BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23665_g3_i1 len=752 path=[7322:0-225 7548:226-231 12416:232-243
19864:244-255 19887:256-257 19889:258-267 9042:268-297 7613:298-312
19934:313-321 19943:322-323 9096:324-330 19945:331-353 14441:354-363
8280:364-420 20043:421-426 20049:427-437 20060:438-447 7743:448-462
20105:463-473 20116:474-485 20128:486-487 7888:488-567 7968:568-593
11011:594-751]

Length=752
                                                                      Score     E

ref|XP_011004043.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    224   2e-69   
ref|XP_002306857.2|  hypothetical protein POPTR_0005s24730g             224   2e-69   Populus trichocarpa [western balsam poplar]
gb|EYU46446.1|  hypothetical protein MIMGU_mgv1a020501mg                222   6e-69   
ref|XP_009336145.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    223   8e-69   
ref|XP_008356205.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    223   9e-69   
gb|KEH23934.1|  G1-like protein                                         223   1e-68   
ref|XP_008235666.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    222   2e-68   
ref|XP_010652376.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    221   2e-68   
emb|CAN67056.1|  hypothetical protein VITISV_036348                     220   2e-68   Vitis vinifera
ref|XP_011080055.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    221   2e-68   
ref|XP_004493783.1|  PREDICTED: uncharacterized protein LOC101490141    221   2e-68   
ref|XP_004292213.1|  PREDICTED: uncharacterized protein LOC101301170    221   3e-68   
gb|KDO60474.1|  hypothetical protein CISIN_1g046561mg                   221   3e-68   
gb|KEH42512.1|  G1-like protein                                         221   5e-68   
ref|XP_009594800.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   6e-68   
ref|XP_009780996.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   6e-68   
emb|CDO99243.1|  unnamed protein product                                219   6e-68   
ref|XP_011028817.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    219   7e-68   
ref|XP_002302041.2|  hypothetical protein POPTR_0002s03860g             219   8e-68   Populus trichocarpa [western balsam poplar]
ref|XP_007201372.1|  hypothetical protein PRUPE_ppa012142mg             219   8e-68   
ref|XP_007050277.1|  IQ motif and SEC7 domain-containing protein 2      219   9e-68   
ref|XP_008382857.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    220   9e-68   
ref|XP_009369473.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    220   1e-67   
gb|KHN10748.1|  hypothetical protein glysoja_019179                     219   1e-67   
ref|XP_003521294.1|  PREDICTED: uncharacterized protein LOC100778...    219   1e-67   
emb|CDP03752.1|  unnamed protein product                                219   1e-67   
ref|XP_003537033.1|  PREDICTED: uncharacterized protein LOC100803605    219   1e-67   
ref|NP_001235822.1|  uncharacterized protein LOC100527164               219   2e-67   
ref|XP_004495090.1|  PREDICTED: activating signal cointegrator 1 ...    220   2e-67   
gb|KDP26521.1|  hypothetical protein JCGZ_17679                         218   2e-67   
ref|XP_009398447.1|  PREDICTED: protein G1-like4                        218   2e-67   
ref|XP_007144887.1|  hypothetical protein PHAVU_007G192200g             218   3e-67   
ref|XP_006354481.1|  PREDICTED: uncharacterized protein LOC102586971    218   6e-67   
ref|XP_009772674.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    217   7e-67   
ref|XP_007162548.1|  hypothetical protein PHAVU_001G161400g             217   7e-67   
ref|XP_006352738.1|  PREDICTED: uncharacterized protein LOC102585062    217   8e-67   
ref|XP_009603577.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    217   9e-67   
ref|NP_001048473.1|  Os02g0811000                                       219   9e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010532649.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    216   1e-66   
ref|NP_001235665.1|  uncharacterized protein LOC100527409               217   1e-66   
ref|XP_004242364.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    217   2e-66   
ref|XP_004152052.1|  PREDICTED: uncharacterized protein LOC101218342    216   2e-66   
emb|CDY35523.1|  BnaA01g23890D                                          216   3e-66   
ref|XP_008447416.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    215   3e-66   
ref|XP_006443825.1|  hypothetical protein CICLE_v10022295mg             216   3e-66   
ref|XP_009391974.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    216   3e-66   
ref|XP_007143863.1|  hypothetical protein PHAVU_007G108200g             215   3e-66   
ref|NP_001078202.2|  protein LIGHT SENSITIVE HYPOCOTYLS 4               215   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007143862.1|  hypothetical protein PHAVU_007G108200g             215   3e-66   
gb|KFK39618.1|  hypothetical protein AALP_AA3G267200                    215   4e-66   
ref|XP_010488385.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    215   4e-66   
ref|XP_006298606.1|  hypothetical protein CARUB_v10014690mg             215   4e-66   
ref|XP_010466654.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    215   5e-66   
ref|XP_002883419.1|  hypothetical protein ARALYDRAFT_898842             215   6e-66   
ref|XP_010488383.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    215   6e-66   
gb|EPS67535.1|  hypothetical protein M569_07240                         213   6e-66   
ref|XP_008810562.1|  PREDICTED: protein G1-like4                        215   6e-66   
ref|XP_006406049.1|  hypothetical protein EUTSA_v10021563mg             214   7e-66   
ref|XP_010512305.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   7e-66   
ref|XP_010527402.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   7e-66   
ref|XP_009399464.1|  PREDICTED: protein G1-like4                        214   7e-66   
ref|XP_010101416.1|  hypothetical protein L484_005652                   217   7e-66   
ref|XP_006648081.1|  PREDICTED: uncharacterized protein LOC102709535    216   7e-66   
ref|XP_004247736.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    215   8e-66   
gb|AFK48050.1|  unknown                                                 214   8e-66   
ref|XP_003590857.1|  hypothetical protein MTR_1g075990                  214   1e-65   
ref|XP_010469755.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    215   1e-65   
ref|XP_010522152.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    215   1e-65   
ref|XP_010414174.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    215   1e-65   
ref|XP_010510232.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   1e-65   
ref|XP_010679333.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   1e-65   
ref|XP_009401942.1|  PREDICTED: protein G1-like4                        214   1e-65   
ref|XP_006410244.1|  hypothetical protein EUTSA_v10017162mg             214   2e-65   
ref|XP_006589267.1|  PREDICTED: uncharacterized protein LOC100789...    214   2e-65   
ref|XP_003536217.1|  PREDICTED: uncharacterized protein LOC100789...    214   2e-65   
ref|XP_004296375.1|  PREDICTED: uncharacterized protein LOC101303109    213   2e-65   
ref|XP_002464485.1|  hypothetical protein SORBIDRAFT_01g019290          214   2e-65   Sorghum bicolor [broomcorn]
gb|EYU28084.1|  hypothetical protein MIMGU_mgv1a022457mg                213   2e-65   
emb|CDY57087.1|  BnaA04g28750D                                          214   2e-65   
emb|CDY10790.1|  BnaA05g11460D                                          214   2e-65   
ref|XP_004152053.1|  PREDICTED: uncharacterized protein LOC101218578    213   3e-65   
emb|CDY15426.1|  BnaC04g41970D                                          214   3e-65   
ref|NP_565716.1|  uncharacterized protein                               214   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004497868.1|  PREDICTED: uncharacterized protein LOC101506...    213   3e-65   
ref|XP_008802142.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    213   3e-65   
ref|XP_010935915.1|  PREDICTED: protein G1-like4                        213   3e-65   
ref|XP_010934319.1|  PREDICTED: protein G1-like4                        212   3e-65   
ref|XP_002862787.1|  hypothetical protein ARALYDRAFT_497295             213   4e-65   
ref|XP_009387892.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    213   4e-65   
ref|XP_010905797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    213   4e-65   
emb|CDY24755.1|  BnaC04g13600D                                          213   4e-65   
ref|XP_009400810.1|  PREDICTED: protein G1-like4                        213   4e-65   
ref|XP_009144232.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    213   4e-65   
ref|XP_006293520.1|  hypothetical protein CARUB_v10024036mg             213   4e-65   
ref|NP_001143695.1|  putative protein of unknown function (DUF640...    214   5e-65   Zea mays [maize]
gb|ABK21716.1|  unknown                                                 213   5e-65   Picea sitchensis
ref|XP_009141136.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    214   5e-65   
ref|XP_002453010.1|  hypothetical protein SORBIDRAFT_04g036620          214   6e-65   Sorghum bicolor [broomcorn]
ref|XP_010557118.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    213   6e-65   
gb|ACN41049.1|  unknown                                                 213   6e-65   Picea sitchensis
ref|XP_006410245.1|  hypothetical protein EUTSA_v10017162mg             214   8e-65   
ref|XP_010246796.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    211   8e-65   
ref|XP_011091303.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    212   9e-65   
emb|CDY69731.1|  BnaCnng65050D                                          212   9e-65   
ref|XP_009144231.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    212   9e-65   
ref|XP_002879309.1|  hypothetical protein ARALYDRAFT_344884             213   1e-64   
ref|XP_008681636.1|  PREDICTED: putative protein of unknown funct...    214   1e-64   
ref|XP_011083033.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    211   1e-64   
ref|XP_009768526.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    211   1e-64   
ref|XP_008681638.1|  PREDICTED: putative protein of unknown funct...    214   1e-64   
ref|NP_001168003.1|  uncharacterized protein LOC100381724               213   1e-64   Zea mays [maize]
ref|XP_009108056.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    211   1e-64   
ref|XP_010104757.1|  hypothetical protein L484_021447                   212   1e-64   
emb|CDX85083.1|  BnaC07g08230D                                          211   2e-64   
ref|NP_001136927.1|  putative protein of unknown function (DUF640...    211   2e-64   Zea mays [maize]
ref|XP_009102637.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    211   2e-64   
ref|XP_004246953.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    210   2e-64   
ref|XP_010023924.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    211   2e-64   
ref|XP_009598088.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    211   2e-64   
gb|EPS74320.1|  hypothetical protein M569_00435                         209   2e-64   
ref|XP_010906808.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    211   2e-64   
gb|ABR18275.1|  unknown                                                 212   2e-64   Picea sitchensis
gb|KFK31223.1|  hypothetical protein AALP_AA6G084400                    212   2e-64   
ref|XP_006351667.1|  PREDICTED: uncharacterized protein LOC102596568    210   2e-64   
ref|XP_003572923.1|  PREDICTED: protein G1-like6                        212   2e-64   
ref|XP_008447415.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    210   3e-64   
ref|XP_008224344.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    211   3e-64   
ref|NP_001159319.1|  uncharacterized protein LOC100304411               211   4e-64   Zea mays [maize]
ref|XP_003556381.1|  PREDICTED: uncharacterized protein LOC100806...    210   4e-64   
ref|XP_008785240.1|  PREDICTED: LOW QUALITY PROTEIN: protein G1-l...    211   4e-64   
ref|XP_007022986.1|  Uncharacterized protein TCM_026988                 211   4e-64   
ref|XP_006420250.1|  hypothetical protein CICLE_v10005901mg             210   5e-64   
ref|XP_006606388.1|  PREDICTED: uncharacterized protein LOC100806...    209   5e-64   
ref|XP_010679332.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    211   5e-64   
ref|XP_010069122.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    210   5e-64   
ref|XP_008807719.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    210   5e-64   
ref|XP_009362175.1|  PREDICTED: protein G1-like1 isoform X2             211   5e-64   
ref|XP_006606387.1|  PREDICTED: uncharacterized protein LOC100806...    209   5e-64   
ref|XP_009362174.1|  PREDICTED: protein G1-like1 isoform X1             211   6e-64   
ref|XP_007226923.1|  hypothetical protein PRUPE_ppa015837mg             210   6e-64   
ref|XP_010650097.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    210   6e-64   
ref|XP_009353874.1|  PREDICTED: protein G1-like1                        211   7e-64   
ref|XP_007211887.1|  hypothetical protein PRUPE_ppa010212mg             211   8e-64   
ref|XP_007035134.1|  Uncharacterized protein TCM_020903                 210   8e-64   
ref|XP_010262338.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    210   8e-64   
ref|XP_010098512.1|  hypothetical protein L484_025951                   211   9e-64   
gb|KEH41129.1|  G1-like protein                                         209   1e-63   
ref|XP_010262340.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    208   1e-63   
ref|XP_010907173.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    209   1e-63   
ref|XP_007145860.1|  hypothetical protein PHAVU_007G274100g             209   1e-63   
ref|XP_004293717.1|  PREDICTED: uncharacterized protein LOC101301655    211   1e-63   
ref|XP_009398867.1|  PREDICTED: protein G1-like4                        209   1e-63   
ref|XP_010655519.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    208   1e-63   
emb|CAN72178.1|  hypothetical protein VITISV_012478                     208   1e-63   Vitis vinifera
ref|NP_001176209.1|  Os10g0478000                                       209   2e-63   
ref|XP_008439509.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    208   2e-63   
ref|XP_006857299.1|  hypothetical protein AMTR_s00067p00052610          209   2e-63   
ref|XP_004495375.1|  PREDICTED: uncharacterized protein LOC101506...    208   2e-63   
ref|XP_006489717.1|  PREDICTED: uncharacterized protein LOC102628291    208   3e-63   
ref|XP_003539992.1|  PREDICTED: uncharacterized protein LOC100806134    207   3e-63   
ref|XP_010279129.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   4e-63   
ref|NP_001142538.1|  uncharacterized protein LOC100274783               207   4e-63   Zea mays [maize]
ref|XP_002311674.2|  hypothetical protein POPTR_0008s16750g             208   4e-63   Populus trichocarpa [western balsam poplar]
ref|XP_008225689.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    207   4e-63   
ref|XP_011085173.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    208   4e-63   
gb|EMS63732.1|  hypothetical protein TRIUR3_33566                       209   5e-63   
ref|XP_008676897.1|  PREDICTED: uncharacterized protein LOC100274...    207   5e-63   
ref|XP_010671018.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   6e-63   
ref|XP_007025375.1|  Beta-lactamase-like protein ENSP00000383859        206   6e-63   
gb|KDP34854.1|  hypothetical protein JCGZ_09142                         208   7e-63   
ref|XP_009615590.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   7e-63   
ref|XP_008793554.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    208   7e-63   
gb|KDP40343.1|  hypothetical protein JCGZ_02341                         207   8e-63   
ref|XP_009611433.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    206   1e-62   
gb|EMT15017.1|  hypothetical protein F775_09728                         206   1e-62   
gb|EYU43203.1|  hypothetical protein MIMGU_mgv1a013748mg                207   1e-62   
ref|XP_008667635.1|  PREDICTED: uncharacterized protein LOC100275...    206   1e-62   
ref|XP_002446786.1|  hypothetical protein SORBIDRAFT_06g022610          206   1e-62   Sorghum bicolor [broomcorn]
ref|XP_011085992.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    205   1e-62   
ref|XP_006378330.1|  hypothetical protein POPTR_0010s08140g             206   1e-62   
dbj|BAJ89549.1|  predicted protein                                      206   1e-62   
ref|XP_002271024.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   2e-62   Vitis vinifera
ref|XP_006395017.1|  hypothetical protein EUTSA_v10004974mg             206   2e-62   
ref|XP_010926891.1|  PREDICTED: protein G1-like1                        207   2e-62   
gb|KGN49491.1|  hypothetical protein Csa_6G526250                       206   2e-62   
ref|XP_004134890.1|  PREDICTED: uncharacterized protein LOC101208925    205   2e-62   
ref|XP_008807164.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    207   3e-62   
ref|XP_009763597.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    205   3e-62   
ref|XP_008661390.1|  PREDICTED: putative protein of unknown funct...    204   3e-62   
ref|NP_001131560.1|  putative protein of unknown function (DUF640...    205   3e-62   Zea mays [maize]
ref|XP_010277024.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    204   4e-62   
dbj|BAI52973.1|  G1-like protein                                        205   4e-62   Physcomitrella patens
ref|XP_009407185.1|  PREDICTED: protein G1-like4                        204   5e-62   
ref|XP_003540402.1|  PREDICTED: uncharacterized protein LOC100802...    204   5e-62   
ref|XP_002973743.1|  hypothetical protein SELMODRAFT_36560              203   6e-62   
ref|XP_008367221.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    205   6e-62   
ref|XP_010689830.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    204   6e-62   
ref|XP_006362411.1|  PREDICTED: uncharacterized protein LOC102591189    204   7e-62   
ref|XP_006358940.1|  PREDICTED: uncharacterized protein LOC102602985    204   8e-62   
ref|XP_003581429.1|  PREDICTED: protein G1-like4                        204   9e-62   
ref|XP_002454193.1|  hypothetical protein SORBIDRAFT_04g026450          204   9e-62   Sorghum bicolor [broomcorn]
ref|XP_007149738.1|  hypothetical protein PHAVU_005G095100g             203   9e-62   
ref|XP_006469013.1|  PREDICTED: uncharacterized protein LOC102606613    203   9e-62   
ref|XP_008218325.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    204   1e-61   
ref|XP_007205890.1|  hypothetical protein PRUPE_ppa011331mg             204   1e-61   
gb|KDP35079.1|  hypothetical protein JCGZ_11031                         203   1e-61   
ref|XP_002522583.1|  conserved hypothetical protein                     203   1e-61   Ricinus communis
ref|XP_009365981.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    204   1e-61   
ref|XP_006446791.1|  hypothetical protein CICLE_v10016699mg             204   1e-61   
ref|XP_011005316.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    206   1e-61   
ref|NP_001053313.1|  Os04g0516200                                       204   1e-61   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001145392.1|  putative protein of unknown function (DUF640...    204   1e-61   Zea mays [maize]
ref|XP_003524092.1|  PREDICTED: uncharacterized protein LOC100775838    205   1e-61   
ref|XP_007048693.1|  Pleckstrin domain-containing family N member 1     204   1e-61   
ref|XP_009773140.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    203   1e-61   
ref|XP_010104392.1|  hypothetical protein L484_010344                   202   2e-61   
ref|XP_004953146.1|  PREDICTED: uncharacterized protein LOC101777...    203   2e-61   
ref|XP_010508549.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   2e-61   
emb|CDO96796.1|  unnamed protein product                                203   2e-61   
gb|EAZ31342.1|  hypothetical protein OsJ_15463                          203   2e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006296565.1|  hypothetical protein CARUB_v100241591mg            202   2e-61   
gb|KHN05068.1|  hypothetical protein glysoja_013975                     201   2e-61   
ref|XP_010506094.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   2e-61   
ref|XP_003571880.1|  PREDICTED: protein G1-like5                        203   2e-61   
ref|XP_006845978.1|  hypothetical protein AMTR_s00155p00022580          204   3e-61   
ref|XP_006592933.1|  PREDICTED: uncharacterized protein LOC100806...    202   3e-61   
ref|XP_010524062.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   3e-61   
ref|XP_010324393.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    203   3e-61   
dbj|BAI52974.1|  G1-like protein                                        204   3e-61   Selaginella moellendorffii
ref|XP_009784769.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   3e-61   
ref|XP_010052190.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   3e-61   
ref|XP_003553762.1|  PREDICTED: uncharacterized protein LOC100786135    202   3e-61   
ref|XP_009133547.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   4e-61   
ref|XP_002961823.1|  hypothetical protein SELMODRAFT_68566              202   4e-61   
ref|XP_004233074.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   4e-61   
ref|XP_011008476.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   4e-61   
ref|XP_009608555.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   4e-61   
ref|NP_565978.1|  uncharacterized protein                               201   4e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003531069.1|  PREDICTED: uncharacterized protein LOC100798406    204   4e-61   
ref|XP_008391225.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   5e-61   
ref|XP_002305745.1|  hypothetical protein POPTR_0004s05610g             201   5e-61   Populus trichocarpa [western balsam poplar]
gb|KHN36698.1|  hypothetical protein glysoja_001429                     201   5e-61   
ref|XP_002521586.1|  conserved hypothetical protein                     201   5e-61   Ricinus communis
ref|XP_010455174.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   5e-61   
ref|XP_004976223.1|  PREDICTED: uncharacterized protein LOC101784...    202   6e-61   
gb|KHG07235.1|  Putative beta-lactamase-like 1                          201   6e-61   
emb|CDY05593.1|  BnaC02g39440D                                          202   6e-61   
ref|XP_006652517.1|  PREDICTED: uncharacterized protein LOC102706933    202   6e-61   
ref|XP_006288726.1|  hypothetical protein CARUB_v10002037mg             201   7e-61   
ref|XP_007021735.1|  Uncharacterized protein TCM_031777                 201   7e-61   
ref|XP_006360044.1|  PREDICTED: uncharacterized protein LOC102584680    202   7e-61   
ref|XP_004239743.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    202   8e-61   
ref|XP_008465553.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   9e-61   
ref|XP_009391315.1|  PREDICTED: protein G1-like4                        201   9e-61   
ref|XP_002280666.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   9e-61   Vitis vinifera
ref|XP_002879996.1|  hypothetical protein ARALYDRAFT_903634             201   1e-60   
ref|XP_010525031.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   1e-60   
ref|XP_007132855.1|  hypothetical protein PHAVU_011G130300g             201   1e-60   
ref|XP_003575389.1|  PREDICTED: protein G1-like3                        201   1e-60   
emb|CDY52505.1|  BnaAnng11520D                                          201   1e-60   
ref|XP_002533787.1|  conserved hypothetical protein                     203   1e-60   Ricinus communis
ref|XP_010109876.1|  hypothetical protein L484_003806                   201   1e-60   
ref|XP_010421690.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   1e-60   
ref|XP_010553628.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   1e-60   
gb|KHN30574.1|  hypothetical protein glysoja_030011                     199   1e-60   
ref|XP_002267312.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   1e-60   Vitis vinifera
ref|XP_011015901.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   1e-60   
ref|XP_002299015.2|  hypothetical protein POPTR_0001s46470g             204   1e-60   Populus trichocarpa [western balsam poplar]
ref|XP_001760807.1|  predicted protein                                  199   1e-60   
ref|XP_001753736.1|  predicted protein                                  199   1e-60   
emb|CAN66524.1|  hypothetical protein VITISV_034969                     199   1e-60   Vitis vinifera
ref|XP_008808528.1|  PREDICTED: protein G1-like1                        202   2e-60   
gb|ACG39130.1|  hypothetical protein                                    203   2e-60   Zea mays [maize]
ref|XP_006467647.1|  PREDICTED: uncharacterized protein LOC102611919    201   2e-60   
ref|XP_006370148.1|  hypothetical protein POPTR_0001s40140g             200   2e-60   
ref|NP_001131187.1|  uncharacterized protein LOC100192495               203   2e-60   Zea mays [maize]
ref|XP_011013261.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   2e-60   
emb|CDY52479.1|  BnaC07g49400D                                          200   2e-60   
gb|EMT15276.1|  hypothetical protein F775_21904                         201   2e-60   
ref|XP_004504735.1|  PREDICTED: uncharacterized protein LOC101506113    202   2e-60   
ref|XP_006449503.1|  hypothetical protein CICLE_v10016772mg             201   2e-60   
ref|XP_010052695.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   2e-60   
ref|XP_002317078.1|  hypothetical protein POPTR_0011s16010g             202   2e-60   
ref|NP_001047471.1|  Os02g0623400                                       202   2e-60   
gb|KFK26569.1|  hypothetical protein AALP_AA8G265800                    200   2e-60   
ref|XP_006411528.1|  hypothetical protein EUTSA_v10017308mg             200   2e-60   
ref|XP_007215057.1|  hypothetical protein PRUPE_ppa012217mg             200   2e-60   
ref|XP_009786006.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   2e-60   
dbj|BAD22522.1|  hypothetical protein                                   202   3e-60   
ref|NP_001046002.1|  Os02g0166800                                       200   3e-60   
ref|XP_011101384.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   3e-60   
ref|NP_001235660.1|  uncharacterized protein LOC100306225               199   3e-60   
gb|KHN45745.1|  hypothetical protein glysoja_043995                     199   3e-60   
ref|NP_198201.1|  protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 1            200   3e-60   
emb|CDY57024.1|  BnaA09g03420D                                          200   3e-60   
ref|XP_002451603.1|  hypothetical protein SORBIDRAFT_04g004470          202   4e-60   
ref|XP_011011486.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   4e-60   
ref|XP_008388722.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   4e-60   
ref|XP_002317421.1|  hypothetical protein POPTR_0011s07350g             199   4e-60   
ref|XP_009364442.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    200   4e-60   
ref|XP_010923781.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   4e-60   
gb|KDP21096.1|  hypothetical protein JCGZ_21567                         199   4e-60   
ref|XP_007159026.1|  hypothetical protein PHAVU_002G202200g             201   4e-60   
ref|XP_002874426.1|  light-dependent short hypocotyls 1                 199   4e-60   
ref|XP_009384186.1|  PREDICTED: protein G1-like1                        201   5e-60   
ref|XP_006442502.1|  hypothetical protein CICLE_v10022456mg             199   5e-60   
ref|XP_003560443.1|  PREDICTED: protein G1-like1                        202   5e-60   
ref|XP_011040543.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    201   6e-60   
ref|XP_008341169.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   6e-60   
ref|XP_004151474.1|  PREDICTED: uncharacterized protein LOC101210225    199   6e-60   
ref|XP_010314085.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    198   6e-60   
ref|XP_009129837.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   7e-60   
gb|KCW67509.1|  hypothetical protein EUGRSUZ_F01238                     199   7e-60   
dbj|BAJ93059.1|  predicted protein                                      201   7e-60   
ref|XP_009385358.1|  PREDICTED: protein G1-like7                        199   7e-60   
ref|XP_009593391.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   7e-60   
ref|XP_004248241.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   8e-60   
gb|KGN65636.1|  hypothetical protein Csa_1G474480                       199   8e-60   
emb|CDY55387.1|  BnaA05g34250D                                          198   9e-60   
ref|NP_001237763.1|  uncharacterized protein LOC100527554               199   9e-60   
emb|CDY64755.1|  BnaCnng44770D                                          199   9e-60   
ref|XP_002456918.1|  hypothetical protein SORBIDRAFT_03g045430          203   9e-60   
ref|XP_008368001.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   1e-59   
ref|XP_002521975.1|  conserved hypothetical protein                     199   1e-59   
ref|XP_003526225.1|  PREDICTED: uncharacterized protein LOC100815968    198   1e-59   
ref|XP_011083008.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   1e-59   
ref|XP_008225289.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   1e-59   
ref|XP_003520849.1|  PREDICTED: uncharacterized protein LOC100803965    198   1e-59   
gb|AFW76035.1|  putative protein of unknown function (DUF640) dom...    201   1e-59   
ref|XP_009334040.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   1e-59   
emb|CDX86199.1|  BnaA06g29160D                                          198   1e-59   
ref|XP_009142076.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   1e-59   
ref|XP_009384790.1|  PREDICTED: protein G1-like7                        199   2e-59   
ref|XP_004174117.1|  PREDICTED: uncharacterized protein LOC101228453    198   2e-59   
ref|XP_004243287.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   2e-59   
gb|KHG14703.1|  Dermatan-sulfate epimerase                              198   2e-59   
ref|XP_004970435.1|  PREDICTED: uncharacterized protein LOC101754104    199   2e-59   
ref|XP_010523365.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    199   2e-59   
ref|XP_004966292.1|  PREDICTED: uncharacterized protein LOC101766...    201   2e-59   
gb|KEH31304.1|  G1-like protein                                         199   2e-59   
gb|KHN36883.1|  hypothetical protein glysoja_001614                     198   2e-59   
emb|CDY14848.1|  BnaC04g48450D                                          197   2e-59   
ref|XP_003542999.1|  PREDICTED: uncharacterized protein LOC100778886    197   2e-59   
gb|ACG41469.1|  hypothetical protein                                    200   2e-59   
sp|Q941W1.1|G1L7_ORYSJ  RecName: Full=Protein G1-like7                  198   2e-59   
sp|A2XED8.1|G1L7_ORYSI  RecName: Full=Protein G1-like7                  198   2e-59   
ref|XP_007212120.1|  hypothetical protein PRUPE_ppa012018mg             197   3e-59   
ref|NP_001058335.1|  Os06g0672400                                       200   3e-59   
ref|XP_008371461.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   3e-59   
ref|XP_007149389.1|  hypothetical protein PHAVU_005G066200g             197   3e-59   
ref|XP_006348870.1|  PREDICTED: uncharacterized protein LOC102600485    197   3e-59   
ref|XP_009419635.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    198   3e-59   
ref|XP_011038515.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   3e-59   
gb|KDP23712.1|  hypothetical protein JCGZ_23545                         197   3e-59   
ref|XP_006345889.1|  PREDICTED: uncharacterized protein LOC102588665    198   3e-59   
ref|XP_010024955.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   3e-59   
ref|XP_008674867.1|  PREDICTED: protein G1-like7                        198   3e-59   
ref|XP_008456451.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   3e-59   
ref|XP_008342774.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   4e-59   
ref|XP_008370739.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   4e-59   
ref|XP_002317458.1|  hypothetical protein POPTR_0011s11120g             196   4e-59   
ref|XP_002319107.2|  hypothetical protein POPTR_0013s04360g             197   4e-59   
gb|ACL54022.1|  unknown                                                 199   4e-59   
ref|XP_009399257.1|  PREDICTED: protein G1-like1                        198   4e-59   
ref|XP_006487714.1|  PREDICTED: uncharacterized protein LOC102610630    197   4e-59   
ref|XP_007148048.1|  hypothetical protein PHAVU_006G176100g             197   5e-59   
emb|CDO99989.1|  unnamed protein product                                197   5e-59   
ref|NP_001136860.1|  putative protein of unknown function (DUF640...    199   5e-59   
ref|XP_006442675.1|  hypothetical protein CICLE_v10022288mg             197   5e-59   
ref|XP_004302092.1|  PREDICTED: uncharacterized protein LOC101292320    197   5e-59   
ref|XP_009142855.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   5e-59   
ref|XP_009369632.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   5e-59   
ref|XP_002320411.1|  hypothetical protein POPTR_0014s13900g             196   5e-59   
ref|XP_008358651.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   6e-59   
ref|XP_007144019.1|  hypothetical protein PHAVU_007G122300g             196   6e-59   
ref|XP_009411199.1|  PREDICTED: protein G1-like7                        197   6e-59   
ref|XP_011033736.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   6e-59   
ref|XP_006350860.1|  PREDICTED: uncharacterized protein LOC102596443    197   7e-59   
ref|XP_008448236.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   7e-59   
ref|XP_001753216.1|  predicted protein                                  195   7e-59   
ref|XP_004489028.1|  PREDICTED: uncharacterized protein LOC101497242    196   7e-59   
ref|XP_004139394.1|  PREDICTED: uncharacterized protein LOC101222316    196   7e-59   
ref|XP_004242504.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   8e-59   
ref|XP_001765087.1|  predicted protein                                  194   8e-59   
gb|AFK47598.1|  unknown                                                 196   9e-59   
ref|XP_004487154.1|  PREDICTED: uncharacterized protein LOC101499419    195   9e-59   
ref|XP_010035859.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   1e-58   
ref|NP_001237249.1|  uncharacterized protein LOC100306082               196   1e-58   
ref|XP_010524920.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   1e-58   
ref|XP_009111892.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   1e-58   
gb|EYU41125.1|  hypothetical protein MIMGU_mgv1a021620mg                195   1e-58   
gb|KGN47252.1|  hypothetical protein Csa_6G236080                       196   1e-58   
ref|XP_004171262.1|  PREDICTED: uncharacterized LOC101216601            196   1e-58   
ref|XP_004485894.1|  PREDICTED: uncharacterized protein LOC101502781    195   1e-58   
gb|AFK34719.1|  unknown                                                 195   1e-58   
ref|XP_002325335.2|  hypothetical protein POPTR_0019s03540g             196   1e-58   
ref|XP_007159450.1|  hypothetical protein PHAVU_002G238600g             195   1e-58   
ref|XP_003569939.1|  PREDICTED: protein G1-like1                        198   2e-58   
ref|XP_002530382.1|  conserved hypothetical protein                     196   2e-58   
ref|XP_010264562.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   2e-58   
ref|XP_007030418.1|  Uncharacterized protein isoform 3                  196   2e-58   
ref|XP_009134766.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   2e-58   
ref|XP_009762992.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    197   2e-58   
ref|XP_011036302.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    195   2e-58   
gb|AES67378.2|  DUF640 family protein                                   194   2e-58   
ref|XP_002458704.1|  hypothetical protein SORBIDRAFT_03g038670          196   2e-58   
ref|XP_004516078.1|  PREDICTED: uncharacterized protein LOC101514778    195   2e-58   
ref|XP_007030419.1|  Uncharacterized protein isoform 4                  196   2e-58   
ref|XP_003597127.1|  177 protein                                        195   2e-58   
ref|XP_011036301.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   2e-58   
ref|XP_006348309.1|  PREDICTED: uncharacterized protein LOC102581082    195   2e-58   
emb|CDP15936.1|  unnamed protein product                                194   2e-58   
ref|XP_003536139.1|  PREDICTED: uncharacterized protein LOC100791424    194   2e-58   
gb|KHN04945.1|  hypothetical protein glysoja_013852                     195   3e-58   
ref|XP_008681302.1|  PREDICTED: putative protein of unknown funct...    199   3e-58   
ref|XP_003596364.1|  177 protein                                        194   3e-58   
ref|XP_009774704.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   3e-58   
ref|XP_006425133.1|  hypothetical protein CICLE_v10029262mg             196   3e-58   
ref|XP_008463732.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   3e-58   
ref|XP_006606450.1|  PREDICTED: uncharacterized protein LOC102663941    194   3e-58   
ref|XP_008681301.1|  PREDICTED: putative protein of unknown funct...    199   3e-58   
ref|XP_003567242.1|  PREDICTED: protein G1-like7                        196   3e-58   
ref|XP_007030416.1|  Uncharacterized protein isoform 1                  196   3e-58   
emb|CAN63025.1|  hypothetical protein VITISV_034817                     194   4e-58   
ref|XP_010694503.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   4e-58   
gb|EYU45022.1|  hypothetical protein MIMGU_mgv1a014215mg                195   4e-58   
emb|CDP06011.1|  unnamed protein product                                195   4e-58   
ref|XP_003590966.1|  hypothetical protein MTR_1g080210                  195   4e-58   
ref|XP_004150559.1|  PREDICTED: uncharacterized protein LOC101216601    196   4e-58   
ref|XP_011080720.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   4e-58   
ref|XP_006417846.1|  hypothetical protein EUTSA_v10009726mg             195   4e-58   
gb|AES61217.2|  light-dependent short hypocotyls protein                194   4e-58   
ref|XP_008237657.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   4e-58   
gb|KDP34762.1|  hypothetical protein JCGZ_10542                         194   4e-58   
ref|XP_007030417.1|  Uncharacterized protein isoform 2                  195   4e-58   
gb|KDP45779.1|  hypothetical protein JCGZ_17386                         196   4e-58   
gb|KHG20571.1|  hypothetical protein F383_02028                         195   5e-58   
ref|XP_009397354.1|  PREDICTED: protein G1-like1                        195   5e-58   
ref|XP_011082761.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   5e-58   
ref|XP_009339946.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   5e-58   
ref|XP_009402225.1|  PREDICTED: protein G1-like7                        195   6e-58   
gb|AFK49191.1|  unknown                                                 194   6e-58   
ref|XP_002278283.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   6e-58   
emb|CAN60458.1|  hypothetical protein VITISV_019556                     195   6e-58   
ref|XP_009629990.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    196   6e-58   
ref|XP_009376979.1|  PREDICTED: LOW QUALITY PROTEIN: protein LIGH...    194   7e-58   
ref|XP_010089535.1|  hypothetical protein L484_011699                   196   7e-58   
ref|XP_004174147.1|  PREDICTED: uncharacterized LOC101222335            194   7e-58   
gb|KDO66991.1|  hypothetical protein CISIN_1g023835mg                   194   8e-58   
ref|XP_008355077.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    195   8e-58   
ref|XP_006488572.1|  PREDICTED: uncharacterized protein LOC102610331    194   8e-58   
ref|XP_002301561.2|  hypothetical protein POPTR_0002s22690g             193   9e-58   
ref|XP_010457872.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   9e-58   
ref|XP_010257059.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   9e-58   
ref|XP_009605797.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   1e-57   
ref|XP_002285447.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   1e-57   
ref|XP_007147217.1|  hypothetical protein PHAVU_006G105500g             193   1e-57   
ref|XP_007133232.1|  hypothetical protein PHAVU_011G162700g             193   1e-57   
emb|CDY49331.1|  BnaA05g32930D                                          194   1e-57   
sp|Q6ATW6.1|G1L8_ORYSJ  RecName: Full=Protein G1-like8                  195   1e-57   
ref|XP_009587002.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   1e-57   
ref|XP_010469892.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   1e-57   
ref|XP_004134659.1|  PREDICTED: uncharacterized protein LOC101214534    194   1e-57   
ref|XP_010475462.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   1e-57   
ref|XP_003531259.1|  PREDICTED: uncharacterized protein LOC100810655    192   1e-57   
ref|XP_009123983.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   1e-57   
ref|XP_004303183.1|  PREDICTED: uncharacterized protein LOC101307414    194   1e-57   
ref|XP_008465528.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   1e-57   
ref|XP_010487116.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   1e-57   
ref|XP_009626514.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   1e-57   
ref|XP_007212123.1|  hypothetical protein PRUPE_ppa012057mg             193   1e-57   
ref|XP_002313971.1|  hypothetical protein POPTR_0009s07990g             194   1e-57   
ref|XP_008226537.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   1e-57   
ref|XP_007205822.1|  hypothetical protein PRUPE_ppa010883mg             194   1e-57   
gb|EYU43335.1|  hypothetical protein MIMGU_mgv1a022623mg                192   1e-57   
ref|XP_006303356.1|  hypothetical protein CARUB_v10010340mg             193   2e-57   
ref|XP_010414310.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   2e-57   
sp|A2Y5N0.1|G1L8_ORYSI  RecName: Full=Protein G1-like8                  194   2e-57   
ref|XP_010108230.1|  hypothetical protein L484_018651                   192   2e-57   
ref|NP_563780.1|  protein LIGHT SENSITIVE HYPOCOTYLS 6                  193   2e-57   
ref|XP_010510405.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   2e-57   
ref|XP_003638136.1|  hypothetical protein MTR_119s0026                  200   2e-57   
ref|XP_006295008.1|  hypothetical protein CARUB_v10024080mg             193   2e-57   
ref|XP_003552937.1|  PREDICTED: AT-rich interactive domain-contai...    194   2e-57   
ref|XP_009383380.1|  PREDICTED: protein G1-like7                        193   2e-57   
ref|XP_003607586.1|  177 protein                                        192   2e-57   
ref|XP_008457335.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   2e-57   
ref|XP_004145308.1|  PREDICTED: uncharacterized protein LOC101222335    193   2e-57   
emb|CDM84812.1|  unnamed protein product                                193   2e-57   
gb|EPS69070.1|  hypothetical protein M569_05697                         190   2e-57   
emb|CDY42932.1|  BnaC05g47190D                                          192   2e-57   
ref|XP_008384749.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    194   2e-57   
gb|KDO66990.1|  hypothetical protein CISIN_1g023835mg                   195   2e-57   
ref|XP_006847407.1|  hypothetical protein AMTR_s00153p00047660          193   3e-57   
gb|KFK43023.1|  hypothetical protein AALP_AA1G068900                    192   3e-57   
ref|XP_009151249.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    192   3e-57   
emb|CDP09236.1|  unnamed protein product                                193   3e-57   
gb|EEE55616.1|  hypothetical protein OsJ_03942                          192   3e-57   
gb|AFK41155.1|  unknown                                                 192   3e-57   
ref|XP_008457336.1|  PREDICTED: protein LIGHT-DEPENDENT SHORT HYP...    193   3e-57   



>ref|XP_011004043.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Populus 
euphratica]
Length=199

 Score =   224 bits (570),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  185  PQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTP  364
            P  S   SRYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTP
Sbjct  37   PPSSTTPSRYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTP  96

Query  365  ICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREV  544
            ICPFYGHPNPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREV
Sbjct  97   ICPFYGHPNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREV  156

Query  545  RDLQSKARGISYE  583
            RDLQSKARGISYE
Sbjct  157  RDLQSKARGISYE  169



>ref|XP_002306857.2| hypothetical protein POPTR_0005s24730g [Populus trichocarpa]
 gb|ABK94898.1| unknown [Populus trichocarpa]
 gb|EEE93853.2| hypothetical protein POPTR_0005s24730g [Populus trichocarpa]
Length=199

 Score =   224 bits (570),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +2

Query  185  PQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTP  364
            P  S   SRYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTP
Sbjct  37   PPSSTTPSRYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTP  96

Query  365  ICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREV  544
            ICPFYGHPNPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREV
Sbjct  97   ICPFYGHPNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREV  156

Query  545  RDLQSKARGISYE  583
            RDLQSKARGISYE
Sbjct  157  RDLQSKARGISYE  169



>gb|EYU46446.1| hypothetical protein MIMGU_mgv1a020501mg [Erythranthe guttata]
Length=193

 Score =   222 bits (566),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 117/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  200  ALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFY  379
             LSRYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFY
Sbjct  40   TLSRYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFY  99

Query  380  GHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQS  559
            GHPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PETNPFGARAVRLYLR+VRDLQS
Sbjct  100  GHPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPETNPFGARAVRLYLRDVRDLQS  159

Query  560  KARGISYE  583
            KARGISYE
Sbjct  160  KARGISYE  167



>ref|XP_009336145.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Pyrus 
x bretschneideri]
 ref|XP_009336146.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Pyrus 
x bretschneideri]
 ref|XP_009336147.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Pyrus 
x bretschneideri]
Length=215

 Score =   223 bits (568),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  60   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  119

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  120  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  179

Query  569  GISYE  583
            GISYE
Sbjct  180  GISYE  184



>ref|XP_008356205.1| PREDICTED: LOW QUALITY PROTEIN: protein LIGHT-DEPENDENT SHORT 
HYPOCOTYLS 4-like [Malus domestica]
Length=221

 Score =   223 bits (568),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  66   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  125

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  126  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  185

Query  569  GISYE  583
            GISYE
Sbjct  186  GISYE  190



>gb|KEH23934.1| G1-like protein [Medicago truncatula]
Length=214

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGH
Sbjct  63   SRYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGH  122

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRDLQSKA
Sbjct  123  PNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDLQSKA  182

Query  566  RGISYE  583
            RGISYE
Sbjct  183  RGISYE  188



>ref|XP_008235666.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Prunus 
mume]
Length=214

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  62   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  121

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  122  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  181

Query  569  GISYE  583
            GISYE
Sbjct  182  GISYE  186



>ref|XP_010652376.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Vitis 
vinifera]
Length=183

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGH
Sbjct  37   SRYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGH  96

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKA
Sbjct  97   PNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKA  156

Query  566  RGISYE  583
            RGISYE
Sbjct  157  RGISYE  162



>emb|CAN67056.1| hypothetical protein VITISV_036348 [Vitis vinifera]
Length=177

 Score =   220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGH
Sbjct  31   SRYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGH  90

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKA
Sbjct  91   PNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKA  150

Query  566  RGISYE  583
            RGISYE
Sbjct  151  RGISYE  156



>ref|XP_011080055.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Sesamum 
indicum]
Length=190

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  39   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  98

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PETNPFGARAVRLYLREVRDLQSKAR
Sbjct  99   NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPETNPFGARAVRLYLREVRDLQSKAR  158

Query  569  GISYE  583
            GISYE
Sbjct  159  GISYE  163



>ref|XP_004493783.1| PREDICTED: uncharacterized protein LOC101490141 [Cicer arietinum]
Length=206

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGH
Sbjct  57   SRYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGH  116

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPP PCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKA
Sbjct  117  PNPPGPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKA  176

Query  566  RGISYE  583
            RGISYE
Sbjct  177  RGISYE  182



>ref|XP_004292213.1| PREDICTED: uncharacterized protein LOC101301170 [Fragaria vesca 
subsp. vesca]
Length=213

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  60   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  119

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  120  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  179

Query  569  GISYE  583
            GISYE
Sbjct  180  GISYE  184



>gb|KDO60474.1| hypothetical protein CISIN_1g046561mg [Citrus sinensis]
Length=204

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  52   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  111

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD+QSKAR
Sbjct  112  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDVQSKAR  171

Query  569  GISYE  583
            GISYE
Sbjct  172  GISYE  176



>gb|KEH42512.1| G1-like protein [Medicago truncatula]
Length=222

 Score =   221 bits (563),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  52   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  111

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRDLQSKAR
Sbjct  112  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDLQSKAR  171

Query  569  GISYE  583
            GISYE
Sbjct  172  GISYE  176



>ref|XP_009594800.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Nicotiana 
tomentosiformis]
Length=189

 Score =   219 bits (559),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTK+HTPICPFYGHP
Sbjct  40   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKIHTPICPFYGHP  99

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PETNPFGARAVRLYLREVRDLQSKAR
Sbjct  100  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPETNPFGARAVRLYLREVRDLQSKAR  159

Query  569  GISYE  583
            G+SYE
Sbjct  160  GVSYE  164



>ref|XP_009780996.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Nicotiana 
sylvestris]
Length=183

 Score =   219 bits (559),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTK+HTPICPFYGHP
Sbjct  34   RYENQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGKTKIHTPICPFYGHP  93

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PETNPFGARAVRLYLREVRDLQSKAR
Sbjct  94   NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPETNPFGARAVRLYLREVRDLQSKAR  153

Query  569  GISYE  583
            G+SYE
Sbjct  154  GVSYE  158



>emb|CDO99243.1| unnamed protein product [Coffea canephora]
Length=180

 Score =   219 bits (558),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  33   LSRYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFG  92

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPP+PCPCPLRQAWGSLDALIGRLRAAYEENGG PETNPFGARAVRLYLREVRD Q+K
Sbjct  93   HPNPPSPCPCPLRQAWGSLDALIGRLRAAYEENGGKPETNPFGARAVRLYLREVRDSQAK  152

Query  563  ARGISYE  583
            ARGISYE
Sbjct  153  ARGISYE  159



>ref|XP_011028817.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Populus 
euphratica]
 ref|XP_011013567.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Populus 
euphratica]
Length=193

 Score =   219 bits (559),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  43   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  102

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  103  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  162

Query  569  GISYE  583
            G+SYE
Sbjct  163  GVSYE  167



>ref|XP_002302041.2| hypothetical protein POPTR_0002s03860g [Populus trichocarpa]
 gb|EEE81314.2| hypothetical protein POPTR_0002s03860g [Populus trichocarpa]
Length=195

 Score =   219 bits (559),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  43   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  102

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  103  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  162

Query  569  GISYE  583
            G+SYE
Sbjct  163  GVSYE  167



>ref|XP_007201372.1| hypothetical protein PRUPE_ppa012142mg [Prunus persica]
 gb|EMJ02571.1| hypothetical protein PRUPE_ppa012142mg [Prunus persica]
Length=182

 Score =   219 bits (558),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  30   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  89

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  90   NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  149

Query  569  GISYE  583
            GISYE
Sbjct  150  GISYE  154



>ref|XP_007050277.1| IQ motif and SEC7 domain-containing protein 2 [Theobroma cacao]
 gb|EOX94434.1| IQ motif and SEC7 domain-containing protein 2 [Theobroma cacao]
Length=187

 Score =   219 bits (558),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  41   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  100

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  101  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  160

Query  569  GISYE  583
            GISYE
Sbjct  161  GISYE  165



>ref|XP_008382857.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Malus 
domestica]
Length=225

 Score =   220 bits (561),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL  C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  70   RYENQKRRDWNTFGQYLKNHRPPLSLSWCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  129

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  130  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  189

Query  569  GISYE  583
            GISYE
Sbjct  190  GISYE  194



>ref|XP_009369473.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Pyrus 
x bretschneideri]
Length=225

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL  C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  70   RYENQKRRDWNTFGQYLKNHRPPLSLSWCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  129

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  130  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  189

Query  569  GISYE  583
            GISYE
Sbjct  190  GISYE  194



>gb|KHN10748.1| hypothetical protein glysoja_019179 [Glycine soja]
Length=203

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  49   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  108

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  109  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  168

Query  569  GISYE  583
            GISYE
Sbjct  169  GISYE  173



>ref|XP_003521294.1| PREDICTED: uncharacterized protein LOC100778283 isoform X1 [Glycine 
max]
 ref|XP_006576945.1| PREDICTED: uncharacterized protein LOC100778283 isoform X2 [Glycine 
max]
Length=203

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  49   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  108

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  109  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  168

Query  569  GISYE  583
            GISYE
Sbjct  169  GISYE  173



>emb|CDP03752.1| unnamed protein product [Coffea canephora]
Length=195

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  38   RYENQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  97

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  98   NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGRPEANPFGARAVRLYLREVRDLQSKAR  157

Query  569  GISYE  583
            GISYE
Sbjct  158  GISYE  162



>ref|XP_003537033.1| PREDICTED: uncharacterized protein LOC100803605 [Glycine max]
Length=207

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  43   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  102

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVR+LQSKAR
Sbjct  103  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRELQSKAR  162

Query  569  GISYE  583
            GISYE
Sbjct  163  GISYE  167



>ref|NP_001235822.1| uncharacterized protein LOC100527164 [Glycine max]
 ref|XP_006603682.1| PREDICTED: uncharacterized protein LOC100527164 isoform X1 [Glycine 
max]
 gb|ACU16214.1| unknown [Glycine max]
 gb|KHN02499.1| hypothetical protein glysoja_002523 [Glycine soja]
Length=203

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  49   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  108

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  109  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  168

Query  569  GISYE  583
            GISYE
Sbjct  169  GISYE  173



>ref|XP_004495090.1| PREDICTED: activating signal cointegrator 1 complex subunit 2 
homolog [Cicer arietinum]
Length=235

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  57   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  116

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRDLQSKAR
Sbjct  117  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDLQSKAR  176

Query  569  GISYE  583
            GISYE
Sbjct  177  GISYE  181



>gb|KDP26521.1| hypothetical protein JCGZ_17679 [Jatropha curcas]
Length=195

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  49   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  108

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  109  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  168

Query  569  GISYE  583
            GISYE
Sbjct  169  GISYE  173



>ref|XP_009398447.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
Length=198

 Score =   218 bits (556),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = +2

Query  197  PALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPF  376
            P+LSRYESQKRRDWNTFGQYL+N RPP++L QC+  HVLEFLRYLDQFGKTK+HT +CPF
Sbjct  47   PSLSRYESQKRRDWNTFGQYLRNHRPPLALSQCSSAHVLEFLRYLDQFGKTKIHTHMCPF  106

Query  377  YGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQ  556
            +GHPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PETNPFGAR VRLYLREVR++Q
Sbjct  107  FGHPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPETNPFGARVVRLYLREVREVQ  166

Query  557  SKARGISYE  583
            SKARG+SYE
Sbjct  167  SKARGVSYE  175



>ref|XP_007144887.1| hypothetical protein PHAVU_007G192200g [Phaseolus vulgaris]
 gb|ESW16881.1| hypothetical protein PHAVU_007G192200g [Phaseolus vulgaris]
Length=209

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/126 (91%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGH
Sbjct  44   SRYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGH  103

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFGARAVRLYLREVR+LQSKA
Sbjct  104  PNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPEINPFGARAVRLYLREVRELQSKA  163

Query  566  RGISYE  583
            RGISYE
Sbjct  164  RGISYE  169



>ref|XP_006354481.1| PREDICTED: uncharacterized protein LOC102586971 [Solanum tuberosum]
Length=203

 Score =   218 bits (554),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  200  ALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFY  379
             LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+
Sbjct  51   TLSRYENQKRRDWNTFGQYLRNHRPPLSLTRCSGAHVLEFLRYLDQFGKTKVHTQLCPFF  110

Query  380  GHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQS  559
            GHPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PETNPFGARAVRLYLREVRD Q+
Sbjct  111  GHPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPETNPFGARAVRLYLREVRDSQA  170

Query  560  KARGISYE  583
            KARGISYE
Sbjct  171  KARGISYE  178



>ref|XP_009772674.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Nicotiana 
sylvestris]
Length=195

 Score =   217 bits (553),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP++L +C+  HVLEFLRYLDQFGKTKVHT +CPFYG
Sbjct  41   LSRYENQKRRDWNTFGQYLRNHRPPLTLTRCSGAHVLEFLRYLDQFGKTKVHTQLCPFYG  100

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PETNPFGARAVRLYLREVRD Q+K
Sbjct  101  HPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPETNPFGARAVRLYLREVRDSQAK  160

Query  563  ARGISYE  583
            ARGISYE
Sbjct  161  ARGISYE  167



>ref|XP_007162548.1| hypothetical protein PHAVU_001G161400g [Phaseolus vulgaris]
 gb|ESW34542.1| hypothetical protein PHAVU_001G161400g [Phaseolus vulgaris]
Length=199

 Score =   217 bits (553),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  48   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  107

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  108  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  167

Query  569  GISYE  583
            GISYE
Sbjct  168  GISYE  172



>ref|XP_006352738.1| PREDICTED: uncharacterized protein LOC102585062 [Solanum tuberosum]
Length=203

 Score =   217 bits (553),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP++L +C+  HVLEFLRYLDQFGKTKVHTP+CPFYGHP
Sbjct  48   RYENQKRRDWNTFGQYLRNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHTPMCPFYGHP  107

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPL+QAWGSLDAL+GRLRAAYEENGG PETNPFGARAVRLYLREVRDLQSKAR
Sbjct  108  NPPAPCPCPLKQAWGSLDALVGRLRAAYEENGGKPETNPFGARAVRLYLREVRDLQSKAR  167

Query  569  GISYE  583
            G+SYE
Sbjct  168  GVSYE  172



>ref|XP_009603577.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Nicotiana 
tomentosiformis]
Length=197

 Score =   217 bits (552),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP++L +C+  HVLEFLRYLDQFGKTKVHT +CPFYG
Sbjct  42   LSRYENQKRRDWNTFGQYLRNHRPPLTLTRCSGAHVLEFLRYLDQFGKTKVHTQLCPFYG  101

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PETNPFGARAVRLYLREVRD Q+K
Sbjct  102  HPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPETNPFGARAVRLYLREVRDSQAK  161

Query  563  ARGISYE  583
            ARGISYE
Sbjct  162  ARGISYE  168



>ref|NP_001048473.1| Os02g0811000 [Oryza sativa Japonica Group]
 sp|Q6K5X1.1|G1L6_ORYSJ RecName: Full=Protein G1-like6 [Oryza sativa Japonica Group]
 sp|A2XAV5.1|G1L6_ORYSI RecName: Full=Protein G1-like6 [Oryza sativa Indica Group]
 dbj|BAD21590.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD22027.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF10387.1| Os02g0811000 [Oryza sativa Japonica Group]
 gb|EAY87965.1| hypothetical protein OsI_09389 [Oryza sativa Indica Group]
 gb|EAZ25035.1| hypothetical protein OsJ_08822 [Oryza sativa Japonica Group]
 dbj|BAG99260.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAI52984.1| G1-like6 protein [Oryza sativa Japonica Group]
Length=248

 Score =   219 bits (557),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFL+Y+DQFGKTKVHTP+CPFYG
Sbjct  78   LSRYESQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLKYMDQFGKTKVHTPVCPFYG  137

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPE NPFGARAVRLYLREVR+ Q++
Sbjct  138  HPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPEMNPFGARAVRLYLREVRETQAR  197

Query  563  ARGISYE  583
            ARGISYE
Sbjct  198  ARGISYE  204



>ref|XP_010532649.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Tarenaya 
hassleriana]
Length=186

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPFYG
Sbjct  37   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFYG  96

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD QSK
Sbjct  97   HPNPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQSK  156

Query  563  ARGISYE  583
            ARGISYE
Sbjct  157  ARGISYE  163



>ref|NP_001235665.1| uncharacterized protein LOC100527409 [Glycine max]
 gb|ACU16499.1| unknown [Glycine max]
Length=211

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  +VLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  46   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGANVLEFLRYLDQFGKTKVHTPICPFYGHP  105

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVR+LQSKAR
Sbjct  106  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRELQSKAR  165

Query  569  GISYE  583
            GISYE
Sbjct  166  GISYE  170



>ref|XP_004242364.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Solanum 
lycopersicum]
Length=218

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP++L +C+  HVLEFLRYLDQFGKTKVHTP+CPFYGHP
Sbjct  51   RYENQKRRDWNTFGQYLRNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHTPMCPFYGHP  110

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPL+QAWGSLDAL+GRLRAAYEENGG PETNPFGARAVRLYLREVRDLQSKAR
Sbjct  111  NPPAPCPCPLKQAWGSLDALVGRLRAAYEENGGKPETNPFGARAVRLYLREVRDLQSKAR  170

Query  569  GISYE  583
            G+SYE
Sbjct  171  GVSYE  175



>ref|XP_004152052.1| PREDICTED: uncharacterized protein LOC101218342 [Cucumis sativus]
 ref|XP_004173379.1| PREDICTED: uncharacterized protein LOC101226268 [Cucumis sativus]
 gb|KGN57902.1| hypothetical protein Csa_3G383780 [Cucumis sativus]
Length=190

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTF QYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  47   RYENQKRRDWNTFCQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  106

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  107  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGMPEANPFGARAVRLYLREVRDLQSKAR  166

Query  569  GISYE  583
            GISYE
Sbjct  167  GISYE  171



>emb|CDY35523.1| BnaA01g23890D [Brassica napus]
Length=195

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  45   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFG  104

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  105  HPNPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  164

Query  563  ARGISYE  583
            ARGISYE
Sbjct  165  ARGISYE  171



>ref|XP_008447416.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Cucumis 
melo]
Length=190

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTF QYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  47   RYENQKRRDWNTFCQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  106

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  107  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGMPEANPFGARAVRLYLREVRDLQSKAR  166

Query  569  GISYE  583
            GISYE
Sbjct  167  GISYE  171



>ref|XP_006443825.1| hypothetical protein CICLE_v10022295mg [Citrus clementina]
 ref|XP_006479528.1| PREDICTED: uncharacterized protein LOC102612277 [Citrus sinensis]
 gb|ESR57065.1| hypothetical protein CICLE_v10022295mg [Citrus clementina]
Length=204

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGH 
Sbjct  52   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHQ  111

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD+QSKAR
Sbjct  112  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDVQSKAR  171

Query  569  GISYE  583
            GISYE
Sbjct  172  GISYE  176



>ref|XP_009391974.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Musa 
acuminata subsp. malaccensis]
Length=200

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTP+CPF+GHP
Sbjct  41   RYESQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPMCPFFGHP  100

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPP+PCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLRE+R++QSKAR
Sbjct  101  NPPSPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREIREMQSKAR  160

Query  569  GISYE  583
            GISYE
Sbjct  161  GISYE  165



>ref|XP_007143863.1| hypothetical protein PHAVU_007G108200g [Phaseolus vulgaris]
 gb|ESW15857.1| hypothetical protein PHAVU_007G108200g [Phaseolus vulgaris]
Length=196

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  47   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTHLCPFFG  106

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD Q+K
Sbjct  107  HPNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDSQAK  166

Query  563  ARGISYE  583
            ARGISYE
Sbjct  167  ARGISYE  173



>ref|NP_001078202.2| protein LIGHT SENSITIVE HYPOCOTYLS 4 [Arabidopsis thaliana]
 sp|Q9LW68.1|LSH4_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4; AltName: 
Full=Protein ORGAN BOUNDARY 4 [Arabidopsis thaliana]
 dbj|BAB02272.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76748.1| uncharacterized protein AT3G23290 [Arabidopsis thaliana]
Length=195

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  46   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTHLCPFFG  105

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  106  HPNPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  165

Query  563  ARGISYE  583
            ARGISYE
Sbjct  166  ARGISYE  172



>ref|XP_007143862.1| hypothetical protein PHAVU_007G108200g [Phaseolus vulgaris]
 gb|ESW15856.1| hypothetical protein PHAVU_007G108200g [Phaseolus vulgaris]
Length=193

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  47   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTHLCPFFG  106

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD Q+K
Sbjct  107  HPNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDSQAK  166

Query  563  ARGISYE  583
            ARGISYE
Sbjct  167  ARGISYE  173



>gb|KFK39618.1| hypothetical protein AALP_AA3G267200 [Arabis alpina]
Length=195

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  46   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFG  105

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  106  HPNPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  165

Query  563  ARGISYE  583
            ARGISYE
Sbjct  166  ARGISYE  172



>ref|XP_010488385.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Camelina 
sativa]
Length=195

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  46   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTHLCPFFG  105

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  106  HPNPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  165

Query  563  ARGISYE  583
            ARGISYE
Sbjct  166  ARGISYE  172



>ref|XP_006298606.1| hypothetical protein CARUB_v10014690mg [Capsella rubella]
 gb|EOA31504.1| hypothetical protein CARUB_v10014690mg [Capsella rubella]
Length=197

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  48   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTNLCPFFG  107

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  108  HPNPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  167

Query  563  ARGISYE  583
            ARGISYE
Sbjct  168  ARGISYE  174



>ref|XP_010466654.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Camelina 
sativa]
Length=195

 Score =   215 bits (547),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  46   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTHLCPFFG  105

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  106  HPNPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  165

Query  563  ARGISYE  583
            ARGISYE
Sbjct  166  ARGISYE  172



>ref|XP_002883419.1| hypothetical protein ARALYDRAFT_898842 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59678.1| hypothetical protein ARALYDRAFT_898842 [Arabidopsis lyrata subsp. 
lyrata]
Length=195

 Score =   215 bits (547),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  46   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTHLCPFFG  105

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  106  HPNPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  165

Query  563  ARGISYE  583
            ARGISYE
Sbjct  166  ARGISYE  172



>ref|XP_010488383.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Camelina 
sativa]
Length=195

 Score =   215 bits (547),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  46   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTHLCPFFG  105

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  106  HPNPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  165

Query  563  ARGISYE  583
            ARGISYE
Sbjct  166  ARGISYE  172



>gb|EPS67535.1| hypothetical protein M569_07240, partial [Genlisea aurea]
Length=144

 Score =   213 bits (542),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            +SRYE+QKRRDWNTFGQYLKN RPP++L  C+  HVLEFLRYLDQFGKTKVH   CPFYG
Sbjct  5    VSRYENQKRRDWNTFGQYLKNHRPPLALNMCSGAHVLEFLRYLDQFGKTKVHAAACPFYG  64

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPCPCPL+QAWGSLDAL+GRLRAAYEENGG PETNPFGARAVRLYLREVRDLQSK
Sbjct  65   HPNPPAPCPCPLKQAWGSLDALVGRLRAAYEENGGKPETNPFGARAVRLYLREVRDLQSK  124

Query  563  ARGISYE  583
            ARGISYE
Sbjct  125  ARGISYE  131



>ref|XP_008810562.1| PREDICTED: protein G1-like4 [Phoenix dactylifera]
Length=198

 Score =   215 bits (547),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  41   RYESQKRRDWNTFGQYLKNHRPPLSLTRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHP  100

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PETNPFGARAVRLYLREVR++Q+KAR
Sbjct  101  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPETNPFGARAVRLYLREVREMQAKAR  160

Query  569  GISYE  583
            GISYE
Sbjct  161  GISYE  165



>ref|XP_006406049.1| hypothetical protein EUTSA_v10021563mg [Eutrema salsugineum]
 gb|ESQ47502.1| hypothetical protein EUTSA_v10021563mg [Eutrema salsugineum]
Length=194

 Score =   214 bits (546),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  45   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFG  104

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  105  HPNPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  164

Query  563  ARGISYE  583
            ARGISYE
Sbjct  165  ARGISYE  171



>ref|XP_010512305.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Camelina 
sativa]
Length=195

 Score =   214 bits (546),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  46   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTHLCPFFG  105

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  106  HPNPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  165

Query  563  ARGISYE  583
            ARGISYE
Sbjct  166  ARGISYE  172



>ref|XP_010527402.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Tarenaya 
hassleriana]
Length=194

 Score =   214 bits (546),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPFYG
Sbjct  41   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFYG  100

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CP RQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  101  HPNPPAPCACPHRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  160

Query  563  ARGISYE  583
            ARGISYE
Sbjct  161  ARGISYE  167



>ref|XP_009399464.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
 ref|XP_009399465.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
Length=196

 Score =   214 bits (546),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTK+HT +CPF+GHP
Sbjct  50   RYESQKRRDWNTFGQYLRNHRPPLSLAQCSSAHVLEFLRYLDQFGKTKIHTHMCPFFGHP  109

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PETNPFGARAVRLYLREVR++QSKAR
Sbjct  110  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPETNPFGARAVRLYLREVREVQSKAR  169

Query  569  GISYE  583
            GISYE
Sbjct  170  GISYE  174



>ref|XP_010101416.1| hypothetical protein L484_005652 [Morus notabilis]
 gb|EXB88382.1| hypothetical protein L484_005652 [Morus notabilis]
Length=280

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQ LKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHTPICPFYGHP
Sbjct  56   RYENQKRRDWNTFGQSLKNPRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPICPFYGHP  115

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRDLQSKAR
Sbjct  116  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDLQSKAR  175

Query  569  GISYE  583
            GISY+
Sbjct  176  GISYD  180



>ref|XP_006648081.1| PREDICTED: uncharacterized protein LOC102709535 [Oryza brachyantha]
Length=242

 Score =   216 bits (550),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFL+Y+DQFGKTKVHTP+CPFYGHP
Sbjct  74   RYESQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLKYMDQFGKTKVHTPVCPFYGHP  133

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPE NPFGARAVRLYLREVR+ Q++AR
Sbjct  134  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPEMNPFGARAVRLYLREVRETQARAR  193

Query  569  GISYE  583
            GISYE
Sbjct  194  GISYE  198



>ref|XP_004247736.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Solanum 
lycopersicum]
Length=208

 Score =   215 bits (547),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  200  ALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFY  379
             LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+
Sbjct  56   TLSRYENQKRRDWNTFGQYLRNHRPPLSLTRCSGAHVLEFLRYLDQFGKTKVHTQLCPFF  115

Query  380  GHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQS  559
            GHPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PETNPFGARAVRLYLREVRD Q+
Sbjct  116  GHPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPETNPFGARAVRLYLREVRDSQA  175

Query  560  KARGISYE  583
            KARGISYE
Sbjct  176  KARGISYE  183



>gb|AFK48050.1| unknown [Medicago truncatula]
 gb|AES61108.2| DUF640 family protein [Medicago truncatula]
Length=197

 Score =   214 bits (546),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  200  ALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFY  379
             LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVH+ ICPF+
Sbjct  50   TLSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHSQICPFF  109

Query  380  GHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQS  559
            GHPNPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRL+LREVRD QS
Sbjct  110  GHPNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEDNPFGARAVRLFLREVRDSQS  169

Query  560  KARGISYE  583
            KARGISYE
Sbjct  170  KARGISYE  177



>ref|XP_003590857.1| hypothetical protein MTR_1g075990, partial [Medicago truncatula]
Length=183

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  200  ALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFY  379
             LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVH+ ICPF+
Sbjct  50   TLSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHSQICPFF  109

Query  380  GHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQS  559
            GHPNPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRL+LREVRD QS
Sbjct  110  GHPNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEDNPFGARAVRLFLREVRDSQS  169

Query  560  KARGISYE  583
            KARGISYE
Sbjct  170  KARGISYE  177



>ref|XP_010469755.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Camelina 
sativa]
Length=219

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +C FYGHP
Sbjct  54   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTDVCHFYGHP  113

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD+QSKAR
Sbjct  114  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDMQSKAR  173

Query  569  GISYE  583
            G+SYE
Sbjct  174  GVSYE  178



>ref|XP_010522152.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Tarenaya 
hassleriana]
Length=218

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHTP+C FYGH
Sbjct  50   SRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPMCHFYGH  109

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPP PCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD QSKA
Sbjct  110  PNPPGPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDSQSKA  169

Query  566  RGISYE  583
            RG+SYE
Sbjct  170  RGVSYE  175



>ref|XP_010414174.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3 [Camelina 
sativa]
Length=219

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +C FYGHP
Sbjct  54   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTNVCHFYGHP  113

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD+QSKAR
Sbjct  114  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDMQSKAR  173

Query  569  GISYE  583
            G+SYE
Sbjct  174  GVSYE  178



>ref|XP_010510232.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Camelina 
sativa]
Length=218

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +C FYGHP
Sbjct  54   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTNVCHFYGHP  113

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD+QSKAR
Sbjct  114  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDMQSKAR  173

Query  569  GISYE  583
            G+SYE
Sbjct  174  GVSYE  178



>ref|XP_010679333.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Beta 
vulgaris subsp. vulgaris]
Length=193

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
             SRYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPFYG
Sbjct  46   FSRYENQKRRDWNTFGQYLKNHRPPLSLNRCSGAHVLEFLRYLDQFGKTKVHTQLCPFYG  105

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFGARAVRL+LREVRD QSK
Sbjct  106  HPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPEINPFGARAVRLFLREVRDSQSK  165

Query  563  ARGISYE  583
            ARGISYE
Sbjct  166  ARGISYE  172



>ref|XP_009401942.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
 ref|XP_009401943.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
 ref|XP_009401944.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
Length=195

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  50   RYESQKRRDWNTFGQYLKNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHP  109

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE+NPFGARAVRLYLREVR+ QSKAR
Sbjct  110  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPESNPFGARAVRLYLREVRETQSKAR  169

Query  569  GISYE  583
            G+SYE
Sbjct  170  GVSYE  174



>ref|XP_006410244.1| hypothetical protein EUTSA_v10017162mg [Eutrema salsugineum]
 gb|ESQ51697.1| hypothetical protein EUTSA_v10017162mg [Eutrema salsugineum]
Length=219

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +C FYGHP
Sbjct  53   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTTVCHFYGHP  112

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD+QSKAR
Sbjct  113  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDMQSKAR  172

Query  569  GISYE  583
            G+SYE
Sbjct  173  GVSYE  177



>ref|XP_006589267.1| PREDICTED: uncharacterized protein LOC100789834 isoform X3 [Glycine 
max]
Length=202

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  194  SPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICP  373
            +  LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CP
Sbjct  51   TTTLSRYENQKRRDWNTFGQYLRNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHTQLCP  110

Query  374  FYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDL  553
            F+GHPNPPA CPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD 
Sbjct  111  FFGHPNPPAACPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDS  170

Query  554  QSKARGISYE  583
            Q+KARGISYE
Sbjct  171  QAKARGISYE  180



>ref|XP_003536217.1| PREDICTED: uncharacterized protein LOC100789834 isoformX2 [Glycine 
max]
Length=199

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  194  SPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICP  373
            +  LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CP
Sbjct  51   TTTLSRYENQKRRDWNTFGQYLRNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHTQLCP  110

Query  374  FYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDL  553
            F+GHPNPPA CPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD 
Sbjct  111  FFGHPNPPAACPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDS  170

Query  554  QSKARGISYE  583
            Q+KARGISYE
Sbjct  171  QAKARGISYE  180



>ref|XP_004296375.1| PREDICTED: uncharacterized protein LOC101303109 [Fragaria vesca 
subsp. vesca]
Length=198

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +2

Query  194  SPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICP  373
            +  LSRYE+QKRRDWNTFGQYL+N RPP+SLP+C+  HVLEFLRYLDQFGKTKVHT +CP
Sbjct  36   TATLSRYENQKRRDWNTFGQYLRNHRPPLSLPRCSGAHVLEFLRYLDQFGKTKVHTQMCP  95

Query  374  FYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDL  553
            F+GHPNPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD 
Sbjct  96   FFGHPNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDS  155

Query  554  QSKARGISY  580
            Q+KARGISY
Sbjct  156  QAKARGISY  164



>ref|XP_002464485.1| hypothetical protein SORBIDRAFT_01g019290 [Sorghum bicolor]
 gb|EER91483.1| hypothetical protein SORBIDRAFT_01g019290 [Sorghum bicolor]
Length=205

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHTP CPF+GH
Sbjct  34   SRYESQKRRDWNTFGQYLRNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHTPACPFFGH  93

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            P PPAPCPCPLRQAWGSLDAL+GRLRAAYEENGG PE NPFGARAVRLYLREVRD QS+A
Sbjct  94   PAPPAPCPCPLRQAWGSLDALVGRLRAAYEENGGRPENNPFGARAVRLYLREVRDHQSRA  153

Query  566  RGISYE  583
            RG+SYE
Sbjct  154  RGVSYE  159



>gb|EYU28084.1| hypothetical protein MIMGU_mgv1a022457mg [Erythranthe guttata]
Length=176

 Score =   213 bits (541),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 120/134 (90%), Gaps = 1/134 (1%)
 Frame = +2

Query  179  HHPQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVH  358
            +HP P+P LSRYESQKRRDWNTFGQYLKNQRPPVSLPQC CNHVLEFLRYLDQFGKTKVH
Sbjct  14   NHP-PAPPLSRYESQKRRDWNTFGQYLKNQRPPVSLPQCNCNHVLEFLRYLDQFGKTKVH  72

Query  359  TPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLR  538
               C F+G P PPAPC CPLRQAWGSLDALIGRLRAAYEE+GG+PETNPFG  ++R+YLR
Sbjct  73   VHGCVFFGQPAPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGSIRVYLR  132

Query  539  EVRDLQSKARGISY  580
            EV+D Q+KARGI Y
Sbjct  133  EVKDCQAKARGIPY  146



>emb|CDY57087.1| BnaA04g28750D [Brassica napus]
 emb|CDY57088.1| BnaA04g28760D [Brassica napus]
Length=217

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +C FYGHP
Sbjct  51   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTTVCHFYGHP  110

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD+QSKAR
Sbjct  111  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDMQSKAR  170

Query  569  GISYE  583
            G+SYE
Sbjct  171  GVSYE  175



>emb|CDY10790.1| BnaA05g11460D [Brassica napus]
Length=215

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT IC FYGHP
Sbjct  49   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTTICHFYGHP  108

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD QSKAR
Sbjct  109  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDTQSKAR  168

Query  569  GISYE  583
            G+SYE
Sbjct  169  GVSYE  173



>ref|XP_004152053.1| PREDICTED: uncharacterized protein LOC101218578 [Cucumis sativus]
 ref|XP_004164534.1| PREDICTED: uncharacterized protein LOC101228718 [Cucumis sativus]
 gb|KGN57900.1| hypothetical protein Csa_3G383760 [Cucumis sativus]
Length=180

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 122/137 (89%), Gaps = 3/137 (2%)
 Frame = +2

Query  182  HPQPSP---ALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTK  352
            H QP+P   + SRYE+QKRRDW TFGQYL N RPP++L +C+  HVLEFLRYLDQFGKTK
Sbjct  22   HQQPAPTSSSSSRYENQKRRDWKTFGQYLNNHRPPLALSRCSGAHVLEFLRYLDQFGKTK  81

Query  353  VHTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLY  532
            VHT ICPFYG PNPPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE NPFGARAVRLY
Sbjct  82   VHTAICPFYGLPNPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGKPEANPFGARAVRLY  141

Query  533  LREVRDLQSKARGISYE  583
            LREVRDLQSKARGISYE
Sbjct  142  LREVRDLQSKARGISYE  158



>emb|CDY15426.1| BnaC04g41970D [Brassica napus]
Length=217

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +C FYGHP
Sbjct  51   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTTVCHFYGHP  110

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD+QSKAR
Sbjct  111  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDMQSKAR  170

Query  569  GISYE  583
            G+SYE
Sbjct  171  GVSYE  175



>ref|NP_565716.1| uncharacterized protein [Arabidopsis thaliana]
 sp|O82268.1|LSH3_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3; AltName: 
Full=Protein ORGAN BOUNDARY 1 [Arabidopsis thaliana]
 gb|AAC63835.1| expressed protein [Arabidopsis thaliana]
 gb|AAL08239.1| At2g31160/T16B12.3 [Arabidopsis thaliana]
 gb|AAL87358.1| At2g31160/T16B12.3 [Arabidopsis thaliana]
 gb|AEC08501.1| uncharacterized protein AT2G31160 [Arabidopsis thaliana]
Length=219

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT IC FYGHP
Sbjct  54   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTNICHFYGHP  113

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD+QSKAR
Sbjct  114  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDMQSKAR  173

Query  569  GISYE  583
            G+SYE
Sbjct  174  GVSYE  178



>ref|XP_004497868.1| PREDICTED: uncharacterized protein LOC101506852 isoform X1 [Cicer 
arietinum]
 ref|XP_004497869.1| PREDICTED: uncharacterized protein LOC101506852 isoform X2 [Cicer 
arietinum]
 ref|XP_004497870.1| PREDICTED: uncharacterized protein LOC101506852 isoform X3 [Cicer 
arietinum]
 ref|XP_004497871.1| PREDICTED: uncharacterized protein LOC101507597 [Cicer arietinum]
Length=213

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT ICPFYGHP
Sbjct  64   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQICPFYGHP  123

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD Q+KAR
Sbjct  124  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDSQAKAR  183

Query  569  GISYE  583
            GISYE
Sbjct  184  GISYE  188



>ref|XP_008802142.1| PREDICTED: LOW QUALITY PROTEIN: protein G1-like4 [Phoenix dactylifera]
Length=189

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +2

Query  197  PALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPF  376
            P+ SRYESQKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVHT +CPF
Sbjct  39   PSPSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPF  98

Query  377  YGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQ  556
            +GHPNPPAPC CPLRQAWGSLDALIGRLRAAYEENGG PE+NPFGARAVRLYLREVR+LQ
Sbjct  99   FGHPNPPAPCSCPLRQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRLYLREVRELQ  158

Query  557  SKARGISYE  583
            +KARGISYE
Sbjct  159  AKARGISYE  167



>ref|XP_010935915.1| PREDICTED: protein G1-like4 [Elaeis guineensis]
 ref|XP_010935916.1| PREDICTED: protein G1-like4 [Elaeis guineensis]
Length=194

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  37   RYESQKRRDWNTFGQYLKNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHP  96

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFGARAVRLYLREVR++Q+KAR
Sbjct  97   NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPEANPFGARAVRLYLREVREMQAKAR  156

Query  569  GISYE  583
            GISYE
Sbjct  157  GISYE  161



>ref|XP_010934319.1| PREDICTED: protein G1-like4 [Elaeis guineensis]
Length=180

 Score =   212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTK+HT +CPF+GHP
Sbjct  34   RYESQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKIHTQMCPFFGHP  93

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE+NPFGARAVRLYLREVR+LQ+KAR
Sbjct  94   NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRLYLREVRELQAKAR  153

Query  569  GISYE  583
            GISYE
Sbjct  154  GISYE  158



>ref|XP_002862787.1| hypothetical protein ARALYDRAFT_497295 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39045.1| hypothetical protein ARALYDRAFT_497295 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +C FYGHP
Sbjct  54   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTNVCHFYGHP  113

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD+QSKAR
Sbjct  114  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDMQSKAR  173

Query  569  GISYE  583
            G+SYE
Sbjct  174  GVSYE  178



>ref|XP_009387892.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009387893.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Musa 
acuminata subsp. malaccensis]
Length=195

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  200  ALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFY  379
            +LSRYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHTP+CPF+
Sbjct  37   SLSRYESQKRRDWNTFGQYLRNHRPPLSLGRCSGAHVLEFLRYLDQFGKTKVHTPLCPFF  96

Query  380  GHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQS  559
            G PNPP+PCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLRE+R++Q+
Sbjct  97   GQPNPPSPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREIREMQA  156

Query  560  KARGISYE  583
            KARG+SYE
Sbjct  157  KARGVSYE  164



>ref|XP_010905797.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Elaeis 
guineensis]
 ref|XP_010905798.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Elaeis 
guineensis]
 ref|XP_010905799.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Elaeis 
guineensis]
Length=200

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  40   RYESQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHP  99

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFGARAVRLYLREVR++Q+KAR
Sbjct  100  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPEANPFGARAVRLYLREVREMQAKAR  159

Query  569  GISYE  583
            GISYE
Sbjct  160  GISYE  164



>emb|CDY24755.1| BnaC04g13600D [Brassica napus]
Length=215

 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT IC FYGHP
Sbjct  49   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTTICHFYGHP  108

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD QSKAR
Sbjct  109  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDTQSKAR  168

Query  569  GISYE  583
            G+SYE
Sbjct  169  GVSYE  173



>ref|XP_009400810.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
 ref|XP_009400811.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
Length=196

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTK+HT +CPF+GHP
Sbjct  51   RYESQKRRDWNTFGQYLRNHRPPLSLSQCSSAHVLEFLRYLDQFGKTKIHTHVCPFFGHP  110

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPP+PCPCPLRQAWGSLDALIGRLRAAYEENGG PE+NPFG RA+RLYLREVR++QSKAR
Sbjct  111  NPPSPCPCPLRQAWGSLDALIGRLRAAYEENGGKPESNPFGTRAIRLYLREVREVQSKAR  170

Query  569  GISYE  583
            GISYE
Sbjct  171  GISYE  175



>ref|XP_009144232.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like isoform 
X2 [Brassica rapa]
Length=206

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT IC FYGHP
Sbjct  49   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTTICHFYGHP  108

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD QSKAR
Sbjct  109  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDTQSKAR  168

Query  569  GISYE  583
            G+SYE
Sbjct  169  GVSYE  173



>ref|XP_006293520.1| hypothetical protein CARUB_v10024036mg [Capsella rubella]
 gb|EOA26418.1| hypothetical protein CARUB_v10024036mg [Capsella rubella]
Length=217

 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +C FYGHP
Sbjct  52   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTNVCHFYGHP  111

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD+QSKAR
Sbjct  112  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDMQSKAR  171

Query  569  GISYE  583
            G+SYE
Sbjct  172  GVSYE  176



>ref|NP_001143695.1| putative protein of unknown function (DUF640) domain family protein 
isoform 1 [Zea mays]
 gb|ACG34300.1| hypothetical protein [Zea mays]
 gb|ACG40580.1| hypothetical protein [Zea mays]
 gb|AFW73956.1| putative protein of unknown function (DUF640) domain family protein 
isoform 1 [Zea mays]
 gb|AFW73957.1| putative protein of unknown function (DUF640) domain family protein 
isoform 2 [Zea mays]
Length=247

 Score =   214 bits (545),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFL+Y+DQFGKTKVHTP+CPFYGHP
Sbjct  79   RYESQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLKYMDQFGKTKVHTPVCPFYGHP  138

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPE NPFGARAVRLYLREVR+ Q++AR
Sbjct  139  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPEMNPFGARAVRLYLREVRETQARAR  198

Query  569  GISYE  583
            GISYE
Sbjct  199  GISYE  203



>gb|ABK21716.1| unknown [Picea sitchensis]
Length=226

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  194  SPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICP  373
            SPA SRYESQKRRDWNTFGQYLKN RPP++LP+C+  HV+EFL YLDQFGKTKVH P CP
Sbjct  38   SPAPSRYESQKRRDWNTFGQYLKNHRPPLALPRCSGAHVVEFLHYLDQFGKTKVHVPACP  97

Query  374  FYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDL  553
            F+GHP+PPAPC CPLRQAWGSLDALIGRLRAAYEENGG PE+NPFGARAVRLYLREVR+ 
Sbjct  98   FFGHPHPPAPCACPLRQAWGSLDALIGRLRAAYEENGGKPESNPFGARAVRLYLREVRES  157

Query  554  QSKARGISYE  583
            Q+KARGI+YE
Sbjct  158  QAKARGIAYE  167



>ref|XP_009141136.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3 [Brassica 
rapa]
Length=247

 Score =   214 bits (545),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +C FYGHP
Sbjct  51   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTTVCHFYGHP  110

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD+QSKAR
Sbjct  111  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDMQSKAR  170

Query  569  GISYE  583
            G+SYE
Sbjct  171  GVSYE  175



>ref|XP_002453010.1| hypothetical protein SORBIDRAFT_04g036620 [Sorghum bicolor]
 gb|EES05986.1| hypothetical protein SORBIDRAFT_04g036620 [Sorghum bicolor]
Length=251

 Score =   214 bits (545),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFL+Y+DQFGKTKVHTP+CPFYGHP
Sbjct  82   RYESQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLKYMDQFGKTKVHTPVCPFYGHP  141

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPE NPFGARAVRLYLREVR+ Q++AR
Sbjct  142  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPEMNPFGARAVRLYLREVRETQARAR  201

Query  569  GISYE  583
            GISYE
Sbjct  202  GISYE  206



>ref|XP_010557118.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Tarenaya 
hassleriana]
Length=218

 Score =   213 bits (542),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHTP+C FYGH
Sbjct  54   SRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTPMCHFYGH  113

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPP PCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVRD+QSKA
Sbjct  114  PNPPGPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPEANPFGARAVRLYLREVRDMQSKA  173

Query  566  RGISYE  583
            RG+SYE
Sbjct  174  RGVSYE  179



>gb|ACN41049.1| unknown [Picea sitchensis]
Length=236

 Score =   213 bits (543),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            +SRYESQKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVH P CPF+G
Sbjct  49   MSRYESQKRRDWNTFGQYLKNHRPPLALSKCSGAHVLEFLRYLDQFGKTKVHVPQCPFFG  108

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HP+PPAPC CPLRQAWGSLDALIGRLRAAYEE+GG PE+NPFGARAVRLYLREVRDLQSK
Sbjct  109  HPHPPAPCACPLRQAWGSLDALIGRLRAAYEEHGGKPESNPFGARAVRLYLREVRDLQSK  168

Query  563  ARGISYE  583
            ARGI+YE
Sbjct  169  ARGIAYE  175



>ref|XP_006410245.1| hypothetical protein EUTSA_v10017162mg [Eutrema salsugineum]
 gb|ESQ51698.1| hypothetical protein EUTSA_v10017162mg [Eutrema salsugineum]
Length=245

 Score =   214 bits (544),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +C FYGHP
Sbjct  53   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTTVCHFYGHP  112

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD+QSKAR
Sbjct  113  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDMQSKAR  172

Query  569  GISYE  583
            G+SYE
Sbjct  173  GVSYE  177



>ref|XP_010246796.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Nelumbo 
nucifera]
 ref|XP_010246797.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Nelumbo 
nucifera]
Length=178

 Score =   211 bits (537),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHT ICPF+GH
Sbjct  34   SRYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQICPFFGH  93

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVR+LQ+KA
Sbjct  94   PNPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPEANPFGARAVRLYLREVRELQAKA  153

Query  566  RGISYE  583
            RGISYE
Sbjct  154  RGISYE  159



>ref|XP_011091303.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Sesamum 
indicum]
Length=195

 Score =   212 bits (539),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  49   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFG  108

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
             PNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFGARAVRLYLREVRD Q+K
Sbjct  109  QPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPEANPFGARAVRLYLREVRDSQAK  168

Query  563  ARGISYE  583
            ARGISYE
Sbjct  169  ARGISYE  175



>emb|CDY69731.1| BnaCnng65050D [Brassica napus]
Length=195

 Score =   212 bits (539),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  45   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFG  104

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  105  HPNPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  164

Query  563  ARGISYE  583
            ARGISYE
Sbjct  165  ARGISYE  171



>ref|XP_009144231.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like isoform 
X1 [Brassica rapa]
Length=206

 Score =   212 bits (539),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT IC FYGHP
Sbjct  49   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTTICHFYGHP  108

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD QSKAR
Sbjct  109  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDTQSKAR  168

Query  569  GISYE  583
            G+SYE
Sbjct  169  GVSYE  173



>ref|XP_002879309.1| hypothetical protein ARALYDRAFT_344884 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55568.1| hypothetical protein ARALYDRAFT_344884 [Arabidopsis lyrata subsp. 
lyrata]
Length=238

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +C FYGHP
Sbjct  54   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTNVCHFYGHP  113

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD+QSKAR
Sbjct  114  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDMQSKAR  173

Query  569  GISYE  583
            G+SYE
Sbjct  174  GVSYE  178



>ref|XP_008681636.1| PREDICTED: putative protein of unknown function (DUF640) domain 
family protein isoform 1 isoform X1 [Zea mays]
 ref|XP_008681637.1| PREDICTED: putative protein of unknown function (DUF640) domain 
family protein isoform 1 isoform X1 [Zea mays]
Length=287

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFL+Y+DQFGKTKVHTP+CPFYGHP
Sbjct  79   RYESQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLKYMDQFGKTKVHTPVCPFYGHP  138

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPE NPFGARAVRLYLREVR+ Q++AR
Sbjct  139  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPEMNPFGARAVRLYLREVRETQARAR  198

Query  569  GISYE  583
            GISYE
Sbjct  199  GISYE  203



>ref|XP_011083033.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Sesamum 
indicum]
Length=187

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTF QYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVH PICPFYGHP
Sbjct  37   RYENQKRRDWNTFCQYLKNHRPPLALTRCSGAHVLEFLRYLDQFGKTKVHNPICPFYGHP  96

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            +PPA CPCPLRQAWGSLDALIGRLRAAYEENGG PETNPFGARAVRLYLREVRDLQSKAR
Sbjct  97   HPPAHCPCPLRQAWGSLDALIGRLRAAYEENGGNPETNPFGARAVRLYLREVRDLQSKAR  156

Query  569  GISYE  583
            G+SYE
Sbjct  157  GVSYE  161



>ref|XP_009768526.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Nicotiana 
sylvestris]
Length=190

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVH P+CPFYGHP
Sbjct  42   RYENQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHVPMCPFYGHP  101

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCP++QAWGSLDAL+GRLRAA+EENGG PETNPFGARAVRLYLREVRDLQSKAR
Sbjct  102  NPPAPCPCPVKQAWGSLDALVGRLRAAFEENGGKPETNPFGARAVRLYLREVRDLQSKAR  161

Query  569  GISYE  583
            G+SY+
Sbjct  162  GVSYD  166



>ref|XP_008681638.1| PREDICTED: putative protein of unknown function (DUF640) domain 
family protein isoform 1 isoform X2 [Zea mays]
Length=269

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFL+Y+DQFGKTKVHTP+CPFYGHP
Sbjct  79   RYESQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLKYMDQFGKTKVHTPVCPFYGHP  138

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPE NPFGARAVRLYLREVR+ Q++AR
Sbjct  139  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPEMNPFGARAVRLYLREVRETQARAR  198

Query  569  GISYE  583
            GISYE
Sbjct  199  GISYE  203



>ref|NP_001168003.1| uncharacterized protein LOC100381724 [Zea mays]
 ref|XP_008677500.1| PREDICTED: uncharacterized protein LOC100381724 isoform X1 [Zea 
mays]
 gb|ACN26805.1| unknown [Zea mays]
 gb|AFW64070.1| putative protein of unknown function (DUF640) domain family protein 
isoform 1 [Zea mays]
 gb|AFW64071.1| putative protein of unknown function (DUF640) domain family protein 
isoform 2 [Zea mays]
Length=246

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFL+Y+DQFGKTKVHTP+CPFYGHP
Sbjct  77   RYESQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLKYMDQFGKTKVHTPVCPFYGHP  136

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPE NPFGARAVRLYLREVR+ Q++AR
Sbjct  137  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPEMNPFGARAVRLYLREVRESQARAR  196

Query  569  GISYE  583
            GISYE
Sbjct  197  GISYE  201



>ref|XP_009108056.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Brassica 
rapa]
Length=195

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C   HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  45   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCGGAHVLEFLRYLDQFGKTKVHTQLCPFFG  104

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            H NPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  105  HANPPAPCACPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  164

Query  563  ARGISYE  583
            ARGISYE
Sbjct  165  ARGISYE  171



>ref|XP_010104757.1| hypothetical protein L484_021447 [Morus notabilis]
 gb|EXC01807.1| hypothetical protein L484_021447 [Morus notabilis]
Length=213

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +2

Query  200  ALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFY  379
             LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+
Sbjct  58   TLSRYENQKRRDWNTFGQYLRNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHTQLCPFF  117

Query  380  GHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQS  559
            GHPNPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVRD Q+
Sbjct  118  GHPNPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPEANPFGARAVRLYLREVRDSQA  177

Query  560  KARGISYE  583
            KARG+SYE
Sbjct  178  KARGVSYE  185



>emb|CDX85083.1| BnaC07g08230D [Brassica napus]
Length=199

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVH  ICPF+G
Sbjct  46   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHMQICPFFG  105

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  106  HPNPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  165

Query  563  ARGISYE  583
            ARGISYE
Sbjct  166  ARGISYE  172



>ref|NP_001136927.1| putative protein of unknown function (DUF640) domain family protein 
isoform 1 [Zea mays]
 ref|XP_008681311.1| PREDICTED: putative protein of unknown function (DUF640) domain 
family protein isoform 1 isoform X1 [Zea mays]
 gb|ACF78982.1| unknown [Zea mays]
 gb|ACF82912.1| unknown [Zea mays]
 gb|ACG25264.1| hypothetical protein [Zea mays]
 gb|AFW68596.1| putative protein of unknown function (DUF640) domain family protein 
isoform 1 [Zea mays]
 gb|AFW68597.1| putative protein of unknown function (DUF640) domain family protein 
isoform 2 [Zea mays]
 gb|AFW68598.1| putative protein of unknown function (DUF640) domain family protein 
isoform 3 [Zea mays]
Length=210

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHTP CPF+GHP
Sbjct  44   RYESQKRRDWNTFGQYLRNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHTPACPFFGHP  103

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
             PPAPCPCPLRQAWGSLDAL+GRLRAAYEENGG PE NPFGARAVRLYLREVRD QS+AR
Sbjct  104  APPAPCPCPLRQAWGSLDALVGRLRAAYEENGGRPENNPFGARAVRLYLREVRDHQSRAR  163

Query  569  GISYE  583
            G+SYE
Sbjct  164  GVSYE  168



>ref|XP_009102637.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Brassica 
rapa]
 emb|CDX77531.1| BnaA07g06690D [Brassica napus]
Length=199

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVH  ICPF+G
Sbjct  46   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHMQICPFFG  105

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPC CPLRQAWGSLDALIGRLRAA+EENGG+PETNPFGARAVRLYLREVRD Q+K
Sbjct  106  HPNPPAPCTCPLRQAWGSLDALIGRLRAAFEENGGSPETNPFGARAVRLYLREVRDSQAK  165

Query  563  ARGISYE  583
            ARGISYE
Sbjct  166  ARGISYE  172



>ref|XP_004246953.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Solanum 
lycopersicum]
Length=171

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTK+HT ICPFYG P
Sbjct  29   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKIHTLICPFYGLP  88

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFG RAVRLYLREVRDLQSKAR
Sbjct  89   NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGNPEMNPFGTRAVRLYLREVRDLQSKAR  148

Query  569  GISYE  583
            G+SYE
Sbjct  149  GVSYE  153



>ref|XP_010023924.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Eucalyptus 
grandis]
 ref|XP_010023925.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Eucalyptus 
grandis]
 gb|KCW60325.1| hypothetical protein EUGRSUZ_H03039 [Eucalyptus grandis]
Length=199

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GH
Sbjct  52   SRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGH  111

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE NPFGARAVRLYLREVRD Q+KA
Sbjct  112  PNPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGKPEANPFGARAVRLYLREVRDSQAKA  171

Query  566  RGISYE  583
            RGISYE
Sbjct  172  RGISYE  177



>ref|XP_009598088.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Nicotiana 
tomentosiformis]
Length=198

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVH P+CPFYGHP
Sbjct  49   RYENQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHIPMCPFYGHP  108

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCP++QAWGSLDAL+GRLRAA+EENGG PETNPFGARAVRLYLREVRDLQSKAR
Sbjct  109  NPPAPCPCPVKQAWGSLDALVGRLRAAFEENGGKPETNPFGARAVRLYLREVRDLQSKAR  168

Query  569  GISYE  583
            G+SY+
Sbjct  169  GVSYD  173



>gb|EPS74320.1| hypothetical protein M569_00435, partial [Genlisea aurea]
Length=163

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVH  ICPFYGHP
Sbjct  21   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHAQICPFYGHP  80

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPL+QAWGSLDALIGRLRAAYEENGG PETNPFGARAVRLYLREVRD QSKAR
Sbjct  81   NPPAPCPCPLKQAWGSLDALIGRLRAAYEENGGRPETNPFGARAVRLYLREVRDSQSKAR  140

Query  569  GISYE  583
            GISYE
Sbjct  141  GISYE  145



>ref|XP_010906808.1| PREDICTED: LOW QUALITY PROTEIN: protein G1-like4 [Elaeis guineensis]
Length=198

 Score =   211 bits (536),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  52   RYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHP  111

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPC CPLRQAWGSLDALIGRLRAAYEENGG PE+NPFGARAVRLYLREVR+LQ+KAR
Sbjct  112  NPPAPCSCPLRQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRLYLREVRELQAKAR  171

Query  569  GISYE  583
            GISYE
Sbjct  172  GISYE  176



>gb|ABR18275.1| unknown [Picea sitchensis]
Length=235

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  194  SPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICP  373
            SPA SRY+SQKRRDWNTFGQYLKN RPP++LP+C+  HV+EFL YLDQFGKTKVH P CP
Sbjct  38   SPAPSRYKSQKRRDWNTFGQYLKNHRPPLALPRCSGAHVVEFLHYLDQFGKTKVHVPACP  97

Query  374  FYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDL  553
            F+GHP+PPAPC CPLRQAWGSLDALIGRLRAAYEENGG PE+NPFGARAVRLYLREVR+ 
Sbjct  98   FFGHPHPPAPCACPLRQAWGSLDALIGRLRAAYEENGGKPESNPFGARAVRLYLREVRES  157

Query  554  QSKARGISYE  583
            Q+KARGI+YE
Sbjct  158  QAKARGIAYE  167



>gb|KFK31223.1| hypothetical protein AALP_AA6G084400 [Arabis alpina]
Length=223

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVH+ IC FYGHP
Sbjct  53   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHSNICHFYGHP  112

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD+QSKAR
Sbjct  113  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDMQSKAR  172

Query  569  GISYE  583
            G+SYE
Sbjct  173  GVSYE  177



>ref|XP_006351667.1| PREDICTED: uncharacterized protein LOC102596568 [Solanum tuberosum]
Length=185

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RY +QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTK+HTPICPFYG P
Sbjct  28   RYGNQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKIHTPICPFYGLP  87

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG  E NPFGARAVRLYLREVRDLQSKAR
Sbjct  88   NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKSEMNPFGARAVRLYLREVRDLQSKAR  147

Query  569  GISYE  583
            G+SYE
Sbjct  148  GVSYE  152



>ref|XP_003572923.1| PREDICTED: protein G1-like6 [Brachypodium distachyon]
Length=244

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFL+Y+DQFGKTKVHTP+CPFYGHP
Sbjct  73   RYESQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLKYMDQFGKTKVHTPMCPFYGHP  132

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPE NPFGARAVRLYLREVR+ Q++AR
Sbjct  133  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGTPEMNPFGARAVRLYLREVRETQARAR  192

Query  569  GISYE  583
            GISYE
Sbjct  193  GISYE  197



>ref|XP_008447415.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Cucumis 
melo]
Length=180

 Score =   210 bits (534),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 121/135 (90%), Gaps = 3/135 (2%)
 Frame = +2

Query  188  QPSP---ALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVH  358
            QP+P   + SRYE+QKRRDW TFGQYL N RPP++L +C+  HVLEFLRYLDQFGKTKVH
Sbjct  24   QPAPTSSSSSRYENQKRRDWKTFGQYLNNHRPPLALSRCSGAHVLEFLRYLDQFGKTKVH  83

Query  359  TPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLR  538
            T ICPFYG PNPPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE NPFGARAVRLYLR
Sbjct  84   TAICPFYGLPNPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGKPEANPFGARAVRLYLR  143

Query  539  EVRDLQSKARGISYE  583
            EVRDLQSKARGISYE
Sbjct  144  EVRDLQSKARGISYE  158



>ref|XP_008224344.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Prunus 
mume]
Length=211

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  50   LSRYENQKRRDWNTFGQYLRNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHTQLCPFFG  109

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVRD Q+K
Sbjct  110  HPNPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPEANPFGARAVRLYLREVRDSQAK  169

Query  563  ARGISYE  583
            ARGISYE
Sbjct  170  ARGISYE  176



>ref|NP_001159319.1| uncharacterized protein LOC100304411 [Zea mays]
 ref|XP_008681465.1| PREDICTED: uncharacterized protein LOC100304411 isoform X1 [Zea 
mays]
 gb|ACF85194.1| unknown [Zea mays]
 gb|ACN25774.1| unknown [Zea mays]
 tpg|DAA49624.1| TPA: putative protein of unknown function (DUF640) domain family 
protein isoform 1 [Zea mays]
 tpg|DAA49625.1| TPA: putative protein of unknown function (DUF640) domain family 
protein isoform 2 [Zea mays]
Length=213

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT  CPF+GH
Sbjct  45   SRYESQKRRDWNTFGQYLRNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHTAACPFFGH  104

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            P PPAPCPCPLRQAWGSLDAL+GRLRAAYEENGG PE NPFGARAVRLYLREVRD QS+A
Sbjct  105  PAPPAPCPCPLRQAWGSLDALVGRLRAAYEENGGRPENNPFGARAVRLYLREVRDHQSRA  164

Query  566  RGISYE  583
            RG+SYE
Sbjct  165  RGVSYE  170



>ref|XP_003556381.1| PREDICTED: uncharacterized protein LOC100806497 isoform X1 [Glycine 
max]
Length=189

 Score =   210 bits (534),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  46   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGHP  105

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD Q+KAR
Sbjct  106  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDSQAKAR  165

Query  569  GISYE  583
            GISYE
Sbjct  166  GISYE  170



>ref|XP_008785240.1| PREDICTED: LOW QUALITY PROTEIN: protein G1-like5 [Phoenix dactylifera]
Length=218

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTK+HT +CPF+GHP
Sbjct  36   RYESQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKIHTQMCPFFGHP  95

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE+NPFGARAVRLYLREVR+LQ+KAR
Sbjct  96   NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGRPESNPFGARAVRLYLREVRELQAKAR  155

Query  569  GISYE  583
            GISYE
Sbjct  156  GISYE  160



>ref|XP_007022986.1| Uncharacterized protein TCM_026988 [Theobroma cacao]
 gb|EOY25608.1| Uncharacterized protein TCM_026988 [Theobroma cacao]
Length=222

 Score =   211 bits (537),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            QP+  LSRYESQKRRDWNTFGQYL+N RPP++L +C+  HVLEFL+YLDQFGKTKVHT  
Sbjct  32   QPTLPLSRYESQKRRDWNTFGQYLRNHRPPLALSRCSGAHVLEFLKYLDQFGKTKVHTQN  91

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            CPF+GHP+PPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVR
Sbjct  92   CPFFGHPHPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGQPELNPFGARAVRLYLREVR  151

Query  548  DLQSKARGISYE  583
            D+Q+KARGI+YE
Sbjct  152  DVQAKARGIAYE  163



>ref|XP_006420250.1| hypothetical protein CICLE_v10005901mg [Citrus clementina]
 gb|ESR33490.1| hypothetical protein CICLE_v10005901mg [Citrus clementina]
 gb|KDO57574.1| hypothetical protein CISIN_1g037966mg [Citrus sinensis]
Length=205

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  55   LSRYENQKRRDWNTFGQYLRNHRPPLSLERCSGAHVLEFLRYLDQFGKTKVHTQLCPFFG  114

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVRD Q+K
Sbjct  115  HPNPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPEANPFGARAVRLYLREVRDSQAK  174

Query  563  ARGISYE  583
            ARGISYE
Sbjct  175  ARGISYE  181



>ref|XP_006606388.1| PREDICTED: uncharacterized protein LOC100806497 isoform X3 [Glycine 
max]
Length=189

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  46   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGHP  105

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD Q+KAR
Sbjct  106  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDSQAKAR  165

Query  569  GISYE  583
            GISYE
Sbjct  166  GISYE  170



>ref|XP_010679332.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Beta 
vulgaris subsp. vulgaris]
Length=234

 Score =   211 bits (537),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPFYGHP
Sbjct  55   RYENQKRRDWNTFGQYLKNHRPPLSLNRCSGAHVLEFLRYLDQFGKTKVHTQLCPFYGHP  114

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFGARAVRL+LREVRD QSKAR
Sbjct  115  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPEINPFGARAVRLFLREVRDSQSKAR  174

Query  569  GISYE  583
            GISYE
Sbjct  175  GISYE  179



>ref|XP_010069122.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Eucalyptus 
grandis]
 gb|KCW57366.1| hypothetical protein EUGRSUZ_H00151 [Eucalyptus grandis]
Length=198

 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G+P
Sbjct  53   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGYP  112

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE NPF ARAVRLYLREVRDLQSKAR
Sbjct  113  NPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGNPEANPFAARAVRLYLREVRDLQSKAR  172

Query  569  GISYE  583
            G+SYE
Sbjct  173  GVSYE  177



>ref|XP_008807719.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Phoenix 
dactylifera]
Length=208

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  48   RYESQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHP  107

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFGAR VRLYLREVR++Q+KAR
Sbjct  108  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPEANPFGARPVRLYLREVREMQAKAR  167

Query  569  GISYE  583
            GISYE
Sbjct  168  GISYE  172



>ref|XP_009362175.1| PREDICTED: protein G1-like1 isoform X2 [Pyrus x bretschneideri]
Length=231

 Score =   211 bits (537),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  194  SPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICP  373
            +P LSRYESQKRRDW TFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVH   CP
Sbjct  43   TPVLSRYESQKRRDWITFGQYLKNHRPPLNLSRCSGAHVLEFLRYLDQFGKTKVHADACP  102

Query  374  FYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDL  553
            FYGHPNPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD 
Sbjct  103  FYGHPNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGHPETNPFGARAVRLYLREVRDS  162

Query  554  QSKARGISYE  583
            Q++ARGI+YE
Sbjct  163  QARARGIAYE  172



>ref|XP_006606387.1| PREDICTED: uncharacterized protein LOC100806497 isoform X2 [Glycine 
max]
Length=192

 Score =   209 bits (533),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  46   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGHP  105

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD Q+KAR
Sbjct  106  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDSQAKAR  165

Query  569  GISYE  583
            GISYE
Sbjct  166  GISYE  170



>ref|XP_009362174.1| PREDICTED: protein G1-like1 isoform X1 [Pyrus x bretschneideri]
Length=232

 Score =   211 bits (537),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  194  SPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICP  373
            +P LSRYESQKRRDW TFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVH   CP
Sbjct  44   TPVLSRYESQKRRDWITFGQYLKNHRPPLNLSRCSGAHVLEFLRYLDQFGKTKVHADACP  103

Query  374  FYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDL  553
            FYGHPNPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD 
Sbjct  104  FYGHPNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGHPETNPFGARAVRLYLREVRDS  163

Query  554  QSKARGISYE  583
            Q++ARGI+YE
Sbjct  164  QARARGIAYE  173



>ref|XP_007226923.1| hypothetical protein PRUPE_ppa015837mg [Prunus persica]
 gb|EMJ28122.1| hypothetical protein PRUPE_ppa015837mg [Prunus persica]
Length=208

 Score =   210 bits (534),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  47   LSRYENQKRRDWNTFGQYLRNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHTQLCPFFG  106

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVRD Q+K
Sbjct  107  HPNPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPEANPFGARAVRLYLREVRDSQAK  166

Query  563  ARGISYE  583
            ARGISYE
Sbjct  167  ARGISYE  173



>ref|XP_010650097.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Vitis 
vinifera]
Length=201

 Score =   210 bits (534),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  57   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHP  116

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVRD Q+KAR
Sbjct  117  NPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPEANPFGARAVRLYLREVRDSQAKAR  176

Query  569  GISYE  583
            GISYE
Sbjct  177  GISYE  181



>ref|XP_009353874.1| PREDICTED: protein G1-like1 [Pyrus x bretschneideri]
Length=229

 Score =   211 bits (536),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +2

Query  197  PALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPF  376
            P LSRYESQKRRDW TFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVH   CPF
Sbjct  44   PVLSRYESQKRRDWITFGQYLKNHRPPLNLSRCSGAHVLEFLRYLDQFGKTKVHADACPF  103

Query  377  YGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQ  556
            YGHPNPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD Q
Sbjct  104  YGHPNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGQPETNPFGARAVRLYLREVRDSQ  163

Query  557  SKARGISYE  583
            +KARGI+YE
Sbjct  164  AKARGIAYE  172



>ref|XP_007211887.1| hypothetical protein PRUPE_ppa010212mg [Prunus persica]
 gb|EMJ13086.1| hypothetical protein PRUPE_ppa010212mg [Prunus persica]
Length=259

 Score =   211 bits (538),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +2

Query  197  PALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPF  376
            P LSRYESQKRRDW TFGQYLKN +PP++L +C+  HVLEFLRYLDQFGKTKVH  +CPF
Sbjct  50   PVLSRYESQKRRDWITFGQYLKNHKPPLTLSRCSGAHVLEFLRYLDQFGKTKVHADVCPF  109

Query  377  YGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQ  556
            YGHP+PPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD Q
Sbjct  110  YGHPHPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGQPETNPFGARAVRLYLREVRDSQ  169

Query  557  SKARGISYE  583
            +KARGI+YE
Sbjct  170  AKARGIAYE  178



>ref|XP_007035134.1| Uncharacterized protein TCM_020903 [Theobroma cacao]
 gb|EOY06060.1| Uncharacterized protein TCM_020903 [Theobroma cacao]
Length=214

 Score =   210 bits (534),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  61   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFG  120

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVRD Q+K
Sbjct  121  HPNPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPEANPFGARAVRLYLREVRDSQAK  180

Query  563  ARGISYE  583
            ARGISYE
Sbjct  181  ARGISYE  187



>ref|XP_010262338.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like isoform 
X1 [Nelumbo nucifera]
Length=210

 Score =   210 bits (534),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  67   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHP  126

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVR+LQ+KAR
Sbjct  127  NPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPEANPFGARAVRLYLREVRELQAKAR  186

Query  569  GISYE  583
            GISYE
Sbjct  187  GISYE  191



>ref|XP_010098512.1| hypothetical protein L484_025951 [Morus notabilis]
 gb|EXB75172.1| hypothetical protein L484_025951 [Morus notabilis]
Length=245

 Score =   211 bits (536),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYESQKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVH+  CPFYG
Sbjct  49   LSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHSDTCPFYG  108

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
             P PPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD Q+K
Sbjct  109  KPQPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPETNPFGARAVRLYLREVRDSQAK  168

Query  563  ARGISYE  583
            ARGI+YE
Sbjct  169  ARGIAYE  175



>gb|KEH41129.1| G1-like protein [Medicago truncatula]
Length=214

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT ICPFYGHP
Sbjct  65   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTLICPFYGHP  124

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPA CPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD Q+KAR
Sbjct  125  NPPASCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDSQAKAR  184

Query  569  GISYE  583
            GISYE
Sbjct  185  GISYE  189



>ref|XP_010262340.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like isoform 
X2 [Nelumbo nucifera]
Length=179

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYLKN RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  36   RYENQKRRDWNTFGQYLKNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQMCPFFGHP  95

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVR+LQ+KAR
Sbjct  96   NPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPEANPFGARAVRLYLREVRELQAKAR  155

Query  569  GISYE  583
            GISYE
Sbjct  156  GISYE  160



>ref|XP_010907173.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Elaeis 
guineensis]
Length=213

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYESQKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVHTP C F+G
Sbjct  10   LSRYESQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGKTKVHTPGCLFFG  69

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HP PP PCPCPLRQAWGSLDAL+GRLRAA+EENGG P TNPFGARAVRLYLREVRD Q+K
Sbjct  70   HPCPPGPCPCPLRQAWGSLDALVGRLRAAFEENGGHPATNPFGARAVRLYLREVRDSQAK  129

Query  563  ARGISYE  583
            ARGI+YE
Sbjct  130  ARGITYE  136



>ref|XP_007145860.1| hypothetical protein PHAVU_007G274100g [Phaseolus vulgaris]
 gb|ESW17854.1| hypothetical protein PHAVU_007G274100g [Phaseolus vulgaris]
Length=204

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  62   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTHLCPFFGHP  121

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD Q+KAR
Sbjct  122  NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDSQAKAR  181

Query  569  GISYE  583
            GISYE
Sbjct  182  GISYE  186



>ref|XP_004293717.1| PREDICTED: uncharacterized protein LOC101301655 [Fragaria vesca 
subsp. vesca]
Length=250

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  194  SPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICP  373
            +P LSRYESQKRRDW TFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVH   CP
Sbjct  47   APQLSRYESQKRRDWITFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHGSGCP  106

Query  374  FYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDL  553
            FYGHPNPPAPCPCPL+QAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD 
Sbjct  107  FYGHPNPPAPCPCPLKQAWGSLDALIGRLRAAFEENGGLPETNPFGARAVRLYLREVRDT  166

Query  554  QSKARGISYE  583
            Q+KARGI+YE
Sbjct  167  QAKARGIAYE  176



>ref|XP_009398867.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
Length=206

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYL+N RPP+SL QC+ +HVLEFLRYLDQFGKTK+HT +CPF+G+ 
Sbjct  43   RYESQKRRDWNTFGQYLRNHRPPLSLSQCSSSHVLEFLRYLDQFGKTKIHTHLCPFFGNS  102

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE+NPFGARA+RLYLREVR++QSKAR
Sbjct  103  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPESNPFGARAIRLYLREVREVQSKAR  162

Query  569  GISYE  583
            GISYE
Sbjct  163  GISYE  167



>ref|XP_010655519.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Vitis 
vinifera]
 ref|XP_010655520.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Vitis 
vinifera]
Length=175

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 118/131 (90%), Gaps = 1/131 (1%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            QP P LSRYESQKRRDWNTFGQYLKNQRPPVSL QC+CNHVLEFLRYLDQFGKTKVH   
Sbjct  23   QPQP-LSRYESQKRRDWNTFGQYLKNQRPPVSLAQCSCNHVLEFLRYLDQFGKTKVHLHG  81

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            C F+G P+PPAPC CPLRQAWGSLDALIGRLRAAYEE+GG+PETNPFG  A+R+YLREVR
Sbjct  82   CVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVR  141

Query  548  DLQSKARGISY  580
            D QSKARGI Y
Sbjct  142  DCQSKARGIPY  152



>emb|CAN72178.1| hypothetical protein VITISV_012478 [Vitis vinifera]
Length=175

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 118/131 (90%), Gaps = 1/131 (1%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            QP P LSRYESQKRRDWNTFGQYLKNQRPPVSL QC+CNHVLEFLRYLDQFGKTKVH   
Sbjct  23   QPQP-LSRYESQKRRDWNTFGQYLKNQRPPVSLAQCSCNHVLEFLRYLDQFGKTKVHLHG  81

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            C F+G P+PPAPC CPLRQAWGSLDALIGRLRAAYEE+GG+PETNPFG  A+R+YLREVR
Sbjct  82   CVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVR  141

Query  548  DLQSKARGISY  580
            D QSKARGI Y
Sbjct  142  DCQSKARGIPY  152



>ref|NP_001176209.1| Os10g0478000 [Oryza sativa Japonica Group]
 sp|Q7XDD0.1|G1L5_ORYSJ RecName: Full=Protein G1-like5 [Oryza sativa Japonica Group]
 gb|AAG13584.1|AC037425_15 hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP54281.1| hypothetical protein LOC_Os10g33780 [Oryza sativa Japonica Group]
 gb|EAZ16425.1| hypothetical protein OsJ_31895 [Oryza sativa Japonica Group]
 dbj|BAH94937.1| Os10g0478000 [Oryza sativa Japonica Group]
 dbj|BAI52983.1| G1-like5 protein [Oryza sativa Japonica Group]
Length=204

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVH P CPF+GH
Sbjct  39   SRYESQKRRDWNTFGQYLRNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHAPACPFFGH  98

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            P PPAPCPCPLRQAWGSLDAL+GRLRAAYEENGG PE NPFGARAVRLYLREVR+ Q++A
Sbjct  99   PAPPAPCPCPLRQAWGSLDALVGRLRAAYEENGGRPENNPFGARAVRLYLREVREHQARA  158

Query  566  RGISYE  583
            RG+SYE
Sbjct  159  RGVSYE  164



>ref|XP_008439509.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Cucumis 
melo]
Length=190

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYLKN RPP++L +C+  H+LEFLRYLDQFGKTKVHT  CPF+GHP
Sbjct  44   RYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHILEFLRYLDQFGKTKVHTSSCPFFGHP  103

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
             PPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFG RAVRLYLREVR+ Q+KAR
Sbjct  104  QPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGQPETNPFGTRAVRLYLREVRESQAKAR  163

Query  569  GISYE  583
            GI+YE
Sbjct  164  GIAYE  168



>ref|XP_006857299.1| hypothetical protein AMTR_s00067p00052610 [Amborella trichopoda]
 gb|ERN18766.1| hypothetical protein AMTR_s00067p00052610 [Amborella trichopoda]
Length=206

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +2

Query  185  PQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTP  364
            P PS   SRYESQKRRDWNTFGQYL+N RPP++L +C+  HVLEFLRYLDQFGKTKVH+ 
Sbjct  27   PAPSTPPSRYESQKRRDWNTFGQYLRNHRPPLALSRCSGAHVLEFLRYLDQFGKTKVHSQ  86

Query  365  ICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREV  544
             CPF+GHP+PPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFGARAVRLYLREV
Sbjct  87   SCPFFGHPHPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPEANPFGARAVRLYLREV  146

Query  545  RDLQSKARGISYE  583
            R+ Q+KARGI+YE
Sbjct  147  RESQAKARGIAYE  159



>ref|XP_004495375.1| PREDICTED: uncharacterized protein LOC101506840 isoform X1 [Cicer 
arietinum]
 ref|XP_004495376.1| PREDICTED: uncharacterized protein LOC101506840 isoform X2 [Cicer 
arietinum]
Length=191

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP++L +C+  HV+EFLRYLDQFGKTKVH+ ICP+YG
Sbjct  50   LSRYENQKRRDWNTFGQYLRNHRPPLALSRCSGAHVVEFLRYLDQFGKTKVHSEICPYYG  109

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG  E NPFGARAVRL+LR+VRD QSK
Sbjct  110  HPNPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKAEDNPFGARAVRLFLRDVRDSQSK  169

Query  563  ARGISYE  583
            ARGISYE
Sbjct  170  ARGISYE  176



>ref|XP_006489717.1| PREDICTED: uncharacterized protein LOC102628291 [Citrus sinensis]
Length=207

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RP +SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+G
Sbjct  55   LSRYENQKRRDWNTFGQYLRNHRPSLSLERCSGAHVLEFLRYLDQFGKTKVHTQLCPFFG  114

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVRD Q+K
Sbjct  115  HPNPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPEANPFGARAVRLYLREVRDSQAK  174

Query  563  ARGISYE  583
            ARGISYE
Sbjct  175  ARGISYE  181



>ref|XP_003539992.1| PREDICTED: uncharacterized protein LOC100806134 [Glycine max]
Length=177

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = +2

Query  188  QPSPA-LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTP  364
            Q SP  LSRYESQKRRDWNTFGQYLKNQRPPV L QC CNHVL+FLRYLDQFGKTKVH  
Sbjct  24   QQSPVTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQ  83

Query  365  ICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREV  544
             C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF + ++R+YLREV
Sbjct  84   GCMFYGQPEPPAPCACPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYLREV  143

Query  545  RDLQSKARGISY  580
            R+ Q+KARGI+Y
Sbjct  144  RECQAKARGIAY  155



>ref|XP_010279129.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nelumbo 
nucifera]
Length=176

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            Q S  LSRYESQKRRDWNTFGQYLKNQRPPVSL QC+C+HVLEFLRYLDQFGKTKVH   
Sbjct  21   QQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCSCSHVLEFLRYLDQFGKTKVHLQG  80

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            C F+G P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPFG+ A+R+YLREVR
Sbjct  81   CIFFGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFGSGAIRVYLREVR  140

Query  548  DLQSKARGISY  580
            + Q+KARGI Y
Sbjct  141  ECQAKARGIPY  151



>ref|NP_001142538.1| uncharacterized protein LOC100274783 [Zea mays]
 gb|ACG24885.1| hypothetical protein [Zea mays]
Length=202

 Score =   207 bits (528),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVHTP CPF+GH
Sbjct  44   SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHTPACPFFGH  103

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE+NPF ARAVRLYLREVR+ Q++A
Sbjct  104  PNPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGRPESNPFAARAVRLYLREVREHQARA  163

Query  566  RGISYE  583
            RG+SYE
Sbjct  164  RGVSYE  169



>ref|XP_002311674.2| hypothetical protein POPTR_0008s16750g [Populus trichocarpa]
 gb|ABK96211.1| unknown [Populus trichocarpa]
 gb|EEE89041.2| hypothetical protein POPTR_0008s16750g [Populus trichocarpa]
Length=203

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  45   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGHP  104

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVRD QSKAR
Sbjct  105  NPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPENNPFGARAVRLYLREVRDSQSKAR  164

Query  569  GISYE  583
            GISYE
Sbjct  165  GISYE  169



>ref|XP_008225689.1| PREDICTED: LOW QUALITY PROTEIN: protein LIGHT-DEPENDENT SHORT 
HYPOCOTYLS 4-like [Prunus mume]
Length=207

 Score =   207 bits (528),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = +2

Query  197  PALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPF  376
            P LSRYESQKRRDW TFGQYLKN +PP++L +C+  HVLEFLRYLDQFGKTKVH   CPF
Sbjct  50   PVLSRYESQKRRDWITFGQYLKNHKPPLTLSRCSGAHVLEFLRYLDQFGKTKVHADACPF  109

Query  377  YGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQ  556
            YGHP+PPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD Q
Sbjct  110  YGHPHPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGQPETNPFGARAVRLYLREVRDSQ  169

Query  557  SKARGISYE  583
            +KARGI+YE
Sbjct  170  AKARGIAYE  178



>ref|XP_011085173.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Sesamum 
indicum]
Length=213

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            + +P+LSRYESQKRRDWNTFGQYLKN +PP+ L +C+  H+LEFLRYLDQFGKTKVH   
Sbjct  30   KTAPSLSRYESQKRRDWNTFGQYLKNHKPPLLLSRCSGAHILEFLRYLDQFGKTKVHNIS  89

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            CPF+GHP+PPAPCPCPL+QAWGSLDAL+GRLRAA+EENGG PE NPFGARAVRLYLREVR
Sbjct  90   CPFFGHPHPPAPCPCPLKQAWGSLDALVGRLRAAFEENGGRPEANPFGARAVRLYLREVR  149

Query  548  DLQSKARGISYE  583
            D Q+KARGI+YE
Sbjct  150  DTQAKARGIAYE  161



>gb|EMS63732.1| hypothetical protein TRIUR3_33566 [Triticum urartu]
Length=248

 Score =   209 bits (532),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +2

Query  194  SPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICP  373
            SP+ SRYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVH   CP
Sbjct  78   SPSPSRYESQKRRDWNTFGQYLRNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHAAGCP  137

Query  374  FYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDL  553
            F+GHP PPAPCPCPLRQAWGSLDAL+GRLRAAYEENGG PE NPFGARAVRLYLREVR+ 
Sbjct  138  FFGHPVPPAPCPCPLRQAWGSLDALVGRLRAAYEENGGRPENNPFGARAVRLYLREVREH  197

Query  554  QSKARGISYE  583
            QS+ARG+SY+
Sbjct  198  QSRARGVSYD  207



>ref|XP_008676897.1| PREDICTED: uncharacterized protein LOC100274783 isoform X1 [Zea 
mays]
 ref|XP_008676898.1| PREDICTED: uncharacterized protein LOC100274783 isoform X1 [Zea 
mays]
 ref|XP_008676899.1| PREDICTED: uncharacterized protein LOC100274783 isoform X1 [Zea 
mays]
 gb|AFW63050.1| putative protein of unknown function (DUF640) domain family protein 
[Zea mays]
Length=202

 Score =   207 bits (528),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVHTP CPF+GH
Sbjct  44   SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHTPACPFFGH  103

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE+NPF ARAVRLYLREVR+ Q++A
Sbjct  104  PNPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGRPESNPFAARAVRLYLREVREHQARA  163

Query  566  RGISYE  583
            RG+SYE
Sbjct  164  RGVSYE  169



>ref|XP_010671018.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Beta 
vulgaris subsp. vulgaris]
Length=208

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP++L +C+  HVLEFLRYLDQFGKTKVH   CPF+G
Sbjct  25   LSRYENQKRRDWNTFGQYLRNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHNMGCPFFG  84

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE+NPFGARAVRL+LREVRD Q+K
Sbjct  85   HPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGPPESNPFGARAVRLFLREVRDSQAK  144

Query  563  ARGISYE  583
            ARGISYE
Sbjct  145  ARGISYE  151



>ref|XP_007025375.1| Beta-lactamase-like protein ENSP00000383859 [Theobroma cacao]
 gb|EOY27997.1| Beta-lactamase-like protein ENSP00000383859 [Theobroma cacao]
Length=179

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 120/136 (88%), Gaps = 1/136 (1%)
 Frame = +2

Query  176  DHHPQPSPA-LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTK  352
            +HH QP PA LSRYESQKRRDWNTFGQYLKNQRPPV+L QC CNHVL+FLRYLDQFGKTK
Sbjct  19   NHHQQPQPAPLSRYESQKRRDWNTFGQYLKNQRPPVALSQCNCNHVLDFLRYLDQFGKTK  78

Query  353  VHTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLY  532
            VH   C F+G P+PPAPC CPLRQAWGSLDALIGRLRAAYEE+GG+ ETNPFG  A+R+Y
Sbjct  79   VHLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSSETNPFGNGAIRVY  138

Query  533  LREVRDLQSKARGISY  580
            LREVR+ Q+KARGI Y
Sbjct  139  LREVRECQAKARGIPY  154



>gb|KDP34854.1| hypothetical protein JCGZ_09142 [Jatropha curcas]
Length=222

 Score =   208 bits (529),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYESQKRRDWNTFGQYL+N RPP++L +C+  HVLEFLRYLDQFGKTKVH   CPF+G
Sbjct  42   LSRYESQKRRDWNTFGQYLRNHRPPLALSRCSGAHVLEFLRYLDQFGKTKVHNQTCPFFG  101

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HP+PPAPCPCPL+QAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD Q+K
Sbjct  102  HPHPPAPCPCPLKQAWGSLDALIGRLRAAFEENGGLPETNPFGARAVRLYLREVRDAQAK  161

Query  563  ARGISYE  583
            ARGI+YE
Sbjct  162  ARGIAYE  168



>ref|XP_009615590.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=194

 Score =   207 bits (526),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 116/137 (85%), Gaps = 2/137 (1%)
 Frame = +2

Query  176  DHHPQ--PSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKT  349
            D+H Q  P P LSRYESQKRRDWNTFGQYLKN RPP+ L QC  NHVLEFLRYLDQFGKT
Sbjct  30   DNHLQLPPPPQLSRYESQKRRDWNTFGQYLKNLRPPIPLSQCNYNHVLEFLRYLDQFGKT  89

Query  350  KVHTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRL  529
            KVH   CPF+G P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG PE NPF + ++R+
Sbjct  90   KVHLHGCPFFGQPEPPAPCACPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRI  149

Query  530  YLREVRDLQSKARGISY  580
            YLREVRD Q+KARGISY
Sbjct  150  YLREVRDFQAKARGISY  166



>ref|XP_008793554.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Phoenix 
dactylifera]
Length=232

 Score =   208 bits (529),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYESQKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVHT  CPF+G
Sbjct  23   LSRYESQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGKTKVHTAGCPFFG  82

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HP PPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG P  NPFGARAVRLYLREVRD Q+K
Sbjct  83   HPCPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGHPAVNPFGARAVRLYLREVRDSQAK  142

Query  563  ARGISYE  583
            ARGI+YE
Sbjct  143  ARGITYE  149



>gb|KDP40343.1| hypothetical protein JCGZ_02341 [Jatropha curcas]
Length=203

 Score =   207 bits (526),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  42   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGHP  101

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVRD Q+KAR
Sbjct  102  NPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPENNPFGARAVRLYLREVRDSQAKAR  161

Query  569  GISYE  583
            GISYE
Sbjct  162  GISYE  166



>ref|XP_009611433.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 1-like [Nicotiana 
tomentosiformis]
Length=195

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  185  PQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTP  364
            P  +P LSRYE+QKRRDWNTF QYL+NQ PP+SLP C+  HVLEFLRYLDQFGKTKVH  
Sbjct  31   PSSAPPLSRYENQKRRDWNTFCQYLRNQHPPLSLPYCSGAHVLEFLRYLDQFGKTKVHNQ  90

Query  365  ICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREV  544
             CPF+G  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFGARAVRL+LREV
Sbjct  91   NCPFFGLQNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPEMNPFGARAVRLFLREV  150

Query  545  RDLQSKARGISYE  583
            RD QSK+RGISYE
Sbjct  151  RDFQSKSRGISYE  163



>gb|EMT15017.1| hypothetical protein F775_09728 [Aegilops tauschii]
Length=201

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVH   CPF+GH
Sbjct  40   SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHASACPFFGH  99

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            P+PPAPCPCPLRQAWGSLDAL+GRLRAAYEENGG+PE+NPF ARAVRLYLREVR+ Q++A
Sbjct  100  PSPPAPCPCPLRQAWGSLDALVGRLRAAYEENGGSPESNPFAARAVRLYLREVREHQARA  159

Query  566  RGISYE  583
            RG+SYE
Sbjct  160  RGVSYE  165



>gb|EYU43203.1| hypothetical protein MIMGU_mgv1a013748mg [Erythranthe guttata]
Length=211

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = +2

Query  200  ALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFY  379
            ALSRYESQKRRDWNTFGQYLKN +PP+ L +C+  H+LEFLRYLDQFGKTKVH   CPF+
Sbjct  26   ALSRYESQKRRDWNTFGQYLKNHKPPLVLCRCSGAHILEFLRYLDQFGKTKVHNNGCPFF  85

Query  380  GHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQS  559
            GHPNPPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE NPFGARAVRLYLREVRD Q+
Sbjct  86   GHPNPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGRPEANPFGARAVRLYLREVRDSQA  145

Query  560  KARGISYE  583
            KARGI+YE
Sbjct  146  KARGIAYE  153



>ref|XP_008667635.1| PREDICTED: uncharacterized protein LOC100275232 isoform X1 [Zea 
mays]
 tpg|DAA36964.1| TPA: putative protein of unknown function (DUF640) domain family 
protein isoform 1 [Zea mays]
 tpg|DAA36965.1| TPA: putative protein of unknown function (DUF640) domain family 
protein isoform 2 [Zea mays]
Length=200

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVH P CPF+GH
Sbjct  38   SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHGPACPFFGH  97

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE+NPF ARAVRLYLREVR+ Q++A
Sbjct  98   PNPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGRPESNPFAARAVRLYLREVREHQARA  157

Query  566  RGISYE  583
            RG+SYE
Sbjct  158  RGVSYE  163



>ref|XP_002446786.1| hypothetical protein SORBIDRAFT_06g022610 [Sorghum bicolor]
 gb|EES11114.1| hypothetical protein SORBIDRAFT_06g022610 [Sorghum bicolor]
Length=199

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVH P CPF+GH
Sbjct  39   SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHGPACPFFGH  98

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE+NPF ARAVRLYLREVR+ Q++A
Sbjct  99   PNPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGRPESNPFAARAVRLYLREVREHQARA  158

Query  566  RGISYE  583
            RG+SYE
Sbjct  159  RGVSYE  164



>ref|XP_011085992.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Sesamum 
indicum]
Length=175

 Score =   205 bits (522),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            Q SP LSRYESQKRRDWNTFGQYLKNQRPPVSL  C CNHVLEFLRYLDQFGKTKVH   
Sbjct  18   QASPPLSRYESQKRRDWNTFGQYLKNQRPPVSLSHCNCNHVLEFLRYLDQFGKTKVHLHG  77

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            C F+G P+PPAPC CPLRQAWGSLDALIGRLRAAYEE+GG+PETNPFG  A+R+YLREV+
Sbjct  78   CVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVK  137

Query  548  DLQSKARGISY  580
            D Q+KARGI Y
Sbjct  138  DSQAKARGIPY  148



>ref|XP_006378330.1| hypothetical protein POPTR_0010s08140g [Populus trichocarpa]
 gb|ERP56127.1| hypothetical protein POPTR_0010s08140g [Populus trichocarpa]
Length=207

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHP
Sbjct  49   RYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGHP  108

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVRD Q+KAR
Sbjct  109  NPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPENNPFGARAVRLYLREVRDSQAKAR  168

Query  569  GISYE  583
            GISYE
Sbjct  169  GISYE  173



>dbj|BAJ89549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=199

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVH   CPF+GH
Sbjct  39   SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHAAACPFFGH  98

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            P+PPAPCPCPLRQAWGSLDAL+GRLRAAYEENGG+PE+NPF ARAVRLYLREVR+ Q++A
Sbjct  99   PSPPAPCPCPLRQAWGSLDALVGRLRAAYEENGGSPESNPFAARAVRLYLREVREHQARA  158

Query  566  RGISYE  583
            RG+SYE
Sbjct  159  RGVSYE  164



>ref|XP_002271024.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Vitis 
vinifera]
Length=220

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            QP    SRYESQKRRDWNTFGQYL+N RPP++L +C+  +VLEFLRYLDQFGKTKVHT +
Sbjct  41   QPLQPPSRYESQKRRDWNTFGQYLRNHRPPLALNRCSGANVLEFLRYLDQFGKTKVHTQM  100

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            CPF+GHP+PPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVR
Sbjct  101  CPFFGHPHPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGPPETNPFGARAVRLYLREVR  160

Query  548  DLQSKARGISYE  583
            D Q+KARGI+YE
Sbjct  161  DAQAKARGIAYE  172



>ref|XP_006395017.1| hypothetical protein EUTSA_v10004974mg [Eutrema salsugineum]
 gb|ESQ32303.1| hypothetical protein EUTSA_v10004974mg [Eutrema salsugineum]
Length=187

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +2

Query  197  PALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPF  376
            P+ SRYE+QKRRDWNTF QYL+N RPP+SLP C+  HVLEFLRYLDQFGKTKVH   C F
Sbjct  21   PSSSRYENQKRRDWNTFCQYLRNHRPPLSLPSCSGAHVLEFLRYLDQFGKTKVHHQNCAF  80

Query  377  YGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQ  556
            +GHPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFG+RAVRLYLREVRD Q
Sbjct  81   FGHPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGPPEANPFGSRAVRLYLREVRDFQ  140

Query  557  SKARGISYE  583
            +KARG+SYE
Sbjct  141  AKARGVSYE  149



>ref|XP_010926891.1| PREDICTED: protein G1-like1 [Elaeis guineensis]
Length=235

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYESQKRRDWNTFGQYL+N RPP++L +C+  HVLEFLRYLDQFGKTKVH   CPF+G
Sbjct  25   LSRYESQKRRDWNTFGQYLRNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAVGCPFFG  84

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HP+PPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD Q+K
Sbjct  85   HPHPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGQPEANPFGARAVRLYLREVRDSQAK  144

Query  563  ARGISYE  583
            ARGI+YE
Sbjct  145  ARGIAYE  151



>gb|KGN49491.1| hypothetical protein Csa_6G526250 [Cucumis sativus]
Length=191

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYLKN RPP++L +C+  H+LEFLRYLDQFGKTKVHT  CPF+GHP
Sbjct  45   RYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHILEFLRYLDQFGKTKVHTSSCPFFGHP  104

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
             PPAPCPCPLRQAWGSLDALIGRLRAA+EENGG P+TNPFG RAVRLYLREVR+ Q+KAR
Sbjct  105  QPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGQPDTNPFGTRAVRLYLREVRESQAKAR  164

Query  569  GISYE  583
            GI+YE
Sbjct  165  GIAYE  169



>ref|XP_004134890.1| PREDICTED: uncharacterized protein LOC101208925 [Cucumis sativus]
 ref|XP_004158697.1| PREDICTED: uncharacterized LOC101208925 [Cucumis sativus]
Length=188

 Score =   205 bits (522),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYLKN RPP++L +C+  H+LEFLRYLDQFGKTKVHT  CPF+GHP
Sbjct  42   RYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHILEFLRYLDQFGKTKVHTSSCPFFGHP  101

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
             PPAPCPCPLRQAWGSLDALIGRLRAA+EENGG P+TNPFG RAVRLYLREVR+ Q+KAR
Sbjct  102  QPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGQPDTNPFGTRAVRLYLREVRESQAKAR  161

Query  569  GISYE  583
            GI+YE
Sbjct  162  GIAYE  166



>ref|XP_008807164.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Phoenix 
dactylifera]
 ref|XP_008807165.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Phoenix 
dactylifera]
Length=235

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYESQKRRDWNTFGQYL+N RPP++L +C+  HVLEFLRYLDQFGKTKVH   CPF+G
Sbjct  25   LSRYESQKRRDWNTFGQYLRNHRPPLALSRCSGAHVLEFLRYLDQFGKTKVHAVGCPFFG  84

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            HP+PPAPCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD Q+K
Sbjct  85   HPHPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGQPEANPFGARAVRLYLREVRDSQAK  144

Query  563  ARGISYE  583
            ARGI+YE
Sbjct  145  ARGIAYE  151



>ref|XP_009763597.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 1-like [Nicotiana 
sylvestris]
Length=193

 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +2

Query  185  PQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTP  364
            P  +P LSRYE+QKRRDWNTF QYL+N  PP+SLP C+  HVLEFLRYLDQFGKTKVH  
Sbjct  31   PSSAPPLSRYENQKRRDWNTFCQYLRNHHPPLSLPHCSGAHVLEFLRYLDQFGKTKVHNQ  90

Query  365  ICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREV  544
             CPF+G  NPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFGARAVRL+LREV
Sbjct  91   NCPFFGLQNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGKPEMNPFGARAVRLFLREV  150

Query  545  RDLQSKARGISYE  583
            RD QSK+RGISYE
Sbjct  151  RDFQSKSRGISYE  163



>ref|XP_008661390.1| PREDICTED: putative protein of unknown function (DUF640) domain 
family protein isoform 1 isoform X2 [Zea mays]
 gb|AFW58862.1| putative protein of unknown function (DUF640) domain family protein 
[Zea mays]
Length=168

 Score =   204 bits (520),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 120/133 (90%), Gaps = 2/133 (2%)
 Frame = +2

Query  185  PQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTP  364
            PQ SP  SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVH P
Sbjct  2    PQSSP--SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHGP  59

Query  365  ICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREV  544
             CPF+GHPNPPAPCPCPLRQAWGSLDAL+GRLRAAYEENGG PE+NPF ARAVRLYL EV
Sbjct  60   ACPFFGHPNPPAPCPCPLRQAWGSLDALVGRLRAAYEENGGRPESNPFAARAVRLYLCEV  119

Query  545  RDLQSKARGISYE  583
            R+ Q++ARG+SYE
Sbjct  120  REHQARARGVSYE  132



>ref|NP_001131560.1| putative protein of unknown function (DUF640) domain family protein 
isoform 1 [Zea mays]
 ref|XP_008661388.1| PREDICTED: putative protein of unknown function (DUF640) domain 
family protein isoform 1 isoform X1 [Zea mays]
 ref|XP_008661389.1| PREDICTED: putative protein of unknown function (DUF640) domain 
family protein isoform 1 isoform X1 [Zea mays]
 gb|ACF80012.1| unknown [Zea mays]
 gb|ACF81854.1| unknown [Zea mays]
 gb|AFW58859.1| putative protein of unknown function (DUF640) domain family protein 
isoform 1 [Zea mays]
 gb|AFW58860.1| putative protein of unknown function (DUF640) domain family protein 
isoform 2 [Zea mays]
 gb|AFW58861.1| putative protein of unknown function (DUF640) domain family protein 
isoform 3 [Zea mays]
Length=201

 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 120/133 (90%), Gaps = 2/133 (2%)
 Frame = +2

Query  185  PQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTP  364
            PQ SP  SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVH P
Sbjct  35   PQSSP--SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHGP  92

Query  365  ICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREV  544
             CPF+GHPNPPAPCPCPLRQAWGSLDAL+GRLRAAYEENGG PE+NPF ARAVRLYL EV
Sbjct  93   ACPFFGHPNPPAPCPCPLRQAWGSLDALVGRLRAAYEENGGRPESNPFAARAVRLYLCEV  152

Query  545  RDLQSKARGISYE  583
            R+ Q++ARG+SYE
Sbjct  153  REHQARARGVSYE  165



>ref|XP_010277024.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Nelumbo 
nucifera]
Length=182

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            Q S  LSRYESQKRRDWNTFGQYLKNQRPPVSL QC C+HVL+FLRYLDQFGKTKVH   
Sbjct  23   QQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCSHVLDFLRYLDQFGKTKVHLQG  82

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            C F+G P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPFG+ A+R+YLREVR
Sbjct  83   CVFFGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFGSGAIRVYLREVR  142

Query  548  DLQSKARGISY  580
            + Q+KARGI Y
Sbjct  143  ECQAKARGIPY  153



>dbj|BAI52973.1| G1-like protein [Physcomitrella patens]
Length=204

 Score =   205 bits (521),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  179  HHPQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVH  358
             H Q S A SRYE+QKRRDWNTFGQYL+N RPP++L +CT  HVLEF+ YLDQFGKTKVH
Sbjct  21   QHDQNSRAPSRYEAQKRRDWNTFGQYLRNHRPPLALARCTGVHVLEFVHYLDQFGKTKVH  80

Query  359  TPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLR  538
             P CPF+G P+PP PCPCPLRQAWGSLDALIGRLRAA+EENGG PE+NPFGAR VRLYLR
Sbjct  81   VPSCPFFGLPHPPHPCPCPLRQAWGSLDALIGRLRAAFEENGGKPESNPFGARQVRLYLR  140

Query  539  EVRDLQSKARGISYE  583
            EVR++Q+KARGI+YE
Sbjct  141  EVREMQAKARGIAYE  155



>ref|XP_009407185.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
 ref|XP_009407186.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
 ref|XP_009407187.1| PREDICTED: protein G1-like4 [Musa acuminata subsp. malaccensis]
Length=190

 Score =   204 bits (520),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYE+QKRRDWNTF QYLKN +PP+SL +C+  HVLEFLRYLDQFGKTK+HTP CPF+GHP
Sbjct  35   RYEAQKRRDWNTFSQYLKNHQPPLSLSRCSAAHVLEFLRYLDQFGKTKIHTPACPFFGHP  94

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            NPPAPCPCPLRQAWGSLDALIGRLRAA+EENGG  E NPFGARAVRLYLRE+R+LQ+KAR
Sbjct  95   NPPAPCPCPLRQAWGSLDALIGRLRAAFEENGGKREANPFGARAVRLYLREIRELQAKAR  154

Query  569  GISY  580
            GISY
Sbjct  155  GISY  158



>ref|XP_003540402.1| PREDICTED: uncharacterized protein LOC100802937 isoform X1 [Glycine 
max]
 ref|XP_006592869.1| PREDICTED: uncharacterized protein LOC100802937 isoform X2 [Glycine 
max]
 gb|KHN27942.1| hypothetical protein glysoja_007674 [Glycine soja]
Length=175

 Score =   204 bits (519),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +2

Query  176  DHHPQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKV  355
            D++ Q    LSRYESQKRRDWNTFGQYLKNQRPPV L QC CNHVL+FLRYLDQFGKTKV
Sbjct  18   DNYQQSPGTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKV  77

Query  356  HTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYL  535
            H   C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF + ++R+YL
Sbjct  78   HLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYL  137

Query  536  REVRDLQSKARGISYE  583
            +EVR+ Q+KARGI Y+
Sbjct  138  KEVRECQAKARGIPYK  153



>ref|XP_002973743.1| hypothetical protein SELMODRAFT_36560, partial [Selaginella moellendorffii]
 ref|XP_002975792.1| hypothetical protein SELMODRAFT_36559, partial [Selaginella moellendorffii]
 gb|EFJ23421.1| hypothetical protein SELMODRAFT_36559, partial [Selaginella moellendorffii]
 gb|EFJ25403.1| hypothetical protein SELMODRAFT_36560, partial [Selaginella moellendorffii]
Length=153

 Score =   203 bits (516),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTK+H P CPF+G 
Sbjct  21   SRYEAQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGKTKIHAPACPFFGL  80

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
             +PPAPC CPLRQAWGSLDALIGRLRAA+EE+GG PE+NPFGARAVRLYLREVR++Q+KA
Sbjct  81   AHPPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARAVRLYLREVREMQAKA  140

Query  566  RGISYE  583
            RGI+YE
Sbjct  141  RGIAYE  146



>ref|XP_008367221.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Malus 
domestica]
 ref|XP_008367222.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Malus 
domestica]
Length=204

 Score =   205 bits (521),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVH  +CPF+G
Sbjct  41   LSRYENQKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHIQLCPFFG  100

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            +PNPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVRD Q+K
Sbjct  101  NPNPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPEANPFGARAVRLYLREVRDSQAK  160

Query  563  ARGISYE  583
            ARGISYE
Sbjct  161  ARGISYE  167



>ref|XP_010689830.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Beta 
vulgaris subsp. vulgaris]
Length=188

 Score =   204 bits (519),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +2

Query  191  PSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPIC  370
            PSP  SRYESQKRRDWNTFGQYL+NQ PPV L QCTC+HVL+FLRYLDQFGKTKVH P C
Sbjct  19   PSPTPSRYESQKRRDWNTFGQYLRNQHPPVPLSQCTCHHVLDFLRYLDQFGKTKVHVPGC  78

Query  371  PFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRD  550
             FYG P PPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PETNPF   A+R+YLREVR+
Sbjct  79   MFYGQPEPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGPPETNPFAGSAIRVYLREVRE  138

Query  551  LQSKARGISY  580
             Q+KARGI Y
Sbjct  139  CQAKARGIPY  148



>ref|XP_006362411.1| PREDICTED: uncharacterized protein LOC102591189 [Solanum tuberosum]
Length=191

 Score =   204 bits (519),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 116/130 (89%), Gaps = 1/130 (1%)
 Frame = +2

Query  191  PSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPIC  370
            P+P LSRYESQKRRDWNTFGQYLKNQRPPVSL QC CNHVLEFLRYLDQFGKTKVH   C
Sbjct  29   PAP-LSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGC  87

Query  371  PFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRD  550
             F+G P+PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PE NPFG  A+RLYLREV++
Sbjct  88   VFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKE  147

Query  551  LQSKARGISY  580
             Q+KARGI Y
Sbjct  148  CQAKARGIPY  157



>ref|XP_006358940.1| PREDICTED: uncharacterized protein LOC102602985 [Solanum tuberosum]
Length=205

 Score =   204 bits (520),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 117/140 (84%), Gaps = 5/140 (4%)
 Frame = +2

Query  176  DHHPQ-PS----PALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQF  340
            DHH Q PS    P LSRYESQKRRDWNTFGQYLKNQRPPV L QC  NHVLEFLRYLDQF
Sbjct  35   DHHHQLPSVPVPPQLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNYNHVLEFLRYLDQF  94

Query  341  GKTKVHTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARA  520
            GKTKVH   CPF+G P PP PC CPLRQAWGSLDALIGRLRAAYEENGG PE NPF + +
Sbjct  95   GKTKVHLHGCPFFGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGS  154

Query  521  VRLYLREVRDLQSKARGISY  580
            +R+YLREVRD Q+KARGISY
Sbjct  155  IRVYLREVRDFQAKARGISY  174



>ref|XP_003581429.1| PREDICTED: protein G1-like4 [Brachypodium distachyon]
Length=209

 Score =   204 bits (520),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVH   CPF+GH
Sbjct  47   SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHASACPFFGH  106

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            P PPAPCPCPLRQAWGSLDAL+GRLRAAYEENGG+PE+NPF ARAVRLYLREVR+ Q++A
Sbjct  107  PTPPAPCPCPLRQAWGSLDALVGRLRAAYEENGGSPESNPFAARAVRLYLREVREHQARA  166

Query  566  RGISYE  583
            RG+SYE
Sbjct  167  RGVSYE  172



>ref|XP_002454193.1| hypothetical protein SORBIDRAFT_04g026450 [Sorghum bicolor]
 gb|EES07169.1| hypothetical protein SORBIDRAFT_04g026450 [Sorghum bicolor]
Length=208

 Score =   204 bits (520),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVHT  CPF+GH
Sbjct  45   SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHTAACPFFGH  104

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE+NPF ARAVRLYLREVR+ Q++A
Sbjct  105  PNPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGRPESNPFAARAVRLYLREVREHQARA  164

Query  566  RGISYE  583
            RG+SYE
Sbjct  165  RGVSYE  170



>ref|XP_007149738.1| hypothetical protein PHAVU_005G095100g [Phaseolus vulgaris]
 gb|AGV54192.1| hypothetical protein [Phaseolus vulgaris]
 gb|ESW21732.1| hypothetical protein PHAVU_005G095100g [Phaseolus vulgaris]
Length=165

 Score =   203 bits (516),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = +2

Query  191  PSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPIC  370
            P+  LSRYESQKRRDWNTFGQYLKNQRPPV L QC CNHVL+FLRYLDQFGKTKVH   C
Sbjct  16   PTGTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGC  75

Query  371  PFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRD  550
             FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF   ++RLYL+E+R+
Sbjct  76   VFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFATSSIRLYLKEIRE  135

Query  551  LQSKARGISY  580
             Q+KARGI Y
Sbjct  136  CQAKARGIPY  145



>ref|XP_006469013.1| PREDICTED: uncharacterized protein LOC102606613 [Citrus sinensis]
 gb|KDO63369.1| hypothetical protein CISIN_1g047785mg [Citrus sinensis]
Length=174

 Score =   203 bits (517),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +2

Query  176  DHHPQ-PSPAL-SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKT  349
            DHH Q   PA  SRYESQKRRDWNTFGQYLKNQRPPV L QC+CNHVL+FLRYLDQFGKT
Sbjct  15   DHHHQLQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCSCNHVLDFLRYLDQFGKT  74

Query  350  KVHTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRL  529
            KVH   C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF + A+R+
Sbjct  75   KVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRV  134

Query  530  YLREVRDLQSKARGISY  580
            YLREVR+ Q+KARGI Y
Sbjct  135  YLREVRECQAKARGIPY  151



>ref|XP_008218325.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 1 [Prunus 
mume]
Length=215

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +2

Query  194  SPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICP  373
            +P  SRYE+QKRRDWNTF QYL+N RPP+SLP C+  HVLEFLRYLDQFGKTK+H   CP
Sbjct  47   TPTPSRYENQKRRDWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQFGKTKIHNQTCP  106

Query  374  FYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDL  553
            F+G PNPPAPCPCPLRQAWGSLDALIGRLRAAYEE+GG PE NPFGARAVRLYLREVRD 
Sbjct  107  FFGLPNPPAPCPCPLRQAWGSLDALIGRLRAAYEEHGGRPEANPFGARAVRLYLREVRDF  166

Query  554  QSKARGISYE  583
            Q+KARG+SYE
Sbjct  167  QAKARGVSYE  176



>ref|XP_007205890.1| hypothetical protein PRUPE_ppa011331mg [Prunus persica]
 gb|EMJ07089.1| hypothetical protein PRUPE_ppa011331mg [Prunus persica]
Length=215

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +2

Query  194  SPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICP  373
            +P  SRYE+QKRRDWNTF QYL+N RPP+SLP C+  HVLEFLRYLDQFGKTK+H   CP
Sbjct  47   TPTPSRYENQKRRDWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQFGKTKIHNQTCP  106

Query  374  FYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDL  553
            F+G PNPPAPCPCPLRQAWGSLDALIGRLRAAYEE+GG PE NPFGARAVRLYLREVRD 
Sbjct  107  FFGLPNPPAPCPCPLRQAWGSLDALIGRLRAAYEEHGGRPEANPFGARAVRLYLREVRDF  166

Query  554  QSKARGISYE  583
            Q+KARG+SYE
Sbjct  167  QAKARGVSYE  176



>gb|KDP35079.1| hypothetical protein JCGZ_11031 [Jatropha curcas]
Length=169

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            Q +   SRYESQKRRDWNTFGQYLKNQRPPV L QC CNHVL+FLRYLDQFGKTKVH   
Sbjct  16   QAAATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHVQG  75

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF + A+R+YLREVR
Sbjct  76   CMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVR  135

Query  548  DLQSKARGISY  580
            D Q+KARGI Y
Sbjct  136  DCQAKARGIPY  146



>ref|XP_002522583.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39883.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 118/131 (90%), Gaps = 1/131 (1%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            QP+P LSRYESQKRRDWNTFGQYLKNQRPPVSL QC CNHVL+FLRYLDQFGKTKVH   
Sbjct  26   QPAP-LSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTKVHLHG  84

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            C F+G P+PPAPC CPLRQAWGSLDALIGRLRAAYEE+GG+PETNPFG  A+R+YLREVR
Sbjct  85   CVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEEHGGSPETNPFGNGAIRVYLREVR  144

Query  548  DLQSKARGISY  580
            + Q+KARGI Y
Sbjct  145  ECQAKARGIPY  155



>ref|XP_009365981.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Pyrus 
x bretschneideri]
 ref|XP_009365982.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3-like [Pyrus 
x bretschneideri]
Length=204

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +2

Query  191  PSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPIC  370
            P   LSRYE+QKRRDWNTFGQYL+N RPP+SL  C+  HVLEFLRYLDQFGKTKVH  +C
Sbjct  37   PCSTLSRYENQKRRDWNTFGQYLRNHRPPLSLSWCSGAHVLEFLRYLDQFGKTKVHIQLC  96

Query  371  PFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRD  550
            PF+G+PNPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVRD
Sbjct  97   PFFGNPNPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPEANPFGARAVRLYLREVRD  156

Query  551  LQSKARGISYE  583
             Q+KARGISYE
Sbjct  157  SQAKARGISYE  167



>ref|XP_006446791.1| hypothetical protein CICLE_v10016699mg [Citrus clementina]
 gb|ESR60031.1| hypothetical protein CICLE_v10016699mg [Citrus clementina]
Length=209

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +2

Query  176  DHHPQ-PSPAL-SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKT  349
            DHH Q   PA  SRYESQKRRDWNTFGQYLKNQRPPV L QC+CNHVL+FLRYLDQFGKT
Sbjct  50   DHHHQLQQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCSCNHVLDFLRYLDQFGKT  109

Query  350  KVHTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRL  529
            KVH   C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF + A+R+
Sbjct  110  KVHLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRV  169

Query  530  YLREVRDLQSKARGISY  580
            YLREVR+ Q+KARGI Y
Sbjct  170  YLREVRECQAKARGIPY  186



>ref|XP_011005316.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4-like [Populus 
euphratica]
Length=247

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +2

Query  209  RYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHp  388
            RYESQKRRDWNTFGQYL+N RPP++L +C+  HVLEFLRYLDQFGKTKVH+  CPF+GHP
Sbjct  56   RYESQKRRDWNTFGQYLRNHRPPLALARCSGAHVLEFLRYLDQFGKTKVHSENCPFFGHP  115

Query  389  nppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKAR  568
            +PP PCPCPL+QAWGSLDALIGRLRAA+EENGG PETNPFGARAVRLYLREVRD QSKAR
Sbjct  116  HPPCPCPCPLKQAWGSLDALIGRLRAAFEENGGLPETNPFGARAVRLYLREVRDAQSKAR  175

Query  569  GISYE  583
            GI+YE
Sbjct  176  GIAYE  180



>ref|NP_001053313.1| Os04g0516200 [Oryza sativa Japonica Group]
 sp|Q7XRS1.2|G1L4_ORYSJ RecName: Full=Protein G1-like4 [Oryza sativa Japonica Group]
 sp|A2XVI8.1|G1L4_ORYSI RecName: Full=Protein G1-like4 [Oryza sativa Indica Group]
 emb|CAE02351.2| OSJNBb0072M01.12 [Oryza sativa Japonica Group]
 dbj|BAF15227.1| Os04g0516200 [Oryza sativa Japonica Group]
 gb|EAY94848.1| hypothetical protein OsI_16643 [Oryza sativa Indica Group]
 dbj|BAH01532.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAI52982.1| G1-like4 protein [Oryza sativa Japonica Group]
Length=202

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVHT  CPF+GH
Sbjct  40   SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHTAACPFFGH  99

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            P+PPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE+NPF ARAVRLYLREVR+ Q++A
Sbjct  100  PSPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGRPESNPFAARAVRLYLREVREHQARA  159

Query  566  RGISYE  583
            RG+SYE
Sbjct  160  RGVSYE  165



>ref|NP_001145392.1| putative protein of unknown function (DUF640) domain family protein 
[Zea mays]
 ref|XP_008643425.1| PREDICTED: putative protein of unknown function (DUF640) domain 
family protein isoform X1 [Zea mays]
 ref|XP_008643426.1| PREDICTED: putative protein of unknown function (DUF640) domain 
family protein isoform X1 [Zea mays]
 gb|ACG47227.1| hypothetical protein [Zea mays]
 gb|AFW72397.1| putative protein of unknown function (DUF640) domain family protein 
[Zea mays]
Length=204

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVHT  CPF+GH
Sbjct  43   SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHTAACPFFGH  102

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            P+PPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE+NPF ARAVRLYLREVR+ Q++A
Sbjct  103  PSPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGRPESNPFAARAVRLYLREVREHQARA  162

Query  566  RGISYE  583
            RG+SYE
Sbjct  163  RGVSYE  168



>ref|XP_003524092.1| PREDICTED: uncharacterized protein LOC100775838 [Glycine max]
Length=236

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +2

Query  194  SPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICP  373
            SP LSRYESQKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVH   C 
Sbjct  42   SPPLSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAETCA  101

Query  374  FYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDL  553
            ++G+ +PP PC CPLRQAWGSLDALIGRLRAA+EENGGTPE NPFG RAVRLYLREVRD 
Sbjct  102  YFGNSHPPGPCACPLRQAWGSLDALIGRLRAAFEENGGTPEMNPFGTRAVRLYLREVRDA  161

Query  554  QSKARGISYE  583
            Q+KARGI+YE
Sbjct  162  QAKARGIAYE  171



>ref|XP_007048693.1| Pleckstrin domain-containing family N member 1 [Theobroma cacao]
 gb|EOX92850.1| Pleckstrin domain-containing family N member 1 [Theobroma cacao]
Length=212

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = +2

Query  176  DHHPQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKV  355
            DH  QP+   SRYESQKRRDWNTFGQYLKNQRPPV L QC CNHVL+FLRYLDQFGKTKV
Sbjct  56   DHQQQPA-TPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKV  114

Query  356  HTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYL  535
            H   C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF + A+R+YL
Sbjct  115  HLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYL  174

Query  536  REVRDLQSKARGISY  580
            REVR+ Q+KARGI Y
Sbjct  175  REVRECQAKARGIPY  189



>ref|XP_009773140.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=188

 Score =   203 bits (517),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 116/130 (89%), Gaps = 1/130 (1%)
 Frame = +2

Query  191  PSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPIC  370
            P+P LSRYESQKRRDWNTFGQYLKNQRPPV+L QC CNHVLEFLRYLDQFGKTKVH   C
Sbjct  28   PAP-LSRYESQKRRDWNTFGQYLKNQRPPVALSQCNCNHVLEFLRYLDQFGKTKVHLHGC  86

Query  371  PFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRD  550
             F+G P+PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PE NPFG  A+RLYLREV++
Sbjct  87   VFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKE  146

Query  551  LQSKARGISY  580
             Q+KARGI Y
Sbjct  147  CQAKARGIPY  156



>ref|XP_010104392.1| hypothetical protein L484_010344 [Morus notabilis]
 gb|EXC00237.1| hypothetical protein L484_010344 [Morus notabilis]
Length=173

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +2

Query  188  QPSPAL-SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTP  364
            QP+PA  SRYESQKRRDWNTFGQYLKNQRPPV L QC CNHVL+FLRYLDQFGKTKVH  
Sbjct  17   QPTPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHVQ  76

Query  365  ICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREV  544
             C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG PETNPF + A+R+YLREV
Sbjct  77   GCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGFPETNPFASGAIRVYLREV  136

Query  545  RDLQSKARGISY  580
            R+ Q+KARGI Y
Sbjct  137  RECQAKARGIPY  148



>ref|XP_004953146.1| PREDICTED: uncharacterized protein LOC101777339 isoform X1 [Setaria 
italica]
 ref|XP_004953147.1| PREDICTED: uncharacterized protein LOC101777339 isoform X2 [Setaria 
italica]
Length=199

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVHT  CPF+GH
Sbjct  38   SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHTAACPFFGH  97

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE+NPF ARAVRLYLREVR+ Q++A
Sbjct  98   PNPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGRPESNPFAARAVRLYLREVREHQARA  157

Query  566  RGISYE  583
            RG+SYE
Sbjct  158  RGVSYE  163



>ref|XP_010508549.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010508550.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010517796.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
 ref|XP_010517797.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Camelina 
sativa]
Length=178

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            +P    SRYESQKRRDWNTFGQYLKNQRPPV +  C+CNHVL+FLRYLDQFGKTKVH P 
Sbjct  18   EPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPG  77

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF + A+R+YLREVR
Sbjct  78   CMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVR  137

Query  548  DLQSKARGISY  580
            + Q+KARGI Y
Sbjct  138  ECQAKARGIPY  148



>emb|CDO96796.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 0/126 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYESQKRRDWNTFGQYLKNQRPPVSL QC CNHVLEFLRYLDQFGKTKVH   C F+G
Sbjct  38   LSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLEFLRYLDQFGKTKVHLHGCVFFG  97

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
             P+PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPFG  A+R+YLREV++ Q+K
Sbjct  98   QPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFGNGAIRVYLREVKECQAK  157

Query  563  ARGISY  580
            ARGI Y
Sbjct  158  ARGIPY  163



>gb|EAZ31342.1| hypothetical protein OsJ_15463 [Oryza sativa Japonica Group]
Length=202

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVHT  CPF+GH
Sbjct  40   SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHTAACPFFGH  99

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            P+PPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE+NPF ARAVRLYLREVR+ Q++A
Sbjct  100  PSPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGRPESNPFAARAVRLYLREVREHQARA  159

Query  566  RGISYE  583
            RG+SYE
Sbjct  160  RGVSYE  165



>ref|XP_006296565.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 ref|XP_006296566.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 gb|EOA29463.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
 gb|EOA29464.1| hypothetical protein CARUB_v100241591mg [Capsella rubella]
Length=178

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            +P    SRYESQKRRDWNTFGQYLKNQRPPV +  C+CNHVL+FLRYLDQFGKTKVH P 
Sbjct  18   EPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPG  77

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF + A+R+YLREVR
Sbjct  78   CMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVR  137

Query  548  DLQSKARGISY  580
            + Q+KARGI Y
Sbjct  138  ECQAKARGIPY  148



>gb|KHN05068.1| hypothetical protein glysoja_013975, partial [Glycine soja]
Length=139

 Score =   201 bits (511),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/121 (87%), Positives = 113/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  221  QKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGHpnppa  400
            QKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVHT +CPF+GHPNPPA
Sbjct  1    QKRRDWNTFGQYLRNHRPPLSLSRCSGAHVLEFLRYLDQFGKTKVHTQLCPFFGHPNPPA  60

Query  401  pcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKARGISY  580
            PCPCPLRQAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREVRD Q+KARGISY
Sbjct  61   PCPCPLRQAWGSLDALIGRLRAAFEENGGKPEANPFGARAVRLYLREVRDSQAKARGISY  120

Query  581  E  583
            E
Sbjct  121  E  121



>ref|XP_010506094.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Camelina 
sativa]
 ref|XP_010506095.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Camelina 
sativa]
Length=178

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            +P    SRYESQKRRDWNTFGQYLKNQRPPV +  C+CNHVL+FLRYLDQFGKTKVH P 
Sbjct  18   EPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPG  77

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF + A+R+YLREVR
Sbjct  78   CMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVR  137

Query  548  DLQSKARGISY  580
            + Q+KARGI Y
Sbjct  138  ECQAKARGIPY  148



>ref|XP_003571880.1| PREDICTED: protein G1-like5 [Brachypodium distachyon]
Length=207

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYESQKRRDWNTFGQYL+N RPP+SL +C+  HVLEFLRYLDQFGKTKVH   CPF+GH
Sbjct  37   SRYESQKRRDWNTFGQYLRNHRPPLSLGRCSGAHVLEFLRYLDQFGKTKVHAQGCPFFGH  96

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDAL+GRLRAAYEENGG PE NPFGARAVRLYLREVR+ Q++A
Sbjct  97   PNPPAPCPCPLRQAWGSLDALVGRLRAAYEENGGRPENNPFGARAVRLYLREVREHQARA  156

Query  566  RGISYE  583
            RG+SYE
Sbjct  157  RGVSYE  162



>ref|XP_006845978.1| hypothetical protein AMTR_s00155p00022580 [Amborella trichopoda]
 gb|ERN07653.1| hypothetical protein AMTR_s00155p00022580 [Amborella trichopoda]
Length=218

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  185  PQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTP  364
            P  S   SRYESQKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVH  
Sbjct  26   PDNSSPPSRYESQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGKTKVHIN  85

Query  365  ICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREV  544
             CPF+GHP+PPAPCPCPL+QAWGSLDALIGRLRAA+EENGG PE NPFGARAVRLYLREV
Sbjct  86   GCPFFGHPHPPAPCPCPLKQAWGSLDALIGRLRAAFEENGGQPEANPFGARAVRLYLREV  145

Query  545  RDLQSKARGISYE  583
            R++Q+KARGI+YE
Sbjct  146  REMQAKARGIAYE  158



>ref|XP_006592933.1| PREDICTED: uncharacterized protein LOC100806493 isoform X1 [Glycine 
max]
 ref|XP_006592934.1| PREDICTED: uncharacterized protein LOC100806493 isoform X2 [Glycine 
max]
Length=184

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +2

Query  179  HHPQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVH  358
            H+ Q    LSRYESQKRRDWNTFGQYL+NQRPPV+L QC+ NHVLEFLRYLDQFGKTKVH
Sbjct  27   HNQQQQLPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCSSNHVLEFLRYLDQFGKTKVH  86

Query  359  TPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLR  538
            +  C F+G   PP PC CPLRQAWGSLDALIGRLRAAYEENGG PETNPF + A+R+YLR
Sbjct  87   SQGCLFFGQTEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRVYLR  146

Query  539  EVRDLQSKARGISY  580
            EVRD QSKARGI Y
Sbjct  147  EVRDSQSKARGIPY  160



>ref|XP_010524062.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Tarenaya 
hassleriana]
Length=176

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            Q S   SRYESQKRRDWNTFGQYLKNQRPPV L QC CNHVL+FLRYLDQFGKTKVH P 
Sbjct  20   QQSVTPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHAPG  79

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF + A+R++LREVR
Sbjct  80   CMFYGQPEPPAPCICPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVFLREVR  139

Query  548  DLQSKARGISY  580
            + Q+KARGI Y
Sbjct  140  ECQAKARGIPY  150



>ref|XP_010324393.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like isoform 
X1 [Solanum lycopersicum]
Length=199

 Score =   203 bits (516),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 110/137 (80%), Gaps = 2/137 (1%)
 Frame = +2

Query  176  DHHPQ--PSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKT  349
            DHH Q  P P LSRYESQKRRDWNTFGQYLKN +PPV LPQC  NHVL+FLRYLDQFGKT
Sbjct  28   DHHHQLSPPPQLSRYESQKRRDWNTFGQYLKNHKPPVPLPQCNYNHVLDFLRYLDQFGKT  87

Query  350  KVHTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRL  529
            KVH   C F+G      PC CPLRQAWGSLDALIGRLRAAYEENGG  ETNPF   A+R+
Sbjct  88   KVHLNGCVFFGQVEQVGPCTCPLRQAWGSLDALIGRLRAAYEENGGLQETNPFANSAIRI  147

Query  530  YLREVRDLQSKARGISY  580
            YLREVRD Q+KARGI Y
Sbjct  148  YLREVRDSQAKARGIPY  164



>dbj|BAI52974.1| G1-like protein [Selaginella moellendorffii]
Length=225

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTK+H P CPF+G 
Sbjct  36   SRYEAQKRRDWNTFGQYLKNHRPPLALSRCSGAHVLEFLRYLDQFGKTKIHAPACPFFGL  95

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
             +PPAPC CPLRQAWGSLDALIGRLRAA+EE+GG PE+NPFGARAVRLYLREVR++Q+KA
Sbjct  96   AHPPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARAVRLYLREVREMQAKA  155

Query  566  RGISYE  583
            RGI+YE
Sbjct  156  RGIAYE  161



>ref|XP_009784769.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
sylvestris]
Length=196

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 114/137 (83%), Gaps = 2/137 (1%)
 Frame = +2

Query  176  DHHPQ--PSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKT  349
            DHH Q  P P LSRYESQKRRDWNTFG YLKN RPP+ L QC  NHVLEFLRYLDQFGKT
Sbjct  32   DHHRQLPPPPQLSRYESQKRRDWNTFGHYLKNLRPPIPLSQCNYNHVLEFLRYLDQFGKT  91

Query  350  KVHTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRL  529
            KVH   CPF+G P PP PC CPLRQAWGSLDALIGRLRAAYEENGG PE NPF + ++R+
Sbjct  92   KVHLHGCPFFGQPEPPGPCACPLRQAWGSLDALIGRLRAAYEENGGLPENNPFASGSIRI  151

Query  530  YLREVRDLQSKARGISY  580
            YLREVRD Q+KARGISY
Sbjct  152  YLREVRDFQAKARGISY  168



>ref|XP_010052190.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Eucalyptus 
grandis]
 gb|KCW76110.1| hypothetical protein EUGRSUZ_D00487 [Eucalyptus grandis]
Length=177

 Score =   202 bits (513),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  185  PQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTP  364
            P P+P LSRYESQKRRDWNTFGQYL+NQ+PPV+L QC CNHVLEFLRYLDQFGKTKVH  
Sbjct  25   PAPAP-LSRYESQKRRDWNTFGQYLRNQKPPVALSQCNCNHVLEFLRYLDQFGKTKVHLH  83

Query  365  ICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREV  544
             C F+G   PPAPC CPLRQAWGSLDALIGRLRAAYEENGG PE NPFG  A+R+YLREV
Sbjct  84   GCVFFGQREPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGAPENNPFGNGAIRVYLREV  143

Query  545  RDLQSKARGISY  580
            ++ Q+KARGI Y
Sbjct  144  KECQAKARGIPY  155



>ref|XP_003553762.1| PREDICTED: uncharacterized protein LOC100786135 [Glycine max]
Length=183

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTF QYL+NQRPP+SL  C+  HVLEFL+YLDQFGKTKVH P CPF+G 
Sbjct  28   SRYENQKRRDWNTFCQYLRNQRPPLSLALCSGAHVLEFLQYLDQFGKTKVHNPPCPFFGL  87

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PETNPFGARAVRLYL +VRD Q+KA
Sbjct  88   PNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGRPETNPFGARAVRLYLHDVRDFQAKA  147

Query  566  RGISYE  583
            RG+SYE
Sbjct  148  RGVSYE  153



>ref|XP_009133547.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10 [Brassica 
rapa]
Length=177

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            +P    SRYESQKRRDWNTFGQYLKNQRPPV +  C CNHVL+FLRYLDQFGKTKVH P 
Sbjct  18   EPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCNCNHVLDFLRYLDQFGKTKVHVPG  77

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF + A+R+YLREVR
Sbjct  78   CMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVR  137

Query  548  DLQSKARGISY  580
            + Q+KARGI Y
Sbjct  138  ECQAKARGIPY  148



>ref|XP_002961823.1| hypothetical protein SELMODRAFT_68566, partial [Selaginella moellendorffii]
 ref|XP_002980828.1| hypothetical protein SELMODRAFT_58613, partial [Selaginella moellendorffii]
 gb|EFJ18013.1| hypothetical protein SELMODRAFT_58613, partial [Selaginella moellendorffii]
 gb|EFJ37083.1| hypothetical protein SELMODRAFT_68566, partial [Selaginella moellendorffii]
Length=173

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP++LP+C+  +VLEFLRYLDQFGKTK+H P CPF+G 
Sbjct  27   SRYEAQKRRDWNTFGQYLRNHRPPLTLPRCSGANVLEFLRYLDQFGKTKIHAPACPFFGI  86

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
             +PPAPC CPLRQAWGSLDALIGRLRAA+EE+GG PE+NPFGARAVRLYLREVR++Q+KA
Sbjct  87   AHPPAPCACPLRQAWGSLDALIGRLRAAFEEHGGKPESNPFGARAVRLYLREVREMQAKA  146

Query  566  RGISYE  583
            RGI+YE
Sbjct  147  RGIAYE  152



>ref|XP_004233074.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Solanum 
lycopersicum]
Length=191

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 115/130 (88%), Gaps = 1/130 (1%)
 Frame = +2

Query  191  PSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPIC  370
            P+P LSRYESQKRRDWNTFGQYLKNQRPPV L QC CNHVLEFLRYLDQFGKTKVH   C
Sbjct  29   PAP-LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLEFLRYLDQFGKTKVHLHGC  87

Query  371  PFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRD  550
             F+G P+PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PE NPFG  A+RLYLREV++
Sbjct  88   VFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKE  147

Query  551  LQSKARGISY  580
             Q+KARGI Y
Sbjct  148  CQAKARGIPY  157



>ref|XP_011008476.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Populus 
euphratica]
Length=177

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  176  DHHPQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKV  355
            DHH   S  LSRYESQKRRDWNTFGQYLKNQRPPVSL QC CNHVL+FLRYLDQFGKTKV
Sbjct  20   DHHQLQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTKV  79

Query  356  HTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYL  535
            H   C F+G P+PPAPC CPLRQAWGSLDALIGRLRAA+EE+GG+ ETNPFG  A+R+YL
Sbjct  80   HLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAFEEHGGSAETNPFGNGAIRVYL  139

Query  536  REVRDLQSKARGISY  580
            REV++ Q+KARGI Y
Sbjct  140  REVKECQAKARGIPY  154



>ref|XP_009608555.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10-like [Nicotiana 
tomentosiformis]
Length=187

 Score =   202 bits (514),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 115/130 (88%), Gaps = 1/130 (1%)
 Frame = +2

Query  191  PSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPIC  370
            P+P LSRYESQKRRDWNTFGQYLKNQRPPV L QC CNHVLEFLRYLDQFGKTKVH   C
Sbjct  27   PAP-LSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLEFLRYLDQFGKTKVHLHGC  85

Query  371  PFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRD  550
             F+G P+PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PE NPFG  A+RLYLREV++
Sbjct  86   VFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPENNPFGNGAIRLYLREVKE  145

Query  551  LQSKARGISY  580
             Q+KARGI Y
Sbjct  146  CQAKARGIPY  155



>ref|NP_565978.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_850374.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9S7R3.1|LSH10_ARATH RecName: Full=Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 10; AltName: 
Full=Protein ORGAN BOUNDARY 10 [Arabidopsis thaliana]
 gb|AAF24517.1|AF218765_1 177 protein [Arabidopsis thaliana]
 gb|AAD22993.1| expressed protein [Arabidopsis thaliana]
 dbj|BAC43308.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43624.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39968.1| At2g42610 [Arabidopsis thaliana]
 gb|ABQ85148.1| unknown [Arabidopsis thaliana]
 gb|ABQ85149.1| unknown [Arabidopsis thaliana]
 gb|ABQ85150.1| unknown [Arabidopsis thaliana]
 gb|ABQ85151.1| unknown [Arabidopsis thaliana]
 gb|ABQ85152.1| unknown [Arabidopsis thaliana]
 gb|ABQ85153.1| unknown [Arabidopsis thaliana]
 gb|ABQ85154.1| unknown [Arabidopsis thaliana]
 gb|ABQ85155.1| unknown [Arabidopsis thaliana]
 gb|ABQ85156.1| unknown [Arabidopsis thaliana]
 gb|ABQ85157.1| unknown [Arabidopsis thaliana]
 gb|ABQ85158.1| unknown [Arabidopsis thaliana]
 gb|ABQ85159.1| unknown [Arabidopsis thaliana]
 gb|ABQ85160.1| unknown [Arabidopsis thaliana]
 gb|ABQ85161.1| unknown [Arabidopsis thaliana]
 gb|ABQ85162.1| unknown [Arabidopsis thaliana]
 gb|ABQ85163.1| unknown [Arabidopsis thaliana]
 gb|ABQ85164.1| unknown [Arabidopsis thaliana]
 gb|ABQ85165.1| unknown [Arabidopsis thaliana]
 gb|ABQ85166.1| unknown [Arabidopsis thaliana]
 gb|ABQ85167.1| unknown [Arabidopsis thaliana]
 gb|ABQ85168.1| unknown [Arabidopsis thaliana]
 gb|ABQ85169.1| unknown [Arabidopsis thaliana]
 gb|ABQ85170.1| unknown [Arabidopsis thaliana]
 gb|ABQ85171.1| unknown [Arabidopsis thaliana]
 gb|AEC10147.1| uncharacterized protein AT2G42610 [Arabidopsis thaliana]
 gb|AEC10148.1| uncharacterized protein AT2G42610 [Arabidopsis thaliana]
Length=177

 Score =   201 bits (512),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 113/131 (86%), Gaps = 0/131 (0%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            +P    SRYESQKRRDWNTFGQYLKNQRPPV +  C+CNHVL+FLRYLDQFGKTKVH P 
Sbjct  18   EPPVTPSRYESQKRRDWNTFGQYLKNQRPPVPMSHCSCNHVLDFLRYLDQFGKTKVHVPG  77

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG PETNPF + A+R+YLREVR
Sbjct  78   CMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGPPETNPFASGAIRVYLREVR  137

Query  548  DLQSKARGISY  580
            + Q+KARGI Y
Sbjct  138  ECQAKARGIPY  148



>ref|XP_003531069.1| PREDICTED: uncharacterized protein LOC100798406 [Glycine max]
Length=247

 Score =   204 bits (519),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = +2

Query  194  SPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICP  373
            SP LSRYESQKRRDWNTFGQYLKN RPP++L +C+  HVLEFLRYLDQFGKTKVH   C 
Sbjct  43   SPPLSRYESQKRRDWNTFGQYLKNHRPPLTLSRCSGAHVLEFLRYLDQFGKTKVHAETCG  102

Query  374  FYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDL  553
            ++G+ +PP PC CPLRQAWGSLDALIGRLRAA+EENGG PE NPFG RAVRLYLREVRD 
Sbjct  103  YFGNSHPPGPCACPLRQAWGSLDALIGRLRAAFEENGGAPEMNPFGTRAVRLYLREVRDA  162

Query  554  QSKARGISYE  583
            Q+KARGI+YE
Sbjct  163  QAKARGIAYE  172



>ref|XP_008391225.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Malus 
domestica]
 ref|XP_008391226.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4 [Malus 
domestica]
Length=204

 Score =   202 bits (515),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +2

Query  203  LSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYG  382
            LSRYE+QKRRDWNTFGQYL+N RPP+S  +C+  HVLEFLRYLDQFGKTKVH  +CPF+G
Sbjct  41   LSRYENQKRRDWNTFGQYLRNHRPPLSXSRCSGAHVLEFLRYLDQFGKTKVHIQLCPFFG  100

Query  383  HpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSK  562
            +PNPPAPCPCPLRQAWGSLDALIGRLRAA+EE+GG PE NPFGARAVRLYLREVRD Q+K
Sbjct  101  NPNPPAPCPCPLRQAWGSLDALIGRLRAAFEEHGGKPEANPFGARAVRLYLREVRDSQAK  160

Query  563  ARGISYE  583
            ARGISYE
Sbjct  161  ARGISYE  167



>ref|XP_002305745.1| hypothetical protein POPTR_0004s05610g [Populus trichocarpa]
 gb|ABK93578.1| unknown [Populus trichocarpa]
 gb|EEE86256.1| hypothetical protein POPTR_0004s05610g [Populus trichocarpa]
Length=177

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  176  DHHPQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKV  355
            DHH   S  LSRYESQKRRDWNTFGQYLKNQRPPVSL QC CNHVL+FLRYLDQFGKTKV
Sbjct  20   DHHQLQSAPLSRYESQKRRDWNTFGQYLKNQRPPVSLSQCNCNHVLDFLRYLDQFGKTKV  79

Query  356  HTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYL  535
            H   C F+G P+PPAPC CPLRQAWGSLDALIGRLRAA+EE+GG+ ETNPFG  A+R+YL
Sbjct  80   HLHGCVFFGQPDPPAPCTCPLRQAWGSLDALIGRLRAAFEEHGGSAETNPFGNGAIRVYL  139

Query  536  REVRDLQSKARGISY  580
            REV++ Q+KARGI Y
Sbjct  140  REVKECQAKARGIPY  154



>gb|KHN36698.1| hypothetical protein glysoja_001429 [Glycine soja]
Length=175

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +2

Query  176  DHHPQPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKV  355
            +++ Q    LSRYESQKRRDWNTFGQYLKNQRPPV L QC CNHVL+FLRYLDQFGKTKV
Sbjct  18   ENYQQSPGTLSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKV  77

Query  356  HTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYL  535
            H   C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF + ++R+YL
Sbjct  78   HLQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGSIRVYL  137

Query  536  REVRDLQSKARGISYE  583
            +E+R+ Q+KARGI Y+
Sbjct  138  KEIRECQAKARGIPYK  153



>ref|XP_002521586.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40857.1| conserved hypothetical protein [Ricinus communis]
Length=174

 Score =   201 bits (512),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = +2

Query  182  HPQPSPAL-SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVH  358
            H Q  PA  SRYESQKRRDWNTFGQYLKNQRPPV L QC CNHVL+FLRYLDQFGKTKVH
Sbjct  17   HQQHQPATPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVH  76

Query  359  TPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLR  538
               C FYG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF + A+R++LR
Sbjct  77   LQGCMFYGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVFLR  136

Query  539  EVRDLQSKARGISY  580
            EVRD Q+KARGI Y
Sbjct  137  EVRDCQAKARGIPY  150



>ref|XP_010455174.1| PREDICTED: protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 1-like [Camelina 
sativa]
Length=191

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 120/141 (85%), Gaps = 5/141 (4%)
 Frame = +2

Query  176  DHHPQPS-----PALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQF  340
            + +P PS     P+ SRYE+QKRRDWNTF QYL+N RPP+SLP C+  HVLEFLRYLDQF
Sbjct  9    NKNPNPSTQLTPPSSSRYENQKRRDWNTFCQYLRNHRPPLSLPSCSGAHVLEFLRYLDQF  68

Query  341  GKTKVHTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARA  520
            GKTKVH   C F+G PNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFG+RA
Sbjct  69   GKTKVHHQNCAFFGLPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGPPEANPFGSRA  128

Query  521  VRLYLREVRDLQSKARGISYE  583
            VRLYLREVRD Q+KARG+SYE
Sbjct  129  VRLYLREVRDFQAKARGVSYE  149



>ref|XP_004976223.1| PREDICTED: uncharacterized protein LOC101784114 isoform X1 [Setaria 
italica]
 ref|XP_004976224.1| PREDICTED: uncharacterized protein LOC101784114 isoform X2 [Setaria 
italica]
 ref|XP_004976225.1| PREDICTED: uncharacterized protein LOC101784114 isoform X3 [Setaria 
italica]
Length=199

 Score =   202 bits (514),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVH   CPF+GH
Sbjct  40   SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHGAACPFFGH  99

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDAL+GRLRAA+EENGG PE+NPF ARAVRLYLREVR+ Q++A
Sbjct  100  PNPPAPCPCPLRQAWGSLDALVGRLRAAFEENGGRPESNPFAARAVRLYLREVREHQARA  159

Query  566  RGISYE  583
            RG+SYE
Sbjct  160  RGVSYE  165



>gb|KHG07235.1| Putative beta-lactamase-like 1 [Gossypium arboreum]
Length=175

 Score =   201 bits (511),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +2

Query  197  PALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPF  376
            P  SRYESQKRRDWNTFGQYLKNQRPPV L QC CNHVL+FLRYLDQFGKTKVH   C F
Sbjct  25   PTPSRYESQKRRDWNTFGQYLKNQRPPVPLSQCNCNHVLDFLRYLDQFGKTKVHLQGCMF  84

Query  377  YGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQ  556
            YG P PPAPC CPLRQAWGSLDALIGRLRAAYEENGG+PETNPF + A+R+YLREVR+ Q
Sbjct  85   YGQPEPPAPCTCPLRQAWGSLDALIGRLRAAYEENGGSPETNPFASGAIRVYLREVRECQ  144

Query  557  SKARGISY  580
            +KARGI Y
Sbjct  145  AKARGIPY  152



>emb|CDY05593.1| BnaC02g39440D [Brassica napus]
Length=191

 Score =   202 bits (513),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = +2

Query  197  PALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPF  376
            P+ SRYE+QKRRDWNTF QYL+N RPP+SLP C+  HVLEFLRYLDQFGKTKVH   C F
Sbjct  21   PSSSRYENQKRRDWNTFCQYLRNHRPPLSLPSCSGAHVLEFLRYLDQFGKTKVHHQNCAF  80

Query  377  YGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQ  556
            +G PNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFG+RAVRL+LREVRD Q
Sbjct  81   FGLPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGPPEANPFGSRAVRLFLREVRDFQ  140

Query  557  SKARGISYE  583
            SKARG+SYE
Sbjct  141  SKARGVSYE  149



>ref|XP_006652517.1| PREDICTED: uncharacterized protein LOC102706933 [Oryza brachyantha]
Length=199

 Score =   202 bits (513),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +2

Query  206  SRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPICPFYGH  385
            SRYE+QKRRDWNTFGQYL+N RPP+SL QC+  HVLEFLRYLDQFGKTKVHT  CPF+GH
Sbjct  39   SRYEAQKRRDWNTFGQYLRNHRPPLSLAQCSGAHVLEFLRYLDQFGKTKVHTAACPFFGH  98

Query  386  pnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVRDLQSKA  565
            PNPPAPCPCPLRQAWGSLDAL+GRLRAA+EENG  PE+NPF ARAVRLYLREVR+ Q++A
Sbjct  99   PNPPAPCPCPLRQAWGSLDALVGRLRAAFEENGARPESNPFAARAVRLYLREVREHQARA  158

Query  566  RGISYE  583
            RG+SYE
Sbjct  159  RGVSYE  164



>ref|XP_006288726.1| hypothetical protein CARUB_v10002037mg [Capsella rubella]
 gb|EOA21624.1| hypothetical protein CARUB_v10002037mg [Capsella rubella]
Length=191

 Score =   201 bits (512),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 120/141 (85%), Gaps = 5/141 (4%)
 Frame = +2

Query  176  DHHPQPS-----PALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQF  340
            + +P PS     P+ SRYE+QKRRDWNTF QYL+N RPP+SLP C+  HVLEFLRYLDQF
Sbjct  9    NKNPNPSTQLTPPSSSRYENQKRRDWNTFCQYLRNHRPPLSLPSCSGAHVLEFLRYLDQF  68

Query  341  GKTKVHTPICPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARA  520
            GKTKVH   C F+G PNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGG PE NPFG+RA
Sbjct  69   GKTKVHHQNCAFFGLPNPPAPCPCPLRQAWGSLDALIGRLRAAYEENGGPPEANPFGSRA  128

Query  521  VRLYLREVRDLQSKARGISYE  583
            VRLYLREVRD Q+KARG+SYE
Sbjct  129  VRLYLREVRDFQAKARGVSYE  149



>ref|XP_007021735.1| Uncharacterized protein TCM_031777 [Theobroma cacao]
 gb|EOY13260.1| Uncharacterized protein TCM_031777 [Theobroma cacao]
Length=186

 Score =   201 bits (512),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +2

Query  188  QPSPALSRYESQKRRDWNTFGQYLKNQRPPVSLPQCTCNHVLEFLRYLDQFGKTKVHTPI  367
            Q  P LSRYESQKRRDWNTFGQYL+NQRPPV+L QC  NHVLEFLRYLDQFGKTKVH   
Sbjct  32   QNPPPLSRYESQKRRDWNTFGQYLRNQRPPVALSQCNANHVLEFLRYLDQFGKTKVHLQG  91

Query  368  CPFYGHpnppapcpcpLRQAWGSLDALIGRLRAAYEENGGTPETNPFGARAVRLYLREVR  547
            C F+G P PP PC CPLRQAWGSLDALIGRLRAAYEENGG PETNPF + A+R+YLREVR
Sbjct  92   CVFFGQPEPPGPCTCPLRQAWGSLDALIGRLRAAYEENGGLPETNPFASGAIRIYLREVR  151

Query  548  DLQSKARGISY  580
            D Q+KARGI Y
Sbjct  152  DSQAKARGIPY  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1296918549570