  GSPETNPFASGEMRVFLGEVRERQ  300



>emb|CDO96796.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 125/148 (84%), Gaps = 9/148 (6%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTSP---------ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQ  219
            +S +R +D  EGS   T            T SRYESQKRRDWNTFGQYL+NQRPPV+LSQ
Sbjct  8    ISAERPRDPIEGSSRSTGENHQQQPQTTTTLSRYESQKRRDWNTFGQYLKNQRPPVSLSQ  67

Query  220  CNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAY  399
            CN NHVLEFLRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAY
Sbjct  68   CNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAY  127

Query  400  EENGGSPETNPFASGAIRVYLREVKECQ  483
            EENGGSPETNPF +GAIRVYLREVKECQ
Sbjct  128  EENGGSPETNPFGNGAIRVYLREVKECQ  155



>gb|KDO64048.1| hypothetical protein CISIN_1g0003541mg, partial [Citrus sinensis]
Length=553

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 125/144 (87%), Gaps = 5/144 (3%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTS-----PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSN  231
            +S DRGK +AEGS          P TPSRYE QKRRDWNTFGQYL+NQRPPV LSQC+S+
Sbjct  386  LSDDRGKKIAEGSSDHHQQQQQHPMTPSRYELQKRRDWNTFGQYLKNQRPPVPLSQCSSS  445

Query  232  HVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENG  411
            HVLEFLRYLD FGK KVHLQGC+FYGQP PPAPCTCPL+QAWGSLDALIGRLRAAYEENG
Sbjct  446  HVLEFLRYLDPFGKIKVHLQGCMFYGQPNPPAPCTCPLRQAWGSLDALIGRLRAAYEENG  505

Query  412  GSPETNPFASGAIRVYLREVKECQ  483
            GSPETNPFASG IRVYLREV+ECQ
Sbjct  506  GSPETNPFASGEIRVYLREVRECQ  529



>ref|XP_007025375.1| Beta-lactamase-like protein ENSP00000383859 [Theobroma cacao]
 gb|EOY27997.1| Beta-lactamase-like protein ENSP00000383859 [Theobroma cacao]
Length=179

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 124/146 (85%), Gaps = 7/146 (5%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTS-------PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MS D  K  AEGS   +        PA  SRYESQKRRDWNTFGQYL+NQRPPVALSQCN
Sbjct  1    MSGDVAKASAEGSSRSSGNHHQQPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVALSQCN  60

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
             NHVL+FLRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEE
Sbjct  61   CNHVLDFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE  120

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            +GGS ETNPF +GAIRVYLREV+ECQ
Sbjct  121  HGGSSETNPFGNGAIRVYLREVRECQ  146



>ref|XP_006362411.1| PREDICTED: uncharacterized protein LOC102591189 [Solanum tuberosum]
Length=191

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 117/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  112  DTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQ  291
            + +PA  SRYESQKRRDWNTFGQYL+NQRPPV+LSQCN NHVLEFLRYLDQFGKTKVHL 
Sbjct  26   NNNPAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLEFLRYLDQFGKTKVHLH  85

Query  292  GCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREV  471
            GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPE NPF +GAIR+YLREV
Sbjct  86   GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREV  145

Query  472  KECQ  483
            KECQ
Sbjct  146  KECQ  149



>ref|XP_010553628.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
 ref|XP_010553707.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=170

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 124/140 (89%), Gaps = 2/140 (1%)
 Frame = +1

Query  70   SFDRGKDLAE--GSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLE  243
            S +RGK L E  GS     PATPSRYESQKRRDWNTFGQYL+NQRPP+ LSQC+ +HVL+
Sbjct  4    SGERGKSLMEPSGSGEQQQPATPSRYESQKRRDWNTFGQYLKNQRPPMPLSQCSCSHVLD  63

Query  244  FLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPE  423
            FLRYLDQFGKTKVH+ GC+FYGQPEPPAPC CPL+QAWGSLDALIGRLRAAYEENGG PE
Sbjct  64   FLRYLDQFGKTKVHVPGCMFYGQPEPPAPCICPLRQAWGSLDALIGRLRAAYEENGGPPE  123

Query  424  TNPFASGAIRVYLREVKECQ  483
            TNPFASGAIR YL+EV++CQ
Sbjct  124  TNPFASGAIRAYLKEVRDCQ  143



>ref|XP_003596364.1| 177 protein [Medicago truncatula]
 gb|AES66615.1| DUF640 family protein [Medicago truncatula]
Length=178

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 123/146 (84%), Gaps = 10/146 (7%)
 Frame = +1

Query  76   DRGKDLAEGSP----GDTSPATP------SRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            ++GKD+ EGS     GD            SRYESQKRRDWNTFGQYLRNQRPPVALS CN
Sbjct  3    NKGKDIVEGSSRSSIGDDQNQQQQQQIPLSRYESQKRRDWNTFGQYLRNQRPPVALSNCN  62

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
            SNHVLEFLRYLDQFGKTKVHLQGC+F+GQ EPP PCTCPLKQAWGSLDALIGRLRAAYEE
Sbjct  63   SNHVLEFLRYLDQFGKTKVHLQGCLFFGQTEPPGPCTCPLKQAWGSLDALIGRLRAAYEE  122

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGG PETNPFASG+IR+YLREV++ Q
Sbjct  123  NGGLPETNPFASGSIRIYLREVRDSQ  148



>ref|XP_004233074.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=191

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 107/124 (86%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +1

Query  112  DTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQ  291
            + +PA  SRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHVLEFLRYLDQFGKTKVHL 
Sbjct  26   NNNPAPLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLEFLRYLDQFGKTKVHLH  85

Query  292  GCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREV  471
            GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPE NPF +GAIR+YLREV
Sbjct  86   GCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREV  145

Query  472  KECQ  483
            KECQ
Sbjct  146  KECQ  149



>ref|XP_002285447.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Vitis 
vinifera]
Length=220

 Score =   237 bits (605),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 125/146 (86%), Gaps = 7/146 (5%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTS-------PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MS ++GKD  EGS   +S       P   SRYESQKRRDWNTFGQ+L+NQRPPVAL+QCN
Sbjct  43   MSSNKGKDTGEGSSTRSSAEDQQQQPPPLSRYESQKRRDWNTFGQFLKNQRPPVALAQCN  102

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
            SN VL+FLRYLDQFGKTKVHLQGC+++GQPEPP PCTCPLKQAWGSLDALIGRLRAAYEE
Sbjct  103  SNQVLDFLRYLDQFGKTKVHLQGCVYFGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEE  162

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGG PE NPFASGAIR+YLREV++ Q
Sbjct  163  NGGLPEKNPFASGAIRIYLREVRDSQ  188



>ref|XP_009608555.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=187

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 121/139 (87%), Gaps = 5/139 (4%)
 Frame = +1

Query  82   GKDLAEGSPGD-----TSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEF  246
             K+L EGS         +PA  SRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHVLEF
Sbjct  9    AKELPEGSSRSGGEQLQNPAPLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLEF  68

Query  247  LRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPET  426
            LRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEENGGSPE 
Sbjct  69   LRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPEN  128

Query  427  NPFASGAIRVYLREVKECQ  483
            NPF +GAIR+YLREVKECQ
Sbjct  129  NPFGNGAIRLYLREVKECQ  147



>ref|XP_010109876.1| hypothetical protein L484_003806 [Morus notabilis]
 gb|EXC24829.1| hypothetical protein L484_003806 [Morus notabilis]
Length=194

 Score =   236 bits (601),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 127/157 (81%), Gaps = 18/157 (11%)
 Frame = +1

Query  67   MSFDRGKD-LAEGS----------PGDT-------SPATPSRYESQKRRDWNTFGQYLRN  192
            MS DR KD  AEGS          P D        S A  SRYESQK+RDWNTFGQYL+N
Sbjct  1    MSGDRRKDSAAEGSSSRSITMTTAPADLHHHQQQPSAAPLSRYESQKKRDWNTFGQYLKN  60

Query  193  QRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDA  372
            Q PPVALSQCN NHVL+FLRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDA
Sbjct  61   QTPPVALSQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDA  120

Query  373  LIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            LIGRLRAAYEE+GGSPETNPF +GAIRVYLREVKECQ
Sbjct  121  LIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQ  157



>gb|KDP21096.1| hypothetical protein JCGZ_21567 [Jatropha curcas]
Length=182

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 126/150 (84%), Gaps = 11/150 (7%)
 Frame = +1

Query  67   MSFDRGKDLAEGSP---GDTSPATP--------SRYESQKRRDWNTFGQYLRNQRPPVAL  213
            MS D+ KD AEGS    GD              SRYESQKRRDWNTFGQYL+NQRPPV+L
Sbjct  1    MSGDKPKDSAEGSSRSSGDHHHQQQQLPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVSL  60

Query  214  SQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRA  393
            SQCN NHVL+FLRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRA
Sbjct  61   SQCNCNHVLDFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRA  120

Query  394  AYEENGGSPETNPFASGAIRVYLREVKECQ  483
            AYEE+GGSPETNPF +GAIRVYLREV+ECQ
Sbjct  121  AYEEHGGSPETNPFGNGAIRVYLREVRECQ  150



>ref|XP_004151474.1| PREDICTED: uncharacterized protein LOC101210225 [Cucumis sativus]
Length=187

 Score =   235 bits (599),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 122/142 (86%), Gaps = 3/142 (2%)
 Frame = +1

Query  67   MSFDRGKDLAEG---SPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHV  237
            MS +  KD  E    S   T+ A  SRYESQKRRDWNTFGQYL+NQ P V+LSQCN NHV
Sbjct  1    MSTEGRKDPTEAGSSSRATTTTAALSRYESQKRRDWNTFGQYLKNQTPAVSLSQCNCNHV  60

Query  238  LEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGS  417
            LEFLRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGS
Sbjct  61   LEFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGS  120

Query  418  PETNPFASGAIRVYLREVKECQ  483
            PETNPF +GAIRVYLREVKECQ
Sbjct  121  PETNPFGNGAIRVYLREVKECQ  142



>ref|XP_004150559.1| PREDICTED: uncharacterized protein LOC101216601 [Cucumis sativus]
Length=226

 Score =   236 bits (603),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 121/134 (90%), Gaps = 1/134 (1%)
 Frame = +1

Query  85   KDLAEGSPGDTSPAT-PSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLD  261
            K+  EGS      AT PSRYESQKRRDWNTFGQYL+NQRP VALSQCN NHVLEFLRYLD
Sbjct  13   KEYGEGSSKSPPRATTPSRYESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRYLD  72

Query  262  QFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFAS  441
            QFGKTKVH+QGC+FYG PEPP+PCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFA+
Sbjct  73   QFGKTKVHVQGCMFYGHPEPPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFAT  132

Query  442  GAIRVYLREVKECQ  483
             +IR+YLR+V+ECQ
Sbjct  133  ASIRLYLRQVRECQ  146



>gb|KGN47252.1| hypothetical protein Csa_6G236080 [Cucumis sativus]
Length=205

 Score =   236 bits (601),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 122/136 (90%), Gaps = 5/136 (4%)
 Frame = +1

Query  85   KDLAEGSPGDTSP---ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRY  255
            K+  EGS    SP    TPSRYESQKRRDWNTFGQYL+NQRP VALSQCN NHVLEFLRY
Sbjct  13   KEYGEGS--SKSPPRATTPSRYESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRY  70

Query  256  LDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  435
            LDQFGKTKVH+QGC+FYG PEPP+PCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF
Sbjct  71   LDQFGKTKVHVQGCMFYGHPEPPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  130

Query  436  ASGAIRVYLREVKECQ  483
            A+ +IR+YLR+V+ECQ
Sbjct  131  ATASIRLYLRQVRECQ  146



>ref|XP_004171262.1| PREDICTED: uncharacterized LOC101216601 [Cucumis sativus]
Length=206

 Score =   236 bits (601),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 122/136 (90%), Gaps = 5/136 (4%)
 Frame = +1

Query  85   KDLAEGSPGDTSP---ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRY  255
            K+  EGS    SP    TPSRYESQKRRDWNTFGQYL+NQRP VALSQCN NHVLEFLRY
Sbjct  13   KEYGEGS--SKSPPRATTPSRYESQKRRDWNTFGQYLKNQRPAVALSQCNFNHVLEFLRY  70

Query  256  LDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  435
            LDQFGKTKVH+QGC+FYG PEPP+PCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF
Sbjct  71   LDQFGKTKVHVQGCMFYGHPEPPSPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPF  130

Query  436  ASGAIRVYLREVKECQ  483
            A+ +IR+YLR+V+ECQ
Sbjct  131  ATASIRLYLRQVRECQ  146



>ref|XP_010062813.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 ref|XP_010062814.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 ref|XP_010062815.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Eucalyptus 
grandis]
 gb|KCW69948.1| hypothetical protein EUGRSUZ_F03266 [Eucalyptus grandis]
Length=182

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 126/151 (83%), Gaps = 14/151 (9%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTSPATP------------SRYESQKRRDWNTFGQYLRNQRPPVA  210
            MS ++GK +AEGS    S A+P            SRYESQKRRDWNTFGQYLRNQRPP+A
Sbjct  1    MSIEKGKGMAEGS--SRSTASPNDQHHQQRVLPLSRYESQKRRDWNTFGQYLRNQRPPIA  58

Query  211  LSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLR  390
            ++Q NSNHVL+FLRYLDQFGKTKVHL GCI++GQPEPP PCTCPL+QAWGSLDALIGRLR
Sbjct  59   ITQFNSNHVLDFLRYLDQFGKTKVHLHGCIYFGQPEPPGPCTCPLRQAWGSLDALIGRLR  118

Query  391  AAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            AAYEENGG PE NPFASG+IR+YLREVK+ Q
Sbjct  119  AAYEENGGLPEANPFASGSIRMYLREVKDSQ  149



>gb|KHG25854.1| Major vault [Gossypium arboreum]
Length=179

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 126/146 (86%), Gaps = 7/146 (5%)
 Frame = +1

Query  67   MSFDRGKDLAEGSP-------GDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MSF++GK++ EGS        G  +P   SRYESQKRRDW TFGQYLRN+RPPVA+SQCN
Sbjct  2    MSFNKGKEIIEGSSRSVTAVVGVENPPRLSRYESQKRRDWITFGQYLRNRRPPVAISQCN  61

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
            +NHVL+FL YLDQFGKTKVHLQGC+F+GQPEPP PC C L+QAWGSLDALIGRLRAAYEE
Sbjct  62   ANHVLDFLGYLDQFGKTKVHLQGCMFFGQPEPPGPCACSLRQAWGSLDALIGRLRAAYEE  121

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGGSPETNPFA+GAIR+YLREV++ Q
Sbjct  122  NGGSPETNPFANGAIRIYLREVRDSQ  147



>gb|KGN65636.1| hypothetical protein Csa_1G474480 [Cucumis sativus]
Length=186

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 122/142 (86%), Gaps = 3/142 (2%)
 Frame = +1

Query  67   MSFDRGKDLAEG---SPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHV  237
            MS +  KD  E    S   T+ A  SRYESQKRRDWNTFGQYL+NQ P V+LSQCN NHV
Sbjct  1    MSTEGRKDPTEAGSSSRATTTTAALSRYESQKRRDWNTFGQYLKNQTPAVSLSQCNCNHV  60

Query  238  LEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGS  417
            LEFLRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGS
Sbjct  61   LEFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGS  120

Query  418  PETNPFASGAIRVYLREVKECQ  483
            PETNPF +GAIRVYLREVKECQ
Sbjct  121  PETNPFGNGAIRVYLREVKECQ  142



>ref|XP_010108230.1| hypothetical protein L484_018651 [Morus notabilis]
 gb|EXC18470.1| hypothetical protein L484_018651 [Morus notabilis]
Length=184

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 125/149 (84%), Gaps = 10/149 (7%)
 Frame = +1

Query  67   MSFDRGKDLAEG-------SPGDTSPATP---SRYESQKRRDWNTFGQYLRNQRPPVALS  216
            MS ++GKD A+G        P  ++   P   SRYESQKRR W TFGQYLRNQRPPVALS
Sbjct  1    MSSNKGKDAADGSSSSSRPQPASSTAQQPPPLSRYESQKRRGWETFGQYLRNQRPPVALS  60

Query  217  QCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAA  396
            QCN NHVL+FLRYLDQFGKTKVHLQGC+F+GQPEPP PC+CPL+QAWGSLDALIGRLRAA
Sbjct  61   QCNGNHVLDFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCSCPLRQAWGSLDALIGRLRAA  120

Query  397  YEENGGSPETNPFASGAIRVYLREVKECQ  483
            YEENGG PETNPFASGAIRVYLR+V++ Q
Sbjct  121  YEENGGLPETNPFASGAIRVYLRDVRDSQ  149



>ref|XP_004489028.1| PREDICTED: uncharacterized protein LOC101497242 [Cicer arietinum]
Length=189

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 125/158 (79%), Gaps = 22/158 (14%)
 Frame = +1

Query  76   DRGKDLAEGSP-------GDTSPATP---------------SRYESQKRRDWNTFGQYLR  189
            ++GKD+ EGS        GD +                   SRYESQKRRDWNTFGQYLR
Sbjct  3    NKGKDIVEGSSRSSTSTIGDATGGGDHQRQQQQQQQQQIPLSRYESQKRRDWNTFGQYLR  62

Query  190  NQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLD  369
            NQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGC+F+GQ EPP PCTCPLKQAWGSLD
Sbjct  63   NQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCLFFGQVEPPGPCTCPLKQAWGSLD  122

Query  370  ALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            ALIGRLRAAYEENGG PETNPFASG+IR+YLREV++ Q
Sbjct  123  ALIGRLRAAYEENGGLPETNPFASGSIRIYLREVRDSQ  160



>ref|XP_004485894.1| PREDICTED: uncharacterized protein LOC101502781 [Cicer arietinum]
Length=183

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 117/130 (90%), Gaps = 2/130 (2%)
 Frame = +1

Query  94   AEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGK  273
            A+  P  T+P   SRYESQK+RDWNTFGQYLRNQ P V+LSQCN NHVLEFLRYLDQFGK
Sbjct  22   ADQQPTATAPL--SRYESQKKRDWNTFGQYLRNQTPAVSLSQCNFNHVLEFLRYLDQFGK  79

Query  274  TKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIR  453
            TKVHL GCIF+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGSPE NPF SGAIR
Sbjct  80   TKVHLHGCIFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPENNPFGSGAIR  139

Query  454  VYLREVKECQ  483
            VYLREVKECQ
Sbjct  140  VYLREVKECQ  149



>gb|AFK47598.1| unknown [Lotus japonicus]
Length=179

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 124/148 (84%), Gaps = 16/148 (11%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTSPATP------------SRYESQKRRDWNTFGQYLRNQRPPVALSQ  219
            ++GKD+AEGS    SPA+             SRYESQKRRDWNTFGQYLRNQRPPVALSQ
Sbjct  3    NKGKDIAEGS----SPASDHHHHQQQQQQPLSRYESQKRRDWNTFGQYLRNQRPPVALSQ  58

Query  220  CNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAY  399
            CNSN VLEFLRYLDQFGKTKVH+QGC+F+GQ EPP PCTCPL+QAWGSLDALIGRLRAAY
Sbjct  59   CNSNQVLEFLRYLDQFGKTKVHVQGCLFFGQAEPPGPCTCPLRQAWGSLDALIGRLRAAY  118

Query  400  EENGGSPETNPFASGAIRVYLREVKECQ  483
            EENGG PE NPFASG IR+YLREV++ Q
Sbjct  119  EENGGLPEANPFASGTIRLYLREVRDSQ  146



>ref|XP_002530382.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32002.1| conserved hypothetical protein [Ricinus communis]
Length=197

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +1

Query  118  SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGC  297
            +P   SRYESQKRRDWNTFGQYLRNQRPPVALSQCN+NHVL+FLRYLDQFGKTKVHLQGC
Sbjct  44   NPPPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLDFLRYLDQFGKTKVHLQGC  103

Query  298  IFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKE  477
            +F+GQPEPP PCTCPLKQAWGSLDALIGRLRAAYEENGG PETNPFASGAIRV+LREV++
Sbjct  104  VFFGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVHLREVRD  163

Query  478  CQ  483
             Q
Sbjct  164  SQ  165



>emb|CAN63025.1| hypothetical protein VITISV_034817 [Vitis vinifera]
Length=177

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 7/143 (5%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTS-------PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNH  234
            ++GKD  EGS   +S       P   SRYESQKRRDWNTFGQ+L+NQRPPVAL+QCNSN 
Sbjct  3    NKGKDTGEGSSTRSSAEDQQQQPPPLSRYESQKRRDWNTFGQFLKNQRPPVALAQCNSNQ  62

Query  235  VLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGG  414
            VL+FLRYLDQFGKTKVHLQGC+++GQPEPP PCTCPLKQAWGSLDALIGRLRAAYEENGG
Sbjct  63   VLDFLRYLDQFGKTKVHLQGCVYFGQPEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGG  122

Query  415  SPETNPFASGAIRVYLREVKECQ  483
             PE NPFASGAIR+YLREV++ Q
Sbjct  123  LPEKNPFASGAIRIYLREVRDSQ  145



>ref|XP_008465553.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=182

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  124  ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIF  303
            A  SRYESQKRRDWNTFGQYL+NQ PPV+LSQCN NHVLEFLRYLDQFGKTKVHL GC+F
Sbjct  24   AALSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVF  83

Query  304  YGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            +GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGSPETNPF +GAIRVYLREVKECQ
Sbjct  84   FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQ  143



>ref|XP_011008476.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=177

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 126/146 (86%), Gaps = 7/146 (5%)
 Frame = +1

Query  67   MSFD-RGKDLAEGSP---GD---TSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MS D R KD AEGS    GD      A  SRYESQKRRDWNTFGQYL+NQRPPV+LSQCN
Sbjct  1    MSGDQRPKDSAEGSSRSVGDHHQLQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCN  60

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
             NHVL+FLRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAA+EE
Sbjct  61   CNHVLDFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAFEE  120

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            +GGS ETNPF +GAIRVYLREVKECQ
Sbjct  121  HGGSAETNPFGNGAIRVYLREVKECQ  146



>gb|AFK34719.1| unknown [Lotus japonicus]
Length=179

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 124/148 (84%), Gaps = 16/148 (11%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTSPATP------------SRYESQKRRDWNTFGQYLRNQRPPVALSQ  219
            ++GKD+AEGS    SPA+             SRYESQKRRDWNTFGQYLRNQRPPVALSQ
Sbjct  3    NKGKDIAEGS----SPASDHHHHQQQQQQPLSRYESQKRRDWNTFGQYLRNQRPPVALSQ  58

Query  220  CNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAY  399
            CNSN VLEFLRYLDQFGKTKVH+QGC+F+GQ EPP PCTCPL+QAWGSLDALIGRLRAAY
Sbjct  59   CNSNQVLEFLRYLDQFGKTKVHVQGCLFFGQAEPPGPCTCPLRQAWGSLDALIGRLRAAY  118

Query  400  EENGGSPETNPFASGAIRVYLREVKECQ  483
            EENGG PE NPFASG IR+YLREV++ Q
Sbjct  119  EENGGLPEANPFASGTIRLYLREVRDSQ  146



>ref|XP_002305745.1| hypothetical protein POPTR_0004s05610g [Populus trichocarpa]
 gb|ABK93578.1| unknown [Populus trichocarpa]
 gb|EEE86256.1| hypothetical protein POPTR_0004s05610g [Populus trichocarpa]
Length=177

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 126/146 (86%), Gaps = 7/146 (5%)
 Frame = +1

Query  67   MSFD-RGKDLAEGSP---GD---TSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MS D R KD AEGS    GD      A  SRYESQKRRDWNTFGQYL+NQRPPV+LSQCN
Sbjct  1    MSGDQRPKDSAEGSSRSGGDHHQLQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCN  60

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
             NHVL+FLRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAA+EE
Sbjct  61   CNHVLDFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAFEE  120

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            +GGS ETNPF +GAIRVYLREVKECQ
Sbjct  121  HGGSAETNPFGNGAIRVYLREVKECQ  146



>ref|XP_003542999.1| PREDICTED: uncharacterized protein LOC100778886 [Glycine max]
Length=181

 Score =   233 bits (593),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYL+NQ PPV+LSQCN NHVLEFLRYLDQFGKTKVHL GCIF+GQ
Sbjct  32   SRYESQKRRDWNTFGQYLKNQTPPVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQ  91

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P+PPAPCTCPL+QAWGSLDALIGRLRAAYEE GGSPETNPF SGAIRVYLREVKECQ
Sbjct  92   PDPPAPCTCPLRQAWGSLDALIGRLRAAYEERGGSPETNPFGSGAIRVYLREVKECQ  148



>ref|XP_007148048.1| hypothetical protein PHAVU_006G176100g [Phaseolus vulgaris]
 gb|ESW20042.1| hypothetical protein PHAVU_006G176100g [Phaseolus vulgaris]
Length=183

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +1

Query  121  PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCI  300
            PA  SRYESQKRRDWNTFGQYL+NQ PPV+LS CN NHVLEFLRYLDQFGKTKVHL GCI
Sbjct  30   PAPLSRYESQKRRDWNTFGQYLKNQTPPVSLSLCNFNHVLEFLRYLDQFGKTKVHLHGCI  89

Query  301  FYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKEC  480
            F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGSPETNPF SGAIRVYLREVKEC
Sbjct  90   FFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGSGAIRVYLREVKEC  149

Query  481  Q  483
            Q
Sbjct  150  Q  150



>ref|XP_002317421.1| hypothetical protein POPTR_0011s07350g [Populus trichocarpa]
 gb|ABK94387.1| unknown [Populus trichocarpa]
 gb|EEE98033.1| hypothetical protein POPTR_0011s07350g [Populus trichocarpa]
Length=177

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 125/146 (86%), Gaps = 7/146 (5%)
 Frame = +1

Query  67   MSFD-RGKDLAEGSP---GDT---SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MS D R KD AEGS    GD     PA  SRYESQKRRDWNTFGQYL+NQRPPV+LSQ N
Sbjct  1    MSGDQRPKDSAEGSSRSGGDHYQPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQSN  60

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
             NHVL+FLRYLDQFGKTKVHL GC+F+GQP PPAPCTCPL+QAWGSLDALIGRLRAAYEE
Sbjct  61   CNHVLDFLRYLDQFGKTKVHLHGCVFFGQPNPPAPCTCPLRQAWGSLDALIGRLRAAYEE  120

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            +GGS ETNPF +GAIRVYLREVKECQ
Sbjct  121  HGGSAETNPFGNGAIRVYLREVKECQ  146



>gb|AFK49191.1| unknown [Medicago truncatula]
 gb|KEH36593.1| DUF640 family protein [Medicago truncatula]
Length=184

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQK+RDWNTFGQYLRNQ PPV+LSQCN NHVLEFLRYLDQFGKTKVHL GCIF+GQ
Sbjct  34   SRYESQKKRDWNTFGQYLRNQSPPVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQ  93

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGSPE NPF +GAIRVYLREVKECQ
Sbjct  94   PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPENNPFGTGAIRVYLREVKECQ  150



>gb|KDP34762.1| hypothetical protein JCGZ_10542 [Jatropha curcas]
Length=184

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 125/153 (82%), Gaps = 14/153 (9%)
 Frame = +1

Query  67   MSFDRGKDLAEGSP--------------GDTSPATPSRYESQKRRDWNTFGQYLRNQRPP  204
            MS ++GKD+AEGS                  +P   SRYESQKRRDWNTFGQYLRNQRPP
Sbjct  1    MSSNKGKDIAEGSSRSGGGGNGGGGNGNDQQNPPPLSRYESQKRRDWNTFGQYLRNQRPP  60

Query  205  VALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGR  384
            V L+ CN+ HVL+FLRYLDQFGKTKVHLQGC+F+GQPEPP PCTCPLKQAWGSLDALIGR
Sbjct  61   VTLANCNATHVLDFLRYLDQFGKTKVHLQGCVFFGQPEPPGPCTCPLKQAWGSLDALIGR  120

Query  385  LRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            LRAAYEENGG PETNPFASGAIRVYLREV++ Q
Sbjct  121  LRAAYEENGGLPETNPFASGAIRVYLREVRDSQ  153



>ref|XP_004505495.1| PREDICTED: uncharacterized protein LOC101509969 [Cicer arietinum]
Length=165

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEF  246
            MS + GK+L E        AT SRYESQKRRDWNTFGQYL+ Q+PPV L  CNSN+VL+F
Sbjct  1    MSSNHGKELQEPESSTNQVATLSRYESQKRRDWNTFGQYLKTQKPPVPLVHCNSNNVLDF  60

Query  247  LRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPET  426
            LRYLDQFGKTKVH+QGC+FYG PEPPAPC+CPL+QAWGSLDALIGRLRAAYEENGGSP T
Sbjct  61   LRYLDQFGKTKVHIQGCMFYGNPEPPAPCSCPLRQAWGSLDALIGRLRAAYEENGGSPHT  120

Query  427  NPFASGAIRVYLREVKECQ  483
            NPFA+ +IR+YLREV+ECQ
Sbjct  121  NPFATSSIRLYLREVRECQ  139



>ref|XP_011011486.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=177

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 121/141 (86%), Gaps = 6/141 (4%)
 Frame = +1

Query  79   RGKDLAEGSPGDTS------PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVL  240
            R KD AEGS    S      PA  SRYESQKRRDWNTFGQYL+NQRPPV+LSQ N NHVL
Sbjct  6    RPKDSAEGSSRSGSDHYQPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQSNCNHVL  65

Query  241  EFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSP  420
            +FLRYLDQFGKTKVHL GC+F+GQP PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGS 
Sbjct  66   DFLRYLDQFGKTKVHLHGCVFFGQPNPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSA  125

Query  421  ETNPFASGAIRVYLREVKECQ  483
            ETNPF +GAIRVYLREVKECQ
Sbjct  126  ETNPFGNGAIRVYLREVKECQ  146



>ref|XP_007212120.1| hypothetical protein PRUPE_ppa012018mg [Prunus persica]
 gb|EMJ13319.1| hypothetical protein PRUPE_ppa012018mg [Prunus persica]
Length=187

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +1

Query  118  SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGC  297
            +P   SRYESQKRRDWNTFGQYL+NQ PPV+LSQCN NHVL+FLRYLDQFGKTKVHL GC
Sbjct  31   APQPLSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGC  90

Query  298  IFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKE  477
            +F+GQP+PPAPCTCPLKQAWGSLDALIGRLRAAYEE+GGSPETNPF +GAIRVYLREVKE
Sbjct  91   VFFGQPDPPAPCTCPLKQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKE  150

Query  478  CQ  483
            CQ
Sbjct  151  CQ  152



>gb|EYU30777.1| hypothetical protein MIMGU_mgv1a014751mg [Erythranthe guttata]
Length=179

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 120/140 (86%), Gaps = 3/140 (2%)
 Frame = +1

Query  73   FDRGKDLAEGSPGDTSPA---TPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLE  243
             DRG      S G   PA   TPSRYESQKRRDWNTFGQ+LRN RP V ++QCNS+HVL+
Sbjct  1    MDRGGAEGSSSWGGGDPAAAATPSRYESQKRRDWNTFGQFLRNMRPAVGVAQCNSSHVLD  60

Query  244  FLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPE  423
            F+RYLDQFGKTKVH QGC FYGQPEPPAPCTCPL+QAWGSLDAL+GRLRAAYEENGGSPE
Sbjct  61   FMRYLDQFGKTKVHSQGCTFYGQPEPPAPCTCPLRQAWGSLDALVGRLRAAYEENGGSPE  120

Query  424  TNPFASGAIRVYLREVKECQ  483
            +NPFAS +IR+YLREVKECQ
Sbjct  121  SNPFASSSIRMYLREVKECQ  140



>gb|KCW67509.1| hypothetical protein EUGRSUZ_F01238 [Eucalyptus grandis]
 gb|KCW67510.1| hypothetical protein EUGRSUZ_F01238 [Eucalyptus grandis]
Length=184

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 123/149 (83%), Gaps = 10/149 (7%)
 Frame = +1

Query  67   MSFD-RGKD-LAEGSPGDTSPATP--------SRYESQKRRDWNTFGQYLRNQRPPVALS  216
            MS D RGKD + EGS    +P+          SRYESQKRRDWNTFGQYL NQRPPVA+S
Sbjct  1    MSMDNRGKDPIQEGSSRSVAPSGDHLPQPTQLSRYESQKRRDWNTFGQYLSNQRPPVAIS  60

Query  217  QCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAA  396
            QCNS HVLEFLRYLDQFGKTKVH  GC+++GQPEPP PCTCPLKQAWGSLDALIGRLRAA
Sbjct  61   QCNSTHVLEFLRYLDQFGKTKVHFNGCVYFGQPEPPGPCTCPLKQAWGSLDALIGRLRAA  120

Query  397  YEENGGSPETNPFASGAIRVYLREVKECQ  483
            YEENGG PETNPFAS +IRVYLREV++ Q
Sbjct  121  YEENGGLPETNPFASSSIRVYLREVRDSQ  149



>ref|XP_011101384.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=183

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYL+NQRPPV +SQCN NHVLEFLRYLDQFGKTKVHL GC+F+GQ
Sbjct  33   SRYESQKRRDWNTFGQYLKNQRPPVPISQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFGQ  92

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGSPETNPF +GAIRVYLREVK+CQ
Sbjct  93   PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKDCQ  149



>ref|XP_007149389.1| hypothetical protein PHAVU_005G066200g [Phaseolus vulgaris]
 gb|ESW21383.1| hypothetical protein PHAVU_005G066200g [Phaseolus vulgaris]
Length=179

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 123/145 (85%), Gaps = 10/145 (7%)
 Frame = +1

Query  79   RGKDLAEGSPGDTSPATP----------SRYESQKRRDWNTFGQYLRNQRPPVALSQCNS  228
            +GK++AEGS   +               SRYESQKRRDWNTFGQYLRNQRPPVALSQC+S
Sbjct  4    KGKEVAEGSSRPSGGGDDQNQQQQQLPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCSS  63

Query  229  NHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN  408
            +HVLEFLRYLDQFGKTKVHLQGC+F+GQ EPP PCTCPL+QAWGSLDALIGRLRAAYEEN
Sbjct  64   SHVLEFLRYLDQFGKTKVHLQGCLFFGQSEPPGPCTCPLRQAWGSLDALIGRLRAAYEEN  123

Query  409  GGSPETNPFASGAIRVYLREVKECQ  483
            GG PETNPFASGAIRVYLREV++ Q
Sbjct  124  GGLPETNPFASGAIRVYLREVRDSQ  148



>ref|NP_001237249.1| uncharacterized protein LOC100306082 [Glycine max]
 gb|ACU14083.1| unknown [Glycine max]
Length=181

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYL+NQ PPV+LSQCN NHVLEFLRYLDQFGKTKVHL GCIF+GQ
Sbjct  32   SRYESQKRRDWNTFGQYLKNQTPPVSLSQCNFNHVLEFLRYLDQFGKTKVHLHGCIFFGQ  91

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGS ETNPF SGAIRVYLREVKECQ
Sbjct  92   PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSAETNPFGSGAIRVYLREVKECQ  148



>ref|XP_008225289.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Prunus 
mume]
Length=187

 Score =   231 bits (588),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +1

Query  118  SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGC  297
            +P   SRYESQKRRDWNTFGQYL+NQ PPV+LSQCN NHVL+FLRYLDQFGKTKVHL GC
Sbjct  31   APQPLSRYESQKRRDWNTFGQYLKNQTPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHGC  90

Query  298  IFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKE  477
            +F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGSPETNPF +GAIRVYLREVKE
Sbjct  91   VFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKE  150

Query  478  CQ  483
            CQ
Sbjct  151  CQ  152



>ref|XP_004136831.1| PREDICTED: uncharacterized protein LOC101208687 [Cucumis sativus]
 ref|XP_004155471.1| PREDICTED: uncharacterized protein LOC101230404 [Cucumis sativus]
 gb|KGN43628.1| hypothetical protein Csa_7G048120 [Cucumis sativus]
Length=189

 Score =   231 bits (588),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  130  PSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYG  309
            PSRYESQKRRDWNTF QYL+NQRPPV LS CN N VLEFLRYLDQFGKTKVH+QGC+FYG
Sbjct  31   PSRYESQKRRDWNTFCQYLKNQRPPVPLSHCNCNQVLEFLRYLDQFGKTKVHIQGCMFYG  90

Query  310  QPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            QPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGS ETNPFASGAIRVYLR+V+ECQ
Sbjct  91   QPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFASGAIRVYLRDVRECQ  148



>ref|NP_001237763.1| uncharacterized protein LOC100527554 [Glycine max]
 gb|ACU16651.1| unknown [Glycine max]
Length=194

 Score =   231 bits (588),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 123/159 (77%), Gaps = 24/159 (15%)
 Frame = +1

Query  79   RGKDLAEGSPGDTSPATPS------------------------RYESQKRRDWNTFGQYL  186
            +GK++AEGS   T+   PS                        RYESQKRRDWNTFGQYL
Sbjct  4    KGKEIAEGSSTTTTATRPSHGGDDHHHHHNQQQQQQQQQLPLSRYESQKRRDWNTFGQYL  63

Query  187  RNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSL  366
            RNQRPPVALSQC+SNHVLEFLRYLDQFGKTKVH QGC+F+GQ EPP PCTCPL+QAWGSL
Sbjct  64   RNQRPPVALSQCSSNHVLEFLRYLDQFGKTKVHSQGCLFFGQTEPPGPCTCPLRQAWGSL  123

Query  367  DALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            DALIGRLRAAYEENGG PETNPFASG IRVYLREV++ Q
Sbjct  124  DALIGRLRAAYEENGGLPETNPFASGTIRVYLREVRDSQ  162



>ref|XP_006592933.1| PREDICTED: uncharacterized protein LOC100806493 isoform X1 [Glycine 
max]
 ref|XP_006592934.1| PREDICTED: uncharacterized protein LOC100806493 isoform X2 [Glycine 
max]
Length=184

 Score =   230 bits (587),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 124/150 (83%), Gaps = 16/150 (11%)
 Frame = +1

Query  79   RGKDLAEGSPGDTSPATP---------------SRYESQKRRDWNTFGQYLRNQRPPVAL  213
            +GK++AEGS   T P+                 SRYESQKRRDWNTFGQYLRNQRPPVAL
Sbjct  4    KGKEVAEGS-STTRPSHGGDDDHHHNQQQQLPLSRYESQKRRDWNTFGQYLRNQRPPVAL  62

Query  214  SQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRA  393
            SQC+SNHVLEFLRYLDQFGKTKVH QGC+F+GQ EPP PCTCPL+QAWGSLDALIGRLRA
Sbjct  63   SQCSSNHVLEFLRYLDQFGKTKVHSQGCLFFGQTEPPGPCTCPLRQAWGSLDALIGRLRA  122

Query  394  AYEENGGSPETNPFASGAIRVYLREVKECQ  483
            AYEENGG PETNPFASGAIRVYLREV++ Q
Sbjct  123  AYEENGGLPETNPFASGAIRVYLREVRDSQ  152



>ref|XP_008455303.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Cucumis 
melo]
Length=188

 Score =   230 bits (587),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +1

Query  130  PSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYG  309
            PSRYESQKRRDWNTF QYL+NQRPPV LS CN N VLEFLRYLDQFGKTKVH+QGC+FYG
Sbjct  30   PSRYESQKRRDWNTFCQYLKNQRPPVPLSHCNCNQVLEFLRYLDQFGKTKVHIQGCMFYG  89

Query  310  QPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            QPEPPAPCTCPL+QAWGSLDALIGRLRAAYEENGGS ETNPFASGAIRVYLR+V+ECQ
Sbjct  90   QPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSQETNPFASGAIRVYLRDVRECQ  147



>ref|XP_004294145.1| PREDICTED: uncharacterized protein LOC101307097 [Fragaria vesca 
subsp. vesca]
Length=194

 Score =   230 bits (587),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYLRNQRPPVALSQ NS+HVL+FLRYLDQFGKTKVHLQGC+F+GQ
Sbjct  41   SRYESQKRRDWNTFGQYLRNQRPPVALSQSNSSHVLDFLRYLDQFGKTKVHLQGCVFFGQ  100

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            PEPP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE+NPFASGAIRVYLREV++ Q
Sbjct  101  PEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPESNPFASGAIRVYLREVRDSQ  157



>ref|XP_008371461.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_008371462.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009349575.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
 ref|XP_009349639.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=187

 Score =   230 bits (587),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +1

Query  118  SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGC  297
            +P   SRYESQKRRDWNTFGQYL+NQ PPV+LS CN NHVL+FLRYLDQFGKTKVHL GC
Sbjct  35   APQPLSRYESQKRRDWNTFGQYLKNQSPPVSLSHCNCNHVLDFLRYLDQFGKTKVHLHGC  94

Query  298  IFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKE  477
            +F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGSPETNPF +GAIRVYLREVKE
Sbjct  95   VFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKE  154

Query  478  CQ  483
            CQ
Sbjct  155  CQ  156



>ref|XP_011085992.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=175

 Score =   229 bits (585),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 120/133 (90%), Gaps = 2/133 (2%)
 Frame = +1

Query  91   LAEGSPGDTSPATP--SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQ  264
            L++ S   +  A+P  SRYESQKRRDWNTFGQYL+NQRPPV+LS CN NHVLEFLRYLDQ
Sbjct  8    LSKDSNSASDQASPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQ  67

Query  265  FGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASG  444
            FGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGSPETNPF +G
Sbjct  68   FGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNG  127

Query  445  AIRVYLREVKECQ  483
            AIRVYLREVK+ Q
Sbjct  128  AIRVYLREVKDSQ  140



>ref|XP_004174117.1| PREDICTED: uncharacterized protein LOC101228453 [Cucumis sativus]
Length=191

 Score =   230 bits (587),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = +1

Query  124  ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIF  303
            A  SRYESQKRRDWNTFGQYL+NQ P V+LSQCN NHVLEFLRYLDQFGKTKVHL GC+F
Sbjct  27   AALSRYESQKRRDWNTFGQYLKNQTPAVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVF  86

Query  304  YGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            +GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGSPETNPF +GAIRVYLREVKECQ
Sbjct  87   FGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKECQ  146



>ref|XP_008358651.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Malus 
domestica]
 ref|XP_009352770.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Pyrus 
x bretschneideri]
Length=190

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 114/122 (93%), Gaps = 0/122 (0%)
 Frame = +1

Query  118  SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGC  297
            +P   SRYESQKRRDWNTFGQYL+NQ PPV+LS CN NHVL+FLRYLDQFGKTKVHL GC
Sbjct  35   APQPLSRYESQKRRDWNTFGQYLKNQSPPVSLSHCNCNHVLDFLRYLDQFGKTKVHLHGC  94

Query  298  IFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKE  477
            +F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGSPETNPF +GAIRVYLREVKE
Sbjct  95   VFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVKE  154

Query  478  CQ  483
            CQ
Sbjct  155  CQ  156



>ref|XP_006467647.1| PREDICTED: uncharacterized protein LOC102611919 [Citrus sinensis]
 gb|KDO77861.1| hypothetical protein CISIN_1g029090mg [Citrus sinensis]
Length=199

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYL+NQRPPV+LSQC+ NHVL+FLRYLDQFGKTKVHL GC+F+GQ
Sbjct  49   SRYESQKRRDWNTFGQYLKNQRPPVSLSQCSCNHVLDFLRYLDQFGKTKVHLHGCVFFGQ  108

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGSPETNPF +GAIRVYLREV+ECQ
Sbjct  109  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQ  165



>ref|XP_011082761.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Sesamum 
indicum]
Length=182

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 114/121 (94%), Gaps = 0/121 (0%)
 Frame = +1

Query  121  PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCI  300
            PA  SRYESQKRRDWNTFGQYLRNQRPPVALSQCN +HVL+F+RYLDQFGKTKVH+QGC+
Sbjct  32   PAQLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNYSHVLDFMRYLDQFGKTKVHIQGCV  91

Query  301  FYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKEC  480
            F+GQPEP  PCTCPL+QAWGSLDALIGRLRAAYEENGG PETNPFA+GAIRVYLREV++ 
Sbjct  92   FFGQPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGVPETNPFANGAIRVYLREVRDS  151

Query  481  Q  483
            Q
Sbjct  152  Q  152



>ref|XP_006478612.1| PREDICTED: probable disease resistance protein At4g27220-like 
isoform X1 [Citrus sinensis]
Length=1622

 Score =   249 bits (637),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 125/144 (87%), Gaps = 5/144 (3%)
 Frame = +1

Query  67    MSFDRGKDLAEGSPGDTS-----PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSN  231
             +S DRGK +AEGS          P TPSRYE QKRRDWNTFGQYL+NQRPPV LSQC+S+
Sbjct  1455  LSDDRGKKIAEGSSDHHQQQQQHPMTPSRYELQKRRDWNTFGQYLKNQRPPVPLSQCSSS  1514

Query  232   HVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENG  411
             HVLEFLRYLD FGK KVHLQGC+FYGQP PPAPCTCPL+QAWGSLDALIGRLRAAYEENG
Sbjct  1515  HVLEFLRYLDPFGKIKVHLQGCMFYGQPNPPAPCTCPLRQAWGSLDALIGRLRAAYEENG  1574

Query  412   GSPETNPFASGAIRVYLREVKECQ  483
             GSPETNPFASG IRVYLREV+ECQ
Sbjct  1575  GSPETNPFASGEIRVYLREVRECQ  1598



>ref|XP_006449503.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 ref|XP_006449504.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 gb|ESR62743.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
 gb|ESR62744.1| hypothetical protein CICLE_v10016772mg [Citrus clementina]
Length=199

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYL+NQRPPV+LSQC+ NHVL+FLRYLDQFGKTKVHL GC+F+GQ
Sbjct  49   SRYESQKRRDWNTFGQYLKNQRPPVSLSQCSCNHVLDFLRYLDQFGKTKVHLHGCVFFGQ  108

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGSPETNPF +GAIRVYLREV+ECQ
Sbjct  109  PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVRECQ  165



>ref|XP_007133232.1| hypothetical protein PHAVU_011G162700g [Phaseolus vulgaris]
 gb|AGV54196.1| 177 protein [Phaseolus vulgaris]
 gb|ESW05226.1| hypothetical protein PHAVU_011G162700g [Phaseolus vulgaris]
Length=187

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSN VL+FLRYLDQFGKTKVH QGC+F+GQ
Sbjct  40   SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNQVLDFLRYLDQFGKTKVHAQGCLFFGQ  99

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             EPP PCTCPLKQAWGSLDALIGRLRAAYEENGG PETNPFASGAIRVYLREV++ Q
Sbjct  100  VEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLREVRDSQ  156



>gb|KHG29970.1| Putative beta-lactamase-like 1 [Gossypium arboreum]
Length=161

 Score =   227 bits (578),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 119/141 (84%), Gaps = 7/141 (5%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTS-------PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            MS    KD AEGS   +        PA  SRYESQKRRDWNTFGQYL+NQRPPV LSQCN
Sbjct  1    MSDGVAKDSAEGSSRSSGNHQQQPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCN  60

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
             NHVL+FLRYLDQFGKTKVHL GC+F+GQP+PPAPCTCPL+QAWGSLDALIGRLRAAYEE
Sbjct  61   CNHVLDFLRYLDQFGKTKVHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEE  120

Query  406  NGGSPETNPFASGAIRVYLRE  468
            +GGSPETNPF +GAIRVYLRE
Sbjct  121  HGGSPETNPFGNGAIRVYLRE  141



>gb|KHN36883.1| hypothetical protein glysoja_001614 [Glycine soja]
Length=193

 Score =   228 bits (580),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYLRNQRPPVALSQC+SNHVLEFLRYLDQFGKTKVH QGC+F+GQ
Sbjct  45   SRYESQKRRDWNTFGQYLRNQRPPVALSQCSSNHVLEFLRYLDQFGKTKVHSQGCLFFGQ  104

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             EPP PCTCPL+QAWGSLDALIGRLRAAYEENGG PETNPFASG IRVYLREV++ Q
Sbjct  105  TEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGTIRVYLREVRDSQ  161



>ref|XP_004248241.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=213

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +1

Query  103  SPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKV  282
            +P  +S    SRYESQKRRDWNTFGQYL+NQRPP++L QCN NHVL+FLRYLDQFGKTKV
Sbjct  46   TPASSSAPQLSRYESQKRRDWNTFGQYLKNQRPPISLPQCNYNHVLDFLRYLDQFGKTKV  105

Query  283  HLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYL  462
            HL GC+F+GQPEPP PCTCPL+QAWGSLDALIGRLRAAYEENGG  ETNPFASGAIRVYL
Sbjct  106  HLHGCLFFGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFASGAIRVYL  165

Query  463  REVKECQ  483
            REV++ Q
Sbjct  166  REVRDSQ  172



>ref|XP_006360044.1| PREDICTED: uncharacterized protein LOC102584680 [Solanum tuberosum]
Length=207

 Score =   226 bits (576),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 2/125 (2%)
 Frame = +1

Query  115  TSPATP--SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHL  288
            T  +TP  SRYESQKRRDWNTFGQYL+NQRPPV+L QCN NHVL+FLRYLDQFGKTKVHL
Sbjct  42   TPASTPQLSRYESQKRRDWNTFGQYLKNQRPPVSLPQCNYNHVLDFLRYLDQFGKTKVHL  101

Query  289  QGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLRE  468
             GC+F+GQPEPP PCTCPL+QAWGSLDALIGRLRAAYEENGG  ETNPFASGAIRVYLRE
Sbjct  102  HGCLFFGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFASGAIRVYLRE  161

Query  469  VKECQ  483
            V++ Q
Sbjct  162  VRDSQ  166



>gb|AFK41155.1| unknown [Lotus japonicus]
Length=185

 Score =   224 bits (572),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQK+RDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVH QGC+F+GQ
Sbjct  37   SRYESQKKRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHSQGCLFFGQ  96

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             EPP PCTCPLKQAWGSLDALIGRLRAAYEENGG PETNPFASG+IRV+L EV++ Q
Sbjct  97   TEPPGPCTCPLKQAWGSLDALIGRLRAAYEENGGLPETNPFASGSIRVHLHEVRDFQ  153



>ref|XP_009622401.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=198

 Score =   225 bits (573),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYL+NQRPPV LS CN NHVL+FL+YLDQFGKTKVHL GC+F+GQ
Sbjct  46   SRYESQKRRDWNTFGQYLKNQRPPVPLSNCNYNHVLDFLKYLDQFGKTKVHLHGCLFFGQ  105

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            PEPP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE+NPFASGAIRVYLREV++ Q
Sbjct  106  PEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPESNPFASGAIRVYLREVRDSQ  162



>ref|XP_004146094.1| PREDICTED: uncharacterized protein LOC101204141 [Cucumis sativus]
Length=204

 Score =   225 bits (574),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = +1

Query  73   FDRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLR  252
            F+RG + A  +         SRYESQKRRDW TFGQYLRNQRPP+A+SQCNS+HVLEFLR
Sbjct  40   FERGDEQAAPTSSVVGAPVISRYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLR  99

Query  253  YLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNP  432
            YLDQFGKTKVHL GC F+G+PEP  PCTCPL+QAWGSLDALIGRLRAAYEENGGS +TNP
Sbjct  100  YLDQFGKTKVHLNGCGFFGEPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNP  159

Query  433  FASGAIRVYLREVKECQ  483
            FASGAIRVYLREV++ Q
Sbjct  160  FASGAIRVYLREVRDSQ  176



>gb|KGN55073.1| hypothetical protein Csa_4G627230 [Cucumis sativus]
Length=201

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = +1

Query  73   FDRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLR  252
            F+RG + A  +         SRYESQKRRDW TFGQYLRNQRPP+A+SQCNS+HVLEFLR
Sbjct  40   FERGDEQAAPTSSVVGAPVISRYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLR  99

Query  253  YLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNP  432
            YLDQFGKTKVHL GC F+G+PEP  PCTCPL+QAWGSLDALIGRLRAAYEENGGS +TNP
Sbjct  100  YLDQFGKTKVHLNGCGFFGEPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNP  159

Query  433  FASGAIRVYLREVKECQ  483
            FASGAIRVYLREV++ Q
Sbjct  160  FASGAIRVYLREVRDSQ  176



>ref|XP_004171006.1| PREDICTED: uncharacterized LOC101204141, partial [Cucumis sativus]
Length=200

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = +1

Query  73   FDRGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLR  252
            F+RG + A  +         SRYESQKRRDW TFGQYLRNQRPP+A+SQCNS+HVLEFLR
Sbjct  41   FERGDEQAAPTSSVVGAPVISRYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLR  100

Query  253  YLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNP  432
            YLDQFGKTKVHL GC F+G+PEP  PCTCPL+QAWGSLDALIGRLRAAYEENGGS +TNP
Sbjct  101  YLDQFGKTKVHLNGCGFFGEPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNP  160

Query  433  FASGAIRVYLREVKECQ  483
            FASGAIRVYLREV++ Q
Sbjct  161  FASGAIRVYLREVRDSQ  177



>ref|XP_006358940.1| PREDICTED: uncharacterized protein LOC102602985 [Solanum tuberosum]
Length=205

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +1

Query  106  PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVH  285
            P    P   SRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHVLEFLRYLDQFGKTKVH
Sbjct  41   PSVPVPPQLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLRYLDQFGKTKVH  100

Query  286  LQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLR  465
            L GC F+GQPEPP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE NPFASG+IRVYLR
Sbjct  101  LHGCPFFGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRVYLR  160

Query  466  EVKECQ  483
            EV++ Q
Sbjct  161  EVRDFQ  166



>ref|XP_010314085.1| PREDICTED: LOW QUALITY PROTEIN: protein LIGHT-DEPENDENT SHORT 
HYPOCOTYLS 10, partial [Solanum lycopersicum]
Length=171

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHVLEFLRYLDQFGKTKVHL GC F+GQ
Sbjct  16   SRYESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCPFFGQ  75

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            PEPP PCTCPL+QAWGSLDALIGRLRAAYEENGG PE NPFASGAIRVYLREV++ Q
Sbjct  76   PEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGAIRVYLREVRDFQ  132



>emb|CDP06011.1| unnamed protein product [Coffea canephora]
Length=200

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYLRNQRPPV LSQCN NHVL+FLRYLDQFGKTKVHLQGC+F+G 
Sbjct  51   SRYESQKRRDWNTFGQYLRNQRPPVPLSQCNFNHVLDFLRYLDQFGKTKVHLQGCVFFGH  110

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            PEP  PCTCPL+QAWGSLDALIGRLRAAYEENGG P+ NPFASGAIRVYLREV++ Q
Sbjct  111  PEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPDKNPFASGAIRVYLREVRDSQ  167



>ref|XP_008463732.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Cucumis 
melo]
Length=199

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 115/127 (91%), Gaps = 2/127 (2%)
 Frame = +1

Query  109  GDTSPATP--SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKV  282
            GD +  TP  SRYESQKRRDW TFGQYLRNQRPP+A+SQCNS+HVLEFLRYLDQFGKTKV
Sbjct  48   GDEAAPTPVISRYESQKRRDWYTFGQYLRNQRPPLAISQCNSSHVLEFLRYLDQFGKTKV  107

Query  283  HLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYL  462
            HL GC F+G+PEP  PCTCPL+QAWGSLDALIGRLRAAYEENGGS +TNPFASGAIRVYL
Sbjct  108  HLNGCGFFGEPEPAGPCTCPLRQAWGSLDALIGRLRAAYEENGGSSDTNPFASGAIRVYL  167

Query  463  REVKECQ  483
            REV++ Q
Sbjct  168  REVRDSQ  174



>ref|XP_010531928.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Tarenaya 
hassleriana]
Length=183

 Score =   222 bits (566),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 117/135 (87%), Gaps = 4/135 (3%)
 Frame = +1

Query  79   RGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYL  258
            RGK++AEGS    SP   SRYESQKRRDWNTF QYLRNQRPPV +SQCN+N++L+FLRYL
Sbjct  9    RGKEVAEGS----SPQPLSRYESQKRRDWNTFCQYLRNQRPPVHISQCNTNNILDFLRYL  64

Query  259  DQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFA  438
            DQFGKTKVHLQGC+F+GQP+P   C CPL+QAWGSLDALIGRLRAAYEENGG PE NPFA
Sbjct  65   DQFGKTKVHLQGCVFFGQPDPSGQCNCPLRQAWGSLDALIGRLRAAYEENGGLPERNPFA  124

Query  439  SGAIRVYLREVKECQ  483
             G IRVYLREV++ Q
Sbjct  125  GGGIRVYLREVRDSQ  139



>ref|XP_004293946.1| PREDICTED: uncharacterized protein LOC101295692 isoform 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004293947.1| PREDICTED: uncharacterized protein LOC101295692 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=187

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYL+NQ PPV +S C  NHVL+FLRYLDQFGKTKVHL  C+F+GQ
Sbjct  37   SRYESQKRRDWNTFGQYLKNQTPPVPMSHCQFNHVLDFLRYLDQFGKTKVHLHCCVFFGQ  96

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P+PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GG+PETNPF +GAIRVYLREVKECQ
Sbjct  97   PDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGAPETNPFGNGAIRVYLREVKECQ  153



>ref|XP_009770169.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=206

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +1

Query  136  RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQP  315
            RYESQKRRDWNTFGQYL+NQRPPV LS CN NHVL+FLRYLDQFGKTKVHL GC+F+GQP
Sbjct  49   RYESQKRRDWNTFGQYLKNQRPPVPLSNCNYNHVLDFLRYLDQFGKTKVHLHGCLFFGQP  108

Query  316  EPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            +PP PCTCPL+QAWGSLDALIGRLRAAYEENGG P +NPFASGAIRVYLRE+++ Q
Sbjct  109  DPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPVSNPFASGAIRVYLREIRDSQ  164



>ref|XP_003539992.1| PREDICTED: uncharacterized protein LOC100806134 [Glycine max]
Length=177

 Score =   217 bits (553),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +1

Query  118  SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGC  297
            SP T SRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHVL+FLRYLDQFGKTKVHLQGC
Sbjct  26   SPVTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGC  85

Query  298  IFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKE  477
            +FYGQPEPPAPC CPL+QAWGSLDALIGRLRAAYEENGGSPETNPFASG+IRVYLREV+E
Sbjct  86   MFYGQPEPPAPCACPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRE  145

Query  478  CQ  483
            CQ
Sbjct  146  CQ  147



>gb|EYU41125.1| hypothetical protein MIMGU_mgv1a021620mg [Erythranthe guttata]
Length=170

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = +1

Query  73   FDRGKDLA-EGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFL  249
             DRGK  + EGS   ++ AT SRYESQKRRDWNTFGQ+LRNQRP V L  CNS+HVL+FL
Sbjct  1    MDRGKHHSSEGSSPPSAAATLSRYESQKRRDWNTFGQFLRNQRPSVGLPHCNSSHVLDFL  60

Query  250  RYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETN  429
            RYLDQFGKTKVHLQGC+FYGQPEPPAPC CPLKQAWGSLDALIGRLRAAYEENGGSPE+N
Sbjct  61   RYLDQFGKTKVHLQGCVFYGQPEPPAPCACPLKQAWGSLDALIGRLRAAYEENGGSPESN  120

Query  430  PFASGAIRVYLREVKECQ  483
            PFASGAIR+YLREVKECQ
Sbjct  121  PFASGAIRIYLREVKECQ  138



>ref|XP_009784769.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=196

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  121  PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCI  300
            P   SRYESQKRRDWNTFG YL+N RPP+ LSQCN NHVLEFLRYLDQFGKTKVHL GC 
Sbjct  40   PPQLSRYESQKRRDWNTFGHYLKNLRPPIPLSQCNYNHVLEFLRYLDQFGKTKVHLHGCP  99

Query  301  FYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKEC  480
            F+GQPEPP PC CPL+QAWGSLDALIGRLRAAYEENGG PE NPFASG+IR+YLREV++ 
Sbjct  100  FFGQPEPPGPCACPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRIYLREVRDF  159

Query  481  Q  483
            Q
Sbjct  160  Q  160



>gb|EYU45022.1| hypothetical protein MIMGU_mgv1a014215mg [Erythranthe guttata]
Length=197

 Score =   215 bits (548),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYLRNQRPPV L QCN +HVLEF+RYLDQFGKTKVH QGC F+GQ
Sbjct  41   SRYESQKRRDWNTFGQYLRNQRPPVGLPQCNYSHVLEFMRYLDQFGKTKVHGQGCPFFGQ  100

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            PEP  PC CPL+QAWGSLDAL+GRLRAAYEENGGS ETNPFA+GAIRVYLREV++ Q
Sbjct  101  PEPAGPCACPLRQAWGSLDALVGRLRAAYEENGGSQETNPFANGAIRVYLREVRDSQ  157



>gb|KHN45745.1| hypothetical protein glysoja_043995 [Glycine soja]
Length=178

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +1

Query  118  SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGC  297
            SP T SRYESQKRRDWNTFGQYL+NQRPPV LSQCN NHVL+FLRYLDQFGKTKVHLQGC
Sbjct  26   SPVTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGC  85

Query  298  IFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKE  477
            +FYGQPEPPAPC CPL+QAWGSLDALIGRLRAAYEENGGSPETNPFASG+IRVYLREV+E
Sbjct  86   MFYGQPEPPAPCACPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREVRE  145

Query  478  CQ  483
            CQ
Sbjct  146  CQ  147



>ref|XP_009383380.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=200

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 117/142 (82%), Gaps = 6/142 (4%)
 Frame = +1

Query  70   SFDRGKDLAEGSPGDTSP----ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHV  237
            + D G   A GS  DT P    A PSRYESQKRRDWNTF QYLRN +PP+ L++C+  HV
Sbjct  3    AVDAGPSRAGGS--DTGPPAGAAAPSRYESQKRRDWNTFLQYLRNHKPPLVLTRCSGAHV  60

Query  238  LEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGS  417
            +EFLRYLDQFGKTKVHL GC FYG P PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGS
Sbjct  61   IEFLRYLDQFGKTKVHLSGCAFYGHPSPPAPCTCPLRQAWGSLDALIGRLRAAYEESGGS  120

Query  418  PETNPFASGAIRVYLREVKECQ  483
            PETNPFA+ A+R++LR+V++ Q
Sbjct  121  PETNPFAARAVRIFLRDVRDSQ  142



>gb|EYU43335.1| hypothetical protein MIMGU_mgv1a022623mg, partial [Erythranthe 
guttata]
Length=169

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = +1

Query  85   KDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQ  264
            K+  EGS  +  P+  SRYESQKRRDWNTF QYL+NQ PP++L  C+ NHVLEFLRYLDQ
Sbjct  10   KNPTEGSSSNGRPSL-SRYESQKRRDWNTFLQYLKNQNPPLSLPNCSYNHVLEFLRYLDQ  68

Query  265  FGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASG  444
            FGKTKVHL GC F+GQP+PP  CTCPL+QAWGSLDALIGRLRAAYEE+GG PE NPF +G
Sbjct  69   FGKTKVHLHGCPFFGQPDPPGQCTCPLRQAWGSLDALIGRLRAAYEEHGGPPEGNPFGNG  128

Query  445  AIRVYLREVKECQ  483
            AIRVYLREVKECQ
Sbjct  129  AIRVYLREVKECQ  141



>ref|XP_009411199.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=221

 Score =   212 bits (539),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 113/138 (82%), Gaps = 4/138 (3%)
 Frame = +1

Query  82   GKDLAEGSPGDTSP----ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFL  249
            G+  + G  GD  P     TPSRYESQKRRDWNTF QYLRN +PP+AL++C+  HV+EFL
Sbjct  26   GERSSSGGLGDAGPPRAATTPSRYESQKRRDWNTFLQYLRNHKPPLALARCSGAHVIEFL  85

Query  250  RYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETN  429
            RYLDQFGKTKVH  GC FYG P PP PC CPL+QAWGSLDALIGRLRAAYEE+GG+PETN
Sbjct  86   RYLDQFGKTKVHAPGCAFYGHPSPPGPCACPLRQAWGSLDALIGRLRAAYEESGGTPETN  145

Query  430  PFASGAIRVYLREVKECQ  483
            PFA+ A+R+YLR+V+E Q
Sbjct  146  PFAARAVRIYLRDVRESQ  163



>ref|XP_011098405.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=173

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = +1

Query  151  KRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAP  330
            KRRDWNTFGQYLRNQRPPV L QCN +HVL+FLRYLDQFGKTKVH+QGC+F+GQPEP  P
Sbjct  24   KRRDWNTFGQYLRNQRPPVGLPQCNYSHVLDFLRYLDQFGKTKVHVQGCVFFGQPEPAGP  83

Query  331  CTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            C+CPL+QAWGSLDALIGRLRAAYEENGG+ ETNPFA+GAIRVYLREV+E Q
Sbjct  84   CSCPLRQAWGSLDALIGRLRAAYEENGGAAETNPFANGAIRVYLREVRESQ  134



>ref|XP_009587002.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=180

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 112/142 (79%), Gaps = 4/142 (3%)
 Frame = +1

Query  70   SFDRGKDLAEGSPGDTS----PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHV  237
            S  R +++ EG+    +    P   SRY SQKRRDWNTFGQYL+N +PPV LS CN NHV
Sbjct  3    SEQRLREVGEGTTSTIANHHQPPQLSRYVSQKRRDWNTFGQYLKNHKPPVPLSNCNYNHV  62

Query  238  LEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGS  417
            L FLRYLDQFGKTKVHL GCIF+G+ E   PCTCPL+QAWGSLDALIGRLRAAYEENGG 
Sbjct  63   LHFLRYLDQFGKTKVHLHGCIFFGESEQTEPCTCPLRQAWGSLDALIGRLRAAYEENGGL  122

Query  418  PETNPFASGAIRVYLREVKECQ  483
             ETNPFA+ AIR+YLREV++ Q
Sbjct  123  QETNPFANSAIRIYLREVRDSQ  144



>ref|XP_006303356.1| hypothetical protein CARUB_v10010340mg [Capsella rubella]
 gb|EOA36254.1| hypothetical protein CARUB_v10010340mg [Capsella rubella]
Length=198

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +1

Query  79   RGKDLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYL  258
            RG D A  S   + PATPSRYESQKRRDWNTF QYL+N +PP+ALS+C+  HV+EFL+YL
Sbjct  15   RGDDPAGPSFVSSPPATPSRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYL  74

Query  259  DQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFA  438
            DQFGKTKVH+  C ++G  +PP+PC+CPLKQAWGSLDALIGRLRAAYEENGG P++NPFA
Sbjct  75   DQFGKTKVHVAACPYFGHQQPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFA  134

Query  439  SGAIRVYLREVKECQ  483
            + A+R+YLREV+E Q
Sbjct  135  ARAVRIYLREVRESQ  149



>ref|XP_010324393.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like isoform 
X1 [Solanum lycopersicum]
Length=199

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  121  PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCI  300
            P   SRYESQKRRDWNTFGQYL+N +PPV L QCN NHVL+FLRYLDQFGKTKVHL GC+
Sbjct  36   PPQLSRYESQKRRDWNTFGQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKTKVHLNGCV  95

Query  301  FYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKEC  480
            F+GQ E   PCTCPL+QAWGSLDALIGRLRAAYEENGG  ETNPFA+ AIR+YLREV++ 
Sbjct  96   FFGQVEQVGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREVRDS  155

Query  481  Q  483
            Q
Sbjct  156  Q  156



>emb|CDX85083.1| BnaC07g08230D [Brassica napus]
Length=199

 Score =   209 bits (532),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYE+QKRRDWNTFGQYLRN RPP++LS+C+  HVLEFLRYLDQFGKTKVH+Q C F+G 
Sbjct  47   SRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHMQICPFFGH  106

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P PPAPCTCPL+QAWGSLDALIGRLRAA+EENGGSPETNPF + A+R+YLREV++ Q
Sbjct  107  PNPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQ  163



>ref|XP_009102637.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Brassica 
rapa]
 emb|CDX77531.1| BnaA07g06690D [Brassica napus]
Length=199

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYE+QKRRDWNTFGQYLRN RPP++LS+C+  HVLEFLRYLDQFGKTKVH+Q C F+G 
Sbjct  47   SRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHMQICPFFGH  106

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P PPAPCTCPL+QAWGSLDALIGRLRAA+EENGGSPETNPF + A+R+YLREV++ Q
Sbjct  107  PNPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQ  163



>ref|XP_010540518.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Tarenaya 
hassleriana]
Length=179

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYL+NQRPPV+ +Q + NHV++FL+YLDQFGKTKVH  GC+F+GQ
Sbjct  15   SRYESQKRRDWNTFGQYLKNQRPPVSFAQLSFNHVIDFLKYLDQFGKTKVHHHGCVFFGQ  74

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P+PP PCTCPLKQAWGSLDALIGRLRAA+EE+GGS + NPF +GAIRVYLREV++ Q
Sbjct  75   PDPPGPCTCPLKQAWGSLDALIGRLRAAFEEHGGSSDQNPFGNGAIRVYLREVRDSQ  131



>gb|EPS59921.1| hypothetical protein M569_14884, partial [Genlisea aurea]
Length=143

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYL+NQRPPV L  CN +HVL+F+RYLDQFGKTKVHL+GC+F+GQ
Sbjct  12   SRYESQKRRDWNTFRQYLKNQRPPVPLEHCNYSHVLDFMRYLDQFGKTKVHLRGCVFFGQ  71

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P+P   CTCPL+QAWGSLDAL+GRLRAAYE NGGS ETNPFA GAIRVYLREV++ Q
Sbjct  72   PDPDGACTCPLRQAWGSLDALVGRLRAAYEGNGGSQETNPFADGAIRVYLREVRDLQ  128



>ref|XP_008802142.1| PREDICTED: LOW QUALITY PROTEIN: protein G1-like4 [Phoenix dactylifera]
Length=189

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +1

Query  127  TPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFY  306
            +PSRYESQKRRDWNTFGQYL+N RPP+ LS+C+  HVLEFLRYLDQFGKTKVH Q C F+
Sbjct  40   SPSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFF  99

Query  307  GQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            G P PPAPC+CPL+QAWGSLDALIGRLRAAYEENGG PE+NPF + A+R+YLREV+E Q
Sbjct  100  GHPNPPAPCSCPLRQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRLYLREVRELQ  158



>gb|KFK42237.1| hypothetical protein AALP_AA2G229400 [Arabis alpina]
Length=200

 Score =   208 bits (529),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYLRNQ+PPV +SQC SNH+L+FL+YLDQFGKTKVH+ GC+F+GQ
Sbjct  43   SRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQ  102

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             EPP  C CPLKQAWGSLDALIGRLRAAYEENGG PE NPFA G IRV+LREV++ Q
Sbjct  103  VEPPGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQ  159



>ref|XP_009385358.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=210

 Score =   208 bits (529),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 111/140 (79%), Gaps = 6/140 (4%)
 Frame = +1

Query  82   GKDLAEGSPGDTSP------ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLE  243
            G+  + G  G   P      A PSRYESQKRRDWNTF QYLRN +PP+AL++C+  HV+E
Sbjct  13   GEGPSSGGAGKAGPQRGAAAAAPSRYESQKRRDWNTFLQYLRNHKPPLALARCSGAHVIE  72

Query  244  FLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPE  423
            FLRYLDQFGKTKVH  GC FYG   PP PC CPL+QAWGSLDALIGRLRAAYEE+GG+PE
Sbjct  73   FLRYLDQFGKTKVHAPGCAFYGHASPPGPCACPLRQAWGSLDALIGRLRAAYEESGGTPE  132

Query  424  TNPFASGAIRVYLREVKECQ  483
            TNPFA+ A+R+YLR+V+E Q
Sbjct  133  TNPFAARAVRIYLRDVRESQ  152



>emb|CDY69731.1| BnaCnng65050D [Brassica napus]
Length=195

 Score =   207 bits (528),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYE+QKRRDWNTFGQYLRN RPP++LS+C+  HVLEFLRYLDQFGKTKVH Q C F+G 
Sbjct  46   SRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGH  105

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P PPAPCTCPL+QAWGSLDALIGRLRAA+EENGGSPETNPF + A+R+YLREV++ Q
Sbjct  106  PNPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQ  162



>ref|XP_009774704.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=190

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  118  SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGC  297
            SP   SRYESQKRRDW TFGQYL+N +PPV LS CN NHVL+FLRYLDQFGKTKVHL GC
Sbjct  33   SPPQLSRYESQKRRDWTTFGQYLKNHKPPVPLSNCNYNHVLDFLRYLDQFGKTKVHLHGC  92

Query  298  IFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKE  477
            +F+G+ E   PCTCPL+QAWGSLDALIGRLRAAYEENGG  ETNPFA+ AIR+YLREV++
Sbjct  93   VFFGESEQGGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREVRD  152

Query  478  CQ  483
             Q
Sbjct  153  SQ  154



>ref|XP_006348309.1| PREDICTED: uncharacterized protein LOC102581082 [Solanum tuberosum]
Length=191

 Score =   207 bits (527),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +1

Query  121  PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCI  300
            P   SRYESQKRRDWNTFGQYL+N +PPV L QCN NHVL+FLRYLDQFGKTKVHL GC+
Sbjct  41   PPQLSRYESQKRRDWNTFGQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKTKVHLNGCV  100

Query  301  FYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKEC  480
            F+GQ E   PCTCPLKQAWGSLDALIGRLRAAYEENGG  ETNPFA+ AIR++LREV++ 
Sbjct  101  FFGQVEQVGPCTCPLKQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIHLREVRDS  160

Query  481  Q  483
            Q
Sbjct  161  Q  161



>ref|XP_010549405.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=190

 Score =   207 bits (526),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQK RDWNTFGQYL NQRPPV+++Q N NHV+ FL+YLDQFGKTKVH  GC F+GQ
Sbjct  25   SRYESQKLRDWNTFGQYLNNQRPPVSVTQFNFNHVINFLKYLDQFGKTKVHHHGCAFFGQ  84

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P+PP PCTCPLKQAWGSLDALIGRLRAAYEE+GGSP  NPF +GAIRVYLREV++ Q
Sbjct  85   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGSPGLNPFGNGAIRVYLREVRDSQ  141



>ref|XP_002313971.1| hypothetical protein POPTR_0009s07990g [Populus trichocarpa]
 gb|EEE87926.1| hypothetical protein POPTR_0009s07990g [Populus trichocarpa]
Length=223

 Score =   208 bits (529),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  109  GDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHL  288
            G + PA PSRYESQKRRDWNTF QYL+N +PP+ L++C+  HV+EFL+YLDQFGKTKVH+
Sbjct  39   GSSPPAPPSRYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHI  98

Query  289  QGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLRE  468
             GC ++G P PPAPC+CPLKQAWGSLDALIGRLRAAYEENGG PE+NPF + A+R+YLRE
Sbjct  99   TGCPYFGHPNPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLRE  158

Query  469  VKECQ  483
            V+E Q
Sbjct  159  VREGQ  163



>ref|XP_010457872.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Camelina 
sativa]
Length=196

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 117/146 (80%), Gaps = 8/146 (5%)
 Frame = +1

Query  70   SFDRGKDLAEGSPGD--------TSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            S D G   ++   GD        + PATPSRYESQKRRDWNTF QYL+N +PP+ALS+C+
Sbjct  3    SVDSGSHRSDPVKGDDPGPSFVSSPPATPSRYESQKRRDWNTFLQYLKNHKPPLALSRCS  62

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
              HV+EFL+YLDQFGKTKVH+  C ++G  +PP+PC+CPLKQAWGSLDALIGRLRAAYEE
Sbjct  63   GAHVIEFLKYLDQFGKTKVHVAACPYFGHQQPPSPCSCPLKQAWGSLDALIGRLRAAYEE  122

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGG P++NPFA+ A+R+YLREV+E Q
Sbjct  123  NGGRPDSNPFAARAVRIYLREVRETQ  148



>ref|XP_010475462.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Camelina 
sativa]
Length=196

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 117/146 (80%), Gaps = 8/146 (5%)
 Frame = +1

Query  70   SFDRGKDLAEGSPGD--------TSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            S D G   ++   GD        + PATPSRYESQKRRDWNTF QYL+N +PP+ALS+C+
Sbjct  3    SVDSGSHRSDPVKGDDPGPSFVSSPPATPSRYESQKRRDWNTFLQYLKNHKPPLALSRCS  62

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
              HV+EFL+YLDQFGKTKVH+  C ++G  +PP+PC+CPLKQAWGSLDALIGRLRAAYEE
Sbjct  63   GAHVIEFLKYLDQFGKTKVHVAACPYFGHQQPPSPCSCPLKQAWGSLDALIGRLRAAYEE  122

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGG P++NPFA+ A+R+YLREV+E Q
Sbjct  123  NGGRPDSNPFAARAVRIYLREVRESQ  148



>ref|XP_010487116.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6 [Camelina 
sativa]
Length=196

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 117/146 (80%), Gaps = 8/146 (5%)
 Frame = +1

Query  70   SFDRGKDLAEGSPGD--------TSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            S D G   ++   GD        + PATPSRYESQKRRDWNTF QYL+N +PP+ALS+C+
Sbjct  3    SVDSGSHRSDPVKGDDPGPSFVSSPPATPSRYESQKRRDWNTFLQYLKNHKPPLALSRCS  62

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
              HV+EFL+YLDQFGKTKVH+  C ++G  +PP+PC+CPLKQAWGSLDALIGRLRAAYEE
Sbjct  63   GAHVIEFLKYLDQFGKTKVHVAACPYFGHQQPPSPCSCPLKQAWGSLDALIGRLRAAYEE  122

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGG P++NPFA+ A+R+YLREV+E Q
Sbjct  123  NGGRPDSNPFAARAVRIYLREVRESQ  148



>ref|XP_002892379.1| hypothetical protein ARALYDRAFT_887918 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68638.1| hypothetical protein ARALYDRAFT_887918 [Arabidopsis lyrata subsp. 
lyrata]
Length=198

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = +1

Query  121  PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCI  300
            PATPSRYESQKRRDWNTF QYL+N +PP+ALS+C+  HV+EFL+YLDQFGKTKVH+  C 
Sbjct  28   PATPSRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAACP  87

Query  301  FYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKEC  480
            ++G  +PP+PC+CPLKQAWGSLDALIGRLRAAYEENGG P++NPFA+ A+R+YLREV+E 
Sbjct  88   YFGHQQPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFATRAVRIYLREVRES  147

Query  481  Q  483
            Q
Sbjct  148  Q  148



>ref|XP_011003514.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 [Populus 
euphratica]
Length=220

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  109  GDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHL  288
            G + PA PSRYESQKRRDWNTF QYL+N +PP+ L++C+  HV+EFL+YLDQFGKTKVH+
Sbjct  37   GSSPPAPPSRYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHI  96

Query  289  QGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLRE  468
             GC ++G P PPAPC+CPLKQAWGSLDALIGRLRAAYEENGG PE+NPF + A+R+YLRE
Sbjct  97   TGCPYFGHPNPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLRE  156

Query  469  VKECQ  483
            V+E Q
Sbjct  157  VREGQ  161



>gb|EYU28084.1| hypothetical protein MIMGU_mgv1a022457mg [Erythranthe guttata]
Length=176

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 123/140 (88%), Gaps = 3/140 (2%)
 Frame = +1

Query  67   MSFDRGKDLAEGSPGDTSPATP-SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLE  243
            MS +   D  +GS  +  PA P SRYESQKRRDWNTFGQYL+NQRPPV+L QCN NHVLE
Sbjct  1    MSKESAAD--QGSGSNHPPAPPLSRYESQKRRDWNTFGQYLKNQRPPVSLPQCNCNHVLE  58

Query  244  FLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPE  423
            FLRYLDQFGKTKVH+ GC+F+GQP PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GGSPE
Sbjct  59   FLRYLDQFGKTKVHVHGCVFFGQPAPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPE  118

Query  424  TNPFASGAIRVYLREVKECQ  483
            TNPF +G+IRVYLREVK+CQ
Sbjct  119  TNPFGNGSIRVYLREVKDCQ  138



>ref|NP_563780.1| protein LIGHT SENSITIVE HYPOCOTYLS 6 [Arabidopsis thaliana]
 sp|Q9LMK2.1|LSH6_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6; AltName: 
Full=Protein ORGAN BOUNDARY 6 [Arabidopsis thaliana]
 gb|AAF82211.1|AC067971_19 Strong similarity to an unknown protein At2g31160 gi|3746060 
from Arabidopsis thaliana BAC F7F1 gb|AC005311. EST gb|AI998165 
comes from this gene [Arabidopsis thaliana]
 gb|AAM63916.1| unknown [Arabidopsis thaliana]
 gb|AAO41893.1| unknown protein [Arabidopsis thaliana]
 gb|AAV84524.1| At1g07090 [Arabidopsis thaliana]
 gb|ABD42982.1| At1g07090 [Arabidopsis thaliana]
 gb|AEE28076.1| uncharacterized protein AT1G07090 [Arabidopsis thaliana]
Length=196

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  115  TSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQG  294
            + PATPSRYESQKRRDWNTF QYL+N +PP+ALS+C+  HV+EFL+YLDQFGKTKVH+  
Sbjct  24   SPPATPSRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAA  83

Query  295  CIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVK  474
            C ++G  +PP+PC+CPLKQAWGSLDALIGRLRAAYEENGG P++NPFA+ A+R+YLREV+
Sbjct  84   CPYFGHQQPPSPCSCPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVR  143

Query  475  ECQ  483
            E Q
Sbjct  144  ESQ  146



>ref|XP_009419635.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Musa 
acuminata subsp. malaccensis]
Length=213

 Score =   206 bits (524),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = +1

Query  130  PSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYG  309
            PSRYESQKRRDWN+FGQYLRN RPP+ LS+C+  HVLEFLRYLDQFGKTKVH  GC F+G
Sbjct  21   PSRYESQKRRDWNSFGQYLRNHRPPLELSRCSGAHVLEFLRYLDQFGKTKVHTAGCPFFG  80

Query  310  QPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             P+PPAPCTCPL+QAWGSLD+L+GRLRAA+EE+GG PE NPFA+ A+R+YLREV++ Q
Sbjct  81   HPQPPAPCTCPLRQAWGSLDSLVGRLRAAFEEDGGQPEVNPFAARAVRLYLREVRDSQ  138



>ref|XP_004244278.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like isoform 
X2 [Solanum lycopersicum]
Length=168

 Score =   204 bits (520),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = +1

Query  121  PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCI  300
            P   SRYESQKRRDWNTFGQYL+N +PPV L QCN NHVL+FLRYLDQFGKTKVHL GC+
Sbjct  36   PPQLSRYESQKRRDWNTFGQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKTKVHLNGCV  95

Query  301  FYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVK  474
            F+GQ E   PCTCPL+QAWGSLDALIGRLRAAYEENGG  ETNPFA+ AIR+YLRE +
Sbjct  96   FFGQVEQVGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRIYLREAR  153



>emb|CDP09236.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  109  GDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHL  288
            G ++ A PSRYESQKRRDWNTF QYLRN +PP+ L++C+  HV+EFL+YLDQFGKTKVH+
Sbjct  31   GGSTAAPPSRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHV  90

Query  289  QGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLRE  468
             GC ++G P PPAPC CPLKQAWGSLDALIGRLRAAYEENGG PE+NPF + A+R+YLRE
Sbjct  91   AGCPYFGHPNPPAPCQCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLRE  150

Query  469  VKECQ  483
            V+E Q
Sbjct  151  VRESQ  155



>ref|XP_006389954.1| hypothetical protein EUTSA_v10019792mg [Eutrema salsugineum]
 gb|ESQ27240.1| hypothetical protein EUTSA_v10019792mg [Eutrema salsugineum]
Length=188

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 114/144 (79%), Gaps = 8/144 (6%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTSPATP--------SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSN  231
            ++GK +AEGS   + P           SRYESQKRRDWNTF QYLRNQ+PPV +SQC SN
Sbjct  6    NKGKGIAEGSSSQSQPQPQSPPNPPALSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSN  65

Query  232  HVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENG  411
            H+L+FL+YLDQFGKTKVH+ GC+F+GQ EP   C CPLKQAWGSLDALIGRLRAAYEENG
Sbjct  66   HILDFLQYLDQFGKTKVHVHGCVFFGQVEPAGQCNCPLKQAWGSLDALIGRLRAAYEENG  125

Query  412  GSPETNPFASGAIRVYLREVKECQ  483
            G PE NPFA G IRV+LREV++ Q
Sbjct  126  GLPERNPFAGGGIRVFLREVRDSQ  149



>ref|XP_006847407.1| hypothetical protein AMTR_s00153p00047660 [Amborella trichopoda]
 gb|ERN08988.1| hypothetical protein AMTR_s00153p00047660 [Amborella trichopoda]
Length=203

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +1

Query  115  TSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQG  294
            +SPA PSRYESQKRRDWNTF QYL+N +PP++LS+C+  HV+EFL+YLDQFGKTKVHL G
Sbjct  33   SSPAPPSRYESQKRRDWNTFLQYLKNHKPPLSLSRCSGAHVIEFLKYLDQFGKTKVHLVG  92

Query  295  CIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVK  474
            C ++G P PP PC CPLKQAWGSLDALIGRLRAAYEENGG P+ NPF + A+R+YLREV+
Sbjct  93   CPYFGHPSPPNPCACPLKQAWGSLDALIGRLRAAYEENGGRPDANPFGARAVRIYLREVR  152

Query  475  ECQ  483
            E Q
Sbjct  153  ESQ  155



>ref|NP_565190.1| protein LIGHT SENSITIVE HYPOCOTYLS 7 [Arabidopsis thaliana]
 sp|Q9ZVA0.1|LSH7_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7; AltName: 
Full=Protein ORGAN BOUNDARY 7 [Arabidopsis thaliana]
 gb|AAC83029.1| Strong similarity to T16B12.3 gi|3746060 unknown protein from 
Arabidopsis thaliana BAC gb|AC005311 [Arabidopsis thaliana]
 gb|AEE36158.1| uncharacterized protein AT1G78815 [Arabidopsis thaliana]
Length=195

 Score =   205 bits (521),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYLRNQ+PPV +SQC SNH+L+FL+YLDQFGKTKVH+ GC+F+GQ
Sbjct  39   SRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFGQ  98

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             EP   C CPLKQAWGSLDALIGRLRAA+EENGG PE NPFA G IRV+LREV++ Q
Sbjct  99   VEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQ  155



>ref|XP_003531259.1| PREDICTED: uncharacterized protein LOC100810655 [Glycine max]
 gb|KHN47994.1| hypothetical protein glysoja_015464 [Glycine soja]
Length=167

 Score =   204 bits (518),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYLRNQ PPV LSQCN NHVL+FLRYLDQFGKTKVHL GCIF+GQ
Sbjct  18   SRYESQKRRDWNTFGQYLRNQSPPVPLSQCNFNHVLDFLRYLDQFGKTKVHLHGCIFFGQ  77

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P PPAPC CPL+QAWGSLDALIGRLRAAYEE+GGSPETNPF  GAIRVYLREVKECQ
Sbjct  78   PTPPAPCACPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGGGAIRVYLREVKECQ  134



>ref|XP_010906808.1| PREDICTED: LOW QUALITY PROTEIN: protein G1-like4 [Elaeis guineensis]
Length=198

 Score =   205 bits (521),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  136  RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQP  315
            RYESQKRRDWNTFGQYL+N RPP+ LS+C+  HVLEFLRYLDQFGKTKVH Q C F+G P
Sbjct  52   RYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHP  111

Query  316  EPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             PPAPC+CPL+QAWGSLDALIGRLRAAYEENGG PE+NPF + A+R+YLREV+E Q
Sbjct  112  NPPAPCSCPLRQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRLYLREVRELQ  167



>ref|XP_009106595.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7 [Brassica 
rapa]
 emb|CDX87432.1| BnaA07g34410D [Brassica napus]
Length=190

 Score =   204 bits (520),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYLRNQ+PPV +SQC SNH+L+FL+YLDQFGKTKVH+ GC+F+GQ
Sbjct  39   SRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQ  98

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             EP   C CPLKQAWGSLDALIGRLRAAYEENGG PE NPFA G IRV+LREV++ Q
Sbjct  99   VEPAGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLREVRDSQ  155



>gb|AAM64330.1| unknown [Arabidopsis thaliana]
Length=195

 Score =   204 bits (520),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +1

Query  118  SPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGC  297
            +P   SRYESQKRRDWNTF QYLRNQ+PPV +SQC SNH+L+FL+YLDQFGKTKVH+ GC
Sbjct  34   NPPALSRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGC  93

Query  298  IFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKE  477
            +F+GQ EP   C CPLKQAWGSLDALIGRLRAA+EENGG PE NPFA G IRV+LREV++
Sbjct  94   VFFGQVEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRD  153

Query  478  CQ  483
             Q
Sbjct  154  SQ  155



>ref|XP_002889213.1| At1g78815 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65472.1| At1g78815 [Arabidopsis lyrata subsp. lyrata]
Length=191

 Score =   204 bits (520),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYLRNQ+PPV +SQC SNH+L+FL+YLDQFGKTKVH+ GC+F+GQ
Sbjct  35   SRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFGQ  94

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             EP   C CPLKQAWGSLDALIGRLRAA+EENGG PE NPFA G IRV+LREV++ Q
Sbjct  95   VEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQ  151



>emb|CDX88480.1| BnaC06g39240D [Brassica napus]
Length=185

 Score =   204 bits (519),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 113/146 (77%), Gaps = 11/146 (8%)
 Frame = +1

Query  76   DRGKDLAEGSPGDTS----------PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCN  225
            ++GK +AEGS               PA  SRYESQKRRDWNTF QYLRNQ PPV +SQC 
Sbjct  6    NKGKGIAEGSSSQPQPQQPQSPPNLPAL-SRYESQKRRDWNTFCQYLRNQHPPVHISQCG  64

Query  226  SNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEE  405
            SNH+L+FL+YLDQFGKTKVH+ GC+F+GQ EP   C CPLKQAWGSLDALIGRLRAAYEE
Sbjct  65   SNHILDFLQYLDQFGKTKVHVHGCVFFGQVEPAGQCNCPLKQAWGSLDALIGRLRAAYEE  124

Query  406  NGGSPETNPFASGAIRVYLREVKECQ  483
            NGG PE NPFA G IRV+LREV++ Q
Sbjct  125  NGGLPERNPFAGGGIRVFLREVRDSQ  150



>gb|ABF83646.1| At1g78815 [Arabidopsis thaliana]
Length=195

 Score =   204 bits (520),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYLRNQ+PPV +SQC SNH+L+FL+YLDQFGKTKVH+ GC+F+GQ
Sbjct  39   SRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHIHGCVFFGQ  98

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             EP   C CPLKQAWGSLDALIGRLRAA+EENGG PE NPFA G IRV+LREV++ Q
Sbjct  99   VEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQ  155



>gb|KFK43023.1| hypothetical protein AALP_AA1G068900 [Arabis alpina]
Length=194

 Score =   204 bits (520),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  115  TSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQG  294
            + PATPSRYESQKRRDWNTF QYL+N +PP+ALS+C+  HV+EFL+YLDQFGKTKVH+  
Sbjct  26   SPPATPSRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAA  85

Query  295  CIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVK  474
            C ++G  +PP+PC CPLKQAWGSLDALIGRLRAAYEENGG P++NPFA+ A+R+YLREV+
Sbjct  86   CPYFGHQQPPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVR  145

Query  475  ECQ  483
            E Q
Sbjct  146  ESQ  148



>gb|AES98763.2| DUF640 family protein [Medicago truncatula]
Length=225

 Score =   205 bits (522),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  88   DLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQF  267
            + A+  P   +  TPSRYESQKRRDWNTF QYLRN +PP+ L+ C+  HV+EFL+YLDQF
Sbjct  21   ETAQPQPSSPATPTPSRYESQKRRDWNTFQQYLRNHKPPLTLALCSGAHVIEFLKYLDQF  80

Query  268  GKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGA  447
            GKTKVH+ GC ++GQP PP+PC CPLKQAWGSLDALIGRLRAA+EENGG PE+NPF + A
Sbjct  81   GKTKVHVIGCPYFGQPNPPSPCACPLKQAWGSLDALIGRLRAAFEENGGKPESNPFGTRA  140

Query  448  IRVYLREVKECQ  483
            +R+YLREVK+ Q
Sbjct  141  VRIYLREVKDGQ  152



>ref|XP_010429720.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Camelina 
sativa]
Length=193

 Score =   204 bits (519),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYLRNQ+PPV +SQC SNH+L+FL+YLDQFGKTKVH+ GC+F+GQ
Sbjct  37   SRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQ  96

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             EP   C CPLKQAWGSLDALIGRLRAA+EENGG PE NPFA G IRV+LREV++ Q
Sbjct  97   VEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQ  153



>ref|XP_010417489.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Camelina 
sativa]
Length=196

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYLRNQ+PPV +SQC SNH+L+FL+YLDQFGKTKVH+ GC+F+GQ
Sbjct  40   SRYESQKRRDWNTFCQYLRNQQPPVHISQCGSNHILDFLQYLDQFGKTKVHVHGCVFFGQ  99

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             EP   C CPLKQAWGSLDALIGRLRAA+EENGG PE NPFA G IRV+LREV++ Q
Sbjct  100  VEPAGQCNCPLKQAWGSLDALIGRLRAAFEENGGLPERNPFAGGGIRVFLREVRDSQ  156



>ref|XP_006302860.1| hypothetical protein CARUB_v10020990mg [Capsella rubella]
 gb|EOA35758.1| hypothetical protein CARUB_v10020990mg [Capsella rubella]
Length=191

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 113/148 (76%), Gaps = 10/148 (7%)
 Frame = +1

Query  70   SFDRGKDLAEGSPGDTSPATPS----------RYESQKRRDWNTFGQYLRNQRPPVALSQ  219
            S ++GKD+A+GS                    RYESQKRRDWNTF QYLRNQ+PPV +SQ
Sbjct  4    SSNKGKDIADGSSQSQPQPHQPQSPPNPPPLSRYESQKRRDWNTFCQYLRNQQPPVHISQ  63

Query  220  CNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAY  399
            C SNH+L+FL+YLDQFGKTKVH+ GC+F+GQ EP   C CPLKQAWGSLDALIGRLRAA+
Sbjct  64   CGSNHILDFLQYLDQFGKTKVHVHGCVFFGQVEPAGQCNCPLKQAWGSLDALIGRLRAAF  123

Query  400  EENGGSPETNPFASGAIRVYLREVKECQ  483
            EENGG PE NPFA G IRV+LREV++ Q
Sbjct  124  EENGGLPERNPFAGGGIRVFLREVRDSQ  151



>ref|XP_002298496.1| hypothetical protein POPTR_0001s28780g [Populus trichocarpa]
 gb|EEE83301.1| hypothetical protein POPTR_0001s28780g [Populus trichocarpa]
Length=228

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +1

Query  109  GDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHL  288
            G + PA PSRYESQKRRDWNTF QY++N +PP+ L++C+  HV+EFL+YLDQFGKTKVH+
Sbjct  39   GSSPPAPPSRYESQKRRDWNTFLQYIKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHI  98

Query  289  QGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLRE  468
             GC ++G P PPAPC+CPLKQAWGSLDALIGRLRAAYEENGG PE+NPF + A+R+YLRE
Sbjct  99   TGCPYFGHPNPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGLPESNPFGARAVRIYLRE  158

Query  469  VKECQ  483
            V+E Q
Sbjct  159  VREGQ  163



>ref|XP_007159450.1| hypothetical protein PHAVU_002G238600g [Phaseolus vulgaris]
 gb|ESW31444.1| hypothetical protein PHAVU_002G238600g [Phaseolus vulgaris]
Length=179

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTFGQYL+NQ PPVALSQCN NHVL+FLRYLDQFGKTKVHL GCIF+GQ
Sbjct  30   SRYESQKRRDWNTFGQYLKNQSPPVALSQCNFNHVLDFLRYLDQFGKTKVHLHGCIFFGQ  89

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P PPAPC CPL+QAWGSLDALIGRLRAAYEE+GGSPETNPF  G+IRVYLREVKECQ
Sbjct  90   PTPPAPCACPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGGGSIRVYLREVKECQ  146



>ref|XP_006417846.1| hypothetical protein EUTSA_v10009726mg [Eutrema salsugineum]
 gb|ESQ36199.1| hypothetical protein EUTSA_v10009726mg [Eutrema salsugineum]
Length=200

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = +1

Query  115  TSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQG  294
            + PATPSRYESQKRRDWNTF QYL+N +PP+ALS+C+  HV+EFL+YLDQFGKTKVH+  
Sbjct  28   SPPATPSRYESQKRRDWNTFLQYLKNHKPPLALSRCSGAHVIEFLKYLDQFGKTKVHVAV  87

Query  295  CIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVK  474
            C ++G  +PP+PC CPLKQAWGSLDALIGRLRAAYEENGG P++NPFA+ A+R+YLREV+
Sbjct  88   CPYFGHQQPPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVR  147

Query  475  ECQ  483
            E Q
Sbjct  148  ESQ  150



>emb|CDY52287.1| BnaA03g57800D [Brassica napus]
 emb|CDY20312.1| BnaC04g36440D [Brassica napus]
 emb|CDY09940.1| BnaC08g45110D [Brassica napus]
 emb|CDX94980.1| BnaC05g06910D [Brassica napus]
Length=198

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 113/137 (82%), Gaps = 6/137 (4%)
 Frame = +1

Query  91   LAEGSPG------DTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLR  252
            ++EG PG       + PATPSRYESQKRRDW TF QYL+N +PP++LS+C+  H +EFL+
Sbjct  11   VSEGDPGPSIVTPSSPPATPSRYESQKRRDWTTFLQYLKNHKPPLSLSRCSGAHAIEFLK  70

Query  253  YLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNP  432
            YLDQFGKTKVH+  C ++G  +PP+PC CPLKQAWGSLDALIGRLRAAYEENGG PE+NP
Sbjct  71   YLDQFGKTKVHVAACPYFGHQQPPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPESNP  130

Query  433  FASGAIRVYLREVKECQ  483
            FA+ A+R+YLREV+E Q
Sbjct  131  FAARAVRIYLREVRESQ  147



>ref|XP_006414079.1| hypothetical protein EUTSA_v10027091mg [Eutrema salsugineum]
 gb|ESQ55532.1| hypothetical protein EUTSA_v10027091mg [Eutrema salsugineum]
Length=193

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYL++Q PP+ +SQ +  HVL FLRYLDQFGKTKVH Q C+FYGQ
Sbjct  38   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHQQACVFYGQ  97

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN-GGSPETNPFASGAIRVYLREVKECQ  483
            P+PP PCTCPLKQAWGSLDALIGRLRAAYEE+ GGSP+TNPFA+G+IR++LREV+E Q
Sbjct  98   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRIHLREVRESQ  155



>ref|XP_003615805.1| hypothetical protein MTR_5g072510 [Medicago truncatula]
Length=257

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  88   DLAEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQF  267
            + A+  P   +  TPSRYESQKRRDWNTF QYLRN +PP+ L+ C+  HV+EFL+YLDQF
Sbjct  21   ETAQPQPSSPATPTPSRYESQKRRDWNTFQQYLRNHKPPLTLALCSGAHVIEFLKYLDQF  80

Query  268  GKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGA  447
            GKTKVH+ GC ++GQP PP+PC CPLKQAWGSLDALIGRLRAA+EENGG PE+NPF + A
Sbjct  81   GKTKVHVIGCPYFGQPNPPSPCACPLKQAWGSLDALIGRLRAAFEENGGKPESNPFGTRA  140

Query  448  IRVYLREVKECQ  483
            +R+YLREVK+ Q
Sbjct  141  VRIYLREVKDGQ  152



>ref|XP_009398867.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
Length=206

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  136  RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQP  315
            RYESQKRRDWNTFGQYLRN RPP++LSQC+S+HVLEFLRYLDQFGKTK+H   C F+G  
Sbjct  43   RYESQKRRDWNTFGQYLRNHRPPLSLSQCSSSHVLEFLRYLDQFGKTKIHTHLCPFFGNS  102

Query  316  EPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             PPAPC CPL+QAWGSLDALIGRLRAAYEENGG PE+NPF + AIR+YLREV+E Q
Sbjct  103  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPESNPFGARAIRLYLREVREVQ  158



>ref|XP_010439831.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Camelina 
sativa]
Length=191

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYL++Q PP+ +SQ +  HVL FLRYLDQFGKTKVH Q C+F+GQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN-GGSPETNPFASGAIRVYLREVKECQ  483
            P+PP PCTCPLKQAWGSLDALIGRLRAAYEE+ GGSP+TNPFA+G+IRV+LREV+E Q
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQ  153



>ref|XP_002973743.1| hypothetical protein SELMODRAFT_36560, partial [Selaginella moellendorffii]
 ref|XP_002975792.1| hypothetical protein SELMODRAFT_36559, partial [Selaginella moellendorffii]
 gb|EFJ23421.1| hypothetical protein SELMODRAFT_36559, partial [Selaginella moellendorffii]
 gb|EFJ25403.1| hypothetical protein SELMODRAFT_36560, partial [Selaginella moellendorffii]
Length=153

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   AEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGK  273
            A+ +   +  A PSRYE+QKRRDWNTFGQYL+N RPP+ALS+C+  HVLEFLRYLDQFGK
Sbjct  8    ADANASSSQQAPPSRYEAQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGK  67

Query  274  TKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIR  453
            TK+H   C F+G   PPAPC CPL+QAWGSLDALIGRLRAA+EE+GG PE+NPF + A+R
Sbjct  68   TKIHAPACPFFGLAHPPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARAVR  127

Query  454  VYLREVKECQ  483
            +YLREV+E Q
Sbjct  128  LYLREVREMQ  137



>ref|XP_009118463.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Brassica 
rapa]
Length=198

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 112/137 (82%), Gaps = 6/137 (4%)
 Frame = +1

Query  91   LAEGSPG------DTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLR  252
            ++EG PG       + PA PSRYESQKRRDW TF QYL+N +PP+ALS+C+  H +EFL+
Sbjct  11   VSEGDPGPSIVTPSSPPAAPSRYESQKRRDWTTFLQYLKNHKPPLALSRCSGAHAIEFLK  70

Query  253  YLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNP  432
            YLDQFGKTKVH+  C ++G  +PP+PC CPLKQAWGSLDALIGRLRAAYEENGG PE+NP
Sbjct  71   YLDQFGKTKVHMAACPYFGHQQPPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPESNP  130

Query  433  FASGAIRVYLREVKECQ  483
            FA+ A+R+YLREV+E Q
Sbjct  131  FAARAVRIYLREVRESQ  147



>gb|EPS68444.1| hypothetical protein M569_06326 [Genlisea aurea]
Length=181

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  121  PATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCI  300
            PA  SRYESQKRRDWNTF QYLRNQRPPV+L QCN  HVLEF+RYLDQFGKTKVH++GC+
Sbjct  26   PAPLSRYESQKRRDWNTFRQYLRNQRPPVSLGQCNGGHVLEFMRYLDQFGKTKVHVRGCV  85

Query  301  FYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKEC  480
            F+G+PEP + CTCP++QAWGSLDAL+GRLRAAYE +GG+ E NPFA  AIR YL+EV+E 
Sbjct  86   FFGRPEPDSACTCPVRQAWGSLDALVGRLRAAYEGSGGAQERNPFADAAIRRYLKEVRET  145

Query  481  Q  483
            Q
Sbjct  146  Q  146



>gb|KFK28531.1| hypothetical protein AALP_AA7G008800 [Arabis alpina]
Length=194

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYL++Q PP+ +SQ +  HVL FLRYLDQFGKTKVH Q C+F+GQ
Sbjct  39   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  98

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN-GGSPETNPFASGAIRVYLREVKECQ  483
            P+PP PCTCPL+QAWGSLDALIGRLRAAYEE+ GGSPETNPFA+G+IRV+LREV+E Q
Sbjct  99   PDPPGPCTCPLRQAWGSLDALIGRLRAAYEEHGGGSPETNPFANGSIRVHLREVRESQ  156



>ref|XP_006286146.1| hypothetical protein CARUB_v10007704mg [Capsella rubella]
 gb|EOA19044.1| hypothetical protein CARUB_v10007704mg [Capsella rubella]
Length=191

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYL++Q PP+ +SQ +  HVL FLRYLDQFGKTKVH Q C+F+GQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHQQACVFFGQ  95

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN-GGSPETNPFASGAIRVYLREVKECQ  483
            P+PP PCTCPLKQAWGSLDALIGRLRAAYEE+ GGSP+TNPFA+G+IRV+LREV+E Q
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQ  153



>ref|NP_193596.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9SN52.1|LSH9_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9; AltName: 
Full=Protein ORGAN BOUNDARY 9 [Arabidopsis thaliana]
 emb|CAB37446.1| putative protein [Arabidopsis thaliana]
 emb|CAB78863.1| putative protein [Arabidopsis thaliana]
 gb|AAR24223.1| At4g18610 [Arabidopsis thaliana]
 gb|AAT35235.1| At4g18610 [Arabidopsis thaliana]
 gb|AEE84068.1| uncharacterized protein AT4G18610 [Arabidopsis thaliana]
Length=191

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYL++Q PP+ +SQ +  HVL FLRYLDQFGKTKVH Q C+F+GQ
Sbjct  36   SRYESQKRRDWNTFVQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN-GGSPETNPFASGAIRVYLREVKECQ  483
            P+PP PCTCPLKQAWGSLDALIGRLRAAYEE+ GGSP+TNPFA+G+IRV+LREV+E Q
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQ  153



>emb|CDY67351.1| BnaCnng54640D [Brassica napus]
Length=193

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 109/127 (86%), Gaps = 1/127 (1%)
 Frame = +1

Query  106  PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVH  285
            P  + P   SRYESQKRRDWNTF QYL++Q PP+ +SQ +  HVL FLRYLDQFGKTKVH
Sbjct  27   PLPSQPQPLSRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVH  86

Query  286  LQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN-GGSPETNPFASGAIRVYL  462
             Q C+F+GQP+PP PCTCPLKQAWGSLDALIGRLRAAYEE+ GGSP+TNPFA+G+IRV+L
Sbjct  87   HQACVFFGQPDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHL  146

Query  463  REVKECQ  483
            REV+E Q
Sbjct  147  REVRESQ  153



>ref|XP_009108375.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Brassica 
rapa]
 ref|XP_009108376.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Brassica 
rapa]
Length=193

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYL++Q PP+ +SQ +  HVL FLRYLDQFGKTKVH Q C+F+GQ
Sbjct  38   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  97

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN-GGSPETNPFASGAIRVYLREVKECQ  483
            P+PP PCTCPLKQAWGSLDALIGRLRAAYEE+ GGSP+TNPFA+G+IRV+LREV+E Q
Sbjct  98   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQ  155



>ref|XP_010434509.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9 [Camelina 
sativa]
Length=191

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYL++Q PP+ +SQ +  HVL FLRYLDQFGKTKVH Q C+F+GQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN-GGSPETNPFASGAIRVYLREVKECQ  483
            P+PP PCTCPLKQAWGSLDALIGRLRAAYEE+ GGSP+TNPFA+G+IRV+LREV+E Q
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQ  153



>ref|XP_010449492.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Camelina 
sativa]
Length=192

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYL++Q PP+ +SQ +  HVL FLRYLDQFGKTKVH Q C+F+GQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN-GGSPETNPFASGAIRVYLREVKECQ  483
            P+PP PCTCPLKQAWGSLDALIGRLRAAYEE+ GGSP+TNPFA+G+IRV+LREV+E Q
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQ  153



>ref|XP_009108056.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Brassica 
rapa]
Length=195

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYE+QKRRDWNTFGQYLRN RPP++LS+C   HVLEFLRYLDQFGKTKVH Q C F+G 
Sbjct  46   SRYENQKRRDWNTFGQYLRNHRPPLSLSRCGGAHVLEFLRYLDQFGKTKVHTQLCPFFGH  105

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
              PPAPC CPL+QAWGSLDALIGRLRAA+EENGGSPETNPF + A+R+YLREV++ Q
Sbjct  106  ANPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQ  162



>emb|CDX76510.1| BnaA08g08900D [Brassica napus]
Length=193

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYL++Q PP+ +SQ +  HVL FLRYLDQFGKTKVH Q C+F+GQ
Sbjct  38   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  97

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN-GGSPETNPFASGAIRVYLREVKECQ  483
            P+PP PCTCPLKQAWGSLDALIGRLRAAYEE+ GGSP+TNPFA+G+IRV+LREV+E Q
Sbjct  98   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQ  155



>ref|XP_008649559.1| PREDICTED: protein G1-like7 [Zea mays]
 gb|AFW77771.1| putative protein of unknown function (DUF640) domain family protein 
[Zea mays]
Length=301

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYLRN +PP+ L++C+  HV+EFLRYLDQFGKTKVH +GC ++GQ
Sbjct  82   SRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHAEGCAYFGQ  141

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GG PE+NPFA+ A+R+YLR+V+E Q
Sbjct  142  PNPPAPCTCPLRQAWGSLDALIGRLRAAYEESGGRPESNPFAAKAVRIYLRDVREAQ  198



>emb|CDY59064.1| BnaAnng15760D [Brassica napus]
Length=198

 Score =   202 bits (513),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 112/137 (82%), Gaps = 6/137 (4%)
 Frame = +1

Query  91   LAEGSPG------DTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLR  252
            ++EG PG       + PA PSRYESQKRRDW TF QYL+N +PP++LS+C+  H +EFL+
Sbjct  11   VSEGDPGPSIVTPSSPPAAPSRYESQKRRDWTTFLQYLKNHKPPLSLSRCSGAHAIEFLK  70

Query  253  YLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNP  432
            YLDQFGKTKVH+  C ++G  +PP+PC CPLKQAWGSLDALIGRLRAAYEENGG PE+NP
Sbjct  71   YLDQFGKTKVHVAACPYFGHQQPPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPESNP  130

Query  433  FASGAIRVYLREVKECQ  483
            FA+ A+R+YLREV+E Q
Sbjct  131  FAARAVRIYLREVRESQ  147



>ref|NP_001143976.1| uncharacterized protein LOC100276793 [Zea mays]
 gb|ACG36867.1| hypothetical protein [Zea mays]
Length=305

 Score =   205 bits (522),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYLRN +PP+ L++C+  HV+EFLRYLDQFGKTKVH +GC ++GQ
Sbjct  84   SRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHAEGCAYFGQ  143

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P PPAPCTCPL+QAWGSLDALIGRLRAAYEE+GG PE+NPFA+ A+R+YLR+V+E Q
Sbjct  144  PNPPAPCTCPLRQAWGSLDALIGRLRAAYEESGGRPESNPFAAKAVRIYLRDVREAQ  200



>ref|XP_008355077.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Malus 
domestica]
Length=228

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +1

Query  112  DTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQ  291
              SPA PSRYESQKRRDWNTF QYL+N +PP+ L++C+  HV+EFL+YLDQFGKTKVH  
Sbjct  41   SASPAPPSRYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHAA  100

Query  292  GCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREV  471
            GC ++G   PPAPC CPLKQAWGSLDALIGRLRAAYEENGG PE+NPF + A+R+YLREV
Sbjct  101  GCPYFGHQNPPAPCACPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLREV  160

Query  472  KECQ  483
            +E Q
Sbjct  161  REGQ  164



>emb|CDY14588.1| BnaC02g25250D [Brassica napus]
Length=190

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQK+RDWNTF QYLRNQ+PPV +SQC SNH+L+FL+YLDQFGKTKVH  GC+F+GQ
Sbjct  34   SRYESQKKRDWNTFCQYLRNQQPPVHVSQCGSNHILDFLQYLDQFGKTKVHAHGCVFFGQ  93

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             EP   C CPLKQAWGSLDALIGRLRAAYEENGG PE NPFA G IRV+L+EV++ Q
Sbjct  94   VEPSGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLKEVRDSQ  150



>emb|CDY34056.1| BnaC03g62760D [Brassica napus]
Length=193

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 105/118 (89%), Gaps = 1/118 (1%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYL++Q PP  +SQ +  HVL FLRYLDQFGKTKVH Q C+F+GQ
Sbjct  38   SRYESQKRRDWNTFIQYLKSQNPPQMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  97

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN-GGSPETNPFASGAIRVYLREVKECQ  483
            P+PP PCTCPLKQAWGSLDALIGRLRAAYEE+ GGSP+TNPFA+G+IRV+LREV+E Q
Sbjct  98   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQ  155



>emb|CDX78877.1| BnaA01g09440D [Brassica napus]
Length=196

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = +1

Query  136  RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQP  315
            RYESQKRRDWNTF QYL++Q PP+ +SQ +  HVL FLRYLDQFGKTKVH Q C+F+GQP
Sbjct  40   RYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQP  99

Query  316  EPPAPCTCPLKQAWGSLDALIGRLRAAYEEN-GGSPETNPFASGAIRVYLREVKECQ  483
            +PP PCTCPLKQAWGSLDALIGRLRAAYEE+ GGSP+TNPFA+G+IRV+LREV+E Q
Sbjct  100  DPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQ  156



>emb|CDY26881.1| BnaA02g19060D [Brassica napus]
Length=191

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQK+RDWNTF QYLRNQ+PPV +SQC SNH+L+FL+YLDQFGKTKVH  GC+F+GQ
Sbjct  34   SRYESQKKRDWNTFCQYLRNQQPPVHVSQCGSNHILDFLQYLDQFGKTKVHAHGCVFFGQ  93

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             EP   C CPLKQAWGSLDALIGRLRAAYEENGG PE NPFA G IRV+L+EV++ Q
Sbjct  94   VEPSGQCNCPLKQAWGSLDALIGRLRAAYEENGGLPERNPFAGGGIRVFLKEVRDSQ  150



>ref|XP_010043398.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 isoform 
X3 [Eucalyptus grandis]
 gb|KCW85401.1| hypothetical protein EUGRSUZ_B02224 [Eucalyptus grandis]
Length=204

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 110/139 (79%), Gaps = 9/139 (6%)
 Frame = +1

Query  94   AEGSPGDTSP---------ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEF  246
            AE  PG +SP         + PSRYESQKRRDWNTF QYL+N +PP+ L++C+   VLEF
Sbjct  27   AETIPGPSSPQEAAAAAAASPPSRYESQKRRDWNTFLQYLQNHKPPLTLARCSGAQVLEF  86

Query  247  LRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPET  426
            L+YLDQFGKTKVH+ GC F+G P PP PC CPLKQAWGSLDALIGRLRAA+EENGG PE 
Sbjct  87   LKYLDQFGKTKVHMNGCPFFGNPTPPGPCACPLKQAWGSLDALIGRLRAAFEENGGRPEL  146

Query  427  NPFASGAIRVYLREVKECQ  483
            NPFA+ A+R+YLREVKE Q
Sbjct  147  NPFAARAVRIYLREVKEGQ  165



>ref|XP_010685918.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 [Beta vulgaris 
subsp. vulgaris]
Length=258

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +1

Query  130  PSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYG  309
            PSRYESQKRRDWNTF QYLRN +PP++LS+C+  HV+EFL+YLDQFGKTKVH+ GC ++G
Sbjct  75   PSRYESQKRRDWNTFLQYLRNHKPPLSLSRCSGAHVIEFLKYLDQFGKTKVHITGCPYFG  134

Query  310  QPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             P PP+PC CPLKQAWGSLDALIGRLRAAYEENGG PE+NPF + A+R+YLREV+E Q
Sbjct  135  HPNPPSPCACPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRIYLREVRESQ  192



>ref|XP_002267312.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 1-like [Vitis 
vinifera]
Length=181

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 106/125 (85%), Gaps = 2/125 (2%)
 Frame = +1

Query  115  TSPAT--PSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHL  288
            +SPA   PSRYE+QKRRDWNTFGQYLRN RPP++LS CN  HVLEFLRYLDQFGKTKVH 
Sbjct  29   SSPAVYAPSRYENQKRRDWNTFGQYLRNHRPPLSLSLCNGAHVLEFLRYLDQFGKTKVHN  88

Query  289  QGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLRE  468
            Q C F+G   PPAPC CPL+QAWGSLDALIGRLRAAYEE+GG PE NPF + A+R+YLRE
Sbjct  89   QTCPFFGLKNPPAPCPCPLRQAWGSLDALIGRLRAAYEEHGGKPEANPFGARAVRLYLRE  148

Query  469  VKECQ  483
            V++ Q
Sbjct  149  VRDFQ  153



>dbj|BAI52974.1| G1-like protein [Selaginella moellendorffii]
Length=225

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = +1

Query  94   AEGSPGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGK  273
            A+ +   +  A PSRYE+QKRRDWNTFGQYL+N RPP+ALS+C+  HVLEFLRYLDQFGK
Sbjct  23   ADANASSSQQAPPSRYEAQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGK  82

Query  274  TKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIR  453
            TK+H   C F+G   PPAPC CPL+QAWGSLDALIGRLRAA+EE+GG PE+NPF + A+R
Sbjct  83   TKIHAPACPFFGLAHPPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARAVR  142

Query  454  VYLREVKECQ  483
            +YLREV+E Q
Sbjct  143  LYLREVREMQ  152



>ref|XP_002870033.1| hypothetical protein ARALYDRAFT_914818 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46292.1| hypothetical protein ARALYDRAFT_914818 [Arabidopsis lyrata subsp. 
lyrata]
Length=191

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 105/118 (89%), Gaps = 1/118 (1%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYL++Q PP+ +SQ +  HVL FLRYLDQFGKTKVH Q C+F+GQ
Sbjct  36   SRYESQKRRDWNTFIQYLKSQNPPLMMSQFDYTHVLSFLRYLDQFGKTKVHHQACVFFGQ  95

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN-GGSPETNPFASGAIRVYLREVKECQ  483
            P+PP PCTCPLKQAWGSLDALIGRLRAAYEE+ GGSP+ NPFA+G+IRV+LREV+E Q
Sbjct  96   PDPPGPCTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDANPFANGSIRVHLREVRESQ  153



>ref|XP_003537309.1| PREDICTED: uncharacterized protein LOC100775798 [Glycine max]
Length=235

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +1

Query  106  PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVH  285
            P  +SPA  SRYESQKRRDWNTF QYL+N RPP+ L++C+  HV+EFL+YLDQFGKTKVH
Sbjct  38   PEGSSPAPLSRYESQKRRDWNTFLQYLQNHRPPLTLARCSGAHVIEFLKYLDQFGKTKVH  97

Query  286  LQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLR  465
            + GC ++G P PPAPCTCPLKQAWGSLDALIGRLRAAYEENGG PE+NPF + A+R  LR
Sbjct  98   VTGCPYFGHPNPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRTCLR  157

Query  466  EVKECQ  483
            EV+E Q
Sbjct  158  EVREGQ  163



>ref|XP_008804907.1| PREDICTED: protein G1-like7 [Phoenix dactylifera]
Length=229

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYLRN +PP+ L++C+  HV+EFLRYLDQFGKTKVH  GC F+GQ
Sbjct  43   SRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHNAGCTFFGQ  102

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P PP PC CPLKQAWGSLDALIGRLRAAYEE+GG PE NPFA+ A+R+YLREV+E Q
Sbjct  103  PNPPGPCACPLKQAWGSLDALIGRLRAAYEESGGRPEANPFAARAVRIYLREVRESQ  159



>gb|KHG10505.1| Error-prone DNA polymerase [Gossypium arboreum]
Length=238

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +1

Query  136  RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQP  315
            RYESQKRRDWNTF QYL+N +PP+ L++C+  HV+EFL+YLDQFGKTKVH+ GC ++G P
Sbjct  52   RYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHP  111

Query  316  EPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             PPAPC+CPLKQAWGSLDALIGRLRAAYEENGG PE+NPFA+ A+R+YLREV+E Q
Sbjct  112  NPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFAARAVRIYLREVREGQ  167



>ref|XP_009385214.1| PREDICTED: protein G1-like7 [Musa acuminata subsp. malaccensis]
Length=195

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = +1

Query  124  ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIF  303
            A PSRYESQKRRDWNTF QYLRN +PP+ LS+C+  HV+EFLRYLDQFGKTKVH+  C F
Sbjct  16   AEPSRYESQKRRDWNTFVQYLRNHKPPLVLSRCSGAHVIEFLRYLDQFGKTKVHVPRCAF  75

Query  304  YGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            YG P PP PC CPL+QAWGSLDAL+GRLRAAYEE+GGSP+TNPFA+ AIR++L +V+E Q
Sbjct  76   YGHPSPPGPCACPLRQAWGSLDALVGRLRAAYEESGGSPDTNPFAARAIRIFLHDVRESQ  135



>ref|XP_004504735.1| PREDICTED: uncharacterized protein LOC101506113 [Cicer arietinum]
Length=236

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = +1

Query  112  DTSPATP-SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHL  288
            D S A P SRYESQKRRDWNTFGQYL+N RPP+ LS+C+  HVLEFLRYLDQFGKTKVH 
Sbjct  38   DVSVAPPLSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHS  97

Query  289  QGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLRE  468
            + C ++G   PP PC CPLKQAWGSLDALIGRLRAA+EENGGSPE NPF + A+R+YLRE
Sbjct  98   ENCAYFGNSNPPGPCPCPLKQAWGSLDALIGRLRAAFEENGGSPEINPFGARAVRLYLRE  157

Query  469  VKECQ  483
            V++ Q
Sbjct  158  VRDAQ  162



>ref|XP_010043397.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 isoform 
X2 [Eucalyptus grandis]
 gb|KCW85400.1| hypothetical protein EUGRSUZ_B02224 [Eucalyptus grandis]
Length=225

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 110/139 (79%), Gaps = 9/139 (6%)
 Frame = +1

Query  94   AEGSPGDTSP---------ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEF  246
            AE  PG +SP         + PSRYESQKRRDWNTF QYL+N +PP+ L++C+   VLEF
Sbjct  27   AETIPGPSSPQEAAAAAAASPPSRYESQKRRDWNTFLQYLQNHKPPLTLARCSGAQVLEF  86

Query  247  LRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPET  426
            L+YLDQFGKTKVH+ GC F+G P PP PC CPLKQAWGSLDALIGRLRAA+EENGG PE 
Sbjct  87   LKYLDQFGKTKVHMNGCPFFGNPTPPGPCACPLKQAWGSLDALIGRLRAAFEENGGRPEL  146

Query  427  NPFASGAIRVYLREVKECQ  483
            NPFA+ A+R+YLREVKE Q
Sbjct  147  NPFAARAVRIYLREVKEGQ  165



>ref|XP_007016962.1| Zinc finger protein ZFPM1 [Theobroma cacao]
 gb|EOY34581.1| Zinc finger protein ZFPM1 [Theobroma cacao]
Length=241

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  136  RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQP  315
            RYESQKRRDWNTF QYL+N +PP+ L++C+  HV+EFL+YLDQFGKTKVH+ GC ++G P
Sbjct  53   RYESQKRRDWNTFLQYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHITGCPYFGHP  112

Query  316  EPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             PPAPC+CPLKQAWGSLDALIGRLRAAYEENGG PE+NPF + A+R+YLREV+E Q
Sbjct  113  NPPAPCSCPLKQAWGSLDALIGRLRAAYEENGGRPESNPFGAKAVRIYLREVREGQ  168



>ref|XP_011024904.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 [Populus 
euphratica]
Length=228

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +1

Query  109  GDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHL  288
            G + PA PSRYESQKRRDWNTF  YL+N +PP+ L++C+  HV+EFL+YLDQFGKTKVH+
Sbjct  39   GSSLPAPPSRYESQKRRDWNTFLGYLKNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHI  98

Query  289  QGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLRE  468
             GC ++G P PPA C+CPLKQAWGSLDALIGRLRAAYEENGG PE+NPF + A+R+YLRE
Sbjct  99   TGCPYFGHPNPPASCSCPLKQAWGSLDALIGRLRAAYEENGGLPESNPFGARAVRIYLRE  158

Query  469  VKECQ  483
            V+E Q
Sbjct  159  VREGQ  163



>ref|XP_010043396.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5 isoform 
X1 [Eucalyptus grandis]
Length=278

 Score =   202 bits (514),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 110/139 (79%), Gaps = 9/139 (6%)
 Frame = +1

Query  94   AEGSPGDTSP---------ATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEF  246
            AE  PG +SP         + PSRYESQKRRDWNTF QYL+N +PP+ L++C+   VLEF
Sbjct  27   AETIPGPSSPQEAAAAAAASPPSRYESQKRRDWNTFLQYLQNHKPPLTLARCSGAQVLEF  86

Query  247  LRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPET  426
            L+YLDQFGKTKVH+ GC F+G P PP PC CPLKQAWGSLDALIGRLRAA+EENGG PE 
Sbjct  87   LKYLDQFGKTKVHMNGCPFFGNPTPPGPCACPLKQAWGSLDALIGRLRAAFEENGGRPEL  146

Query  427  NPFASGAIRVYLREVKECQ  483
            NPFA+ A+R+YLREVKE Q
Sbjct  147  NPFAARAVRIYLREVKEGQ  165



>ref|XP_009136943.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Brassica 
rapa]
 ref|XP_009136944.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 9-like [Brassica 
rapa]
 emb|CDY53996.1| BnaA03g58210D [Brassica napus]
Length=191

 Score =   199 bits (506),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 105/118 (89%), Gaps = 1/118 (1%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYL++Q PP+ +SQ N  HVL FLRYLDQFGKTKVH Q C+F+GQ
Sbjct  39   SRYESQKRRDWNTFIQYLKSQNPPLLMSQFNYTHVLCFLRYLDQFGKTKVHEQACVFFGQ  98

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEEN-GGSPETNPFASGAIRVYLREVKECQ  483
            P+PP  CTCPLKQAWGSLDALIGRLRAAYEE+ GGSP+TNPFA+G+IRV+LREV+E Q
Sbjct  99   PDPPGACTCPLKQAWGSLDALIGRLRAAYEEHGGGSPDTNPFANGSIRVHLREVRESQ  156



>gb|EYU45980.1| hypothetical protein MIMGU_mgv1a021801mg [Erythranthe guttata]
Length=201

 Score =   199 bits (507),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  136  RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQP  315
            RYESQKRRDWNTF QYLRN +PP+ L++C+  HV+EFL+YLDQFGKTKVH+ GC ++GQP
Sbjct  43   RYESQKRRDWNTFQQYLRNHKPPLTLARCSGAHVIEFLKYLDQFGKTKVHVTGCPYFGQP  102

Query  316  EPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            +PPAPC C LKQAWGSLDALIGRLRAAYEENGG P+TNPF + A+R+YLREV+E Q
Sbjct  103  DPPAPCACQLKQAWGSLDALIGRLRAAYEENGGRPDTNPFGAKAVRIYLREVRESQ  158



>ref|XP_009128313.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 7-like [Brassica 
rapa]
Length=191

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQK+RDWNTF QYLRNQ+PPV +SQC SNH+L+FL+YLDQFGKTKVH  GC+F+GQ
Sbjct  34   SRYESQKKRDWNTFCQYLRNQQPPVHVSQCGSNHILDFLQYLDQFGKTKVHAHGCVFFGQ  93

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             EP   C CPLKQAWGSLDAL GRLRAAYEENGG PE NPFA G IRV+L+EV++ Q
Sbjct  94   VEPSGQCNCPLKQAWGSLDALSGRLRAAYEENGGLPERNPFAGGGIRVFLKEVRDSQ  150



>ref|XP_010922606.1| PREDICTED: protein G1-like7 [Elaeis guineensis]
Length=225

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  136  RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQP  315
            RYESQKRRDWNTF QYLRN +PP+ L++C+  HV+EFLRYLDQFGKTKVH  GC F+GQP
Sbjct  40   RYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHNAGCTFFGQP  99

Query  316  EPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
             PP PC CPLKQAWGSLDALIGRLRAAYEE+GG PE NPFA+ A+R+YLREV+E Q
Sbjct  100  NPPGPCACPLKQAWGSLDALIGRLRAAYEESGGRPEANPFAARAVRIYLREVRESQ  155



>ref|XP_010689830.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Beta 
vulgaris subsp. vulgaris]
Length=188

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  127  TPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFY  306
            TPSRYESQKRRDWNTFGQYLRNQ PPV LSQC  +HVL+FLRYLDQFGKTKVH+ GC+FY
Sbjct  22   TPSRYESQKRRDWNTFGQYLRNQHPPVPLSQCTCHHVLDFLRYLDQFGKTKVHVPGCMFY  81

Query  307  GQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            GQPEPPAPC CPL+QAWGSLDALIGRLRAAYEENGG PETNPFA  AIRVYLREV+ECQ
Sbjct  82   GQPEPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGPPETNPFAGSAIRVYLREVRECQ  140



>emb|CBI21986.3| unnamed protein product [Vitis vinifera]
Length=158

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 106/142 (75%), Gaps = 29/142 (20%)
 Frame = +1

Query  67   MSFDRGKDLAEGS---PGDTSPATPSRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHV  237
            MS +RGKDLAEGS   PGD    TPSRYESQKRRDWNTFGQYL+NQRPPV LSQCN NH 
Sbjct  1    MSSERGKDLAEGSSRSPGDQQSVTPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNH-  59

Query  238  LEFLRYLDQFGKTKVHLQGCIFYGQPEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGS  417
                                     PEPPAPCTCPL+QAWGSLDAL+GRLRAAYEENGGS
Sbjct  60   -------------------------PEPPAPCTCPLRQAWGSLDALVGRLRAAYEENGGS  94

Query  418  PETNPFASGAIRVYLREVKECQ  483
            PETNPFASGAIR+YLREV+ECQ
Sbjct  95   PETNPFASGAIRIYLREVRECQ  116



>ref|XP_008811689.1| PREDICTED: protein G1-like7 [Phoenix dactylifera]
Length=218

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYLRN +PP+ L++C+  HV+EFLRYLDQFGKTKVH  GC F+G 
Sbjct  35   SRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHNAGCAFFGH  94

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P PP PC CPLKQAWGSLDALIGRLRAAYEE+GG PE NPFA+ A+R+YLREV+E Q
Sbjct  95   PNPPGPCACPLKQAWGSLDALIGRLRAAYEESGGRPEANPFAARAVRIYLREVRESQ  151



>ref|XP_010906823.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6-like [Elaeis 
guineensis]
Length=218

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +1

Query  133  SRYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQ  312
            SRYESQKRRDWNTF QYLRN +PP+ L++C+  HV+EFLRYLDQFGKTKVH  GC F+G 
Sbjct  35   SRYESQKRRDWNTFLQYLRNHKPPLTLARCSGAHVIEFLRYLDQFGKTKVHNAGCAFFGH  94

Query  313  PEPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            P PP PC CPLKQAWGSLDALIGRLRAAYEE+GG PE NPFA+ A+R+YLREV+E Q
Sbjct  95   PNPPGPCACPLKQAWGSLDALIGRLRAAYEESGGRPEANPFAARAVRIYLREVRESQ  151



>ref|XP_002862737.1| hypothetical protein ARALYDRAFT_920315 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38995.1| hypothetical protein ARALYDRAFT_920315 [Arabidopsis lyrata subsp. 
lyrata]
Length=193

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  136  RYESQKRRDWNTFGQYLRNQRPPVALSQCNSNHVLEFLRYLDQFGKTKVHLQGCIFYGQP  315
            RYESQKRRDWNTF QYLRN +PP+ L++C+  HVLEFL+YLDQFGKTKVH++ C F+G P
Sbjct  26   RYESQKRRDWNTFLQYLRNHKPPLTLTRCSGAHVLEFLKYLDQFGKTKVHVETCPFFGHP  85

Query  316  EPPAPCTCPLKQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVKECQ  483
            +PP+ C+CP KQAWGSLDALIGRLRAAYEENGG P++NPFA+ A+R+YLREVKE Q
Sbjct  86   DPPSSCSCPHKQAWGSLDALIGRLRAAYEENGGRPDSNPFAARAVRIYLREVKESQ  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2230116990256