BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23664_g1_i1 len=1114 path=[1:0-351 353:352-354 356:355-380
5409:381-389 391:390-510 512:511-578 5432:579-587 589:588-614
616:615-753 755:754-813 815:814-841 843:842-852 854:853-1113]

Length=1114
                                                                      Score     E

ref|XP_004241917.1|  PREDICTED: 60S ribosomal protein L15               354   1e-118   
ref|XP_004242022.1|  PREDICTED: 60S ribosomal protein L15               353   3e-118   
ref|XP_004236901.1|  PREDICTED: 60S ribosomal protein L15-like          352   6e-118   
ref|XP_011076387.1|  PREDICTED: 60S ribosomal protein L15-like          352   8e-118   
ref|XP_011080625.1|  PREDICTED: 60S ribosomal protein L15-like          352   9e-118   
ref|XP_009606590.1|  PREDICTED: 60S ribosomal protein L15               351   2e-117   
ref|XP_011069801.1|  PREDICTED: 60S ribosomal protein L15               351   3e-117   
ref|XP_009796395.1|  PREDICTED: 60S ribosomal protein L15-like          351   3e-117   
gb|EYU24942.1|  hypothetical protein MIMGU_mgv1a013374mg                351   5e-117   
ref|XP_011076388.1|  PREDICTED: 60S ribosomal protein L15-like          350   7e-117   
gb|EYU43197.1|  hypothetical protein MIMGU_mgv1a012815mg                351   7e-117   
ref|XP_006477158.1|  PREDICTED: 60S ribosomal protein L15-like          349   1e-116   
gb|EPS66678.1|  hypothetical protein M569_08101                         347   1e-115   
ref|XP_009764605.1|  PREDICTED: 60S ribosomal protein L15-like          345   4e-115   
ref|XP_008369443.1|  PREDICTED: 60S ribosomal protein L15-1             346   8e-115   
ref|XP_009607935.1|  PREDICTED: 60S ribosomal protein L15-like          344   8e-115   
ref|XP_006440278.1|  hypothetical protein CICLE_v10024403mg             345   1e-114   
ref|XP_009618098.1|  PREDICTED: 60S ribosomal protein L15-like          344   1e-114   
ref|XP_009334550.1|  PREDICTED: 60S ribosomal protein L15-1             345   2e-114   
ref|XP_009768655.1|  PREDICTED: 60S ribosomal protein L15-like          343   2e-114   
ref|XP_002301250.1|  60S ribosomal protein L15                          343   4e-114   Populus trichocarpa [western balsam poplar]
ref|XP_006490145.1|  PREDICTED: 60S ribosomal protein L15-like          343   4e-114   
gb|EPS59253.1|  hypothetical protein M569_15555                         343   4e-114   
sp|O82528.1|RL15_PETHY  RecName: Full=60S ribosomal protein L15         342   6e-114   Petunia x hybrida [garden petunia]
gb|KHG22797.1|  60S ribosomal L15-1 -like protein                       342   6e-114   
ref|XP_006421625.1|  hypothetical protein CICLE_v10005611mg             345   8e-114   
ref|XP_007038342.1|  Ribosomal protein L23/L15e family protein          341   1e-113   
ref|XP_011017435.1|  PREDICTED: 60S ribosomal protein L15-like          342   2e-113   
ref|XP_002304285.2|  60S ribosomal protein L15                          341   2e-113   Populus trichocarpa [western balsam poplar]
ref|XP_007209614.1|  hypothetical protein PRUPE_ppa011603mg             341   2e-113   
ref|XP_011031909.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    340   5e-113   
ref|XP_006369001.1|  60S ribosomal protein L15                          340   5e-113   
ref|XP_008775187.1|  PREDICTED: 60S ribosomal protein L15               340   6e-113   
ref|XP_007157273.1|  hypothetical protein PHAVU_002G057000g             340   7e-113   
ref|XP_002510977.1|  ribosomal protein L15, putative                    339   7e-113   Ricinus communis
ref|XP_010933636.1|  PREDICTED: 60S ribosomal protein L15-1             339   8e-113   
ref|XP_010667037.1|  PREDICTED: 60S ribosomal protein L15-1             339   1e-112   
ref|XP_010919627.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    338   3e-112   
gb|KDP39891.1|  hypothetical protein JCGZ_03422                         338   3e-112   
ref|XP_010107162.1|  60S ribosomal protein L15                          338   3e-112   
ref|XP_008798983.1|  PREDICTED: 60S ribosomal protein L15-like          338   4e-112   
ref|XP_010933963.1|  PREDICTED: 60S ribosomal protein L15-like          337   5e-112   
ref|XP_009406701.1|  PREDICTED: 60S ribosomal protein L15-1-like        337   5e-112   
ref|XP_010686789.1|  PREDICTED: 60S ribosomal protein L15               337   6e-112   
gb|KDP22442.1|  hypothetical protein JCGZ_26273                         337   6e-112   
ref|NP_001235890.1|  uncharacterized protein LOC100305473               337   6e-112   
gb|KHG00889.1|  60S ribosomal L15                                       337   7e-112   
ref|XP_010934657.1|  PREDICTED: 60S ribosomal protein L15-1-like        337   1e-111   
ref|XP_010264371.1|  PREDICTED: 60S ribosomal protein L15-like          336   1e-111   
ref|XP_011001078.1|  PREDICTED: 60S ribosomal protein L15-like          336   1e-111   
gb|KHN44085.1|  60S ribosomal protein L15                               336   1e-111   
ref|XP_004146916.1|  PREDICTED: 60S ribosomal protein L15-like is...    336   1e-111   
ref|XP_009399011.1|  PREDICTED: 60S ribosomal protein L15-1-like        336   1e-111   
ref|XP_009418976.1|  PREDICTED: 60S ribosomal protein L15-1             336   1e-111   
ref|XP_003549922.1|  PREDICTED: 60S ribosomal protein L15-1-like        336   2e-111   
ref|XP_008796124.1|  PREDICTED: 60S ribosomal protein L15-2             335   3e-111   
ref|XP_002277836.1|  PREDICTED: 60S ribosomal protein L15-1             335   3e-111   Vitis vinifera
ref|XP_008437057.1|  PREDICTED: 60S ribosomal protein L15-2 isofo...    335   3e-111   
ref|XP_010538411.1|  PREDICTED: 60S ribosomal protein L15-1-like        335   3e-111   
ref|XP_010539086.1|  PREDICTED: 60S ribosomal protein L15-1-like        335   3e-111   
ref|XP_009398340.1|  PREDICTED: 60S ribosomal protein L15-1-like        335   3e-111   
ref|XP_002530661.1|  ribosomal protein L15, putative                    335   4e-111   Ricinus communis
gb|AGL08210.1|  60S ribosomal protein L15                               335   5e-111   
emb|CAN68893.1|  hypothetical protein VITISV_004609                     335   5e-111   Vitis vinifera
ref|XP_007155679.1|  hypothetical protein PHAVU_003G222000g             334   8e-111   
ref|NP_001236804.1|  uncharacterized protein LOC100306052               334   8e-111   
ref|XP_010258850.1|  PREDICTED: 60S ribosomal protein L15               334   8e-111   
ref|XP_004152395.1|  PREDICTED: 60S ribosomal protein L15-like is...    334   1e-110   
ref|XP_003635402.1|  PREDICTED: 60S ribosomal protein L15-1             334   1e-110   
ref|XP_009408522.1|  PREDICTED: 60S ribosomal protein L15-1-like        333   2e-110   
ref|XP_002268465.1|  PREDICTED: 60S ribosomal protein L15-1-like        333   2e-110   Vitis vinifera
ref|XP_010053499.1|  PREDICTED: 60S ribosomal protein L15-2             333   2e-110   
gb|ACU24496.1|  unknown                                                 333   2e-110   Glycine max [soybeans]
ref|XP_008452210.1|  PREDICTED: 60S ribosomal protein L15-2-like        333   2e-110   
ref|XP_008437056.1|  PREDICTED: 60S ribosomal protein L15-2 isofo...    333   2e-110   
ref|XP_010529971.1|  PREDICTED: 60S ribosomal protein L15-1             333   3e-110   
ref|XP_010062398.1|  PREDICTED: 60S ribosomal protein L15-1             332   4e-110   
gb|KHG16565.1|  60S ribosomal L15-1 -like protein                       332   4e-110   
gb|ACF88005.1|  unknown                                                 332   6e-110   Zea mays [maize]
ref|XP_006838929.1|  hypothetical protein AMTR_s00002p00270230          332   8e-110   
ref|XP_006837338.1|  hypothetical protein AMTR_s00111p00086580          332   8e-110   
ref|NP_001150716.1|  60S ribosomal protein L15                          332   8e-110   Zea mays [maize]
gb|KHG20796.1|  60S ribosomal L15-1 -like protein                       331   1e-109   
ref|XP_002460708.1|  hypothetical protein SORBIDRAFT_02g033530          331   1e-109   Sorghum bicolor [broomcorn]
ref|XP_010540825.1|  PREDICTED: 60S ribosomal protein L15-1-like        330   3e-109   
ref|NP_001050612.1|  Os03g0598800                                       330   3e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010104882.1|  60S ribosomal protein L15                          332   3e-109   
emb|CBI16601.3|  unnamed protein product                                330   4e-109   
ref|NP_001148378.1|  60S ribosomal protein L15                          330   4e-109   Zea mays [maize]
ref|XP_006650289.1|  PREDICTED: 60S ribosomal protein L15-like          330   4e-109   
ref|XP_007039793.1|  Ribosomal protein L23/L15e family protein is...    330   4e-109   
ref|XP_009352987.1|  PREDICTED: 60S ribosomal protein L15-like          330   4e-109   
ref|NP_001150386.1|  60S ribosomal protein L15                          330   5e-109   Zea mays [maize]
gb|ACF87670.1|  unknown                                                 330   6e-109   Zea mays [maize]
ref|XP_002461521.1|  hypothetical protein SORBIDRAFT_02g004020          329   6e-109   Sorghum bicolor [broomcorn]
gb|ADA67930.1|  putative 60S ribosomal protein L15                      329   1e-108   Wolffia arrhiza
ref|XP_007039791.1|  Ribosomal protein L23/L15e family protein is...    328   2e-108   
ref|XP_006655163.1|  PREDICTED: 60S ribosomal protein L15-like          328   2e-108   
gb|ACV50439.1|  ribosomal protein L15                                   328   2e-108   Jatropha curcas
ref|NP_001148602.1|  60S ribosomal protein L15                          328   3e-108   Zea mays [maize]
gb|EEE63068.1|  hypothetical protein OsJ_17876                          334   4e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006837287.1|  hypothetical protein AMTR_s00111p00023340          328   9e-108   
ref|NP_193405.1|  60S ribosomal protein L15-1                           326   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108318.1|  PREDICTED: 60S ribosomal protein L15-1-like        325   2e-107   
ref|XP_008241281.1|  PREDICTED: 60S ribosomal protein L15-like          325   3e-107   
ref|NP_193470.1|  60S ribosomal protein L15-2                           325   3e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145572.1|  PREDICTED: 60S ribosomal protein L15-1             325   4e-107   
ref|XP_007202591.1|  hypothetical protein PRUPE_ppa011597mg             325   4e-107   
gb|AFK49215.1|  unknown                                                 325   4e-107   
ref|XP_004491939.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    325   4e-107   
ref|XP_009136839.1|  PREDICTED: 60S ribosomal protein L15-1             325   4e-107   
emb|CDX90499.1|  BnaA03g42820D                                          327   5e-107   
gb|AFK46983.1|  unknown                                                 325   5e-107   
gb|EEC78893.1|  hypothetical protein OsI_19264                          331   6e-107   Oryza sativa Indica Group [Indian rice]
sp|O65050.1|RL15A_PICMA  RecName: Full=60S ribosomal protein L15-1      324   7e-107   Picea mariana [black spruce]
sp|O65082.1|RL15B_PICMA  RecName: Full=60S ribosomal protein L15-2      324   7e-107   Picea mariana [black spruce]
emb|CDY53647.1|  BnaA08g30370D                                          325   7e-107   
emb|CDY54747.1|  BnaAnng13420D                                          325   8e-107   
emb|CDY60707.1|  BnaC07g50070D                                          327   8e-107   
ref|XP_003593619.1|  Ribosomal protein L15                              326   9e-107   
pdb|3J61|N  Chain N, Localization Of The Large Subunit Ribosomal ...    323   1e-106   
dbj|BAJ95856.1|  predicted protein                                      323   1e-106   
ref|XP_004299420.1|  PREDICTED: 60S ribosomal protein L15-like          323   1e-106   
emb|CDY50842.1|  BnaC08g47880D                                          326   1e-106   
ref|XP_002868106.1|  60S ribosomal protein L15                          323   2e-106   
ref|XP_009136806.1|  PREDICTED: 60S ribosomal protein L15-1-like        323   2e-106   
ref|XP_008360544.1|  PREDICTED: 60S ribosomal protein L15               323   3e-106   
gb|KFK32179.1|  hypothetical protein AALP_AA6G207900                    322   3e-106   
ref|XP_001764493.1|  predicted protein                                  322   3e-106   
ref|XP_006282719.1|  hypothetical protein CARUB_v10005752mg             322   4e-106   
ref|XP_010434676.1|  PREDICTED: 60S ribosomal protein L15-1-like        322   4e-106   
emb|CDY40505.1|  BnaC01g20070D                                          327   4e-106   
ref|XP_004491938.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    323   5e-106   
ref|XP_004955579.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    322   5e-106   
gb|AAK67641.1|  ribosomal protein L15                                   321   9e-106   Homo sapiens [man]
ref|XP_003573847.1|  PREDICTED: 60S ribosomal protein L15-2             321   1e-105   
emb|CAB10520.1|  ribosomal protein                                      322   1e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004957717.1|  PREDICTED: 60S ribosomal protein L15-1-like        321   1e-105   
ref|XP_001753036.1|  predicted protein                                  321   1e-105   
dbj|BAD22764.1|  ribosomal protein                                      321   2e-105   Bromus inermis [awnless brome grass]
ref|XP_001771165.1|  predicted protein                                  320   2e-105   
emb|CDP10996.1|  unnamed protein product                                320   2e-105   
ref|XP_002879569.1|  60S ribosomal protein L15                          320   2e-105   
gb|AFK37409.1|  unknown                                                 320   3e-105   
ref|XP_003563105.1|  PREDICTED: 60S ribosomal protein L15-2             319   6e-105   
ref|XP_004512167.1|  PREDICTED: 60S ribosomal protein L15-1-like        319   7e-105   
gb|ACJ84067.1|  unknown                                                 319   9e-105   Medicago truncatula
ref|XP_001757563.1|  predicted protein                                  318   2e-104   
emb|CDP11952.1|  unnamed protein product                                316   8e-104   
gb|KDO49937.1|  hypothetical protein CISIN_1g028757mg                   316   1e-103   
ref|XP_002961462.1|  hypothetical protein SELMODRAFT_270259             314   7e-103   
ref|XP_002971348.1|  hypothetical protein SELMODRAFT_270900             312   4e-102   
gb|KDO49939.1|  hypothetical protein CISIN_1g028757mg                   308   1e-100   
gb|EMS52882.1|  60S ribosomal protein L15                               310   2e-100   
ref|XP_011031911.1|  PREDICTED: 60S ribosomal protein L15 isoform X3    306   6e-100   
ref|XP_010539199.1|  PREDICTED: 60S ribosomal protein L15-1-like        305   2e-99    
ref|XP_010919628.1|  PREDICTED: 60S ribosomal protein L15 isoform X2    303   8e-99    
ref|XP_004955578.1|  PREDICTED: 60S ribosomal protein L15-1-like ...    303   3e-98    
ref|XP_002946380.1|  component of cytosolic 80S ribosome and 60S ...    301   6e-98    
ref|XP_008234416.1|  PREDICTED: 60S ribosomal protein L15-like          300   1e-97    
ref|XP_004152396.1|  PREDICTED: 60S ribosomal protein L15-like is...    299   2e-97    
emb|CBI25842.3|  unnamed protein product                                298   4e-97    
emb|CBI38664.3|  unnamed protein product                                298   5e-97    
tpg|DAA62721.1|  TPA: hypothetical protein ZEAMMB73_667917              298   1e-96    
ref|XP_001701780.1|  ribosomal protein L15, component of cytosoli...    298   1e-96    Chlamydomonas reinhardtii
gb|EMT29287.1|  60S ribosomal protein L15                               300   1e-96    
gb|AAT85124.1|  putative 60s ribosomal protein L15                      297   2e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_005845356.1|  hypothetical protein CHLNCDRAFT_32281              297   2e-96    
ref|XP_010516773.1|  PREDICTED: 60S ribosomal protein L15-2-like        298   3e-96    
ref|XP_005646118.1|  ribosomal protein L15e                             294   6e-95    
emb|CDX76573.1|  BnaA08g08270D                                          290   1e-93    
emb|CDY09632.1|  BnaC07g34290D                                          290   2e-93    
emb|CDY59531.1|  BnaCnng35130D                                          290   2e-93    
gb|AAF67144.1|AF230646_1  large subunit ribosomal protein L15           290   2e-93    Syntrichia ruralis
emb|CEG01197.1|  Ribosomal protein L15e, conserved site                 288   7e-93    
gb|KFM28228.1|  60S ribosomal protein L15                               296   2e-92    
gb|KCW90850.1|  hypothetical protein EUGRSUZ_A02903                     285   6e-92    
ref|XP_003056552.1|  predicted protein                                  286   9e-92    
gb|EMT18644.1|  60S ribosomal protein L15                               283   3e-91    
ref|XP_001416062.1|  Ribosomal protein L15, component of cytosoli...    283   7e-91    Ostreococcus lucimarinus CCE9901
gb|AFK40278.1|  unknown                                                 281   1e-89    
gb|ACU45020.1|  60s ribosomal protein L15                               276   4e-88    
ref|XP_005717822.1|  60S ribosomal protein L15                          268   7e-85    
ref|XP_004348091.1|  ribosomal protein L15                              268   7e-85    
ref|XP_005703122.1|  60S ribosomal protein L15e isoform 2               267   2e-84    
gb|KDD73446.1|  ribosomal L15                                           267   2e-84    
ref|XP_003382517.1|  PREDICTED: 60S ribosomal protein L15-like          266   2e-84    
ref|XP_503229.1|  60S ribosomal protein L15                             266   3e-84    Yarrowia lipolytica CLIB122
ref|XP_003884098.1|  hypothetical protein NCLIV_045010                  265   7e-84    
ref|XP_005534852.1|  60S ribosomal protein L15                          265   1e-83    
ref|XP_002366469.1|  ribosomal protein L15, putative                    264   2e-83    Toxoplasma gondii ME49
ref|XP_001624083.1|  predicted protein                                  263   4e-83    Nematostella vectensis
gb|EPE06282.1|  60s ribosomal protein l15                               263   5e-83    
gb|ERS96332.1|  60S ribosomal protein L15                               262   1e-82    
ref|XP_007511637.1|  60S ribosomal protein L15                          261   2e-82    
ref|XP_006690758.1|  ribosomal protein L15-like protein                 261   3e-82    
gb|ESW97334.1|  60S ribosomal protein L15-B                             261   4e-82    
gb|EFX04788.1|  60S ribosomal protein l15                               261   4e-82    
ref|XP_002598589.1|  hypothetical protein BRAFLDRAFT_113717             260   9e-82    Branchiostoma floridae
gb|KEF63356.1|  60S ribosomal protein L15                               260   1e-81    
ref|XP_008713401.1|  60S ribosomal protein L15                          259   2e-81    
gb|EMS24660.1|  60S ribosomal protein l15                               259   2e-81    
emb|CEJ94099.1|  Putative Ribosomal protein L15                         259   2e-81    
ref|XP_006822011.1|  PREDICTED: 60S ribosomal protein L15-like is...    259   2e-81    
gb|EQL00837.1|  Ribosomal protein L15e                                  259   3e-81    
ref|XP_002545593.1|  60S ribosomal protein L15-B                        259   3e-81    Candida tropicalis MYA-3404
ref|XP_009159952.1|  60S ribosomal protein L15                          258   5e-81    
ref|XP_008725811.1|  60S ribosomal protein L15                          258   6e-81    
gb|EOA94531.1|  60S ribosomal protein L15                               258   6e-81    
ref|XP_007872719.1|  ribosomal L15                                      258   7e-81    
gb|AAN52373.1|  ribosomal protein L15                                   258   7e-81    Branchiostoma belcheri
gb|KGQ83010.1|  60S ribosomal protein L15-A                             258   8e-81    
ref|XP_001525424.1|  60S ribosomal protein L15-B                        257   9e-81    Lodderomyces elongisporus NRRL YB-4239
ref|XP_007373844.1|  hypothetical protein SPAPADRAFT_59682              257   9e-81    
ref|XP_717445.1|  likely cytosolic ribosomal protein L15                257   1e-80    Candida albicans SC5314
gb|EPQ66314.1|  Protein component of the large (60S) ribosomal su...    257   1e-80    
ref|XP_957199.1|  60S ribosomal protein L15                             257   2e-80    Neurospora crassa OR74A
gb|KEQ59346.1|  60S ribosomal protein L15                               257   2e-80    
ref|XP_004377436.1|  PREDICTED: 60S ribosomal protein L15 isoform 1     257   2e-80    
gb|KEQ99844.1|  hypothetical protein AUEXF2481DRAFT_25720               258   2e-80    
ref|XP_007344080.1|  60S ribosomal protein L15                          256   2e-80    
ref|XP_003869213.1|  Rpl15a ribosomal protein                           256   2e-80    
ref|XP_002162844.1|  PREDICTED: 60S ribosomal protein L15-like          256   2e-80    
ref|XP_003415776.1|  PREDICTED: 60S ribosomal protein L15               256   3e-80    
ref|XP_005029295.1|  PREDICTED: 60S ribosomal protein L15               256   3e-80    
gb|AAS59857.1|  ribosomal protein L15                                   256   3e-80    Acipenser sinensis
ref|XP_003657786.1|  60S ribosomal protein L15                          256   3e-80    
ref|XP_007788991.1|  putative 60s ribosomal protein l15 protein         256   3e-80    
gb|ACR24948.1|  ribosomal protein L15                                   256   4e-80    
ref|XP_009226880.1|  60S ribosomal protein L15                          256   4e-80    
ref|XP_007759046.1|  60S ribosomal protein L15                          256   4e-80    
emb|CCE42581.1|  hypothetical protein CPAR2_202240                      256   4e-80    
ref|XP_007804051.1|  60S ribosomal protein L15                          256   4e-80    
ref|XP_003666937.1|  hypothetical protein MYCTH_2312102                 256   4e-80    
ref|XP_007925894.1|  hypothetical protein MYCFIDRAFT_58365              255   5e-80    
ref|XP_001481087.1|  PREDICTED: 60S ribosomal protein L15-like          255   5e-80    Mus musculus [mouse]
gb|KIE03942.1|  Ribosomal protein L15e                                  255   6e-80    
ref|XP_007421748.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    255   7e-80    
ref|XP_004339224.1|  ribosomal L15, putative                            254   7e-80    
ref|XP_009502210.1|  PREDICTED: 60S ribosomal protein L15               255   7e-80    
ref|XP_007505229.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    255   7e-80    
gb|KFO70740.1|  60S ribosomal protein L15                               255   8e-80    
gb|ENH84342.1|  60s ribosomal protein l15                               255   8e-80    
ref|XP_007737355.1|  60S ribosomal protein L15                          255   9e-80    
ref|XP_007068583.1|  PREDICTED: 60S ribosomal protein L15 isoform X1    255   1e-79    
ref|XP_426002.2|  PREDICTED: 60S ribosomal protein L15 isoform X3       255   1e-79    Gallus gallus [bantam]
ref|XP_001909718.1|  hypothetical protein                               254   1e-79    Podospora anserina S mat+
gb|KEY67005.1|  hypothetical protein S7711_05126                        254   1e-79    
ref|XP_006965992.1|  60s ribosomal protein L152/L15B                    254   1e-79    
ref|XP_007812013.1|  60S ribosomal protein L15                          254   1e-79    
emb|CCF41498.1|  60S ribosomal protein L15                              254   1e-79    
ref|XP_008080630.1|  Ribosomal proteins S24e, L23 and L15e              254   1e-79    
emb|CAH91644.1|  hypothetical protein                                   254   1e-79    Pongo abelii [orang utan]
ref|XP_001545571.1|  60S ribosomal protein L15                          254   1e-79    Botrytis cinerea B05.10
ref|XP_455872.1|  60S ribosomal protein L15                             254   1e-79    Kluyveromyces lactis NRRL Y-1140
tpg|DAA16199.1|  TPA: ribosomal protein L15-like                        254   1e-79    
ref|XP_003350788.1|  60S ribosomal protein L15                          254   1e-79    
ref|NP_079862.1|  60S ribosomal protein L15                             254   1e-79    Mus musculus [mouse]
ref|XP_007762548.1|  ribosomal protein L15e                             254   2e-79    
ref|XP_001245521.1|  60S ribosomal protein L15                          254   2e-79    Coccidioides immitis RS
ref|XP_007378639.1|  60S ribosomal protein L15                          254   2e-79    
gb|KFY50714.1|  hypothetical protein V496_09238                         255   2e-79    
ref|XP_007671745.1|  hypothetical protein BAUCODRAFT_566278             254   2e-79    
gb|KID77747.1|  Ribosomal protein L15e                                  254   2e-79    
gb|AAV38477.1|  ribosomal protein L15                                   254   2e-79    
tpg|DAA32565.1|  TPA: ribosomal protein L15-like                        254   2e-79    
ref|XP_006986589.1|  PREDICTED: 60S ribosomal protein L15-like          254   2e-79    
ref|NP_001266930.1|  60S ribosomal protein L15                          254   2e-79    
ref|XP_007835687.1|  60S ribosomal protein L15                          254   2e-79    
ref|XP_002583622.1|  60S ribosomal protein L15                          254   2e-79    Uncinocarpus reesii 1704
ref|XP_003226267.1|  PREDICTED: 60S ribosomal protein L15               254   2e-79    
gb|EHK15888.1|  hypothetical protein TRIVIDRAFT_217112                  254   2e-79    
ref|XP_009937095.1|  PREDICTED: 60S ribosomal protein L15               254   2e-79    
ref|XP_008831372.1|  PREDICTED: 60S ribosomal protein L15               254   2e-79    
ref|XP_002553867.1|  60S ribosomal protein L15                          254   3e-79    Lachancea thermotolerans CBS 6340
ref|XP_007724541.1|  60S ribosomal protein L15                          254   3e-79    
ref|XP_008596519.1|  60S ribosomal protein L15                          254   3e-79    
ref|XP_007741637.1|  60S ribosomal protein L15                          253   3e-79    
emb|CDO96181.1|  unnamed protein product                                253   3e-79    
ref|XP_001225510.1|  60S ribosomal protein L15                          253   3e-79    
gb|ETE59074.1|  60S ribosomal protein L15                               253   3e-79    
gb|KFR14077.1|  60S ribosomal protein L15                               253   3e-79    
gb|ELR05722.1|  60S ribosomal protein L15                               253   3e-79    
emb|CEI91883.1|  Putative Ribosomal protein L15                         253   3e-79    
gb|KHN95867.1|  Ribosomal protein L15e                                  253   3e-79    
ref|XP_002616462.1|  conserved hypothetical protein                     253   4e-79    
ref|XP_003709740.1|  60S ribosomal protein L15                          253   4e-79    
gb|ESZ93952.1|  60S ribosomal protein L15                               253   4e-79    
ref|XP_007595397.1|  ribosomal L15                                      253   4e-79    
ref|XP_001644954.1|  hypothetical protein Kpol_1025p16                  253   4e-79    
emb|CCX31468.1|  Similar to 60S ribosomal protein L15; acc. no. Q...    253   4e-79    
ref|XP_005040971.1|  PREDICTED: 60S ribosomal protein L15               253   4e-79    
ref|XP_009887238.1|  PREDICTED: 60S ribosomal protein L15               253   4e-79    
ref|XP_003936085.1|  PREDICTED: 60S ribosomal protein L15               253   4e-79    
gb|KFA61144.1|  hypothetical protein S40285_02203                       253   4e-79    
ref|XP_001386507.1|  60S ribosomal protein L15                          253   4e-79    
dbj|BAE31437.1|  unnamed protein product                                253   4e-79    
gb|KFY89477.1|  hypothetical protein V500_05675                         253   5e-79    
gb|EFQ32205.1|  ribosomal L15                                           253   5e-79    
gb|KFO06064.1|  60S ribosomal protein L15                               253   5e-79    
gb|AAG44837.1|  60S ribosomal protein L15                               253   5e-79    
gb|KHJ35835.1|  putative 60s ribosomal protein l15                      253   5e-79    
gb|AAH14837.1|  Ribosomal protein L15                                   253   5e-79    
gb|KGL96424.1|  60S ribosomal protein L15                               253   5e-79    
ref|XP_004198963.1|  Piso0_002360                                       253   5e-79    
gb|KFM13801.1|  60S ribosomal protein L15                               253   5e-79    
ref|XP_006021253.1|  PREDICTED: 60S ribosomal protein L15               253   5e-79    
ref|XP_003856171.1|  60S ribosomal protein L15                          253   5e-79    
gb|EIE79210.1|  60S ribosomal protein L15                               253   5e-79    
gb|EWM27504.1|  Ribosomal protein L15e                                  253   6e-79    
ref|XP_461011.1|  60S ribosomal protein L15                             253   6e-79    
ref|XP_001541513.1|  60S ribosomal protein L15                          253   6e-79    
gb|AAX36167.1|  ribosomal protein L15                                   253   6e-79    
ref|XP_004634243.1|  PREDICTED: 60S ribosomal protein L15               253   7e-79    
dbj|BAO40104.1|  60S ribosomal protein L15-B                            253   7e-79    
ref|XP_003686547.1|  60S ribosomal protein L15                          253   7e-79    
gb|KFH71724.1|  60S ribosomal protein L15                               253   8e-79    
ref|XP_001484435.1|  60S ribosomal protein L15-A                        252   9e-79    
ref|XP_003281126.1|  PREDICTED: 60S ribosomal protein L15-like is...    252   9e-79    
ref|XP_006635829.1|  PREDICTED: 60S ribosomal protein L15-like          252   1e-78    
gb|ERE87094.1|  60S ribosomal protein L15-like protein                  252   1e-78    
gb|AAX43023.1|  ribosomal protein L15                                   252   1e-78    
ref|XP_003647297.1|  hypothetical protein Ecym_6084                     252   1e-78    
ref|XP_002759698.1|  PREDICTED: 60S ribosomal protein L15               252   1e-78    
dbj|BAB79461.1|  ribosomal protein L15                                  252   1e-78    
ref|XP_007589065.1|  putative 60s ribosomal protein l15 protein         252   1e-78    
ref|XP_009691154.1|  60S ribosomal protein L15                          252   1e-78    
ref|XP_007296945.1|  60S ribosomal protein L15                          252   1e-78    
gb|KGK38943.1|  hypothetical protein JL09_g1954                         252   1e-78    
gb|AAX08723.1|  ribosomal protein L15                                   252   1e-78    
gb|EME46361.1|  hypothetical protein DOTSEDRAFT_70383                   251   2e-78    
ref|XP_003837801.1|  hypothetical protein LEMA_P121210.1                253   2e-78    
ref|XP_008020295.1|  hypothetical protein SETTUDRAFT_40911              251   2e-78    
dbj|BAB27107.1|  unnamed protein product                                251   2e-78    
ref|XP_762879.1|  60S ribosomal protein L15                             251   2e-78    
ref|XP_007915208.1|  putative 60s ribosomal protein l15 protein         251   2e-78    
gb|EEQ87750.1|  60S ribosomal protein L15                               251   2e-78    
ref|NP_985761.1|  60S ribosomal protein L15                             251   2e-78    
ref|XP_002623870.1|  60S ribosomal protein L15                          251   2e-78    
emb|CEG70134.1|  Putative Ribosomal protein L15                         251   2e-78    
ref|XP_001828739.2|  60S ribosomal protein L15                          252   2e-78    
ref|XP_006686733.1|  hypothetical protein CANTEDRAFT_114246             251   2e-78    
gb|EFZ14326.1|  hypothetical protein SINV_15101                         251   2e-78    
ref|XP_004221219.1|  60S ribosomal protein L15-1                        251   2e-78    
ref|XP_010986099.1|  PREDICTED: 60S ribosomal protein L15               251   3e-78    
emb|CCD34791.1|  hypothetical protein BofuT4_P098500.1                  254   3e-78    
gb|EJT43462.1|  RPL15B-like protein                                     251   3e-78    
ref|XP_008630208.1|  PREDICTED: 60S ribosomal protein L15               251   3e-78    
gb|KFY33682.1|  hypothetical protein V495_08272                         260   3e-78    
ref|XP_002797110.1|  60S ribosomal protein L15                          251   3e-78    
ref|XP_006670037.1|  60S ribosomal protein L15                          251   3e-78    
ref|XP_003233932.1|  60S ribosomal protein L15                          251   3e-78    
emb|CCQ18640.1|  60S ribosomal protein L15                              251   4e-78    
ref|XP_002771940.1|  60S ribosomal protein L15, putative                251   4e-78    
gb|EMF14509.1|  ribosomal protein L15e                                  251   4e-78    
ref|NP_001232361.1|  putative 60S ribosomal protein L10                 251   4e-78    
gb|EKG10086.1|  Ribosomal protein L15e                                  251   4e-78    
gb|KFX94172.1|  hypothetical protein O988_06437                         260   4e-78    
ref|XP_001615040.1|  60S ribosomal protein L15-1                        251   4e-78    
gb|EJT43834.1|  hypothetical protein SKUD_204406                        251   4e-78    
ref|XP_010136517.1|  PREDICTED: 60S ribosomal protein L15               250   4e-78    
emb|CAG00252.1|  unnamed protein product                                250   4e-78    
ref|XP_008936743.1|  PREDICTED: 60S ribosomal protein L15               250   4e-78    
ref|XP_007414800.1|  hypothetical protein MELLADRAFT_91790              250   5e-78    
ref|XP_003969112.1|  PREDICTED: 60S ribosomal protein L15-like          250   5e-78    
emb|CCK68268.1|  hypothetical protein KNAG_0A06060                      250   5e-78    
gb|KIH94692.1|  large subunit ribosomal protein L15e                    250   6e-78    
ref|XP_008816354.1|  ribosomal L15                                      250   6e-78    
ref|XP_003296271.1|  60S ribosomal protein L15                          251   6e-78    
ref|XP_011123288.1|  hypothetical protein AOL_s00081g168                250   6e-78    
ref|XP_007864396.1|  60S ribosomal protein L15                          250   7e-78    
gb|EJU02043.1|  ribosomal protein L15e                                  250   8e-78    
ref|XP_003678734.1|  60S ribosomal protein L15                          250   8e-78    
ref|XP_002808654.1|  60S ribosomal protein L15, putative                249   1e-77    
gb|EPB90299.1|  60S ribosomal protein L15                               249   1e-77    
ref|XP_002258209.1|  ribosomal protein l15                              249   1e-77    
ref|XP_007844218.1|  60s ribosomal protein l15                          249   1e-77    
ref|XP_004588348.1|  PREDICTED: 60S ribosomal protein L15               249   1e-77    
ref|XP_006005298.1|  PREDICTED: 60S ribosomal protein L15               249   1e-77    
gb|EPB89957.1|  60S ribosomal protein L15                               249   1e-77    
dbj|GAA24916.1|  K7_Rpl15ap                                             249   1e-77    
gb|KFY44566.1|  hypothetical protein V494_01413                         258   1e-77    
ref|XP_003957065.1|  hypothetical protein KAFR_0D02820                  249   1e-77    
gb|KEZ43818.1|  hypothetical protein SAPIO_CDS3973                      249   1e-77    
ref|XP_003054429.1|  60S ribosomal protein L15                          249   1e-77    
gb|EHN00844.1|  Rpl15bp                                                 249   1e-77    
ref|XP_002922979.1|  PREDICTED: 60S ribosomal protein L15-like is...    249   1e-77    
sp|P61369.2|RL15_SILAS  RecName: Full=60S ribosomal protein L15         249   1e-77    
gb|ADO28804.1|  60S ribosomal protein l15                               249   2e-77    
ref|NP_013840.1|  ribosomal 60S subunit protein L15B                    249   2e-77    
gb|EGA57755.1|  Rpl15ap                                                 249   2e-77    
gb|KFH46732.1|  60S ribosomal protein-like protein                      249   2e-77    
ref|NP_001080766.1|  ribosomal protein L15                              249   2e-77    
gb|EHN01315.1|  Rpl15bp                                                 249   2e-77    
emb|CCA75151.1|  probable RPL15A 60S large subunit ribosomal prot...    249   2e-77    
gb|KFY08345.1|  hypothetical protein V492_06315                         258   2e-77    
dbj|BAF98663.1|  ribosomal protein L15                                  249   2e-77    
gb|KFZ12787.1|  hypothetical protein V502_06922                         258   2e-77    
gb|EWG89405.1|  Rpl15bp                                                 249   2e-77    
ref|XP_001212942.1|  60S ribosomal protein L15                          249   2e-77    
ref|NP_001187212.1|  60S ribosomal protein L15                          249   2e-77    
gb|EWG84044.1|  Rpl15bp                                                 248   2e-77    
gb|EGA77362.1|  Rpl15bp                                                 248   3e-77    
ref|XP_004024128.1|  ribosomal protein, putative                        248   3e-77    
ref|XP_381021.1|  RL15_NEUCR 60S ribosomal protein L15                  248   3e-77    
ref|XP_444915.1|  60S ribosomal protein L15                             248   3e-77    
sp|Q7T3M9.3|RL15_SINKN  RecName: Full=60S ribosomal protein L15         248   3e-77    
sp|Q7T3N1.3|RL15_MYLPI  RecName: Full=60S ribosomal protein L15         248   3e-77    
gb|ACD65166.1|  putative 60S ribosomal protein RPL15                    248   3e-77    
ref|NP_001003447.1|  60S ribosomal protein L15                          248   3e-77    
gb|EDL26238.1|  mCG16398                                                248   3e-77    
ref|XP_007068587.1|  PREDICTED: 60S ribosomal protein L15 isoform X5    248   4e-77    
ref|XP_011104444.1|  rpl15ap                                            248   4e-77    
ref|XP_001481082.1|  PREDICTED: 60S ribosomal protein L15-like is...    248   4e-77    
gb|ETW38445.1|  hypothetical protein PFTANZ_00876                       248   4e-77    
sp|Q7T3N2.3|RL15_MONAL  RecName: Full=60S ribosomal protein L15         248   4e-77    
ref|XP_004199814.1|  Piso0_002360                                       248   4e-77    
ref|XP_004939469.1|  PREDICTED: 60S ribosomal protein L15 isoform X5    248   4e-77    
gb|EMT61608.1|  60S ribosomal protein L15                               248   4e-77    
ref|XP_004991174.1|  ribosomal protein L15                              248   4e-77    
gb|KDE04267.1|  60S ribosomal protein L15-B                             248   5e-77    
ref|XP_003795995.1|  PREDICTED: 60S ribosomal protein L15-like is...    248   5e-77    
ref|XP_001712430.1|  rpl15                                              248   5e-77    
ref|NP_013129.1|  ribosomal 60S subunit protein L15A                    248   5e-77    
ref|XP_003322415.1|  60S ribosomal protein L15                          248   6e-77    
gb|EMG48668.1|  Ribosomal protein L15                                   248   6e-77    
ref|XP_002491583.1|  60S ribosomal protein L15                          248   6e-77    
emb|CAJ82575.1|  ribosomal protein L15                                  248   7e-77    
gb|EXL86692.1|  60S ribosomal protein L15                               249   7e-77    
ref|XP_001265199.1|  60S ribosomal protein L15                          247   8e-77    
emb|CDM26463.1|  60S ribosomal protein L15                              247   9e-77    
ref|XP_001873807.1|  60S ribosomal protein L15                          247   9e-77    
ref|XP_004179266.1|  hypothetical protein TBLA_0B09300                  247   1e-76    
dbj|GAA99917.1|  hypothetical protein E5Q_06620                         247   1e-76    
ref|XP_007470051.1|  PREDICTED: 60S ribosomal protein L15-like          247   1e-76    
ref|XP_004074144.1|  PREDICTED: 60S ribosomal protein L15-like          247   1e-76    
gb|EPZ35492.1|  60S ribosomal protein L15                               247   1e-76    
gb|EGU81126.1|  hypothetical protein FOXB_08400                         249   1e-76    
ref|XP_011054650.1|  PREDICTED: 60S ribosomal protein L15               247   1e-76    
sp|Q7T3N7.3|RL15_CYPCA  RecName: Full=60S ribosomal protein L15         247   1e-76    
gb|EGA61325.1|  Rpl15ap                                                 247   1e-76    
emb|CCE30070.1|  probable ribosomal protein L15.e.B, cytosolic          255   2e-76    
gb|EIF48674.1|  60s ribosomal protein l15-b                             246   2e-76    
gb|EWZ51470.1|  60S ribosomal protein L15                               248   2e-76    
ref|XP_005804544.1|  PREDICTED: 60S ribosomal protein L15-like          246   2e-76    
sp|Q7T3P0.3|RL15_HYPNO  RecName: Full=60S ribosomal protein L15         246   2e-76    
ref|XP_006678614.1|  hypothetical protein BATDEDRAFT_36929              246   2e-76    
emb|CCA20982.1|  60S ribosomal protein L151 putative                    246   2e-76    
ref|XP_008502571.1|  PREDICTED: 60S ribosomal protein L15 isoform X2    246   2e-76    
gb|EHN05368.1|  Rpl15bp                                                 246   2e-76    
ref|XP_009657767.1|  60S ribosomal protein L15-B                        246   2e-76    
ref|XP_008558014.1|  PREDICTED: 60S ribosomal protein L15               246   2e-76    
emb|CDR41295.1|  CYFA0S07e00386g1_1                                     246   3e-76    
sp|Q7T3P1.3|RL15_ANGJA  RecName: Full=60S ribosomal protein L15         246   3e-76    
gb|KDQ57849.1|  hypothetical protein JAAARDRAFT_35542                   246   3e-76    
ref|XP_010744993.1|  PREDICTED: 60S ribosomal protein L15               246   3e-76    
ref|XP_008330344.1|  PREDICTED: 60S ribosomal protein L15               246   3e-76    
emb|CDJ61736.1|  ribosomal protein L15, putative                        246   3e-76    
gb|KDB17596.1|  60S ribosomal protein L15                               255   3e-76    
ref|XP_001388776.1|  60S ribosomal protein L15                          246   3e-76    
gb|EPS27962.1|  hypothetical protein PDE_02907                          246   3e-76    
ref|XP_009036617.1|  hypothetical protein AURANDRAFT_60075              246   3e-76    
emb|CDO71546.1|  hypothetical protein BN946_scf184911.g16               246   3e-76    
ref|XP_003455275.1|  PREDICTED: 60S ribosomal protein L15-like is...    246   3e-76    
gb|AAP35254.1|  ribosomal protein L15                                   246   3e-76    
gb|EPT04305.1|  hypothetical protein FOMPIDRAFT_1021970                 246   3e-76    
ref|XP_003488628.1|  PREDICTED: 60S ribosomal protein L15-like          246   3e-76    
ref|XP_658049.1|  RL15_ASPNG 60S RIBOSOMAL PROTEIN L15                  246   4e-76    
gb|EHH16796.1|  hypothetical protein EGK_12144                          245   4e-76    
ref|XP_011102974.1|  rpl15bp                                            245   4e-76    
gb|AAX62392.1|  ribosomal protein L15                                   245   5e-76    
ref|NP_001011478.1|  ribosomal protein L15                              245   5e-76    
gb|EXK95810.1|  60S ribosomal protein L15                               247   5e-76    
gb|KDQ07685.1|  hypothetical protein BOTBODRAFT_38583                   245   5e-76    
gb|EFN78553.1|  60S ribosomal protein L15                               246   5e-76    
sp|P61368.2|RL15_HYDVU  RecName: Full=60S ribosomal protein L15         245   5e-76    
gb|KEI40886.1|  hypothetical protein L969DRAFT_86127                    245   6e-76    
emb|CAY81267.1|  Rpl15ap                                                245   7e-76    
gb|EUD70551.1|  ribosomal L15                                           245   7e-76    
ref|XP_002108683.1|  expressed hypothetical protein                     245   8e-76    
gb|KEY77864.1|  60S ribosomal protein L15                               244   8e-76    
sp|Q7T2N4.3|RL15_SILME  RecName: Full=60S ribosomal protein L15         245   8e-76    
gb|ACO09170.1|  60S ribosomal protein L15                               244   8e-76    
sp|Q7T3N4.3|RL15_MEGAM  RecName: Full=60S ribosomal protein L15         244   8e-76    
ref|XP_005105827.1|  PREDICTED: 60S ribosomal protein L15-like is...    244   8e-76    
ref|XP_010387454.1|  PREDICTED: 60S ribosomal protein L15-like          244   9e-76    
pdb|1S1I|L  Chain L, Structure Of The Ribosomal 80s-Eef2-Sordarin...    244   9e-76    
gb|EYE94488.1|  60S ribosomal protein L15                               244   9e-76    
sp|P61367.2|RL15_EPICO  RecName: Full=60S ribosomal protein L15         244   9e-76    
ref|XP_001430095.1|  hypothetical protein                               244   9e-76    
ref|XP_010582670.1|  PREDICTED: 60S ribosomal protein L15 isoform X2    244   1e-75    
emb|CCO29354.1|  60S ribosomal protein L15                              244   1e-75    
gb|EGA81785.1|  Rpl15ap                                                 244   1e-75    
gb|EQL32630.1|  hypothetical protein BDFG_05175                         255   1e-75    
ref|XP_001820015.1|  60S ribosomal protein L15                          244   1e-75    
ref|XP_001029813.1|  ribosomal protein L15                              244   1e-75    
ref|XP_006810809.1|  PREDICTED: 60S ribosomal protein L15-like          244   1e-75    
ref|XP_007695684.1|  hypothetical protein COCSADRAFT_133030             244   1e-75    
ref|XP_002561234.1|  Pc16g09160                                         244   1e-75    
emb|CDQ81142.1|  unnamed protein product                                244   2e-75    



>ref|XP_004241917.1| PREDICTED: 60S ribosomal protein L15 [Solanum lycopersicum]
 ref|XP_006355022.1| PREDICTED: 60S ribosomal protein L15-like [Solanum tuberosum]
 ref|XP_006356521.1| PREDICTED: 60S ribosomal protein L15 [Solanum tuberosum]
Length=204

 Score =   354 bits (909),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 196/204 (96%), Positives = 200/204 (98%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_004242022.1| PREDICTED: 60S ribosomal protein L15 [Solanum lycopersicum]
 ref|XP_006363900.1| PREDICTED: 60S ribosomal protein L15-like [Solanum tuberosum]
Length=204

 Score =   353 bits (906),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 200/204 (98%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVIL+D AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INEDSTYKYFEVILIDSAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_004236901.1| PREDICTED: 60S ribosomal protein L15-like [Solanum lycopersicum]
Length=204

 Score =   352 bits (904),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 199/204 (98%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AHA IRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDQAHAGIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_011076387.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   352 bits (903),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 202/204 (99%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT STRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHSTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+EVILVDPAHA +RNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_011080625.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   352 bits (903),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 201/204 (99%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT STRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHSTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVIL+DPAH  IRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILIDPAHTTIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_009606590.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana tomentosiformis]
 ref|XP_009601449.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana tomentosiformis]
 ref|XP_009780055.1| PREDICTED: 60S ribosomal protein L15 [Nicotiana sylvestris]
Length=204

 Score =   351 bits (901),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 201/204 (99%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_011069801.1| PREDICTED: 60S ribosomal protein L15 [Sesamum indicum]
Length=204

 Score =   351 bits (900),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 201/204 (99%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVIL+DPAHA +RNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILIDPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_009796395.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   351 bits (900),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 194/204 (95%), Positives = 201/204 (99%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQT+SLRRYR
Sbjct  181  HHKARPSRRATWKRNQTISLRRYR  204



>gb|EYU24942.1| hypothetical protein MIMGU_mgv1a013374mg [Erythranthe guttata]
Length=222

 Score =   351 bits (900),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = -2

Query  933  GSRSSPQFAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRL  754
            G   +    MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT  TRPDKARRL
Sbjct  10   GGERAAATVMGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRL  69

Query  753  GYKAKQgyviyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLG  574
            GYKAKQGYV+YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL 
Sbjct  70   GYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLA  129

Query  573  GLRVLNSYWINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKF  394
            GLRVLNSYWINEDSTYKYFEVIL+DPAH  +RNDPRINW+CNPVHKHRELRGLTSAGKK+
Sbjct  130  GLRVLNSYWINEDSTYKYFEVILIDPAHTTVRNDPRINWICNPVHKHRELRGLTSAGKKY  189

Query  393  RGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  295
            RGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR
Sbjct  190  RGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  222



>ref|XP_011076388.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
 ref|XP_011076389.1| PREDICTED: 60S ribosomal protein L15-like [Sesamum indicum]
Length=204

 Score =   350 bits (897),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 201/204 (99%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+EVIL+DPAHA +RNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILIDPAHATVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>gb|EYU43197.1| hypothetical protein MIMGU_mgv1a012815mg [Erythranthe guttata]
Length=239

 Score =   351 bits (900),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 194/217 (89%), Positives = 202/217 (93%), Gaps = 0/217 (0%)
 Frame = -2

Query  945  RIPAGSRSSPQFAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDK  766
            R   G   +    MGAYTYVSELW+KKQSDVMRFLLRVRCWEYRQLP++VRVT  TRPDK
Sbjct  23   RFHLGGERAAATVMGAYTYVSELWKKKQSDVMRFLLRVRCWEYRQLPAVVRVTHPTRPDK  82

Query  765  ARRLGYKAKQgyviyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAG  586
            ARRLGYKAKQGYV+YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAG
Sbjct  83   ARRLGYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAG  142

Query  585  RKLGGLRVLNSYWINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSA  406
            RKL GLRVLNSYWINEDSTYKYFEVILVDPAH  +RNDPRINW+CNPVHKHRELRGLTSA
Sbjct  143  RKLAGLRVLNSYWINEDSTYKYFEVILVDPAHTTVRNDPRINWICNPVHKHRELRGLTSA  202

Query  405  GKKFRGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  295
            GKK+RGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR
Sbjct  203  GKKYRGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  239



>ref|XP_006477158.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis]
 gb|KDO61391.1| hypothetical protein CISIN_1g028730mg [Citrus sinensis]
Length=204

 Score =   349 bits (895),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 195/204 (96%), Positives = 199/204 (98%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYT+VSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVDPAH AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  181  HHKARPSRRATWKRNNTLSLRRYR  204



>gb|EPS66678.1| hypothetical protein M569_08101, partial [Genlisea aurea]
Length=203

 Score =   347 bits (889),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 191/203 (94%), Positives = 200/203 (99%), Gaps = 0/203 (0%)
 Frame = -2

Query  903  GAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyvi  724
            GAYTY SELWRKKQSDVMRF+LR+RCWEYRQLP++VR+TR TRPDKA RLGYKAKQGYVI
Sbjct  1    GAYTYCSELWRKKQSDVMRFVLRIRCWEYRQLPAVVRITRPTRPDKAHRLGYKAKQGYVI  60

Query  723  yrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWI  544
            YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+
Sbjct  61   YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWV  120

Query  543  NEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLH  364
            NEDSTYKYFEVILVDPAHAAIRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHLH
Sbjct  121  NEDSTYKYFEVILVDPAHAAIRNDPRINWVCNPVHKHRELRGLTSAGKKYRGLRGKGHLH  180

Query  363  HKARPSRRATWKRNQTLSLRRYR  295
            HKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HKARPSRRATWKRNQTLSLRRYR  203



>ref|XP_009764605.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   345 bits (886),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 199/204 (98%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVIL+D AHAA+RNDPRINW+CNPVHKHRELRGLTSAGKK RGL+G+GHL
Sbjct  121  INEDSTYKYFEVILIDAAHAAVRNDPRINWICNPVHKHRELRGLTSAGKKNRGLQGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKQRPSRRATWKRNQTLSLRRYR  204



>ref|XP_008369443.1| PREDICTED: 60S ribosomal protein L15-1 [Malus domestica]
 ref|XP_008363794.1| PREDICTED: 60S ribosomal protein L15-1 [Malus domestica]
Length=236

 Score =   346 bits (887),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 207/235 (88%), Gaps = 4/235 (2%)
 Frame = -2

Query  999  HLLNLFMRSQLFPSAD*PRIPAGSRSSPQFAMGAYTYVSELWRKKQSDVMRFLLRVRCWE  820
            H  +L     L P+A     P  S+   + AMGAY YVSE+WRKKQSDVMRFL RVRCWE
Sbjct  6    HKPSLCASKTLAPTAQ----PCASQLISEPAMGAYKYVSEIWRKKQSDVMRFLQRVRCWE  61

Query  819  YRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkgIVYGKPTNQGV  640
            YRQ PSIVRVTR TRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV KGIVYGKPTNQGV
Sbjct  62   YRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVSKGIVYGKPTNQGV  121

Query  639  TQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHAAIRNDPRIN  460
            TQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVI+VD AH AIRNDPRIN
Sbjct  122  TQLKFQRSKRSVAEERAGRKLGGLRVLNSYWLNEDSTYKYFEVIMVDVAHNAIRNDPRIN  181

Query  459  WLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  295
            WLCNPVHKHRELRGLTSAGKK+RGLRG+GHL+HK RPSRRATWKRN TLSLRRYR
Sbjct  182  WLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRATWKRNTTLSLRRYR  236



>ref|XP_009607935.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana tomentosiformis]
Length=204

 Score =   344 bits (883),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 199/204 (98%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+EVILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDAAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRR TWKRNQTLSLRRYR
Sbjct  181  YHKNRPSRRGTWKRNQTLSLRRYR  204



>ref|XP_006440278.1| hypothetical protein CICLE_v10024403mg [Citrus clementina]
 gb|ESR53518.1| hypothetical protein CICLE_v10024403mg [Citrus clementina]
Length=230

 Score =   345 bits (885),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 196/216 (91%), Positives = 202/216 (94%), Gaps = 0/216 (0%)
 Frame = -2

Query  942  IPAGSRSSPQFAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKA  763
            I   S  +P  +  AYT+VSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKA
Sbjct  15   ISLASLYNPYSSHWAYTFVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKA  74

Query  762  RRLGYKAKQgyviyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGR  583
            RRLGYKAKQGYV+YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR
Sbjct  75   RRLGYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR  134

Query  582  KLGGLRVLNSYWINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAG  403
            KLGGLRVLNSYWINEDSTYKYFEVILVDPAH AIRNDPRINWLCNPVHKHRELRGLTSAG
Sbjct  135  KLGGLRVLNSYWINEDSTYKYFEVILVDPAHNAIRNDPRINWLCNPVHKHRELRGLTSAG  194

Query  402  KKFRGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  295
            KK+RGLRG+GHLHHKARPSRRATWKRN TLSLRRYR
Sbjct  195  KKYRGLRGKGHLHHKARPSRRATWKRNNTLSLRRYR  230



>ref|XP_009618098.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana tomentosiformis]
Length=204

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 190/204 (93%), Positives = 199/204 (98%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+EVIL+D AHAA+RNDPRINW+CNPVHKHRELRGLTSAGKK RGL+G+GHL
Sbjct  121  INEDSTYKYYEVILIDAAHAAVRNDPRINWICNPVHKHRELRGLTSAGKKNRGLQGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKQRPSRRATWKRNQTLSLRRYR  204



>ref|XP_009334550.1| PREDICTED: 60S ribosomal protein L15-1 [Pyrus x bretschneideri]
 ref|XP_009334556.1| PREDICTED: 60S ribosomal protein L15-1 [Pyrus x bretschneideri]
Length=235

 Score =   345 bits (884),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 207/236 (88%), Gaps = 4/236 (2%)
 Frame = -2

Query  1002  RHLLNLFMRSQLFPSAD*PRIPAGSRSSPQFAMGAYTYVSELWRKKQSDVMRFLLRVRCW  823
             RH  +L     L P+A     P  S+     AMGAY YVSE+WRKKQSDVMRFL RVRCW
Sbjct  4     RHKPSLCALKTLAPTAQ----PCASQLISDPAMGAYKYVSEIWRKKQSDVMRFLQRVRCW  59

Query  822   EYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkgIVYGKPTNQG  643
             EYRQ PSIVRVTR TRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPV KGIVYGKPTNQG
Sbjct  60    EYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVSKGIVYGKPTNQG  119

Query  642   VTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHAAIRNDPRI  463
             VTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFEVI+VD AH AIRNDPRI
Sbjct  120   VTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWLNEDSTYKYFEVIMVDVAHNAIRNDPRI  179

Query  462   NWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  295
             NWLCNPVHKHRELRGLTSAGKK+RGLRG+GHL+HK RPSRRATWKRN TLSLRRYR
Sbjct  180   NWLCNPVHKHRELRGLTSAGKKYRGLRGKGHLYHKNRPSRRATWKRNTTLSLRRYR  235



>ref|XP_009768655.1| PREDICTED: 60S ribosomal protein L15-like [Nicotiana sylvestris]
Length=204

 Score =   343 bits (881),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDAAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRR TWKRNQTLSLRRYR
Sbjct  181  YHKNRPSRRGTWKRNQTLSLRRYR  204



>ref|XP_002301250.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_006375250.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011033124.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
 gb|EEE80523.1| 60S ribosomal protein L15 [Populus trichocarpa]
 gb|ERP53047.1| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   343 bits (879),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YR+RVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_006490145.1| PREDICTED: 60S ribosomal protein L15-like [Citrus sinensis]
 gb|KDO49938.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=204

 Score =   343 bits (879),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>gb|EPS59253.1| hypothetical protein M569_15555, partial [Genlisea aurea]
Length=203

 Score =   343 bits (879),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 187/203 (92%), Positives = 199/203 (98%), Gaps = 0/203 (0%)
 Frame = -2

Query  903  GAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyvi  724
            GAYTY SELWRKKQSDVMRF+LR+RCWEYRQLP++VR+TR TRPDKA RLGYKAKQGYVI
Sbjct  1    GAYTYCSELWRKKQSDVMRFVLRIRCWEYRQLPAVVRITRPTRPDKAHRLGYKAKQGYVI  60

Query  723  yrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWI  544
            YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+
Sbjct  61   YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWV  120

Query  543  NEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLH  364
            NEDSTYKY+EVIL+DPAHA +RNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHLH
Sbjct  121  NEDSTYKYYEVILIDPAHAVVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLH  180

Query  363  HKARPSRRATWKRNQTLSLRRYR  295
            HKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HKARPSRRATWKRNQTLSLRRYR  203



>sp|O82528.1|RL15_PETHY RecName: Full=60S ribosomal protein L15 [Petunia x hybrida]
 gb|AAD13389.1| ribosomal protein L15 [Petunia x hybrida]
Length=204

 Score =   342 bits (878),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRTKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AHAAIRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDQAHAAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            H+KA PSRRA WKRNQTLSL RYR
Sbjct  181  HNKAPPSRRANWKRNQTLSLPRYR  204



>gb|KHG22797.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
Length=204

 Score =   342 bits (877),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV   TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVDPAH AIRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDPAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  181  HHKARPSRRATWKRNNTLSLRRYR  204



>ref|XP_006421625.1| hypothetical protein CICLE_v10005611mg [Citrus clementina]
 gb|ESR34865.1| hypothetical protein CICLE_v10005611mg [Citrus clementina]
Length=273

 Score =   345 bits (884),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 192/205 (94%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  909  AMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgy  730
             MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQGY
Sbjct  69   TMGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGY  128

Query  729  viyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSY  550
            V+YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSY
Sbjct  129  VVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSY  188

Query  549  WINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH  370
            WINEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKK+RGLRG+GH
Sbjct  189  WINEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGH  248

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
            LHHKARPSRRATWKRNQTLSLRRYR
Sbjct  249  LHHKARPSRRATWKRNQTLSLRRYR  273



>ref|XP_007038342.1| Ribosomal protein L23/L15e family protein [Theobroma cacao]
 gb|EOY22843.1| Ribosomal protein L23/L15e family protein [Theobroma cacao]
Length=204

 Score =   341 bits (875),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV   TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVDPAH AIRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDPAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRA WKRN TLSLRRYR
Sbjct  181  HHKARPSRRANWKRNNTLSLRRYR  204



>ref|XP_011017435.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
Length=228

 Score =   342 bits (877),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 201/215 (93%), Gaps = 2/215 (1%)
 Frame = -2

Query  933  GSR--SSPQFAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKAR  760
            GSR  +S    MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT  TRPDKAR
Sbjct  14   GSRLQTSRATTMGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKAR  73

Query  759  RLGYKAKQgyviyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRK  580
            RLGYKAKQGYV+YR+RVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRK
Sbjct  74   RLGYKAKQGYVVYRIRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRK  133

Query  579  LGGLRVLNSYWINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGK  400
            LGGL+VLNSYWINEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGK
Sbjct  134  LGGLKVLNSYWINEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGK  193

Query  399  KFRGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  295
            K+RGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR
Sbjct  194  KYRGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  228



>ref|XP_002304285.2| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_006376227.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011031910.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Populus euphratica]
 gb|ABK93503.1| unknown [Populus trichocarpa]
 gb|ERP54024.1| 60S ribosomal protein L15 [Populus trichocarpa]
 gb|EEE79264.2| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   341 bits (875),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRA WKRN TLSLRRYR
Sbjct  181  HHKARPSRRANWKRNNTLSLRRYR  204



>ref|XP_007209614.1| hypothetical protein PRUPE_ppa011603mg [Prunus persica]
 ref|XP_008238447.1| PREDICTED: 60S ribosomal protein L15 [Prunus mume]
 gb|EMJ10813.1| hypothetical protein PRUPE_ppa011603mg [Prunus persica]
Length=204

 Score =   341 bits (874),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSE+WRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSEIWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HKARPSRRATWKRN TLSLRRYR
Sbjct  181  YHKARPSRRATWKRNTTLSLRRYR  204



>ref|XP_011031909.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Populus euphratica]
Length=206

 Score =   340 bits (872),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 192/206 (93%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  912  FAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQg  733
              +GAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT  TRPDKARRLGYKAKQG
Sbjct  1    MKIGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQG  60

Query  732  yviyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  553
            YV+YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS
Sbjct  61   YVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNS  120

Query  552  YWINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRG  373
            YWINEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRGRG
Sbjct  121  YWINEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRG  180

Query  372  HLHHKARPSRRATWKRNQTLSLRRYR  295
            HLHHKARPSRRA WKRN TLSLRRYR
Sbjct  181  HLHHKARPSRRANWKRNNTLSLRRYR  206



>ref|XP_006369001.1| 60S ribosomal protein L15 [Populus trichocarpa]
 ref|XP_011001458.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
 gb|ABK93954.1| unknown [Populus trichocarpa]
 gb|ERP65570.1| 60S ribosomal protein L15 [Populus trichocarpa]
Length=204

 Score =   340 bits (872),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YR+RVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRA WKRN TLSLRRYR
Sbjct  181  HHKARPSRRANWKRNNTLSLRRYR  204



>ref|XP_008775187.1| PREDICTED: 60S ribosomal protein L15 [Phoenix dactylifera]
Length=204

 Score =   340 bits (871),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 190/204 (93%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+EVILVD AH+AIRNDPRINW+C  VHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  VNEDSTYKYYEVILVDAAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_007157273.1| hypothetical protein PHAVU_002G057000g [Phaseolus vulgaris]
 gb|ESW29267.1| hypothetical protein PHAVU_002G057000g [Phaseolus vulgaris]
Length=204

 Score =   340 bits (871),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEV+LVD AHAAIRNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL
Sbjct  121  VNEDSTYKYFEVVLVDVAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HKARPSRRATWKRN TLSLRRYR
Sbjct  181  YHKARPSRRATWKRNNTLSLRRYR  204



>ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus communis]
 gb|EEF51579.1| ribosomal protein L15, putative [Ricinus communis]
Length=204

 Score =   339 bits (870),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKARR+GYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRMGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  181  HHKARPSRRATWKRNNTLSLRRYR  204



>ref|XP_010933636.1| PREDICTED: 60S ribosomal protein L15-1 [Elaeis guineensis]
Length=204

 Score =   339 bits (870),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLP+IVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPAIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINW+CN VHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICNGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_010667037.1| PREDICTED: 60S ribosomal protein L15-1 [Beta vulgaris subsp. 
vulgaris]
Length=204

 Score =   339 bits (869),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 190/204 (93%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWR+KQSDVMRF+LRVRCWEYRQLPSIVRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVLRVRCWEYRQLPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH A+RN+PRINW+CNPVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  LNEDSTYKYFEVILVDTAHNAVRNNPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRNQTLSLRRYR
Sbjct  181  NHKNRPSRRATWKRNQTLSLRRYR  204



>ref|XP_010919627.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Elaeis guineensis]
Length=204

 Score =   338 bits (867),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINW+C  VHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>gb|KDP39891.1| hypothetical protein JCGZ_03422 [Jatropha curcas]
Length=204

 Score =   338 bits (867),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINWLC+PVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCDPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRN TLSLRRYR
Sbjct  181  HHKNRPSRRATWKRNNTLSLRRYR  204



>ref|XP_010107162.1| 60S ribosomal protein L15 [Morus notabilis]
 gb|EXC13927.1| 60S ribosomal protein L15 [Morus notabilis]
Length=204

 Score =   338 bits (866),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 188/204 (92%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSE+WRKKQSD+MRF+ RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYQYVSEIWRKKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFE+ILVDPAH AIRNDPRINW+C PVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  INEDSTYKYFEIILVDPAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHT  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  181  HHKARPSRRATWKRNNTLSLRRYR  204



>ref|XP_008798983.1| PREDICTED: 60S ribosomal protein L15-like [Phoenix dactylifera]
 ref|XP_008810110.1| PREDICTED: 60S ribosomal protein L15-like [Phoenix dactylifera]
Length=204

 Score =   338 bits (866),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 190/204 (93%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH A+RNDPRINW+C  VHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDAAHNAVRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_010933963.1| PREDICTED: 60S ribosomal protein L15-like [Elaeis guineensis]
Length=204

 Score =   337 bits (865),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 189/204 (93%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+RVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH AIRNDPRINW+C  VHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  VNEDSTYKYFEVILVDAAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_009406701.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   337 bits (865),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+IL+DPAH+AIRNDPRINW+C  VHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  VNEDSTYKYYEIILIDPAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_010686789.1| PREDICTED: 60S ribosomal protein L15 [Beta vulgaris subsp. vulgaris]
Length=204

 Score =   337 bits (865),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 188/204 (92%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWR+KQSDVMRF  RVRCWEYRQLPSIVRVT  TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYMQELWRRKQSDVMRFTQRVRCWEYRQLPSIVRVTHPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVMNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPR+NW+CNPVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDTAHNAIRNDPRVNWICNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HKARPSRRATWKRNQTLSLRRYR
Sbjct  181  NHKARPSRRATWKRNQTLSLRRYR  204



>gb|KDP22442.1| hypothetical protein JCGZ_26273 [Jatropha curcas]
Length=204

 Score =   337 bits (864),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRA WKRN TLSLRRYR
Sbjct  181  HHKARPSRRANWKRNNTLSLRRYR  204



>ref|NP_001235890.1| uncharacterized protein LOC100305473 [Glycine max]
 ref|XP_003538942.1| PREDICTED: 60S ribosomal protein L15-1-like [Glycine max]
 gb|ACU13151.1| unknown [Glycine max]
 gb|KHN34919.1| 60S ribosomal protein L15 [Glycine soja]
 gb|KHN42683.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   337 bits (864),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 192/204 (94%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRSTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AHAAIRNDPRINWL NPVHKHRELRGLTSAGK  RGLRGRGHL
Sbjct  121  VNEDSTYKYFEVILVDVAHAAIRNDPRINWLANPVHKHRELRGLTSAGKSNRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HKARPSRRATWKRN TLSLRRYR
Sbjct  181  YHKARPSRRATWKRNNTLSLRRYR  204



>gb|KHG00889.1| 60S ribosomal L15 [Gossypium arboreum]
Length=204

 Score =   337 bits (864),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 189/204 (93%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV   TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDTAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRA WKRN TLSLRRYR
Sbjct  181  HHKARPSRRANWKRNNTLSLRRYR  204



>ref|XP_010934657.1| PREDICTED: 60S ribosomal protein L15-1-like [Elaeis guineensis]
Length=204

 Score =   337 bits (863),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL R+RCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRIRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGI+YGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIIYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+EVILVD AH+AIRNDPRINW+C  VHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  VNEDSTYKYYEVILVDAAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_010264371.1| PREDICTED: 60S ribosomal protein L15-like [Nelumbo nucifera]
Length=204

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGI+YGKPTNQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIMYGKPTNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+E+ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKK+RGL G+GHL
Sbjct  121  INEDSTYKYYEIILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLHGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  181  HHKARPSRRATWKRNNTLSLRRYR  204



>ref|XP_011001078.1| PREDICTED: 60S ribosomal protein L15-like [Populus euphratica]
Length=204

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 191/204 (94%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV   TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVKHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPV KHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVQKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRA WKRN TLSLRRYR
Sbjct  181  HHKARPSRRANWKRNNTLSLRRYR  204



>gb|KHN44085.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 190/204 (93%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRSTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL
Sbjct  121  VNEDSTYKYFEVILVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRN TLSLRRYR
Sbjct  181  YHKNRPSRRATWKRNNTLSLRRYR  204



>ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004146917.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 ref|XP_004167164.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004167165.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 gb|KGN53150.1| hypothetical protein Csa_4G022860 [Cucumis sativus]
 gb|KGN56283.1| hypothetical protein Csa_3G112770 [Cucumis sativus]
 gb|KGN56284.1| hypothetical protein Csa_3G112780 [Cucumis sativus]
Length=204

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 188/204 (92%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV   TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+EVILVD AH A+RNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDVAHNAVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  181  HHKARPSRRATWKRNNTLSLRRYR  204



>ref|XP_009399011.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 188/204 (92%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+EVIL+DPAH AIRNDPRINW+C  VHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  VNEDSTYKYYEVILIDPAHNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_009418976.1| PREDICTED: 60S ribosomal protein L15-1 [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   336 bits (862),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+IL+DPAH+AIRNDPRINW+C  VHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  VNEDSTYKYYEIILIDPAHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_003549922.1| PREDICTED: 60S ribosomal protein L15-1-like [Glycine max]
 gb|KHN09835.1| 60S ribosomal protein L15 [Glycine soja]
Length=204

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 190/204 (93%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRSTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL
Sbjct  121  VNEDSTYKYFEVILVDVAHTAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRN TLSLRRYR
Sbjct  181  YHKNRPSRRATWKRNNTLSLRRYR  204



>ref|XP_008796124.1| PREDICTED: 60S ribosomal protein L15-2 [Phoenix dactylifera]
Length=204

 Score =   335 bits (860),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 189/204 (93%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLP+IVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPAIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH  IRNDPRINW+C  VHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDAAHNTIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_002277836.1| PREDICTED: 60S ribosomal protein L15-1 [Vitis vinifera]
Length=204

 Score =   335 bits (860),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 189/204 (93%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYMYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+E+ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  INEDSTYKYYEIILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  181  HHKARPSRRATWKRNNTLSLRRYR  204



>ref|XP_008437057.1| PREDICTED: 60S ribosomal protein L15-2 isoform X2 [Cucumis melo]
 ref|XP_008453903.1| PREDICTED: 60S ribosomal protein L15-2 [Cucumis melo]
Length=204

 Score =   335 bits (860),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 189/204 (93%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV   TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+EVILVD AH AIRNDPRI W+CNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDVAHNAIRNDPRIKWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  181  HHKARPSRRATWKRNNTLSLRRYR  204



>ref|XP_010538411.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=204

 Score =   335 bits (860),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 185/204 (91%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YR+RV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRIRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+EVILVDPAH A+RNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDPAHKAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRN TLSLRRYR
Sbjct  181  YHKNRPSRRATWKRNNTLSLRRYR  204



>ref|XP_010539086.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=204

 Score =   335 bits (860),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YR+RV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRIRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+EVILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDPAHKAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
             HK RPSRRATWKRN TLSLRRYR
Sbjct  181  FHKNRPSRRATWKRNNTLSLRRYR  204



>ref|XP_009398340.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   335 bits (860),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 197/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+IL+DPAH AIRNDPRINW+C  VHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  VNEDSTYKYYEIILIDPAHGAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_002530661.1| ribosomal protein L15, putative [Ricinus communis]
 gb|EEF31730.1| ribosomal protein L15, putative [Ricinus communis]
Length=204

 Score =   335 bits (859),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 190/204 (93%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKARR+GYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRMGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINWLC PVHKHRELRGLTS+GKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCKPVHKHRELRGLTSSGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRR TWKRN TLSLRRYR
Sbjct  181  HHKNRPSRRGTWKRNNTLSLRRYR  204



>gb|AGL08210.1| 60S ribosomal protein L15 [Arachis hypogaea]
 gb|AGL08221.1| 60S ribosomal protein L15 [Arachis hypogaea]
Length=204

 Score =   335 bits (858),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEE+AGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEEKAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFE+I+VD AH AIRNDPRINWLCNPVHKHRELRGLTSAGK  RGLRG+GHL
Sbjct  121  VNEDSTYKYFEIIMVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRN TLSLRRYR
Sbjct  181  YHKNRPSRRATWKRNNTLSLRRYR  204



>emb|CAN68893.1| hypothetical protein VITISV_004609 [Vitis vinifera]
Length=204

 Score =   335 bits (858),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 188/204 (92%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIV  TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVXATRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+EVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  181  HHKARPSRRATWKRNNTLSLRRYR  204



>ref|XP_007155679.1| hypothetical protein PHAVU_003G222000g [Phaseolus vulgaris]
 gb|ESW27673.1| hypothetical protein PHAVU_003G222000g [Phaseolus vulgaris]
Length=204

 Score =   334 bits (857),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSV+EERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVSEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEV+LVD AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL
Sbjct  121  VNEDSTYKYFEVVLVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRN TLSLRRYR
Sbjct  181  YHKNRPSRRATWKRNNTLSLRRYR  204



>ref|NP_001236804.1| uncharacterized protein LOC100306052 [Glycine max]
 gb|ACU14044.1| unknown [Glycine max]
Length=204

 Score =   334 bits (857),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 189/204 (93%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRSTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL
Sbjct  121  VNEDSTYKYFEVILVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRN  LSLRRYR
Sbjct  181  YHKNRPSRRATWKRNNILSLRRYR  204



>ref|XP_010258850.1| PREDICTED: 60S ribosomal protein L15 [Nelumbo nucifera]
Length=204

 Score =   334 bits (857),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGI+YGKPTNQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIMYGKPTNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+E+ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKK+RGL G+GHL
Sbjct  121  INEDSTYKYYEIILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLHGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRA WKRN TLSLRRYR
Sbjct  181  HHKARPSRRANWKRNNTLSLRRYR  204



>ref|XP_004152395.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 ref|XP_004158132.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis 
sativus]
 gb|KGN50265.1| hypothetical protein Csa_5G162630 [Cucumis sativus]
Length=204

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 188/204 (92%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV   TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+EVILVD AH A+RNDPRINW+CNPVHK RELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDVAHNAVRNDPRINWICNPVHKRRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  181  HHKARPSRRATWKRNNTLSLRRYR  204



>ref|XP_003635402.1| PREDICTED: 60S ribosomal protein L15-1 [Vitis vinifera]
Length=204

 Score =   334 bits (856),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 188/204 (92%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+E+ILVD AH  IRNDPRINW+C PVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  INEDSTYKYYEIILVDAAHNTIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  181  HHKARPSRRATWKRNNTLSLRRYR  204



>ref|XP_009408522.1| PREDICTED: 60S ribosomal protein L15-1-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 185/204 (91%), Positives = 198/204 (97%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPD+ARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDRARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+IL+DP+H+AIRNDPRINW+C  VHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  VNEDSTYKYYEIILLDPSHSAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKARPSRRATWKRNQTLSLRRYR  204



>ref|XP_002268465.1| PREDICTED: 60S ribosomal protein L15-1-like [Vitis vinifera]
Length=204

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 188/204 (92%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIV  TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVCATRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+EVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  181  HHKARPSRRATWKRNNTLSLRRYR  204



>ref|XP_010053499.1| PREDICTED: 60S ribosomal protein L15-2 [Eucalyptus grandis]
 gb|KCW77807.1| hypothetical protein EUGRSUZ_D02096 [Eucalyptus grandis]
Length=204

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 188/204 (92%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH  IR DPRI+WLCNPVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  INEDSTYKYFEVILVDVAHTTIRRDPRISWLCNPVHKHRELRGLTSAGKKYRGLRGKGHT  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN +LSLRRYR
Sbjct  181  HHKARPSRRATWKRNNSLSLRRYR  204



>gb|ACU24496.1| unknown [Glycine max]
Length=204

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 189/204 (93%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TRSTRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRSTRPDKARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH+A+RNDPRINWLCNPVHKHRELRGLTSAGK  RGLRGRGHL
Sbjct  121  VNEDSTYKYFEVILVDVAHSAVRNDPRINWLCNPVHKHRELRGLTSAGKSNRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRN TLS RRYR
Sbjct  181  YHKNRPSRRATWKRNNTLSPRRYR  204



>ref|XP_008452210.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
 ref|XP_008452211.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
 ref|XP_008452213.1| PREDICTED: 60S ribosomal protein L15-2-like [Cucumis melo]
Length=204

 Score =   333 bits (854),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 188/204 (92%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV   TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+EVILVD AH AIRNDPRI W+C PVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDVAHNAIRNDPRIKWICKPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  181  HHKARPSRRATWKRNNTLSLRRYR  204



>ref|XP_008437056.1| PREDICTED: 60S ribosomal protein L15-2 isoform X1 [Cucumis melo]
Length=214

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -2

Query  921  SPQFAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKA  742
            S  F   AY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV   TRPDKARRLGYKA
Sbjct  6    SSSFFFRAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKA  65

Query  741  KQgyviyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  562
            KQGYV+YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV
Sbjct  66   KQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV  125

Query  561  LNSYWINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLR  382
            LNSYWINEDSTYKY+EVILVD AH AIRNDPRI W+CNPVHKHRELRGLTSAGKK+RGLR
Sbjct  126  LNSYWINEDSTYKYYEVILVDVAHNAIRNDPRIKWICNPVHKHRELRGLTSAGKKYRGLR  185

Query  381  GRGHLHHKARPSRRATWKRNQTLSLRRYR  295
            G+GHLHHKARPSRRATWKRN TLSLRRYR
Sbjct  186  GKGHLHHKARPSRRATWKRNNTLSLRRYR  214



>ref|XP_010529971.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
 ref|XP_010529975.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
Length=204

 Score =   333 bits (853),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+EVILVD AH+AIRNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDTAHSAIRNDPRVNWICNPVHKHRELRGLTSEGKKNRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRN TLSLRRYR
Sbjct  181  YHKNRPSRRATWKRNNTLSLRRYR  204



>ref|XP_010062398.1| PREDICTED: 60S ribosomal protein L15-1 [Eucalyptus grandis]
 gb|KCW90851.1| hypothetical protein EUGRSUZ_A02903 [Eucalyptus grandis]
Length=204

 Score =   332 bits (852),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH  IR DPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  LNEDSTYKYFEVILVDAAHNTIRKDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHS  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN +LSLRRYR
Sbjct  181  HHKARPSRRATWKRNNSLSLRRYR  204



>gb|KHG16565.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
Length=204

 Score =   332 bits (852),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 188/204 (92%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV   TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRN TLSLRRYR
Sbjct  181  HHKNRPSRRATWKRNNTLSLRRYR  204



>gb|ACF88005.1| unknown [Zea mays]
 tpg|DAA62722.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   332 bits (851),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFE+ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTLSLRRYR  204



>ref|XP_006838929.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda]
 gb|ERN01498.1| hypothetical protein AMTR_s00002p00270230 [Amborella trichopoda]
Length=204

 Score =   332 bits (850),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 185/204 (91%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSE+WRKKQSDVMRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSEMWRKKQSDVMRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+E+ILVD AH AIRNDPRINW+  PVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INQDSTYKYYEIILVDAAHNAIRNDPRINWITKPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  181  HHKARPSRRATWKRNNTLSLRRYR  204



>ref|XP_006837338.1| hypothetical protein AMTR_s00111p00086580 [Amborella trichopoda]
 gb|ERN00192.1| hypothetical protein AMTR_s00111p00086580 [Amborella trichopoda]
Length=204

 Score =   332 bits (850),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 185/204 (91%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSE+WRKKQSDVMRFL RVRCWEYRQLPSIVR TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSEMWRKKQSDVMRFLQRVRCWEYRQLPSIVRCTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+EVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INQDSTYKYYEVILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRN TLSLRRYR
Sbjct  181  YHKNRPSRRATWKRNNTLSLRRYR  204



>ref|NP_001150716.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACF85905.1| unknown [Zea mays]
 gb|ACG40111.1| 60S ribosomal protein L15 [Zea mays]
 tpg|DAA62720.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   332 bits (850),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFE+ILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTLSLRRYR  204



>gb|KHG20796.1| 60S ribosomal L15-1 -like protein [Gossypium arboreum]
Length=204

 Score =   331 bits (849),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ P+IVRV   TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPAIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRN TLSLRRYR
Sbjct  181  HHKNRPSRRATWKRNNTLSLRRYR  204



>ref|XP_002460708.1| hypothetical protein SORBIDRAFT_02g033530 [Sorghum bicolor]
 gb|ACG25131.1| 60S ribosomal protein L15 [Zea mays]
 gb|EER97229.1| hypothetical protein SORBIDRAFT_02g033530 [Sorghum bicolor]
 tpg|DAA40842.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   331 bits (849),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFE+ILVD AH  IRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTLSLRRYR  204



>ref|XP_010540825.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
 ref|XP_010542214.1| PREDICTED: 60S ribosomal protein L15-1 [Tarenaya hassleriana]
Length=204

 Score =   330 bits (847),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRVTRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YR+RV+RGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRIRVKRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+EVILVD AH A+RNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL
Sbjct  121  INEDSTYKYYEVILVDVAHKAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRN +LSLRRYR
Sbjct  181  YHKNRPSRRATWKRNNSLSLRRYR  204



>ref|NP_001050612.1| Os03g0598800 [Oryza sativa Japonica Group]
 ref|NP_001174316.1| Os05g0274700 [Oryza sativa Japonica Group]
 gb|AAN08216.1| ribosomal protein L15 [Oryza sativa Japonica Group]
 gb|AAO59978.1| ribosomal protein L15 [Oryza sativa Japonica Group]
 gb|ABF97468.1| 60S ribosomal protein L15, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12526.1| Os03g0598800 [Oryza sativa Japonica Group]
 gb|EAY90899.1| hypothetical protein OsI_12513 [Oryza sativa Indica Group]
 gb|EAZ27702.1| hypothetical protein OsJ_11650 [Oryza sativa Japonica Group]
 dbj|BAG87626.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00645.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93044.1| Os05g0274700 [Oryza sativa Japonica Group]
Length=204

 Score =   330 bits (847),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHT  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQT+SLRRYR
Sbjct  181  HHKARPSRRATWKRNQTVSLRRYR  204



>ref|XP_010104882.1| 60S ribosomal protein L15 [Morus notabilis]
 gb|EXC02118.1| 60S ribosomal protein L15 [Morus notabilis]
Length=241

 Score =   332 bits (850),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 189/204 (93%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            +GAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPD+ARRLGYKAKQGYV
Sbjct  38   LGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDRARRLGYKAKQGYV  97

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  98   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  157

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
             NEDSTYKYFEVILVD AH AIRNDPRINWL  PVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  158  TNEDSTYKYFEVILVDVAHNAIRNDPRINWLSKPVHKHRELRGLTSAGKKYRGLRGKGHT  217

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN TLSLRRYR
Sbjct  218  HHKARPSRRATWKRNNTLSLRRYR  241



>emb|CBI16601.3| unnamed protein product [Vitis vinifera]
Length=206

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 187/202 (93%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = -2

Query  900  AYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviy  721
            AY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQGYVIY
Sbjct  5    AYMYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIY  64

Query  720  rvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWIN  541
            RVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWIN
Sbjct  65   RVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWIN  124

Query  540  EDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHH  361
            EDSTYKY+E+ILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKK+RGLRG+GH HH
Sbjct  125  EDSTYKYYEIILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHH  184

Query  360  KARPSRRATWKRNQTLSLRRYR  295
            KARPSRRATWKRN TLSLRRYR
Sbjct  185  KARPSRRATWKRNNTLSLRRYR  206



>ref|NP_001148378.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG31200.1| 60S ribosomal protein L15 [Zea mays]
Length=204

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWR+KQSDVMRF+ R+RCWEYRQ P+IVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRMRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFE+ILVD AH  IRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTLSLRRYR  204



>ref|XP_006650289.1| PREDICTED: 60S ribosomal protein L15-like [Oryza brachyantha]
Length=204

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+SELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYISELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHT  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQT+SLRRYR
Sbjct  181  HHKARPSRRATWKRNQTVSLRRYR  204



>ref|XP_007039793.1| Ribosomal protein L23/L15e family protein isoform 3 [Theobroma 
cacao]
 gb|EOY24294.1| Ribosomal protein L23/L15e family protein isoform 3 [Theobroma 
cacao]
Length=204

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV   TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRN TLSLRRYR
Sbjct  181  YHKNRPSRRATWKRNNTLSLRRYR  204



>ref|XP_009352987.1| PREDICTED: 60S ribosomal protein L15-like [Pyrus x bretschneideri]
Length=204

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 185/204 (91%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MG Y Y SE+WRKKQSD+MRF+ RVRCWEYRQ PSIVRVTR TRPDKAR LGYKAKQGYV
Sbjct  1    MGFYKYQSEIWRKKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARCLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HKARPSRRATWKRN TLSLRRYR
Sbjct  181  YHKARPSRRATWKRNTTLSLRRYR  204



>ref|NP_001150386.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG38875.1| 60S ribosomal protein L15 [Zea mays]
Length=204

 Score =   330 bits (845),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFE+ILVD AH AIR DPRINWLCNPVHKHRELRGLTSAGKKFRGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHTAIRKDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTLSLRRYR  204



>gb|ACF87670.1| unknown [Zea mays]
Length=204

 Score =   330 bits (845),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQL+FQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLRFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFE+ILVD AH  IRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHTTIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTLSLRRYR  204



>ref|XP_002461521.1| hypothetical protein SORBIDRAFT_02g004020 [Sorghum bicolor]
 gb|EER98042.1| hypothetical protein SORBIDRAFT_02g004020 [Sorghum bicolor]
Length=204

 Score =   329 bits (844),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFE+ILVD AH AI+ DPRINWLCNPVHKHRELRGLTSAGKKFRGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHTAIKTDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHT  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTLSLRRYR  204



>gb|ADA67930.1| putative 60S ribosomal protein L15 [Wolffia arrhiza]
Length=204

 Score =   329 bits (843),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 185/204 (91%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQ+P+IVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQMPAIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+EVILVD A  AIRNDPRINW+C  VHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  VNEDSTYKYYEVILVDGALNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQT SLRRYR
Sbjct  181  HHKARPSRRATWKRNQTKSLRRYR  204



>ref|XP_007039791.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007039792.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24292.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
 gb|EOY24293.1| Ribosomal protein L23/L15e family protein isoform 1 [Theobroma 
cacao]
Length=206

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            +GAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRV   TRPDKARRLGYKAKQGYV
Sbjct  3    VGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYV  62

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  63   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  122

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL
Sbjct  123  INEDSTYKYFEVILVDVAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLHGKGHL  182

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRN TLSLRRYR
Sbjct  183  YHKNRPSRRATWKRNNTLSLRRYR  206



>ref|XP_006655163.1| PREDICTED: 60S ribosomal protein L15-like [Oryza brachyantha]
Length=213

 Score =   328 bits (842),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  909  AMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgy  730
             +GAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLGYKAKQGY
Sbjct  9    GVGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGY  68

Query  729  viyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSY  550
            V+YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSY
Sbjct  69   VVYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSY  128

Query  549  WINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH  370
            W+NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH
Sbjct  129  WVNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGH  188

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
             HHKARPSRRATWKRNQT+SLRRYR
Sbjct  189  THHKARPSRRATWKRNQTVSLRRYR  213



>gb|ACV50439.1| ribosomal protein L15 [Jatropha curcas]
Length=204

 Score =   328 bits (841),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 187/204 (92%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVT  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFE ILVD AH AIRNDPRINW+C PVHKHRELRGLT AGKK+RGLRGRGHL
Sbjct  121  INEDSTYKYFEDILVDTAHNAIRNDPRINWICKPVHKHRELRGLTFAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRA WKRN TL  RRYR
Sbjct  181  HHKARPSRRANWKRNNTLFFRRYR  204



>ref|NP_001148602.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACF83256.1| unknown [Zea mays]
 gb|ACG32179.1| 60S ribosomal protein L15 [Zea mays]
 gb|ACG38194.1| 60S ribosomal protein L15 [Zea mays]
 tpg|DAA59713.1| TPA: ribosomal protein L15 [Zea mays]
Length=204

 Score =   328 bits (840),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ PSIVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFE+ILVD AH AI+ DPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHKAIKTDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGHT  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTLSLRRYR  204



>gb|EEE63068.1| hypothetical protein OsJ_17876 [Oryza sativa Japonica Group]
Length=377

 Score =   334 bits (856),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 185/214 (86%), Positives = 199/214 (93%), Gaps = 4/214 (2%)
 Frame = -2

Query  924  SSPQF----AMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARR  757
            SSP F      GAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARR
Sbjct  164  SSPAFLEPQVTGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARR  223

Query  756  LGYKAKQgyviyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL  577
            LGYKAKQGYV+YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKL
Sbjct  224  LGYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKL  283

Query  576  GGLRVLNSYWINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKK  397
            GGLRVLNSYW+NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKK
Sbjct  284  GGLRVLNSYWVNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKK  343

Query  396  FRGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  295
            +RGLRG+GH HHKARPSRRATWKRNQT+SLRRYR
Sbjct  344  YRGLRGKGHTHHKARPSRRATWKRNQTVSLRRYR  377



>ref|XP_006837287.1| hypothetical protein AMTR_s00111p00023340 [Amborella trichopoda]
 gb|ERN00141.1| hypothetical protein AMTR_s00111p00023340 [Amborella trichopoda]
Length=233

 Score =   328 bits (840),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 184/203 (91%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -2

Query  903  GAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyvi  724
            GAY YVSE+WRKKQSDVMRFL RVRCWEYRQLPSIVR TR TRPDKARRLGYKAKQGYVI
Sbjct  31   GAYKYVSEMWRKKQSDVMRFLQRVRCWEYRQLPSIVRCTRPTRPDKARRLGYKAKQGYVI  90

Query  723  yrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWI  544
            YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGL+VLNSYWI
Sbjct  91   YRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLKVLNSYWI  150

Query  543  NEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLH  364
            N+DSTYKY+EVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GHL+
Sbjct  151  NQDSTYKYYEVILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLY  210

Query  363  HKARPSRRATWKRNQTLSLRRYR  295
            HK RPSRRATWKRN TLSLRRYR
Sbjct  211  HKNRPSRRATWKRNNTLSLRRYR  233



>ref|NP_193405.1| 60S ribosomal protein L15-1 [Arabidopsis thaliana]
 ref|XP_002868071.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006391552.1| hypothetical protein EUTSA_v10019144mg [Eutrema salsugineum]
 ref|XP_006414312.1| hypothetical protein EUTSA_v10026269mg [Eutrema salsugineum]
 ref|XP_010440111.1| PREDICTED: 60S ribosomal protein L15-1 [Camelina sativa]
 ref|XP_010449726.1| PREDICTED: 60S ribosomal protein L15-1 [Camelina sativa]
 sp|O23515.1|RL151_ARATH RecName: Full=60S ribosomal protein L15-1 [Arabidopsis thaliana]
 gb|AAK44167.1|AF370352_1 putative ribosomal protein [Arabidopsis thaliana]
 emb|CAB10447.1| ribosomal protein [Arabidopsis thaliana]
 emb|CAB78714.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAL24229.1| AT4g16720/dl4385c [Arabidopsis thaliana]
 gb|AAL91619.1| AT4g16720/dl4385c [Arabidopsis thaliana]
 gb|AAM64387.1| ribosomal protein [Arabidopsis thaliana]
 gb|AAM91731.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN28757.1| At4g16720/dl4385c [Arabidopsis thaliana]
 gb|EFH44330.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 gb|AEE83791.1| 60S ribosomal protein L15-1 [Arabidopsis thaliana]
 gb|ESQ28838.1| hypothetical protein EUTSA_v10019144mg [Eutrema salsugineum]
 gb|ESQ55765.1| hypothetical protein EUTSA_v10026269mg [Eutrema salsugineum]
 gb|KFK23089.1| hypothetical protein AALP_AAs51321U000100 [Arabis alpina]
Length=204

 Score =   326 bits (835),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N +LSLRRYR
Sbjct  181  NHKNRPSRRATWKKNNSLSLRRYR  204



>ref|XP_009108318.1| PREDICTED: 60S ribosomal protein L15-1-like [Brassica rapa]
Length=204

 Score =   325 bits (834),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH AIRNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAIRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N +LSLRRYR
Sbjct  181  NHKNRPSRRATWKKNNSLSLRRYR  204



>ref|XP_008241281.1| PREDICTED: 60S ribosomal protein L15-like [Prunus mume]
Length=204

 Score =   325 bits (834),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MG Y Y SE+WRKKQSD+MRF+ RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGGYKYQSEIWRKKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YR+RVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVAKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK RGL G+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKCRGLGGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HKARPSRRATWKRN TLSL RYR
Sbjct  181  YHKARPSRRATWKRNNTLSLPRYR  204



>ref|NP_193470.1| 60S ribosomal protein L15-2 [Arabidopsis thaliana]
 ref|XP_006282721.1| hypothetical protein CARUB_v10005754mg [Capsella rubella]
 sp|Q8VYF1.1|RL152_ARATH RecName: Full=60S ribosomal protein L15-2 [Arabidopsis thaliana]
 gb|AAL59940.1| putative 60S ribosomal protein L15-like protein [Arabidopsis 
thaliana]
 gb|AAM64649.1| 60S ribosomal protein L15 homolog [Arabidopsis thaliana]
 gb|AAM67498.1| putative 60S ribosomal protein L15-like protein [Arabidopsis 
thaliana]
 dbj|BAE98399.1| 60S ribosomal protein L15 homolog [Arabidopsis thaliana]
 gb|AEE83883.1| 60S ribosomal protein L15-2 [Arabidopsis thaliana]
 gb|EOA15619.1| hypothetical protein CARUB_v10005754mg [Capsella rubella]
Length=204

 Score =   325 bits (833),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N ++SLRRYR
Sbjct  181  NHKNRPSRRATWKKNNSISLRRYR  204



>ref|XP_009145572.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
 ref|XP_009123031.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
Length=204

 Score =   325 bits (833),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N +LSLRRYR
Sbjct  181  NHKNRPSRRATWKKNNSLSLRRYR  204



>ref|XP_007202591.1| hypothetical protein PRUPE_ppa011597mg [Prunus persica]
 ref|XP_008244846.1| PREDICTED: 60S ribosomal protein L15-1-like [Prunus mume]
 gb|EMJ03790.1| hypothetical protein PRUPE_ppa011597mg [Prunus persica]
Length=204

 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MG Y Y +ELWRKKQSDVMRF+ RVRCWEYRQ PSIVRVTR TRPDKAR LGYKAKQGYV
Sbjct  1    MGFYKYPTELWRKKQSDVMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARLLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPV KGIVYGKPTNQGVTQLKFQRS RSVAEERAGRKL GLRVLNSYW
Sbjct  61   VYRVRVKRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSLRSVAEERAGRKLAGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH AIRNDPRINWLCNPVHKHRELRGLTSAGKK RGLRG+GHL
Sbjct  121  INEDSTYKYFEVILVDVAHNAIRNDPRINWLCNPVHKHRELRGLTSAGKKCRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HKARPSRRATWKRN TLSLRRYR
Sbjct  181  YHKARPSRRATWKRNTTLSLRRYR  204



>gb|AFK49215.1| unknown [Medicago truncatula]
 gb|KEH35101.1| 60S ribosomal protein L15-1 [Medicago truncatula]
Length=204

 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDST+KYFEVILVD AH+AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGL G+GH 
Sbjct  121  VNEDSTFKYFEVILVDVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGKENRGLSGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HKARPSRRA WKRN TLSLRRYR
Sbjct  181  YHKARPSRRANWKRNNTLSLRRYR  204



>ref|XP_004491939.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X2 [Cicer 
arietinum]
Length=204

 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 184/204 (90%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDST+KYFEVILVD AH AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGLRG+GH 
Sbjct  121  VNEDSTFKYFEVILVDVAHTAIRNDPRINWLVNPVHKHRELRGLTSAGKENRGLRGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRN TLSLRRYR
Sbjct  181  YHKNRPSRRATWKRNNTLSLRRYR  204



>ref|XP_009136839.1| PREDICTED: 60S ribosomal protein L15-1 [Brassica rapa]
 gb|ABD65137.1| 60S ribosomal protein L15 [Brassica oleracea]
Length=204

 Score =   325 bits (832),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N +LSLRRYR
Sbjct  181  NHKNRPSRRATWKKNNSLSLRRYR  204



>emb|CDX90499.1| BnaA03g42820D [Brassica napus]
Length=275

 Score =   327 bits (839),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V
Sbjct  72   MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  131

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  132  VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  191

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  192  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHR  251

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N +LSLRRYR
Sbjct  252  NHKNRPSRRATWKKNNSLSLRRYR  275



>gb|AFK46983.1| unknown [Lotus japonicus]
Length=204

 Score =   325 bits (832),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVD AH AIRNDPRINWLCNPVHKHREL G TSAGK  RGL G+GH 
Sbjct  121  VNEDSTYKYYEIILVDVAHTAIRNDPRINWLCNPVHKHRELTGKTSAGKHNRGLVGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWK+N +LSLRRYR
Sbjct  181  HHKARPSRRATWKKNNSLSLRRYR  204



>gb|EEC78893.1| hypothetical protein OsI_19264 [Oryza sativa Indica Group]
Length=377

 Score =   331 bits (848),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 197/208 (95%), Gaps = 1/208 (0%)
 Frame = -2

Query  918  PQFAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAK  739
            PQ   GAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLGYKAK
Sbjct  171  PQV-TGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAK  229

Query  738  QgyviyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVL  559
            QGYV+YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVL
Sbjct  230  QGYVVYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVL  289

Query  558  NSYWINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRG  379
            NSYW+NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG
Sbjct  290  NSYWVNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRG  349

Query  378  RGHLHHKARPSRRATWKRNQTLSLRRYR  295
            +GH HHKARPSRRATWKRNQT+SLRRYR
Sbjct  350  KGHTHHKARPSRRATWKRNQTVSLRRYR  377



>sp|O65050.1|RL15A_PICMA RecName: Full=60S ribosomal protein L15-1 [Picea mariana]
 gb|AAC32112.1| probable 60S ribosomal protein L15 [Picea mariana]
 gb|ABK22257.1| unknown [Picea sitchensis]
Length=204

 Score =   324 bits (831),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELW+KKQSDVMRFL RVRCWE+RQLP IVRVTR +RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWKKKQSDVMRFLQRVRCWEFRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQRS RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRSLRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+E+ILVD AH+AIR DPRINW+CN VHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INQDSTYKYYEIILVDQAHSAIRKDPRINWICNAVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HKARPS+RATWKRN TLSLRRYR
Sbjct  181  YHKARPSKRATWKRNNTLSLRRYR  204



>sp|O65082.1|RL15B_PICMA RecName: Full=60S ribosomal protein L15-2 [Picea mariana]
 gb|AAC32144.1| probable 60S ribosomal protein L15 [Picea mariana]
 gb|ABK25889.1| unknown [Picea sitchensis]
Length=204

 Score =   324 bits (831),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELW+KKQSDVMRFL RVRCWEYRQLP IVR+T  TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWKKKQSDVMRFLQRVRCWEYRQLPGIVRITHPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKP NQG+TQLKFQRS RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKNQGITQLKFQRSLRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+EV+LVD AH  IRNDPRINW+CN VHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INQDSTYKYYEVVLVDQAHTVIRNDPRINWICNAVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HKARPS+RATWKRN TLSLRRYR
Sbjct  181  YHKARPSKRATWKRNNTLSLRRYR  204



>emb|CDY53647.1| BnaA08g30370D [Brassica napus]
Length=237

 Score =   325 bits (834),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V
Sbjct  34   MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  93

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  94   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  153

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  154  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  213

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N +LSLRRYR
Sbjct  214  NHKNRPSRRATWKKNNSLSLRRYR  237



>emb|CDY54747.1| BnaAnng13420D [Brassica napus]
Length=239

 Score =   325 bits (834),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V
Sbjct  36   MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  95

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  96   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  155

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  156  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  215

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N +LSLRRYR
Sbjct  216  NHKNRPSRRATWKKNNSLSLRRYR  239



>emb|CDY60707.1| BnaC07g50070D [Brassica napus]
Length=274

 Score =   327 bits (837),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V
Sbjct  71   MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  130

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  131  VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  190

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  191  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHR  250

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N +LSLRRYR
Sbjct  251  NHKNRPSRRATWKKNNSLSLRRYR  274



>ref|XP_003593619.1| Ribosomal protein L15 [Medicago truncatula]
 gb|AES63870.1| 60S ribosomal protein L15-1 [Medicago truncatula]
Length=252

 Score =   326 bits (835),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 184/215 (86%), Positives = 196/215 (91%), Gaps = 2/215 (1%)
 Frame = -2

Query  939  PAGSRSSPQFAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKAR  760
            PA  R + +  MGAY Y+SELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TR TRPDKAR
Sbjct  40   PASVRQTEK--MGAYKYISELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKAR  97

Query  759  RLGYKAKQgyviyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRK  580
            RLGYKAKQGYV+YRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRK
Sbjct  98   RLGYKAKQGYVVYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRK  157

Query  579  LGGLRVLNSYWINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGK  400
            LGGLRVLNSYW+NEDST+KYFEVILVD AH+AIRNDPRINWL NPVHKHRELRGLTSAGK
Sbjct  158  LGGLRVLNSYWVNEDSTFKYFEVILVDVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGK  217

Query  399  KFRGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  295
            + RGL G+GH +HKARPSRRA WKRN TLSLRRYR
Sbjct  218  ENRGLSGKGHRYHKARPSRRANWKRNNTLSLRRYR  252



>pdb|3J61|N Chain N, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
Length=200

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 178/200 (89%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFE+ILVD AH+AIRNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  VNEDSTYKYFEIILVDVAHSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHT  180

Query  366  HHKARPSRRATWKRNQTLSL  307
            HHKARPSRRATWKRNQT+SL
Sbjct  181  HHKARPSRRATWKRNQTVSL  200



>dbj|BAJ95856.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 195/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH+A+RNDPRINWLC PVHKHRELRGLTSAGKKFRGLRG+GH 
Sbjct  121  VNEDSTYKYFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQT+SLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTVSLRRYR  204



>ref|XP_004299420.1| PREDICTED: 60S ribosomal protein L15-like [Fragaria vesca subsp. 
vesca]
Length=204

 Score =   323 bits (829),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVM F+ RVRCW+YRQ PSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMGFVQRVRCWDYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVAKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKYFEVILVD AH+ I+ DPRINW+ NPVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  121  INEDSTYKYFEVILVDVAHSVIKKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWKRN TLSLRRYR
Sbjct  181  YHKNRPSRRATWKRNNTLSLRRYR  204



>emb|CDY50842.1| BnaC08g47880D, partial [Brassica napus]
Length=260

 Score =   326 bits (835),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 180/210 (86%), Positives = 196/210 (93%), Gaps = 0/210 (0%)
 Frame = -2

Query  924  SSPQFAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYK  745
            S+  + MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ R TRPDKARRLGYK
Sbjct  51   SAKTWKMGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYK  110

Query  744  AKQgyviyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  565
            AKQG+V+YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR
Sbjct  111  AKQGFVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  170

Query  564  VLNSYWINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGL  385
            V+NSYW+NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGL
Sbjct  171  VVNSYWLNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGL  230

Query  384  RGRGHLHHKARPSRRATWKRNQTLSLRRYR  295
            RG+GH +HK RPSRRATWK+N +LSLRRYR
Sbjct  231  RGKGHNNHKNRPSRRATWKKNNSLSLRRYR  260



>ref|XP_002868106.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_010434780.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 ref|XP_010440015.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 ref|XP_010449626.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
 gb|EFH44365.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N +L LRRYR
Sbjct  181  NHKNRPSRRATWKKNNSLVLRRYR  204



>ref|XP_009136806.1| PREDICTED: 60S ribosomal protein L15-1-like [Brassica rapa]
Length=204

 Score =   323 bits (828),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ R TRPD+ARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDRARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N +LSLRRYR
Sbjct  181  NHKNRPSRRATWKKNNSLSLRRYR  204



>ref|XP_008360544.1| PREDICTED: 60S ribosomal protein L15 [Malus domestica]
Length=204

 Score =   323 bits (827),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 182/204 (89%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MG Y Y SE+WRKKQSD+MRF+ RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGFYKYQSEIWRKKQSDLMRFVQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRRLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTY YFEVILVD AH AIRND RIN LCNPVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  121  INEDSTYXYFEVILVDVAHNAIRNDARINXLCNPVHKHRELRGLTSAGKKYRGLRGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HKARPSRRATWKRN  LSLRRYR
Sbjct  181  YHKARPSRRATWKRNTALSLRRYR  204



>gb|KFK32179.1| hypothetical protein AALP_AA6G207900 [Arabis alpina]
Length=204

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N +LSL RYR
Sbjct  181  NHKNRPSRRATWKKNNSLSLCRYR  204



>ref|XP_001764493.1| predicted protein [Physcomitrella patens]
 gb|EDQ70760.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   322 bits (826),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQLP IVRVTR +RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFE+ILVDP HA IR DPRINW+ NPVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INQDSTYKYFEIILVDPQHAVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            + KARPS RATWKRN TLSL+RYR
Sbjct  181  YTKARPSIRATWKRNNTLSLKRYR  204



>ref|XP_006282719.1| hypothetical protein CARUB_v10005752mg [Capsella rubella]
 gb|EOA15617.1| hypothetical protein CARUB_v10005752mg [Capsella rubella]
Length=204

 Score =   322 bits (826),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N ++ LRRYR
Sbjct  181  NHKNRPSRRATWKKNNSVVLRRYR  204



>ref|XP_010434676.1| PREDICTED: 60S ribosomal protein L15-1-like [Camelina sativa]
Length=204

 Score =   322 bits (826),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 178/204 (87%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N +  LRRYR
Sbjct  181  NHKNRPSRRATWKKNNSFVLRRYR  204



>emb|CDY40505.1| BnaC01g20070D [Brassica napus]
Length=318

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V
Sbjct  115  MGAYKYVSELWRKKQSDVMRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFV  174

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW
Sbjct  175  VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYW  234

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  235  LNEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  294

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N +LSLRRYR
Sbjct  295  NHKNRPSRRATWKKNNSLSLRRYR  318



>ref|XP_004491938.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X1 [Cicer 
arietinum]
Length=216

 Score =   323 bits (827),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 192/210 (91%), Gaps = 0/210 (0%)
 Frame = -2

Query  924  SSPQFAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYK  745
             S     GAY YVSELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TR TRPDKARRLGYK
Sbjct  7    DSFSLVTGAYKYVSELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYK  66

Query  744  AKQgyviyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  565
            AKQGYV+YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR
Sbjct  67   AKQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLR  126

Query  564  VLNSYWINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGL  385
            VLNSYW+NEDST+KYFEVILVD AH AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGL
Sbjct  127  VLNSYWVNEDSTFKYFEVILVDVAHTAIRNDPRINWLVNPVHKHRELRGLTSAGKENRGL  186

Query  384  RGRGHLHHKARPSRRATWKRNQTLSLRRYR  295
            RG+GH +HK RPSRRATWKRN TLSLRRYR
Sbjct  187  RGKGHRYHKNRPSRRATWKRNNTLSLRRYR  216



>ref|XP_004955579.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X2 [Setaria 
italica]
Length=204

 Score =   322 bits (825),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKP +QGVTQLKFQR+KRSVAEERAGRK+GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGVTQLKFQRNKRSVAEERAGRKIGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFE+ILVD AHAAIRNDPRINWLC  VHKHRELRGLTSAGKK+RGLRG+G  
Sbjct  121  VNEDSTYKYFEIILVDVAHAAIRNDPRINWLCKDVHKHRELRGLTSAGKKYRGLRGKGSS  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTLSLRRYR  204



>gb|AAK67641.1| ribosomal protein L15 [Homo sapiens]
Length=204

 Score =   321 bits (823),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NED TYKYFEVILVD AH+A+RNDPRINWLC PVHKHRELRGLTSAGKKFRGLRG+GH 
Sbjct  121  VNEDFTYKYFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQT+SLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTVSLRRYR  204



>ref|XP_003573847.1| PREDICTED: 60S ribosomal protein L15-2 [Brachypodium distachyon]
Length=204

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH A+RNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRG+G  
Sbjct  121  VNEDSTYKYFEVILVDVAHNAVRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGKGQR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQT+SLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTVSLRRYR  204



>emb|CAB10520.1| ribosomal protein [Arabidopsis thaliana]
 emb|CAB78742.1| ribosomal protein [Arabidopsis thaliana]
Length=216

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 177/202 (88%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = -2

Query  900  AYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviy  721
            AY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V+Y
Sbjct  15   AYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVY  74

Query  720  rvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWIN  541
            RVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+N
Sbjct  75   RVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLN  134

Query  540  EDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHH  361
            EDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +H
Sbjct  135  EDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNH  194

Query  360  KARPSRRATWKRNQTLSLRRYR  295
            K RPSRRATWK+N ++SLRRYR
Sbjct  195  KNRPSRRATWKKNNSISLRRYR  216



>ref|XP_004957717.1| PREDICTED: 60S ribosomal protein L15-1-like [Setaria italica]
Length=204

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGRK+GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRKIGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH AIRNDPRINWLC  VHKHRELRGLTSAGKK+RGLRG+G  
Sbjct  121  VNEDSTYKYFEVILVDVAHTAIRNDPRINWLCKDVHKHRELRGLTSAGKKYRGLRGKGSA  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQTLSLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTLSLRRYR  204



>ref|XP_001753036.1| predicted protein [Physcomitrella patens]
 ref|XP_001758957.1| predicted protein [Physcomitrella patens]
 ref|XP_001772614.1| predicted protein [Physcomitrella patens]
 gb|EDQ62656.1| predicted protein [Physcomitrella patens]
 gb|EDQ76463.1| predicted protein [Physcomitrella patens]
 gb|EDQ82077.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   321 bits (822),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 177/204 (87%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQLP IVRVTR +RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFE+ILVDP H  IR DPRINW+ NPVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INQDSTYKYFEIILVDPQHTVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            + KARPS RATWKRN TLSL+RYR
Sbjct  181  YTKARPSIRATWKRNNTLSLKRYR  204



>dbj|BAD22764.1| ribosomal protein [Bromus inermis]
Length=204

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 175/204 (86%), Positives = 194/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY ++SE+WR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFLSEIWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH A+RNDPRINWLC PVHKHRELRGLTSAGKKFRGLRG+GH 
Sbjct  121  VNEDSTYKYFEVILVDVAHNAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQT+SLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTVSLRRYR  204



>ref|XP_001771165.1| predicted protein [Physcomitrella patens]
 gb|EDQ64014.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQLP IVRVTR +RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFE+IL+DP H  IR DPRINW+ NPVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INQDSTYKYFEIILIDPQHTVIRKDPRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            + KARPS RATWKRN TLSL+RYR
Sbjct  181  YTKARPSIRATWKRNNTLSLKRYR  204



>emb|CDP10996.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   320 bits (819),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 181/186 (97%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = -2

Query  852  MRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkg  673
            MRFLLRVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  672  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPA  493
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVDPA
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDPA  120

Query  492  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTL  313
            HAAIRNDPRINWLC PVHKHRELRGLTSAGKK+RGLRGRGHLHHKARPSRRATWKRNQTL
Sbjct  121  HAAIRNDPRINWLCQPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRATWKRNQTL  180

Query  312  SLRRYR  295
            SLRRYR
Sbjct  181  SLRRYR  186



>ref|XP_002879569.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55828.1| 60S ribosomal protein L15 [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   320 bits (821),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 179/204 (88%), Positives = 191/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMR L RVRCW+YRQ PSIVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRHLQRVRCWDYRQQPSIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRV+NSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLSGLRVVNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            INEDSTYKY+E+ILVDPAH A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH 
Sbjct  121  INEDSTYKYYEIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHN  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPSRRATWK+N TLSL RYR
Sbjct  181  NHKNRPSRRATWKKNNTLSLLRYR  204



>gb|AFK37409.1| unknown [Lotus japonicus]
Length=204

 Score =   320 bits (820),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFE+ILV  AH AIRNDPRINWLC PVH HRELRG TSAGK  R LRGRGH 
Sbjct  121  VNEDSTYKYFEIILVGIAHTAIRNDPRINWLCKPVHNHRELRGNTSAGKSNRCLRGRGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HKARPSRRATW+RN +LSLRRYR
Sbjct  181  YHKARPSRRATWRRNNSLSLRRYR  204



>ref|XP_003563105.1| PREDICTED: 60S ribosomal protein L15-2 [Brachypodium distachyon]
Length=204

 Score =   319 bits (818),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 193/204 (95%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH A+RNDPRINWLC PVHKHRELRGLTSAGKKFRGLRG+G  
Sbjct  121  VNEDSTYKYFEVILVDVAHNAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGTR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQT+SLRRYR
Sbjct  181  HHKNRPSRRATWKRNQTVSLRRYR  204



>ref|XP_004512167.1| PREDICTED: 60S ribosomal protein L15-1-like [Cicer arietinum]
Length=204

 Score =   319 bits (818),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 192/204 (94%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMR L R RCWEYRQ  SIVRVTR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRCLQRWRCWEYRQQSSIVRVTRPTRPDKARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+EVILVD AH AIRNDPR+NW+CNPVHKHRELRGLTSAGK+ RGL+G+GH 
Sbjct  121  MNEDSTYKYYEVILVDVAHTAIRNDPRVNWVCNPVHKHRELRGLTSAGKQNRGLQGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HKARPSRRATWKRN TLSLRRYR
Sbjct  181  YHKARPSRRATWKRNNTLSLRRYR  204



>gb|ACJ84067.1| unknown [Medicago truncatula]
Length=204

 Score =   319 bits (817),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 180/204 (88%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRF+ RVRCWEYRQ  SIVR+TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFMQRVRCWEYRQQSSIVRLTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDST+KYFEVILVD AH+AIRNDPRINWL NPVHKHRELRGLTSAGK+ RGL G+GH 
Sbjct  121  VNEDSTFKYFEVILVDVAHSAIRNDPRINWLTNPVHKHRELRGLTSAGKENRGLSGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HKARPSRRA WKRN T SLRR R
Sbjct  181  YHKARPSRRANWKRNNTSSLRRCR  204



>ref|XP_001757563.1| predicted protein [Physcomitrella patens]
 gb|EDQ77620.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 188/204 (92%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQLP IVRVTR +RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQLPGIVRVTRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVAKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFE+ILVDP H  IR D RINW+ NPVHKHRELRGLTSAGKK+RGLRGRGHL
Sbjct  121  INQDSTYKYFEIILVDPQHTVIRKDSRINWIVNPVHKHRELRGLTSAGKKYRGLRGRGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            + KARPS RATWKRN TLSL+RYR
Sbjct  181  YTKARPSIRATWKRNNTLSLKRYR  204



>emb|CDP11952.1| unnamed protein product [Coffea canephora]
Length=186

 Score =   316 bits (809),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 178/186 (96%), Positives = 184/186 (99%), Gaps = 0/186 (0%)
 Frame = -2

Query  852  MRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkg  673
            MRFLLRVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLLRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  672  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPA  493
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVDPA
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDPA  120

Query  492  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTL  313
            HAAIRNDPRI+W+C PVHKHRELRGLTSAGKK+RGLRG+GHLHHKARPSRRATWKRNQTL
Sbjct  121  HAAIRNDPRIHWICEPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQTL  180

Query  312  SLRRYR  295
            SLRRYR
Sbjct  181  SLRRYR  186



>gb|KDO49937.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=195

 Score =   316 bits (809),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 183/204 (90%), Positives = 188/204 (92%), Gaps = 9/204 (4%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+      
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLK------  114

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
               DSTYKYFEVILVD AH AIRNDPRINW+C PVHKHRELRGLTSAGKK+RGLRG+GHL
Sbjct  115  ---DSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHL  171

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRNQTLSLRRYR
Sbjct  172  HHKARPSRRATWKRNQTLSLRRYR  195



>ref|XP_002961462.1| hypothetical protein SELMODRAFT_270259 [Selaginella moellendorffii]
 gb|EFJ36722.1| hypothetical protein SELMODRAFT_270259 [Selaginella moellendorffii]
Length=204

 Score =   314 bits (804),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 171/204 (84%), Positives = 186/204 (91%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDVMRFL+RVRCWEYRQLP IVR+ R TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVMRFLMRVRCWEYRQLPGIVRIQRPTRPDKARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLG LRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFE+IL+DP H AIR DPRINW+C PVHKHRELRG+TSAG+K RGLRG+GH 
Sbjct  121  INQDSTYKYFEIILIDPMHTAIRKDPRINWICQPVHKHRELRGITSAGRKHRGLRGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPS RATWKRN TLSLRRYR
Sbjct  181  NHKNRPSIRATWKRNNTLSLRRYR  204



>ref|XP_002971348.1| hypothetical protein SELMODRAFT_270900 [Selaginella moellendorffii]
 gb|EFJ27946.1| hypothetical protein SELMODRAFT_270900 [Selaginella moellendorffii]
Length=204

 Score =   312 bits (799),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 185/204 (91%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDVMRFL+RVRCWEYRQLP IVR+ R TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVMRFLMRVRCWEYRQLPGIVRIQRPTRPDKARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPV KGIVYGKP NQG+TQLKFQR+ RSVAEERAGRKLG LRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVSKGIVYGKPKNQGITQLKFQRNLRSVAEERAGRKLGNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFE+IL+DP H AIR DPRINW+C PVHKHRELRG+TSAG+K RGLRG+GH 
Sbjct  121  INQDSTYKYFEIILIDPMHTAIRKDPRINWICQPVHKHRELRGITSAGRKHRGLRGKGHR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +HK RPS R TWKRN TLSLRRYR
Sbjct  181  NHKNRPSIRGTWKRNNTLSLRRYR  204



>gb|KDO49939.1| hypothetical protein CISIN_1g028757mg [Citrus sinensis]
Length=186

 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 175/186 (94%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -2

Query  852  MRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkg  673
            MRFL RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  672  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPA  493
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILVDAA  120

Query  492  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTL  313
            H AIRNDPRINW+C PVHKHRELRGLTSAGKK+RGLRG+GHLHHKARPSRRATWKRNQTL
Sbjct  121  HNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQTL  180

Query  312  SLRRYR  295
            SLRRYR
Sbjct  181  SLRRYR  186



>gb|EMS52882.1| 60S ribosomal protein L15 [Triticum urartu]
Length=268

 Score =   310 bits (794),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 180/220 (82%), Gaps = 17/220 (8%)
 Frame = -2

Query  903  GAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyvi  724
            GAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPD+ARRLG+KAKQ   +
Sbjct  49   GAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRITRPTRPDRARRLGFKAKQILFL  108

Query  723  yrvrvrrggrkrp-----------------vpkgIVYGKPTNQGVTQLKFQRSKRSVAEE  595
                  +  R                    VPKGIVYGKP +QG+TQLKFQR+KRSVAEE
Sbjct  109  CDSYTLKYVRIYAGYVVYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKRSVAEE  168

Query  594  RAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGL  415
            RAGR+LGGLRVLNSYW+NEDSTYKYFEVILVD AH+A+RNDPRINWLC PVHKHRELRGL
Sbjct  169  RAGRRLGGLRVLNSYWVNEDSTYKYFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGL  228

Query  414  TSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  295
            TSAGKKFRGLRG+GH HHK RPSRRATWKRNQT+SLRRYR
Sbjct  229  TSAGKKFRGLRGKGHRHHKNRPSRRATWKRNQTVSLRRYR  268



>ref|XP_011031911.1| PREDICTED: 60S ribosomal protein L15 isoform X3 [Populus euphratica]
Length=186

 Score =   306 bits (783),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 176/186 (95%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -2

Query  852  MRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkg  673
            MRFL RVRCWEYRQ PSIVRVT  TRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  672  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPA  493
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDVA  120

Query  492  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTL  313
            H AIRNDPRINWLCNPVHKHRELRGLTSAGKK+RGLRGRGHLHHKARPSRRA WKRN TL
Sbjct  121  HNAIRNDPRINWLCNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARPSRRANWKRNNTL  180

Query  312  SLRRYR  295
            SLRRYR
Sbjct  181  SLRRYR  186



>ref|XP_010539199.1| PREDICTED: 60S ribosomal protein L15-1-like [Tarenaya hassleriana]
Length=197

 Score =   305 bits (781),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 172/192 (90%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -2

Query  870  KKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrk  691
            K+QSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLGYKAKQG V+YRVRVRRGGRK
Sbjct  6    KRQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGIVVYRVRVRRGGRK  65

Query  690  rpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEV  511
            RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL GLRVLNSYWINEDSTYKY+EV
Sbjct  66   RPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLAGLRVLNSYWINEDSTYKYYEV  125

Query  510  ILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATW  331
            ILVD AH+A+RNDPR+NW+CNPVHKHRELRGLTS GKK RGLRG+GHL+HK RPSRRATW
Sbjct  126  ILVDTAHSAVRNDPRMNWICNPVHKHRELRGLTSEGKKNRGLRGKGHLYHKNRPSRRATW  185

Query  330  KRNQTLSLRRYR  295
            KRN TLSLRRYR
Sbjct  186  KRNNTLSLRRYR  197



>ref|XP_010919628.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Elaeis guineensis]
Length=186

 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 174/186 (94%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -2

Query  852  MRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkg  673
            MRFL RVRCWEYRQLPSIVRVTR TRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQLPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  672  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPA  493
            IVYGKP NQG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVD A
Sbjct  61   IVYGKPKNQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDAA  120

Query  492  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTL  313
            H AIRNDPRINW+C  VHKHRELRGLTSAGKK+RGLRG+GHLHHKARPSRRATWKRNQTL
Sbjct  121  HNAIRNDPRINWICKGVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQTL  180

Query  312  SLRRYR  295
            SLRRYR
Sbjct  181  SLRRYR  186



>ref|XP_004955578.1| PREDICTED: 60S ribosomal protein L15-1-like isoform X1 [Setaria 
italica]
Length=238

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 193/238 (81%), Gaps = 34/238 (14%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWR+KQSDVMRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRRKQSDVMRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKP +QGVTQLKFQR+KRSVAEERAGRK+GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPKHQGVTQLKFQRNKRSVAEERAGRKIGGLRVLNSYW  120

Query  546  INE----------------------------------DSTYKYFEVILVDPAHAAIRNDP  469
            +NE                                  DSTYKYFE+ILVD AHAAIRNDP
Sbjct  121  VNEVCWILWRNFLLEGSYCSCPIYFVLMPATVHLSTQDSTYKYFEIILVDVAHAAIRNDP  180

Query  468  RINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  295
            RINWLC  VHKHRELRGLTSAGKK+RGLRG+G  HHK RPSRRATWKRNQTLSLRRYR
Sbjct  181  RINWLCKDVHKHRELRGLTSAGKKYRGLRGKGSSHHKNRPSRRATWKRNQTLSLRRYR  238



>ref|XP_002946380.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ52307.1| component of cytosolic 80S ribosome and 60S large subunit [Volvox 
carteri f. nagariensis]
Length=204

 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YV ELWRKKQSDV+RFLLRVRCWEYRQLPSIVR+TR +RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVEELWRKKQSDVLRFLLRVRCWEYRQLPSIVRLTRPSRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRG RKRPV KGIVYGKP NQG+TQLK  R+ RSVAEER GRK GGLRVLNSYW
Sbjct  61   VYRVRVRRGNRKRPVHKGIVYGKPVNQGITQLKAARNLRSVAEERVGRKCGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DS YKYFEVILVDPAH  IRND RINWLCNPVHKHRELRGLTSAGK +RGLR +GH 
Sbjct  121  VNQDSCYKYFEVILVDPAHTTIRNDARINWLCNPVHKHRELRGLTSAGKHYRGLRAKGHK  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
              K RPS+RA+WKR  +LSLRR+R
Sbjct  181  ASKTRPSKRASWKRRNSLSLRRFR  204



>ref|XP_008234416.1| PREDICTED: 60S ribosomal protein L15-like [Prunus mume]
Length=204

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MG Y Y SEL RKKQSDVMR L R+R +EYR  PSIVRVT  T PDKA RLGYKAKQGYV
Sbjct  1    MGYYKYTSELGRKKQSDVMRALQRLRAFEYRHQPSIVRVTHPTCPDKAHRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRV+RGGRKRPV KGIVYGKPTNQGV+QLKFQRSKRSVAEERAGRKL GL+VLNSYW
Sbjct  61   VYRVRVKRGGRKRPVAKGIVYGKPTNQGVSQLKFQRSKRSVAEERAGRKLAGLKVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH AIRNDPRINW+CNPVHKHRELRGLTSAGKK RGL G+GHL
Sbjct  121  VNEDSTYKYFEVILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKNRGLCGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRA WK N TLSL RYR
Sbjct  181  HHKARPSRRANWKSNNTLSLPRYR  204



>ref|XP_004152396.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
 ref|XP_004158133.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis 
sativus]
Length=186

 Score =   299 bits (766),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -2

Query  852  MRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkg  673
            MRFL RVRCWEYRQ PSIVRV   TRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVNHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  672  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPA  493
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYYEVILVDVA  120

Query  492  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTL  313
            H A+RNDPRINW+CNPVHK RELRGLTSAGKK+RGLRG+GHLHHKARPSRRATWKRN TL
Sbjct  121  HNAVRNDPRINWICNPVHKRRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNTL  180

Query  312  SLRRYR  295
            SLRRYR
Sbjct  181  SLRRYR  186



>emb|CBI25842.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   298 bits (764),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -2

Query  852  MRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkg  673
            MRFL RVRCWEYRQ PSIVRVTR TRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  672  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPA  493
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYWINEDSTYKY+E+ILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYYEIILVDAA  120

Query  492  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTL  313
            H  IRNDPRINW+C PVHKHRELRGLTSAGKK+RGLRG+GH HHKARPSRRATWKRN TL
Sbjct  121  HNTIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHRHHKARPSRRATWKRNNTL  180

Query  312  SLRRYR  295
            SLRRYR
Sbjct  181  SLRRYR  186



>emb|CBI38664.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   298 bits (764),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -2

Query  852  MRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkg  673
            MRFL RVRCWEYRQ PSIV  TR TRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG
Sbjct  1    MRFLQRVRCWEYRQHPSIVCATRPTRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG  60

Query  672  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPA  493
            IVYGKPTNQGVTQLKFQRSKRS+AEERAGRKLGGL+VLNSYWINEDSTYKY+EVILVD A
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSIAEERAGRKLGGLKVLNSYWINEDSTYKYYEVILVDAA  120

Query  492  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTL  313
            H AIRNDPRINW+C PVHKHRELRGLTSAGKK+RGLRG+GHLHHKARPSRRATWKRN TL
Sbjct  121  HNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNNTL  180

Query  312  SLRRYR  295
            SLRRYR
Sbjct  181  SLRRYR  186



>tpg|DAA62721.1| TPA: hypothetical protein ZEAMMB73_667917 [Zea mays]
Length=186

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -2

Query  852  MRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkg  673
            MRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLG+KAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGFKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  672  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPA  493
            IVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILVD A
Sbjct  61   IVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILVDVA  120

Query  492  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTL  313
            H AIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRG+GH HHK RPSRRATWKRNQTL
Sbjct  121  HTAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATWKRNQTL  180

Query  312  SLRRYR  295
            SLRRYR
Sbjct  181  SLRRYR  186



>ref|XP_001701780.1| ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP06755.1| ribosomal protein L15 [Chlamydomonas reinhardtii]
Length=204

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 182/204 (89%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDV+RFLLRVRCWEYRQ+PS VR+TR +RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIEELWRKKQSDVLRFLLRVRCWEYRQMPSCVRLTRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRG RKRPV KGIVYGKP NQG+TQLK  R+ R+VAEERAGRK GGLRVLNSYW
Sbjct  61   VYRVRVRRGNRKRPVHKGIVYGKPVNQGITQLKPARNLRNVAEERAGRKCGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DS YKYFEVI+VDPAH AIRND RINWLCNPVHKHRELRGLT+AGK +RGLR +GH 
Sbjct  121  VNQDSCYKYFEVIMVDPAHNAIRNDARINWLCNPVHKHRELRGLTAAGKNYRGLRAKGHK  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
              K RPS+RA+WKR  +LSLRR+R
Sbjct  181  ASKTRPSKRASWKRRNSLSLRRFR  204



>gb|EMT29287.1| 60S ribosomal protein L15 [Aegilops tauschii]
Length=261

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 197/225 (88%), Gaps = 7/225 (3%)
 Frame = -2

Query  948  PRIPAGS-------RSSPQFAMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRV  790
            P  PA S       R       GAY +VSELWR+KQSDVMRF+ RVRCWEYR  P+IVR+
Sbjct  37   PGTPAASSHVLSLARCDGFVVAGAYKFVSELWRRKQSDVMRFVQRVRCWEYRLQPAIVRI  96

Query  789  TRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKR  610
            TR  RPD+ARRLG+KAKQGYV+YR+RVRRGGRKRPVPKGIVYGKP +QG+TQLKFQR+KR
Sbjct  97   TRPPRPDRARRLGFKAKQGYVVYRIRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRNKR  156

Query  609  SVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHR  430
            SVAEERAGR+LGGLRVLNSYW+NEDSTYKYFEVILVD AH+A+RNDPRINWLC PVHKHR
Sbjct  157  SVAEERAGRRLGGLRVLNSYWVNEDSTYKYFEVILVDVAHSAVRNDPRINWLCKPVHKHR  216

Query  429  ELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  295
            ELRGLTSAGKKFRGLRG+GH HHK RPSRRATWKRNQT+SLRRYR
Sbjct  217  ELRGLTSAGKKFRGLRGKGHRHHKNRPSRRATWKRNQTVSLRRYR  261



>gb|AAT85124.1| putative 60s ribosomal protein L15 [Oryza sativa Japonica Group]
Length=186

 Score =   297 bits (760),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -2

Query  852  MRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkg  673
            MRF+ RVRCWEYRQ P+IVR+TR TRPDKARRLGYKAKQGYV+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKG  60

Query  672  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPA  493
            IVYGKP +QG+TQLKFQR+KRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+ILVD A
Sbjct  61   IVYGKPKHQGITQLKFQRNKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILVDVA  120

Query  492  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTL  313
            H+AIRNDPRINWLC PVHKHRELRGLTSAGKK+RGLRG+GH HHKARPSRRATWKRNQT+
Sbjct  121  HSAIRNDPRINWLCKPVHKHRELRGLTSAGKKYRGLRGKGHTHHKARPSRRATWKRNQTV  180

Query  312  SLRRYR  295
            SLRRYR
Sbjct  181  SLRRYR  186



>ref|XP_005845356.1| hypothetical protein CHLNCDRAFT_32281 [Chlorella variabilis]
 gb|EFN53254.1| hypothetical protein CHLNCDRAFT_32281 [Chlorella variabilis]
Length=204

 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/204 (78%), Positives = 184/204 (90%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YV ELW+KKQSDV+RFLLRVRCWE+RQLP IVR+TR +RPDKARR+G+KAKQGYV
Sbjct  1    MGAYKYVEELWKKKQSDVLRFLLRVRCWEFRQLPGIVRLTRPSRPDKARRMGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRK+PV KGIVYGKP +QGVTQLK  R+ +++AEER GRK GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKKPVSKGIVYGKPVHQGVTQLKPTRNLQNIAEERVGRKCGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+D+ YKYFEVILVDPAH AIR D R+NW+CNPVHKHRE RGLTSAGKK+RGL G+GHL
Sbjct  121  VNQDAVYKYFEVILVDPAHKAIRKDARVNWICNPVHKHREQRGLTSAGKKYRGLVGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRA W++N ++ LRRYR
Sbjct  181  HHKARPSRRAVWRKNNSIVLRRYR  204



>ref|XP_010516773.1| PREDICTED: 60S ribosomal protein L15-2-like [Camelina sativa]
Length=212

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 186/212 (88%), Gaps = 8/212 (4%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMR L RVRCW YRQ PSIVR+TR TRPD+ARRLG+KAKQGYV
Sbjct  1    MGAYKYVSELWRKKQSDVMRHLQRVRCWNYRQQPSIVRLTRPTRPDEARRLGFKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRS +EERAGRKLGGLR LNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSGSEERAGRKLGGLRDLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKH--------RELRGLTSAGKKFR  391
            INEDSTYKY+E+ILVD AH A+ NDPRINW+CNPVHKH        RELRGLTS GKK +
Sbjct  121  INEDSTYKYYEIILVDLAHNAVSNDPRINWICNPVHKHQLRSSSHNRELRGLTSEGKKNK  180

Query  390  GLRGRGHLHHKARPSRRATWKRNQTLSLRRYR  295
            GLRG+GH ++K RPSRRATWK N T+SL RYR
Sbjct  181  GLRGKGHNNNKNRPSRRATWKNNNTISLLRYR  212



>ref|XP_005646118.1| ribosomal protein L15e [Coccomyxa subellipsoidea C-169]
 gb|EIE21574.1| ribosomal protein L15e [Coccomyxa subellipsoidea C-169]
Length=204

 Score =   294 bits (752),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 183/204 (90%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELW++KQSDV+RFLLRVRCWEYRQLP IVR+T  +RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELWKRKQSDVLRFLLRVRCWEYRQLPGIVRLTGPSRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRK+PV KGIVYGKP NQG+TQLK  R+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKKPVHKGIVYGKPVNQGITQLKPTRNLRSVAEERAGRKLGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DSTYKYFE+ILVD AH  +R DPR+NW+ +PVHKHRELRGLTSAGKKFRGLR +GH 
Sbjct  121  VNQDSTYKYFEIILVDIAHKVVREDPRVNWIVDPVHKHRELRGLTSAGKKFRGLRHKGHA  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
             +K RPSRRATWKRN  +SL+RYR
Sbjct  181  TNKLRPSRRATWKRNNRISLKRYR  204



>emb|CDX76573.1| BnaA08g08270D [Brassica napus]
Length=186

 Score =   290 bits (742),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -2

Query  852  MRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkg  673
            MRF+ RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  672  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPA  493
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVDPA
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  492  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTL  313
            H AIRNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N +L
Sbjct  121  HNAIRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKNNSL  180

Query  312  SLRRYR  295
            SLRRYR
Sbjct  181  SLRRYR  186



>emb|CDY09632.1| BnaC07g34290D [Brassica napus]
 emb|CDX90478.1| BnaA03g43030D [Brassica napus]
Length=186

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -2

Query  852  MRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkg  673
            MRF+ RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  672  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPA  493
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVDPA
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  492  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTL  313
            H A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N +L
Sbjct  121  HNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHRNHKNRPSRRATWKKNNSL  180

Query  312  SLRRYR  295
            SLRRYR
Sbjct  181  SLRRYR  186



>emb|CDY59531.1| BnaCnng35130D [Brassica napus]
Length=186

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -2

Query  852  MRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkrpvpkg  673
            MRF+ RVRCWEYRQ PSIVR+ R TRPDKARRLGYKAKQG+V+YRVRVRRGGRKRPVPKG
Sbjct  1    MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVRVRRGGRKRPVPKG  60

Query  672  IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVILVDPA  493
            IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRV+NSYW+NEDSTYKY+E+ILVDPA
Sbjct  61   IVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYYEIILVDPA  120

Query  492  HAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATWKRNQTL  313
            H A+RNDPRINW+CNPVHKHRELRGLTS GKK RGLRG+GH +HK RPSRRATWK+N +L
Sbjct  121  HNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKNRPSRRATWKKNNSL  180

Query  312  SLRRYR  295
            SLRRYR
Sbjct  181  SLRRYR  186



>gb|AAF67144.1|AF230646_1 large subunit ribosomal protein L15 [Syntrichia ruralis]
Length=203

 Score =   290 bits (742),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 165/204 (81%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWR+KQSDV+RFLLRVRCWE+RQLP IVRVT +  PDKARRLGY+  +   
Sbjct  1    MGAYKYIEELWRRKQSDVLRFLLRVRCWEFRQLPGIVRVT-AQPPDKARRLGYRPSRVTW  59

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
                       +   P+ +   KP NQG+TQLKFQR+ RSVAEERAGRKLGGLRVLNSYW
Sbjct  60   CTVCVCAVEAGRGRWPRVLCMEKPKNQGITQLKFQRNLRSVAEERAGRKLGGLRVLNSYW  119

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFE+ILVDP H  IR DPRINW+ NPVHKHR++RGLTSAGKK+RGLRGRGHL
Sbjct  120  INQDSTYKYFEIILVDPQHKVIRKDPRINWIVNPVHKHRDVRGLTSAGKKYRGLRGRGHL  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            + KARPS RATWKRN TLSL+RYR
Sbjct  180  YTKARPSIRATWKRNNTLSLKRYR  203



>emb|CEG01197.1| Ribosomal protein L15e, conserved site [Ostreococcus tauri]
Length=204

 Score =   288 bits (738),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 179/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YV ELW+KKQSDVMRFL R+R WEYRQLPSI RVTR TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVEELWKKKQSDVMRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR RVRRGGRKRPVPKG VYGKP + G+T+LKF R+ RSVAEERA R+ G LRVLNSYW
Sbjct  61   IYRARVRRGGRKRPVPKGQVYGKPVHCGITKLKFARNLRSVAEERAARRCGALRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DS YKY+EVI+VDP H  IRNDPRINW+CNP HKHRE+RGLTSAG+K+RGLRG+GH 
Sbjct  121  LNQDSVYKYYEVIMVDPMHKCIRNDPRINWICNPTHKHREMRGLTSAGRKYRGLRGKGHN  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            + K+RPS+RATW+ N  LSLRRYR
Sbjct  181  YTKSRPSKRATWRNNNRLSLRRYR  204



>gb|KFM28228.1| 60S ribosomal protein L15 [Auxenochlorella protothecoides]
Length=437

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELW+KKQSDV+RFLLRVRCWEYRQLPSIVR+T  TRPDKARR+GYKAKQGYV
Sbjct  1    MGAYKYIEELWKKKQSDVLRFLLRVRCWEYRQLPSIVRLTGPTRPDKARRMGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRK+PVPKGIVYGKP NQG+TQLK  R+  ++AEER GRK GGLRVLNSYW
Sbjct  61   VYRVRVRRGGRKKPVPKGIVYGKPVNQGITQLKPTRNLANLAEERVGRKCGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+D+ YKYFEVILVDP H AIRND RINW+ NPVHKHRELRGLTSAGKK+RGL G+GHL
Sbjct  121  VNQDAVYKYFEVILVDPFHKAIRNDARINWIANPVHKHRELRGLTSAGKKYRGLTGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR*C*IL  280
            H K RPSRRA WK+N  +SLRR   C +L
Sbjct  181  HTKNRPSRRAVWKKNNRVSLRRTIQCTVL  209



>gb|KCW90850.1| hypothetical protein EUGRSUZ_A02903 [Eucalyptus grandis]
Length=183

 Score =   285 bits (730),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 165/204 (81%), Gaps = 21/204 (10%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSELWRKKQSDVMRFL RVRCWEYRQ PSI  V    R  +             
Sbjct  1    MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIGYVVYRVRVRRG------------  48

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
                     GRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGL+VLNSYW
Sbjct  49   ---------GRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYW  99

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH  IR DPRINW+CNPVHKHRELRGLTSAGKK+RGLRG+GH 
Sbjct  100  LNEDSTYKYFEVILVDAAHNTIRKDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHS  159

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHKARPSRRATWKRN +LSLRRYR
Sbjct  160  HHKARPSRRATWKRNNSLSLRRYR  183



>ref|XP_003056552.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59928.1| predicted protein [Micromonas pusilla CCMP1545]
Length=204

 Score =   286 bits (731),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YV ELW+KKQSDV+RFL RVR WEYRQLPS+ RVTR TRPDKARRLGYKAKQG+ 
Sbjct  1    MGAYKYVEELWKKKQSDVLRFLQRVRVWEYRQLPSVCRVTRPTRPDKARRLGYKAKQGFC  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YR RVRRGGRKRPV KGI YGKP +QGV +LKF R+ RSVAEER  R+ G LRVLNSYW
Sbjct  61   VYRARVRRGGRKRPVSKGIRYGKPVHQGVKKLKFARNLRSVAEERTARRCGALRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDS YKY+EVI+VDP H  IR DPRINW+C PVHKHRELRGLTSAG+K+RGL+G+GH 
Sbjct  121  LNEDSVYKYYEVIMVDPMHKVIRGDPRINWICAPVHKHRELRGLTSAGRKYRGLQGKGHN  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K+RPS+R TWKRNQ LSLRRYR
Sbjct  181  YNKSRPSKRGTWKRNQQLSLRRYR  204



>gb|EMT18644.1| 60S ribosomal protein L15 [Aegilops tauschii]
Length=183

 Score =   283 bits (725),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 166/204 (81%), Gaps = 21/204 (10%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY +VSELWR+KQSDVMRF+ RVRCWEYRQ P+I  V    R    RR G K      
Sbjct  1    MGAYKFVSELWRRKQSDVMRFVQRVRCWEYRQQPAIGYVVYRIR---VRRGGRK------  51

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
                        RPVPKGIVYGKP +QG+TQLKFQR+KRSVAEERAGR+LGGLRVLNSYW
Sbjct  52   ------------RPVPKGIVYGKPKHQGITQLKFQRNKRSVAEERAGRRLGGLRVLNSYW  99

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKYFEVILVD AH+A+RNDPRINWLC PVHKHRELRGLTSAGKKFRGLRG+GH 
Sbjct  100  VNEDSTYKYFEVILVDVAHSAVRNDPRINWLCKPVHKHRELRGLTSAGKKFRGLRGKGHR  159

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            HHK RPSRRATWKRNQT+SLRRYR
Sbjct  160  HHKNRPSRRATWKRNQTVSLRRYR  183



>ref|XP_001416062.1| Ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO94354.1| Ribosomal protein L15, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=204

 Score =   283 bits (725),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YV ELW+KKQSDVMRFL R+R WEYRQLPSI RVTR TRPDKARRLGYKAKQG+ 
Sbjct  1    MGAYKYVEELWKKKQSDVMRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFC  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR RVRRGGRKRPV KG VYGKP + G+T+LKF R+ RSVAEERA R+ G LRVLNSYW
Sbjct  61   IYRARVRRGGRKRPVAKGQVYGKPVHCGITKLKFARNLRSVAEERAARRCGALRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DS YKY+EVI+VDP H  +RNDPRINW+CNP HKHRE+RGLTSAG+K+RGL G+GH 
Sbjct  121  LNQDSVYKYYEVIMVDPMHKCVRNDPRINWICNPTHKHREMRGLTSAGRKYRGLHGKGHN  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
              K+RPS+RATW+ N  LS RRYR
Sbjct  181  FTKSRPSKRATWRNNNRLSYRRYR  204



>gb|AFK40278.1| unknown [Lotus japonicus]
Length=222

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  867  KQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyviyrvrvrrggrkr  688
            KQSDVMRFL RVRCWEYRQ PSIVR+TR TRPDKARRLGYKAKQGYV+YRVRVRRGGRKR
Sbjct  8    KQSDVMRFLQRVRCWEYRQQPSIVRLTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKR  67

Query  687  pvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWINEDSTYKYFEVI  508
            PV KGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW+NEDSTYKYFE+I
Sbjct  68   PVSKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEII  127

Query  507  LVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHLHHKARPSRRATW  331
            LVD AH AIRNDPRINWLC PVH HRELRG TSAGK  R LRGRGH +HKARPSRRATW
Sbjct  128  LVDIAHTAIRNDPRINWLCKPVHNHRELRGNTSAGKSNRCLRGRGHRYHKARPSRRATW  186



>gb|ACU45020.1| 60s ribosomal protein L15 [Pfiesteria piscicida]
Length=204

 Score =   276 bits (706),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWR+KQSDV+RFLLR+RCWE R LP + R TR TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYLQELWRRKQSDVLRFLLRIRCWELRHLPRVHRATRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR RVRRGGRK+ V KG   GKP +QGV  LKFQRSK SVAEER GR  G LRVLNSYW
Sbjct  61   IYRSRVRRGGRKKRVAKGNTDGKPKHQGVNHLKFQRSKASVAEERVGRVCGNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DST+KY+EVI VDP+H AIRNDPRINW+  PVHKHRELRGLTSAGKK RGL GRG  
Sbjct  121  VNQDSTFKYYEVICVDPSHNAIRNDPRINWITKPVHKHRELRGLTSAGKKNRGLVGRGRR  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            + K RPSRRA WK+N TLSLRRYR
Sbjct  181  YQKNRPSRRAVWKKNNTLSLRRYR  204



>ref|XP_005717822.1| 60S ribosomal protein L15, partial [Chondrus crispus]
 emb|CDF37953.1| 60S ribosomal protein L15, partial [Chondrus crispus]
Length=216

 Score =   268 bits (686),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWR KQSDVMRF+LRVR WEYRQLPSI R +R TRP+KARRLGYK+KQG+V
Sbjct  13   MGAYKYMEELWRHKQSDVMRFMLRVRAWEYRQLPSIHRASRPTRPEKARRLGYKSKQGFV  72

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPV KGI YGKP +QG+T+LKF+R+KR+VAEERAGR+ G LRVLNSYW
Sbjct  73   VYRVRVRRGGRKRPVKKGIQYGKPKHQGITELKFKRNKRAVAEERAGRRCGNLRVLNSYW  132

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NED+ YKYFE+ILVDP+H AIRNDPR+NWL  PV KHRELRGLT+AG+K RGL  RGH 
Sbjct  133  VNEDAAYKYFEIILVDPSHNAIRNDPRLNWLARPVMKHRELRGLTAAGRKGRGLHVRGHR  192

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
             +  RPS RA WK++ TL L RYR
Sbjct  193  ANSTRPSVRAVWKKHNTLRLLRYR  216



>ref|XP_004348091.1| ribosomal protein L15 [Capsaspora owczarzaki ATCC 30864]
 gb|EFW46298.1| ribosomal protein L15 [Capsaspora owczarzaki ATCC 30864]
Length=204

 Score =   268 bits (685),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 179/205 (87%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ EL++KKQSDV+RFL+R+RCW+YRQLP+I R +R TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYLEELYKKKQSDVLRFLVRLRCWQYRQLPAIHRASRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+R+RRGGRKRPV KGI+YGKP  QGVTQLK QRS R++AEER GR +GGLRVLNSYW
Sbjct  61   IYRIRLRRGGRKRPVFKGIIYGKPAAQGVTQLKNQRSHRAIAEERIGRAIGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            I +DST+KY+EVI+VD AH AIR DPRINW+C  VHKHRELRGLT+AG+K RG+ G+GHL
Sbjct  121  ICQDSTFKYYEVIMVDTAHKAIRRDPRINWICENVHKHRELRGLTAAGRKHRGV-GKGHL  179

Query  366  HHK-ARPSRRATWKRNQTLSLRRYR  295
            H+K A  SRRA WKR  TLSLRRYR
Sbjct  180  HNKTAGSSRRANWKRRNTLSLRRYR  204



>ref|XP_005703122.1| 60S ribosomal protein L15e isoform 2 [Galdieria sulphuraria]
 ref|XP_005703123.1| 60S ribosomal protein L15e isoform 1 [Galdieria sulphuraria]
 gb|EME26602.1| 60S ribosomal protein L15e isoform 2 [Galdieria sulphuraria]
 gb|EME26603.1| 60S ribosomal protein L15e isoform 1 [Galdieria sulphuraria]
Length=204

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDVMRFLLRVR WEYR LPS+ R +R TRPDKAR LGYKAKQG+V
Sbjct  1    MGAYKYMQELWRKKQSDVMRFLLRVRAWEYRHLPSVHRASRPTRPDKARMLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKGI YGKP NQG+TQLKF+R+KRSVAEERAGR+ G LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGIQYGKPKNQGITQLKFKRNKRSVAEERAGRRCGNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+D  YKYFEVILVDP H AIR DPRI+W+C P  KHRE RGLTSAG+  RGLR +G  
Sbjct  121  INQDGIYKYFEVILVDPNHKAIRRDPRIHWICKPTMKHRERRGLTSAGRAHRGLRRKGLG  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
              K RPS RA WKR  TLSLRRYR
Sbjct  181  VAKVRPSVRANWKRRNTLSLRRYR  204



>gb|KDD73446.1| ribosomal L15, partial [Helicosporidium sp. ATCC 50920]
Length=200

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELW+KKQSDV+RFLLRVRCWE+RQLP IVR+T  +RPDKARR+GYKAKQGYV
Sbjct  1    MGAYKYIEELWKKKQSDVLRFLLRVRCWEFRQLPRIVRLTGPSRPDKARRMGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRK+PV KGIVYGKP NQG+TQLK +R+ ++++E R GR   GLRVLNSYW
Sbjct  61   IYRVRVRRGGRKKPVAKGIVYGKPVNQGITQLKPRRNLQAISEGRVGRACRGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+D+++KY+EVI+VDPAH  IRNDP INW+CNPVHKHRE  GLTSAGKK RGL G+GH 
Sbjct  121  VNQDASHKYYEVIMVDPAHTVIRNDPHINWICNPVHKHREGHGLTSAGKKHRGLGGKGHG  180

Query  366  HHKARPSRRATWKRNQ  319
            H  ARPSRRATW+RNQ
Sbjct  181  HVHARPSRRATWRRNQ  196



>ref|XP_003382517.1| PREDICTED: 60S ribosomal protein L15-like [Amphimedon queenslandica]
Length=204

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 170/205 (83%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YV ELWRKKQSD++RFLLRVRCW+YRQL  + R  R TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVQELWRKKQSDLLRFLLRVRCWQYRQLNVLHRAPRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+RVRRGGRKR   KG  YGKPTNQGV +LKFQRS +SVAEER GR  GGLRVLNSYW
Sbjct  61   IYRIRVRRGGRKRKARKGATYGKPTNQGVNELKFQRSLQSVAEERVGRHCGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            + +DST+K++EVILVDPAH  IR DPR NW+C PVHKHRE+RGLTS G+K RGL G+GHL
Sbjct  121  VGQDSTFKFYEVILVDPAHKVIRQDPRTNWICRPVHKHREMRGLTSCGRKNRGL-GKGHL  179

Query  366  HHKAR-PSRRATWKRNQTLSLRRYR  295
              K +  SRRA WKR  TLSLRRYR
Sbjct  180  RTKVQGGSRRANWKRRNTLSLRRYR  204



>ref|XP_503229.1| 60S ribosomal protein L15 [Yarrowia lipolytica]
 emb|CAG81430.1| YALI0D24387p [Yarrowia lipolytica CLIB122]
Length=203

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 167/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ E+ RKKQSDV+RFLLRVRCWEYRQ   I R +R +RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEEIHRKKQSDVLRFLLRVRCWEYRQKTGIHRASRPSRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRG RKRP  KG  YGKPTNQG+ QLK QRS R+VAEER GR+ G LRVLNSYW
Sbjct  61   IYRVRVRRGNRKRPSKKGATYGKPTNQGINQLKLQRSLRAVAEERVGRRAGNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DSTYKYFEVILVDP+H  IRNDPRINW+CNPVHKHRE RGLT+AGKK RG+  +GH 
Sbjct  121  VNQDSTYKYFEVILVDPSHVVIRNDPRINWICNPVHKHRESRGLTAAGKKNRGI-NKGHK  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            +H     RR TWK   TLSL RYR
Sbjct  180  YHNTSAGRRHTWKLQNTLSLWRYR  203



>ref|XP_003884098.1| hypothetical protein NCLIV_045010 [Neospora caninum Liverpool]
 emb|CBZ54067.1| hypothetical protein NCLIV_045010 [Neospora caninum Liverpool]
Length=205

 Score =   265 bits (678),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 172/205 (84%), Gaps = 1/205 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELW+KKQSDV+RFLLRVR WEYRQLP++ R T+STRPDKARRLGYK KQG+V
Sbjct  1    MGAYKYLEELWKKKQSDVLRFLLRVRTWEYRQLPAVHRCTQSTRPDKARRLGYKKKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSY  550
            IYRVRVRRG RK+ V KGIVYGKP NQGV + K  R+ R+VAEE+ GRK+ GGLRVLNSY
Sbjct  61   IYRVRVRRGDRKKQVHKGIVYGKPKNQGVRKQKSSRNLRAVAEEKVGRKICGGLRVLNSY  120

Query  549  WINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH  370
            W+ +D+ YKY+EVILVDPAH AIRNDPRINWLC PV KHRE RGLTSAGKK+RGLR +G 
Sbjct  121  WVGQDAVYKYYEVILVDPAHNAIRNDPRINWLCKPVMKHRECRGLTSAGKKYRGLRTKGS  180

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
               + RPSRRA WK+ Q L LRRYR
Sbjct  181  GAARLRPSRRACWKKRQALRLRRYR  205



>ref|XP_005534852.1| 60S ribosomal protein L15 [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80245.1| 60S ribosomal protein L15 [Cyanidioschyzon merolae strain 10D]
Length=205

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 176/205 (86%), Gaps = 1/205 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQS+ +RFL RVR WEYRQ P++ R TR +RPDKARRLGY+AKQGYV
Sbjct  1    MGAYKYLQELWRKKQSEALRFLQRVRAWEYRQRPTVHRATRPSRPDKARRLGYRAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSY  550
            IYRVRVRRGGRKRPVPKGI YGKP +QG+TQLKFQR+KRSVAEER GRK+   LRVLNSY
Sbjct  61   IYRVRVRRGGRKRPVPKGIQYGKPKHQGITQLKFQRNKRSVAEERVGRKICANLRVLNSY  120

Query  549  WINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH  370
            WINED+ YKY+EVIL+DP H AIR DPRINW+C P  KHRELRGLTSAG+K RGL  +GH
Sbjct  121  WINEDALYKYYEVILIDPNHNAIRRDPRINWICRPTMKHRELRGLTSAGRKGRGLHRKGH  180

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
            L +KARPS R+ WKR+ TLSLRRYR
Sbjct  181  LVNKARPSVRSVWKRHNTLSLRRYR  205



>ref|XP_002366469.1| ribosomal protein L15, putative [Toxoplasma gondii ME49]
 ref|XP_008882193.1| ribosomal protein RPL15 [Hammondia hammondi]
 gb|EPR62406.1| ribosomal protein RPL15 [Toxoplasma gondii GT1]
 gb|EPT27335.1| ribosomal protein RPL15 [Toxoplasma gondii ME49]
 gb|ESS32798.1| ribosomal protein RPL15 [Toxoplasma gondii VEG]
 gb|KEP67758.1| ribosomal protein RPL15 [Hammondia hammondi]
 gb|KFG42256.1| ribosomal protein RPL15 [Toxoplasma gondii p89]
 gb|KFG44929.1| ribosomal protein RPL15 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG52242.1| ribosomal protein RPL15 [Toxoplasma gondii FOU]
 gb|KFG65712.1| ribosomal protein RPL15 [Toxoplasma gondii RUB]
 gb|KFH10025.1| ribosomal protein RPL15 [Toxoplasma gondii MAS]
 gb|KFH12821.1| ribosomal protein RPL15 [Toxoplasma gondii VAND]
Length=205

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 172/205 (84%), Gaps = 1/205 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELW+KKQSDV+RFLLRVR WEYRQLP++ R T+STRPDKARRLGYK KQG+V
Sbjct  1    MGAYKYLEELWKKKQSDVLRFLLRVRTWEYRQLPAVHRCTQSTRPDKARRLGYKKKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKL-GGLRVLNSY  550
            IYRVRVRRG RK+ V KGIVYGKP NQGV + K  R+ R+VAEE+ GRK+ GGLRVLNSY
Sbjct  61   IYRVRVRRGDRKKQVHKGIVYGKPKNQGVRKQKSTRNLRAVAEEKVGRKICGGLRVLNSY  120

Query  549  WINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH  370
            W+ +D+ YKY+EVILVDPAH AIRNDPRINWLC PV KHRE RGLTSAGKK+RGLR +G 
Sbjct  121  WVGQDAVYKYYEVILVDPAHNAIRNDPRINWLCKPVMKHRECRGLTSAGKKYRGLRTKGS  180

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
               + RPSRRA WK+ Q + LRRYR
Sbjct  181  GAARLRPSRRACWKKRQAVRLRRYR  205



>ref|XP_001624083.1| predicted protein [Nematostella vectensis]
 gb|EDO31983.1| predicted protein [Nematostella vectensis]
Length=204

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 174/205 (85%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ EL++KKQSD++RFLLRVRCW+YRQL +I R TR TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELYKKKQSDLLRFLLRVRCWQYRQLTAIHRATRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKP NQGV +LKFQRS RSVAEERAGR  GGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPVNQGVNELKFQRSLRSVAEERAGRYCGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            + +DS YKYFEVI+VDP H AIR D RINW+C P HKHRELRGLT+AG K RG+R +GH 
Sbjct  121  VGQDSIYKYFEVIMVDPFHKAIRRDARINWICKPTHKHRELRGLTAAGTKNRGMR-KGHN  179

Query  366  HHKA-RPSRRATWKRNQTLSLRRYR  295
            ++K    SRRA WKR+ TLSLRRYR
Sbjct  180  YNKVIGSSRRANWKRHNTLSLRRYR  204



>gb|EPE06282.1| 60s ribosomal protein l15 [Ophiostoma piceae UAMH 11346]
Length=203

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 170/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL ++KQSDV+RFLLRVRCWEYRQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKRKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRK+PV KG  YGKPTNQGV QLK+QRS +S AEER GR+ G LRVLNSYW
Sbjct  61   IYRVRVRRGGRKKPVRKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCGNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DSTYKYFEVILVDP HAAIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  VNQDSTYKYFEVILVDPQHAAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHK  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
             +K R  RR TWKR+ TLSL RYR
Sbjct  180  FNKTRAGRRKTWKRHNTLSLWRYR  203



>gb|ERS96332.1| 60S ribosomal protein L15 [Sporothrix schenckii ATCC 58251]
Length=203

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL ++KQSDV+RFLLRVRCWEYRQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKRKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRK+PV KG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKKPVRKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFEVILVDP HAAIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYFEVILVDPQHAAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHK  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
             +K R  RR TWKR+ TLSL RYR
Sbjct  180  FNKTRAGRRKTWKRHNTLSLWRYR  203



>ref|XP_007511637.1| 60S ribosomal protein L15 [Bathycoccus prasinos]
 emb|CCO17758.1| 60S ribosomal protein L15 [Bathycoccus prasinos]
Length=204

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YV ELW+KKQSDV+RFL R+R WEYRQLPSI RVTR TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVEELWKKKQSDVLRFLQRIRVWEYRQLPSICRVTRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR RVRRGGRKRPV KGIV GKP + G+T+LKF R+ +SVAEERA R+ G LRVLNSYW
Sbjct  61   IYRARVRRGGRKRPVRKGIVNGKPVHCGITKLKFARNLKSVAEERAARRCGALRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DS YKY+EVI+VDP H AIR+DPRINW+C P HK R +RGLTSAG+K RGL G+GH 
Sbjct  121  LNQDSVYKYYEVIMVDPMHKAIRSDPRINWICAPTHKGRAMRGLTSAGRKHRGLHGKGHN  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            + K R S+ A WK N  LSL+RYR
Sbjct  181  YTKNRSSKHAQWKNNNRLSLKRYR  204



>ref|XP_006690758.1| ribosomal protein L15-like protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS23516.1| ribosomal protein L15-like protein [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=203

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 170/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  Y+ EL +KKQSDV+RFLLRVRCWEYRQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYLEELSKKKQSDVVRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS R+ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRCSNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DSTYKY+EVILVDP H AIR DPRINW+CNPVHKHRE RGLTS GKK RGL  +GH 
Sbjct  121  VNQDSTYKYYEVILVDPNHKAIRRDPRINWICNPVHKHRECRGLTSTGKKSRGL-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
             +K R  RR TWKR+ TLSL RYR
Sbjct  180  FNKTRAGRRKTWKRHNTLSLWRYR  203



>gb|ESW97334.1| 60S ribosomal protein L15-B [Ogataea parapolymorpha DL-1]
Length=204

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ EL RKKQSDVMRFLLR+RCWEYRQ   I R +R +RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLLRIRCWEYRQKTVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            I+R+RVRRGGRKRPVPKG  YGKPTNQGV QLK+Q++ RS AEER GRK   LRVLNSYW
Sbjct  61   IFRIRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQKALRSTAEERVGRKAANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +NEDSTYKY+EVI VDP H AIR DPR NW+CNPVHKHRE RGLT+ GKK RG+  +GHL
Sbjct  121  VNEDSTYKYYEVICVDPQHKAIRRDPRYNWICNPVHKHREARGLTATGKKSRGI-AKGHL  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
             +K R  RR TWK++ TLSL RYR
Sbjct  180  FNKTRKGRRHTWKQHNTLSLWRYR  203



>gb|EFX04788.1| 60S ribosomal protein l15 [Grosmannia clavigera kw1407]
Length=203

 Score =   261 bits (666),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL ++KQSDV+RFLLRVRCWEYRQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKRKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR RVRRGGRK+PV KG  +GKPTNQGV QLK+QRS +S AEER GR+ G LRVLNSYW
Sbjct  61   IYRARVRRGGRKKPVAKGATFGKPTNQGVNQLKYQRSLKSTAEERVGRRCGNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DSTYKY+EVILVDP HAAIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  VNQDSTYKYYEVILVDPNHAAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHK  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
             +K R  RR TWKR+ TLSL RYR
Sbjct  180  FNKTRAGRRKTWKRHNTLSLWRYR  203



>ref|XP_002598589.1| hypothetical protein BRAFLDRAFT_113717 [Branchiostoma floridae]
 gb|EEN54601.1| hypothetical protein BRAFLDRAFT_113717 [Branchiostoma floridae]
Length=204

 Score =   260 bits (664),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 170/205 (83%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YV ELWRKKQSDVMRFLLRVRCW+YR L +I R  R TRP+KA RLGYKAKQGYV
Sbjct  1    MGAYKYVQELWRKKQSDVMRFLLRVRCWQYRNLSAIHRAPRPTRPEKAHRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+R+RRGGRK+PVPKG  YGKP +QGV Q+KF R+ RSVAEER GR  G LRV+NSYW
Sbjct  61   IYRIRLRRGGRKKPVPKGATYGKPVHQGVNQMKFARNLRSVAEERVGRACGALRVMNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            + +DSTYK+FEVILVDP H A+R+DP + W+C PV KHRELRGLTSAGK  RGL G+GHL
Sbjct  121  VGQDSTYKFFEVILVDPFHKAVRHDPEVQWICKPVMKHRELRGLTSAGKSSRGL-GKGHL  179

Query  366  HHKAR-PSRRATWKRNQTLSLRRYR  295
            HHK +  S RA+WKR  TLSLRRYR
Sbjct  180  HHKTKGGSWRASWKRRNTLSLRRYR  204



>gb|KEF63356.1| 60S ribosomal protein L15 [Exophiala aquamarina CBS 119918]
Length=203

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRASNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFEVILVDP H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH 
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHG  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K    RR TWKR+ TLSL RYR
Sbjct  180  YNKTTAGRRKTWKRHNTLSLWRYR  203



>ref|XP_008713401.1| 60S ribosomal protein L15 [Cyphellophora europaea CBS 101466]
 gb|ETN44328.1| 60S ribosomal protein L15 [Cyphellophora europaea CBS 101466]
Length=203

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 167/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDVMRFLLRVRCWE RQL  I R TR +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELHKKKQSDVMRFLLRVRCWELRQLNVIHRATRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRP PKG  YGKPTNQG+ QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPAPKGATYGKPTNQGINQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFEVILVDP H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRKDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHG  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K    RR TWKR+ TLSL RYR
Sbjct  180  YNKTSAGRRKTWKRHNTLSLWRYR  203



>gb|EMS24660.1| 60S ribosomal protein l15 [Rhodosporidium toruloides NP11]
 emb|CDR35885.1| RHTO0S01e09384g1_1 [Rhodosporidium toruloides]
Length=201

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 171/204 (84%), Gaps = 3/204 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y++EL ++KQSDV+RFLLRVRCWEYRQL  I R +R +RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLTELQKRKQSDVLRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRG RKRPVPKG  YGKPTNQGV QLKFQRS RS AEER  R+ G LRVLNSYW
Sbjct  61   VYRVRVRRGNRKRPVPKGATYGKPTNQGVNQLKFQRSLRSTAEERVARRCGNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+D  YKY+EVILVDP+H AIR D RINW+CNPVHK RE RGLTSAGK+ RGL G+GH 
Sbjct  121  INQDGVYKYYEVILVDPSHKAIRRDARINWICNPVHKRRESRGLTSAGKQNRGL-GKGHS  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            + K+  +RRA WKR  TLSLRRYR
Sbjct  180  YTKS--NRRAHWKRTNTLSLRRYR  201



>emb|CEJ94099.1| Putative Ribosomal protein L15 [Torrubiella hemipterigena]
Length=203

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 166/204 (81%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDVMRFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRK+P  KG  YGKPTNQG+ QLK+QRS R+ AEER GR+   LRVLNSYW
Sbjct  61   VYRVRVRRGGRKKPARKGATYGKPTNQGINQLKYQRSLRATAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFEVILVDP H AIR DPRINW+ NPVHKHRE RGLTS GK+ RGL  +GH 
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRIDPRINWIVNPVHKHREARGLTSTGKRSRGL-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K    RR TWKR+ TLSL RYR
Sbjct  180  YNKTTAGRRKTWKRHNTLSLWRYR  203



>ref|XP_006822011.1| PREDICTED: 60S ribosomal protein L15-like isoform X1 [Saccoglossus 
kowalevskii]
 ref|XP_006822012.1| PREDICTED: 60S ribosomal protein L15-like isoform X2 [Saccoglossus 
kowalevskii]
Length=204

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 172/205 (84%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ E+W+KKQSD MRFLLRVRCW+YRQL +I R  R TRPDKARRLGY+AKQGYV
Sbjct  1    MGAYKYMQEVWKKKQSDAMRFLLRVRCWQYRQLTAIHRAPRPTRPDKARRLGYRAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+R+RRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S+AEERAGR+ GGLRVLNSYW
Sbjct  61   IYRIRLRRGGRKRPVPKGATYGKPTNQGVNQLKWQRSLQSLAEERAGRRCGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            + +DSTYK+FEVI+VDP H AIR +P   W+CNPVHKHRELRGLTSAGKK RG+ G+GHL
Sbjct  121  VGQDSTYKFFEVIMVDPFHKAIRRNPDTQWICNPVHKHRELRGLTSAGKKNRGI-GKGHL  179

Query  366  HHKA-RPSRRATWKRNQTLSLRRYR  295
            H +    SRRA WKR  T  + RYR
Sbjct  180  HTQTIGGSRRAAWKRRNTQQMHRYR  204



>gb|EQL00837.1| Ribosomal protein L15e [Ophiocordyceps sinensis CO18]
Length=203

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDVMRFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPV KG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVRKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+E+ILVDP H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEIILVDPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K R  RR TWKR+ TLSL RYR
Sbjct  180  YNKTRAGRRKTWKRHNTLSLWRYR  203



>ref|XP_002545593.1| 60S ribosomal protein L15-B [Candida tropicalis MYA-3404]
 gb|EER35635.1| 60S ribosomal protein L15-B [Candida tropicalis MYA-3404]
Length=204

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +R +RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRASNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DSTYKYFEVILVDP+H AIR D R NW+ NPVHKHRE RGLTSAGKK RG+  +GHL
Sbjct  121  VNQDSTYKYFEVILVDPSHKAIRRDARYNWIANPVHKHRESRGLTSAGKKSRGI-NKGHL  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
             +K +  RR TWK++ TLSL RYR
Sbjct  180  FNKTKAGRRHTWKKHNTLSLWRYR  203



>ref|XP_009159952.1| 60S ribosomal protein L15 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY59491.1| 60S ribosomal protein L15 [Exophiala dermatitidis NIH/UT8656]
Length=203

 Score =   258 bits (659),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS R+ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFEVILVDP H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH 
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRRDPRINWIVNPVHKHREARGLTATGKKSRGL-GKGHG  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
             +K    RR TWKR+ TLSL RYR
Sbjct  180  FNKTTAGRRKTWKRHNTLSLWRYR  203



>ref|XP_008725811.1| 60S ribosomal protein L15 [Cladophialophora carrionii CBS 160.54]
 gb|ETI26466.1| 60S ribosomal protein L15 [Cladophialophora carrionii CBS 160.54]
Length=203

 Score =   258 bits (659),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 167/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFEVILVDP H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH 
Sbjct  121  INQDSTYKYFEVILVDPNHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHG  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++     RR TWKR  TLSL RYR
Sbjct  180  YNNTTAGRRKTWKRQNTLSLWRYR  203



>gb|EOA94531.1| 60S ribosomal protein L15, partial [Anas platyrhynchos]
Length=206

 Score =   258 bits (659),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 167/206 (81%), Gaps = 2/206 (1%)
 Frame = -2

Query  909  AMGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgy  730
            AMGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  R TRPDKARRLGYKAKQGY
Sbjct  2    AMGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGY  61

Query  729  viyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSY  550
            VIYRVRVRRGGRKRPVPKG  YGKP + GV QLKF RS +SVAEERAGR  G LRVLNSY
Sbjct  62   VIYRVRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSY  121

Query  549  WINEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH  370
            W+ EDSTYK+FEVIL+DP H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH
Sbjct  122  WVGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGH  180

Query  369  -LHHKARPSRRATWKRNQTLSLRRYR  295
              HH    SRRA WKR  TL L RYR
Sbjct  181  KFHHTIGGSRRAAWKRRNTLQLHRYR  206



>ref|XP_007872719.1| ribosomal L15 [Pneumocystis murina B123]
 gb|EMR11223.1| ribosomal L15 [Pneumocystis murina B123]
Length=204

 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YV EL++ KQSD++RFLLR+RCWEYRQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVEELYKHKQSDILRFLLRLRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+RVRRGGRKRPVPKG  YGKPTN GV QLK+Q+S R  AEER GR+   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPTNMGVNQLKYQKSLRVTAEERVGRRCSNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DSTYKY+EVILVDP H AIR DPRINW+ N VHKHRE RGLT+ G+K RG+ G+GHL
Sbjct  121  VNQDSTYKYYEVILVDPHHKAIRRDPRINWIVNAVHKHREARGLTAIGRKSRGVSGKGHL  180

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K+   RR  WKR+ TLSLRRYR
Sbjct  181  YNKSSCGRRKIWKRHNTLSLRRYR  204



>gb|AAN52373.1| ribosomal protein L15 [Branchiostoma belcheri]
Length=204

 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 169/205 (82%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YV ELWRKKQSDVMRFLLRVRCW+YR L +I R  R TRP+KA RLGYKAKQGYV
Sbjct  1    MGAYKYVQELWRKKQSDVMRFLLRVRCWQYRNLSAIHRAPRPTRPEKAHRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVR+RRGGRK+PVPKG  YGKP +QGV Q+KF R+ RSVAEER GR  G LRV+NSYW
Sbjct  61   IYRVRLRRGGRKKPVPKGATYGKPVHQGVNQMKFARNLRSVAEERVGRACGALRVMNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            + +DSTYK+FEVILVDP H  +R+DP + W+C PV KHRELRGLTSAGK+ RGL G+GH 
Sbjct  121  VGQDSTYKFFEVILVDPFHKTVRHDPEVQWICKPVMKHRELRGLTSAGKRSRGL-GKGHF  179

Query  366  HHKAR-PSRRATWKRNQTLSLRRYR  295
            HHK +  S RA+WKR  TLSLRRYR
Sbjct  180  HHKTKGGSWRASWKRRNTLSLRRYR  204



>gb|KGQ83010.1| 60S ribosomal protein L15-A [Candida albicans P37005]
 gb|KGT63650.1| 60S ribosomal protein L15-A [Candida albicans 12C]
 gb|KGU02265.1| 60S ribosomal protein L15-A [Candida albicans L26]
 gb|KGU02520.1| 60S ribosomal protein L15-A [Candida albicans 19F]
Length=204

 Score =   258 bits (658),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +R +RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+RVRRGGRKRPV KG  YGKPTNQGV QLK+Q+S RS AEER GR+   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVLKGATYGKPTNQGVNQLKYQKSLRSTAEERVGRRASNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DSTYKYFEVILVDP+H AIR D R NW+ NPVHKHRE RGLTSAGKK RG+  +GHL
Sbjct  121  VNQDSTYKYFEVILVDPSHKAIRRDARYNWIVNPVHKHREARGLTSAGKKSRGI-NKGHL  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
             +K +  RR TWK++ TLSL RYR
Sbjct  180  FNKTKAGRRHTWKKHNTLSLWRYR  203



>ref|XP_001525424.1| 60S ribosomal protein L15-B [Lodderomyces elongisporus NRRL YB-4239]
 gb|EDK45173.1| 60S ribosomal protein L15-B [Lodderomyces elongisporus NRRL YB-4239]
Length=204

 Score =   257 bits (657),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +R +RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV  LK+Q+S RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNHLKYQKSLRSTAEERVGRRAANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DSTYKYFEVILVDP H AIR DPR NW+ N VHKHRE RGLTSAGKK RG+  +GHL
Sbjct  121  VNQDSTYKYFEVILVDPQHKAIRRDPRYNWIANAVHKHREARGLTSAGKKSRGI-NKGHL  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K R  RR TWK++ TLSL RYR
Sbjct  180  YNKTRAGRRHTWKKHNTLSLWRYR  203



>ref|XP_007373844.1| hypothetical protein SPAPADRAFT_59682 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW34260.1| hypothetical protein SPAPADRAFT_59682 [Spathaspora passalidarum 
NRRL Y-27907]
Length=204

 Score =   257 bits (657),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +R +RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            I+RVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+ G LRVLNSYW
Sbjct  61   IFRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRAGNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFEVILVDP+H AIR D R NW+  PVHKHRE RGLT+AGKK RG+  +GH 
Sbjct  121  INQDSTYKYFEVILVDPSHKAIRRDARYNWITEPVHKHRESRGLTAAGKKSRGI-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            + K +  RR TWK+N TLSL RYR
Sbjct  180  YTKTKAGRRHTWKKNNTLSLWRYR  203



>ref|XP_717445.1| likely cytosolic ribosomal protein L15 [Candida albicans SC5314]
 ref|XP_717356.1| likely cytosolic ribosomal protein L15 [Candida albicans SC5314]
 ref|XP_002421973.1| 60S ribosomal protein L15 [Candida dubliniensis CD36]
 gb|EAK98387.1| likely cytosolic ribosomal protein L15 [Candida albicans SC5314]
 gb|EAK98479.1| likely cytosolic ribosomal protein L15 [Candida albicans SC5314]
 emb|CAX39974.1| ribosomal protein, large subunit, putative [Candida dubliniensis 
CD36]
 gb|EEQ43509.1| 60S ribosomal protein L15-B [Candida albicans WO-1]
 gb|KGQ81742.1| 60S ribosomal protein L15-A [Candida albicans P94015]
 gb|KGQ82421.1| 60S ribosomal protein L15-A [Candida albicans GC75]
 gb|KGR01884.1| 60S ribosomal protein L15-A [Candida albicans P57072]
 gb|KGR03380.1| 60S ribosomal protein L15-A [Candida albicans P78048]
 gb|KGR06697.1| 60S ribosomal protein L15-A [Candida albicans P37037]
 gb|KGU01202.1| 60S ribosomal protein L15-A [Candida albicans P87]
 gb|KGU19047.1| 60S ribosomal protein L15-A [Candida albicans P34048]
 gb|KGU21267.1| 60S ribosomal protein L15-A [Candida albicans P57055]
 gb|KGU22062.1| 60S ribosomal protein L15-A [Candida albicans P75063]
 gb|KHC28236.1| 60S ribosomal protein L15-A [Candida albicans P76067]
 gb|KHC29192.1| 60S ribosomal protein L15-A [Candida albicans Ca6]
 gb|KHC29778.1| 60S ribosomal protein L15-A [Candida albicans P76055]
 gb|KHC45171.1| 60S ribosomal protein L15-A [Candida albicans P60002]
 gb|KHC45723.1| 60S ribosomal protein L15-A [Candida albicans P37039]
 gb|KHC54469.1| 60S ribosomal protein L15-A [Candida albicans P75010]
 gb|KHC61439.1| 60S ribosomal protein L15-A [Candida albicans P75016]
 gb|KHC66364.1| 60S ribosomal protein L15-A [Candida albicans P78042]
 gb|KHC71356.1| 60S ribosomal protein L15-A [Candida albicans SC5314]
 gb|KHC78351.1| 60S ribosomal protein L15-A [Candida albicans SC5314]
Length=204

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +R +RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+RVRRGGRKRPVPKG  YGKPTNQGV QLK+Q+S RS AEER GR+   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQKSLRSTAEERVGRRASNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DSTYKYFEVILVDP+H AIR D R NW+ NPVHKHRE RGLTSAGKK RG+  +GHL
Sbjct  121  VNQDSTYKYFEVILVDPSHKAIRRDARYNWIVNPVHKHREARGLTSAGKKSRGI-NKGHL  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
             +K +  RR TWK++ TLSL RYR
Sbjct  180  FNKTKAGRRHTWKKHNTLSLWRYR  203



>gb|EPQ66314.1| Protein component of the large (60S) ribosomal subunit [Blumeria 
graminis f. sp. tritici 96224]
 emb|CCU77282.1| 60S ribosomal protein L15 [Blumeria graminis f. sp. hordei DH14]
Length=203

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 170/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  + R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVVHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+EVILVDP H AIR DPRINW+ NPVHKHRE RGLT+ GK+ RGL G+GH 
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRRDPRINWIVNPVHKHRECRGLTATGKRSRGL-GKGHG  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K    RR TWKR+ TL+L+RYR
Sbjct  180  YNKTTAGRRKTWKRHNTLNLQRYR  203



>ref|XP_957199.1| 60S ribosomal protein L15 [Neurospora crassa OR74A]
 ref|XP_009852151.1| hypothetical protein NEUTE1DRAFT_117386 [Neurospora tetrasperma 
FGSC 2508]
 sp|Q8X034.1|RL15_NEUCR RecName: Full=60S ribosomal protein L15 [Neurospora crassa OR74A]
 emb|CAD21192.1| probable ribosomal protein L15.e.B, cytosolic [Neurospora crassa]
 gb|EAA27963.1| 60S ribosomal protein L15 [Neurospora crassa OR74A]
 gb|EGO56565.1| hypothetical protein NEUTE1DRAFT_117386 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ70567.1| putative ribosomal protein L15.e.B, cytosolic [Neurospora tetrasperma 
FGSC 2509]
 gb|KHE83595.1| hypothetical protein GE21DRAFT_3246 [Neurospora crassa]
Length=203

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  Y+ EL +KKQSDV+RFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYLEELQKKKQSDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR RVRRGGRK+PVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRARVRRGGRKKPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFEVILVDP H AIR DPRINW+ NPVHKHRE RGLTS GK+ RGL  +GH 
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTSTGKRSRGL-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K R  RR TWKR+ TLSL RYR
Sbjct  180  YNKTRAGRRKTWKRHNTLSLWRYR  203



>gb|KEQ59346.1| 60S ribosomal protein L15 [Aureobasidium melanogenum CBS 110374]
 gb|KEQ71724.1| 60S ribosomal protein L15 [Aureobasidium pullulans var. namibiae 
CBS 147.97]
 gb|KEQ81902.1| 60S ribosomal protein L15 [Aureobasidium pullulans EXF-150]
Length=203

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 166/204 (81%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLKFQRS RSVAEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKFQRSLRSVAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFE+ILVDP H AIR D RINW+ NPVHKHRELRGLTS GK  RG+  +GH 
Sbjct  121  INQDSTYKYFEIILVDPQHKAIRKDARINWIVNPVHKHRELRGLTSTGKHNRGI-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++     RR TWKR  TLSL RYR
Sbjct  180  YNNTSAGRRKTWKRQNTLSLWRYR  203



>ref|XP_004377436.1| PREDICTED: 60S ribosomal protein L15 isoform 1 [Trichechus manatus 
latirostris]
 ref|XP_004377437.1| PREDICTED: 60S ribosomal protein L15 isoform 2 [Trichechus manatus 
latirostris]
Length=204

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  R TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKP N GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPVNHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH-  370
            + EDSTYK+FEVIL+DP H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  121  VGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  179

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
             HH    SRRA W+R  TL L RYR
Sbjct  180  FHHTIGGSRRAAWRRRNTLQLHRYR  204



>gb|KEQ99844.1| hypothetical protein AUEXF2481DRAFT_25720 [Aureobasidium subglaciale 
EXF-2481]
Length=253

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 166/204 (81%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  51   MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  110

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLKFQRS RSVAEER GR+   LRVLNSYW
Sbjct  111  IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKFQRSLRSVAEERVGRRCANLRVLNSYW  170

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFE+ILVDP H AIR D RINW+ NPVHKHRELRGLTS GK  RG+  +GH 
Sbjct  171  INQDSTYKYFEIILVDPQHKAIRKDARINWIVNPVHKHRELRGLTSTGKHNRGI-NKGHR  229

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++     RR TWKR  TLSL RYR
Sbjct  230  YNNTSAGRRKTWKRQNTLSLWRYR  253



>ref|XP_007344080.1| 60S ribosomal protein L15 [Auricularia delicata TFB-10046 SS5]
 gb|EJD47661.1| 60S ribosomal protein L15 [Auricularia delicata TFB-10046 SS5]
Length=201

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 170/204 (83%), Gaps = 3/204 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YVSEL++KKQSDV+RFL+RVRCWEYRQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYVSELYKKKQSDVLRFLMRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRG RK+ VPKG  YGKP +QGV  LK QR  R +AEER GR+ G LRVLNSYW
Sbjct  61   IYRVRVRRGNRKKHVPKGATYGKPVHQGVNHLKPQRGLRVLAEERVGRRCGNLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+D  YKY+EVILVDP+H AI+ DPRINW+CNPVHK RE RGLT+ GKK RGL G+GHL
Sbjct  121  VNQDGVYKYYEVILVDPSHKAIKRDPRINWICNPVHKRREARGLTATGKKNRGL-GKGHL  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            H+ A  +RR+ WKR+ TLSLRRYR
Sbjct  180  HNLA--NRRSVWKRHNTLSLRRYR  201



>ref|XP_003869213.1| Rpl15a ribosomal protein [Candida orthopsilosis Co 90-125]
 emb|CCG23077.1| Rpl15a ribosomal protein [Candida orthopsilosis]
Length=204

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +R +RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YR+RVRRGGRKRPVPKG  YGKPTNQGV  LK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   VYRIRVRRGGRKRPVPKGATYGKPTNQGVNHLKYQRSLRSTAEERVGRRAANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+EVILVDP H AIR DPR NW+ N VHKHRE RGLTSAGKK RG+  +GHL
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRRDPRYNWIANAVHKHRESRGLTSAGKKSRGI-NKGHL  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K R  RR TWK++ TLSL RYR
Sbjct  180  YNKTRAGRRHTWKKHNTLSLWRYR  203



>ref|XP_002162844.1| PREDICTED: 60S ribosomal protein L15-like [Hydra vulgaris]
Length=204

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 173/205 (84%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ EL++KKQSD++RFL R+RCW+ R L +I R +R TRPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELYKKKQSDLLRFLFRIRCWQLRHLNAIHRASRPTRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPV KGI YGKP  +GV QLKFQRS RSVAEERAGR  GGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVAKGITYGKPKGEGVNQLKFQRSIRSVAEERAGRYCGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            I +DSTYKYFEVI+VDPAH A+R DPRINW+C  VHKHRELRGLT+AGKK RG+R +GH 
Sbjct  121  IAQDSTYKYFEVIMVDPAHKAVRRDPRINWICKAVHKHRELRGLTAAGKKNRGMR-KGHG  179

Query  366  HHKA-RPSRRATWKRNQTLSLRRYR  295
            ++K    SRRA WK++  +SLRRYR
Sbjct  180  YNKVIGSSRRANWKKHNLVSLRRYR  204



>ref|XP_003415776.1| PREDICTED: 60S ribosomal protein L15 [Loxodonta africana]
 ref|XP_005297124.1| PREDICTED: 60S ribosomal protein L15 [Chrysemys picta bellii]
 ref|XP_005297125.1| PREDICTED: 60S ribosomal protein L15 [Chrysemys picta bellii]
 ref|XP_005297126.1| PREDICTED: 60S ribosomal protein L15 [Chrysemys picta bellii]
 ref|XP_005297127.1| PREDICTED: 60S ribosomal protein L15 [Chrysemys picta bellii]
 ref|XP_006134385.1| PREDICTED: 60S ribosomal protein L15 [Pelodiscus sinensis]
 ref|XP_008168855.1| PREDICTED: 60S ribosomal protein L15 [Chrysemys picta bellii]
Length=204

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  R TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+RVRRGGRKRPVPKG  YGKP N GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPVNHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH-  370
            + EDSTYK+FEVIL+DP H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  121  VGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  179

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
             HH    SRRA W+R  TL L RYR
Sbjct  180  FHHTIGGSRRAAWRRRNTLQLHRYR  204



>ref|XP_005029295.1| PREDICTED: 60S ribosomal protein L15 [Anas platyrhynchos]
Length=204

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  R TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKP + GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH-  370
            + EDSTYK+FEVIL+DP H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  121  VGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  179

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
             HH    SRRA WKR  TL L RYR
Sbjct  180  FHHTIGGSRRAAWKRRNTLQLHRYR  204



>gb|AAS59857.1| ribosomal protein L15 [Acipenser sinensis]
 gb|AAS59858.1| ribosomal protein L15 [Acipenser schrenckii]
 gb|AAS59859.1| ribosomal protein L15 [Acipenser gueldenstaedtii]
Length=204

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 168/205 (82%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  R TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYMQELWRKKQSDVMRFLLRVRCWQYRQLSNLHRAPRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKP N G+ ++KF RS +SVAEERAGR  GGLRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPVNHGINEIKFARSLQSVAEERAGRHCGGLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH-  370
            + ED+TYK+FEVIL+DP H AIR +P I WL  PVHKHRE+RGLTSAGKK RGL G+GH 
Sbjct  121  VGEDATYKFFEVILIDPFHKAIRRNPDIQWLTKPVHKHREMRGLTSAGKKSRGL-GKGHK  179

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
             H     SRRA W+R  TL LRRYR
Sbjct  180  FHLTIGGSRRACWRRRNTLQLRRYR  204



>ref|XP_003657786.1| 60S ribosomal protein L15 [Thielavia terrestris NRRL 8126]
 gb|AEO71450.1| hypothetical protein THITE_2083064 [Thielavia terrestris NRRL 
8126]
Length=203

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  Y+ EL +KKQSDV+RFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYLEELSKKKQSDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+EVILVDP H AIR DPRINW+ NPVHKHRE RGLTS GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRRDPRINWIVNPVHKHREARGLTSTGKKSRGL-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K R  RR TWKR+ TLSL RYR
Sbjct  180  YNKTRAGRRKTWKRHNTLSLWRYR  203



>ref|XP_007788991.1| putative 60s ribosomal protein l15 protein [Eutypa lata UCREL1]
 gb|EMR71923.1| putative 60s ribosomal protein l15 protein [Eutypa lata UCREL1]
Length=203

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+EVILVDP H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRLDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K R  RR TWKR+ TLSL RYR
Sbjct  180  YNKTRAGRRKTWKRHNTLSLWRYR  203



>gb|ACR24948.1| ribosomal protein L15 [Lepidochitona cinerea]
Length=204

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 171/205 (83%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ EL+RKKQSDV+RFLLR+R W+YRQL S+ R +R TRPDKARRLGY+AKQGYV
Sbjct  1    MGAYKYMQELYRKKQSDVLRFLLRIRSWQYRQLASVHRASRPTRPDKARRLGYRAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKP NQGV QLKFQRS +SVAEER GRK  GLRVL+SYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPVNQGVNQLKFQRSLQSVAEERVGRKCQGLRVLSSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            + +DSTYK+FE+++VDP H AIR DP+INWLCNPVHKHRELRGLT+AGK  RGL  +GH 
Sbjct  121  VAQDSTYKFFEIVMVDPFHKAIRRDPKINWLCNPVHKHRELRGLTTAGKSSRGLX-KGHK  179

Query  366  HHKA-RPSRRATWKRNQTLSLRRYR  295
             HK    SRRA WKR  T+ +RR R
Sbjct  180  FHKTIGGSRRANWKRQNTVQMRRKR  204



>ref|XP_009226880.1| 60S ribosomal protein L15 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
 gb|EJT71483.1| 60S ribosomal protein L15 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
Length=203

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSD++RFLLRVRCWEYRQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDILRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+EVILVDP H AIR DPRI+W+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRRDPRISWIVNPVHKHRESRGLTATGKKSRGL-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K    RR TWKR+ TLSL RYR
Sbjct  180  YNKTTAGRRKTWKRHNTLSLWRYR  203



>ref|XP_007759046.1| 60S ribosomal protein L15 [Cladophialophora yegresii CBS 114405]
 gb|EXJ56512.1| 60S ribosomal protein L15 [Cladophialophora yegresii CBS 114405]
Length=203

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 167/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRSTAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFEVILVDP H AIR DPRI+W+ NPVHKHRE RGLT+ GKK RGL G+GH 
Sbjct  121  INQDSTYKYFEVILVDPNHKAIRRDPRISWIVNPVHKHRESRGLTATGKKSRGL-GKGHG  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++     RR TWKR  TLSL RYR
Sbjct  180  YNNTTAGRRKTWKRQNTLSLWRYR  203



>emb|CCE42581.1| hypothetical protein CPAR2_202240 [Candida parapsilosis]
Length=204

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ EL RKKQSDVMRFL RVRCWEYRQ   I R +R +RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYLEELQRKKQSDVMRFLYRVRCWEYRQKNVIHRASRPSRPDKARRLGYKAKQGFV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+RVRRGGRKRPVPKG  YGKPTNQGV  LK+QRS RS AEER GR+   LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPTNQGVNHLKYQRSLRSTAEERVGRRAANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DSTYKY+EVILVDP H AIR DPR NW+ N VHKHRE RGLTSAGKK RG+  +GHL
Sbjct  121  VNQDSTYKYYEVILVDPQHKAIRRDPRYNWIANAVHKHRESRGLTSAGKKSRGI-NKGHL  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K R  RR TWK++ TLSL RYR
Sbjct  180  YNKTRAGRRHTWKKHNTLSLWRYR  203



>ref|XP_007804051.1| 60S ribosomal protein L15 [Endocarpon pusillum Z07020]
 gb|ERF70289.1| 60S ribosomal protein L15 [Endocarpon pusillum Z07020]
Length=203

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+E+ILVDP H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL G+GH 
Sbjct  121  INQDSTYKYYEIILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-GKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K    RR TWKR  TLSL RYR
Sbjct  180  YNKTTAGRRKTWKRLNTLSLWRYR  203



>ref|XP_003666937.1| hypothetical protein MYCTH_2312102 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO61692.1| hypothetical protein MYCTH_2312102 [Myceliophthora thermophila 
ATCC 42464]
Length=203

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  Y+ EL +KKQSDV+RFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYLEELSKKKQSDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRP PKG  YGKPTNQG+ QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPAPKGATYGKPTNQGINQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+EVILVDP H AIR DPRINW+ NPVHKHRE RGLTS GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRRDPRINWIVNPVHKHREARGLTSTGKKSRGL-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K R  RR TWKR+ TLSL RYR
Sbjct  180  YNKTRAGRRKTWKRHNTLSLWRYR  203



>ref|XP_007925894.1| hypothetical protein MYCFIDRAFT_58365 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME83067.1| hypothetical protein MYCFIDRAFT_58365 [Pseudocercospora fijiensis 
CIRAD86]
Length=203

 Score =   255 bits (652),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA+ Y+ EL +KKQSDVMRFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGAHKYLEELQKKKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS +S AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKSTAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+E+ILVDP H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEIILVDPQHKAIRKDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++  +  RR TWKR  TLSL RYR
Sbjct  180  YNNTKAGRRHTWKRQNTLSLWRYR  203



>ref|XP_001481087.1| PREDICTED: 60S ribosomal protein L15-like [Mus musculus]
Length=204

 Score =   255 bits (652),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  R TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+RVRRGGRKRPVPKG +YGKP + GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGAIYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH-  370
            + EDSTYK+FEVIL+DP H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  121  VGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  179

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
             HH    SRRA W+R  TL L RYR
Sbjct  180  FHHTIGGSRRAAWRRRNTLQLHRYR  204



>gb|KIE03942.1| Ribosomal protein L15e, partial [Metarhizium majus ARSEF 297]
Length=203

 Score =   255 bits (652),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDVMRFLLRVRCWEYRQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            +YRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   VYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+EVILVDP H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K +  RR TW R+ T SL RYR
Sbjct  180  YNKTQAGRRKTWLRHNTTSLWRYR  203



>ref|XP_007421748.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Python bivittatus]
 ref|XP_007421749.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Python bivittatus]
Length=204

 Score =   255 bits (652),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  R TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+RVRRGGRKRPVPKG  YGKP + GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH-  370
            + EDSTYK+FEVILVDP H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  121  VGEDSTYKFFEVILVDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  179

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
             HH    SRRA W+R+ TL L RYR
Sbjct  180  FHHTIGGSRRAAWRRHNTLQLHRYR  204



>ref|XP_004339224.1| ribosomal L15, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR17211.1| ribosomal L15, putative [Acanthamoeba castellanii str. Neff]
Length=193

 Score =   254 bits (650),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 166/204 (81%), Gaps = 11/204 (5%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY YV ELWRKKQ           CWEYRQ P ++RV+R +RPDKARRLGYKAKQG+V
Sbjct  1    MGAYKYVQELWRKKQ-----------CWEYRQYPMVLRVSRPSRPDKARRLGYKAKQGFV  49

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKR + KG V+GKP  QGV  LKFQRS RSVAEERAGR+ G LRVLNSYW
Sbjct  50   IYRVRVRRGGRKRKIRKGRVHGKPATQGVNALKFQRSLRSVAEERAGRRCGNLRVLNSYW  109

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            + +D+T+K+FE+ILVDP H A+R DP++NW+  P HKHRE+RGLTSAGKK+RGLRG+GH 
Sbjct  110  VAQDATFKFFEIILVDPFHKAVRRDPKMNWIAAPTHKHREMRGLTSAGKKYRGLRGKGHN  169

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            + K+RPSRRA WKRN  +SLRRYR
Sbjct  170  YTKSRPSRRAVWKRNNKVSLRRYR  193



>ref|XP_009502210.1| PREDICTED: 60S ribosomal protein L15 [Phalacrocorax carbo]
 ref|XP_009568622.1| PREDICTED: 60S ribosomal protein L15 [Cuculus canorus]
 ref|XP_009568623.1| PREDICTED: 60S ribosomal protein L15 [Cuculus canorus]
 ref|XP_009568624.1| PREDICTED: 60S ribosomal protein L15 [Cuculus canorus]
 ref|XP_009568626.1| PREDICTED: 60S ribosomal protein L15 [Cuculus canorus]
 ref|XP_009568627.1| PREDICTED: 60S ribosomal protein L15 [Cuculus canorus]
 ref|XP_009568628.1| PREDICTED: 60S ribosomal protein L15 [Cuculus canorus]
Length=204

 Score =   255 bits (651),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  R TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKP N GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPVNHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH-  370
            + EDSTYK+FEVIL+DP H  IR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  121  VGEDSTYKFFEVILIDPFHKTIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  179

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
             HH    SRRA W+R  TL L RYR
Sbjct  180  FHHTIGGSRRAAWRRRNTLQLHRYR  204



>ref|XP_007505229.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Monodelphis 
domestica]
 ref|XP_007505230.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Monodelphis 
domestica]
Length=204

 Score =   255 bits (651),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL S+ R  R TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSSLHRAPRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+RVRRGGRKRPVPKG  YGKP + GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH-  370
            + EDSTYK+FEVIL+DP H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  121  VGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  179

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
             HH    SRRA W+R  TL L RYR
Sbjct  180  FHHTIGGSRRAAWRRRNTLQLHRYR  204



>gb|KFO70740.1| 60S ribosomal protein L15, partial [Cuculus canorus]
 gb|KFW90595.1| 60S ribosomal protein L15, partial [Phalacrocorax carbo]
Length=205

 Score =   255 bits (651),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  R TRPDKARRLGYKAKQGYV
Sbjct  2    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYV  61

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKP N GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  62   IYRVRVRRGGRKRPVPKGATYGKPVNHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  121

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH-  370
            + EDSTYK+FEVIL+DP H  IR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  122  VGEDSTYKFFEVILIDPFHKTIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  180

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
             HH    SRRA W+R  TL L RYR
Sbjct  181  FHHTIGGSRRAAWRRRNTLQLHRYR  205



>gb|ENH84342.1| 60s ribosomal protein l15 [Colletotrichum orbiculare MAFF 240422]
Length=203

 Score =   255 bits (651),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDVMRFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRK+PV KG  +GKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKKPVAKGATFGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            +N+DSTYKY+EVILVDP H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  VNQDSTYKYYEVILVDPQHKAIRIDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K +  RR TWKR+ TLSL RYR
Sbjct  180  YNKTKAGRRKTWKRHNTLSLWRYR  203



>ref|XP_007737355.1| 60S ribosomal protein L15 [Capronia epimyces CBS 606.96]
 gb|EXJ77910.1| 60S ribosomal protein L15 [Capronia epimyces CBS 606.96]
Length=203

 Score =   255 bits (651),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDV+RFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVLRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS R+ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLRATAEERVGRRAANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+EVILVDP H AIR DPRI+W+ NPVHKHRE RGLT+ GKK RGL G+GH 
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRRDPRISWIVNPVHKHREARGLTATGKKSRGL-GKGHG  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
             +K    RR TWKR+ TLSL RYR
Sbjct  180  FNKTTAGRRKTWKRHNTLSLWRYR  203



>ref|XP_007068583.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Chelonia mydas]
 ref|XP_007068584.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Chelonia mydas]
 ref|XP_007068585.1| PREDICTED: 60S ribosomal protein L15 isoform X3 [Chelonia mydas]
 ref|XP_007068586.1| PREDICTED: 60S ribosomal protein L15 isoform X4 [Chelonia mydas]
 gb|EMP27622.1| 60S ribosomal protein L15 [Chelonia mydas]
Length=204

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  R TRPD+ARRLGYKAKQGYV
Sbjct  1    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDRARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYR+RVRRGGRKRPVPKG  YGKP N GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  61   IYRIRVRRGGRKRPVPKGATYGKPVNHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH-  370
            + EDSTYK+FEVIL+DP H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  121  VGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  179

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
             HH    SRRA W+R  TL L RYR
Sbjct  180  FHHTIGGSRRAAWRRRNTLQLHRYR  204



>ref|XP_426002.2| PREDICTED: 60S ribosomal protein L15 isoform X3 [Gallus gallus]
 ref|XP_004271958.1| PREDICTED: 60S ribosomal protein L15 [Orcinus orca]
 ref|XP_004939468.1| PREDICTED: 60S ribosomal protein L15 isoform X4 [Gallus gallus]
 ref|XP_007112828.1| PREDICTED: 60S ribosomal protein L15 isoform X1 [Physeter catodon]
 ref|XP_007112829.1| PREDICTED: 60S ribosomal protein L15 isoform X2 [Physeter catodon]
 ref|XP_007173933.1| PREDICTED: 60S ribosomal protein L15 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007468121.1| PREDICTED: 60S ribosomal protein L15 [Lipotes vexillifer]
 ref|XP_009671088.1| PREDICTED: 60S ribosomal protein L15 [Struthio camelus australis]
 ref|XP_010711165.1| PREDICTED: 60S ribosomal protein L15 [Meleagris gallopavo]
 gb|KFV72964.1| 60S ribosomal protein L15 [Struthio camelus australis]
Length=204

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGAY Y+ ELWRKKQSDVMRFLLRVRCW+YRQL ++ R  R TRPDKARRLGYKAKQGYV
Sbjct  1    MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKP + GV QLKF RS +SVAEERAGR  G LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGH-  370
            + EDSTYK+FEVIL+DP H AIR +P   W+  PVHKHRE+RGLTSAG+K RGL G+GH 
Sbjct  121  VGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGL-GKGHK  179

Query  369  LHHKARPSRRATWKRNQTLSLRRYR  295
             HH    SRRA W+R  TL L RYR
Sbjct  180  FHHTIGGSRRAAWRRRNTLQLHRYR  204



>ref|XP_001909718.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP70851.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP27445.1| Putative cytosolic 60S ribosomal protein Rpl15 [Podospora anserina 
S mat+]
Length=203

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  Y+ EL +KKQSDV+RFLLRVRCWE RQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYLEELSKKKQSDVVRFLLRVRCWELRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRK+PVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKKPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFEVILVDP H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRRDPRINWIVNPVHKHRESRGLTATGKKSRGL-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K +  RR TWKR+ TLSL RYR
Sbjct  180  YNKTKAGRRKTWKRHNTLSLWRYR  203



>gb|KEY67005.1| hypothetical protein S7711_05126 [Stachybotrys chartarum IBT 
7711]
 gb|KFA47415.1| hypothetical protein S40293_05401 [Stachybotrys chartarum IBT 
40293]
 gb|KFA74656.1| hypothetical protein S40288_03233 [Stachybotrys chartarum IBT 
40288]
Length=203

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 167/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDVMRFLLRVRCWE RQL  I R +R +R DKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWELRQLNVIHRASRPSRLDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRK+PV KG  +GKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKKPVAKGATFGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKYFEVILVDP H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYFEVILVDPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHG  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K R  RR TWKR+ TLSL RYR
Sbjct  180  YNKTRAGRRKTWKRHNTLSLWRYR  203



>ref|XP_006965992.1| 60s ribosomal protein L152/L15B [Trichoderma reesei QM6a]
 gb|EGR47918.1| 60s ribosomal protein L152/L15B [Trichoderma reesei QM6a]
 gb|ETS02075.1| 60S ribosomal protein l15 [Trichoderma reesei RUT C-30]
Length=203

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 169/204 (83%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSD++RFLLRVRCWEYRQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDLVRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRP PKG  YGKPTNQG+ QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPAPKGATYGKPTNQGINQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+EVILVDP+H AIR DPRINW+ NPVHKHRE RGLT+ GK+ RGL  +GH 
Sbjct  121  INQDSTYKYYEVILVDPSHKAIRIDPRINWIVNPVHKHREARGLTATGKRSRGL-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K    RR TWKR+ TLSL RYR
Sbjct  180  YNKTTAGRRKTWKRHNTLSLWRYR  203



>ref|XP_007812013.1| 60S ribosomal protein L15 [Metarhizium acridum CQMa 102]
 ref|XP_007818066.1| 60S ribosomal protein L15 [Metarhizium robertsii ARSEF 23]
 gb|EFY88332.1| 60S ribosomal protein L15 [Metarhizium acridum CQMa 102]
 gb|EFZ02295.1| Ribosomal protein L15e [Metarhizium robertsii ARSEF 23]
 gb|EXV05475.1| ribosomal protein L15 [Metarhizium robertsii]
 gb|KFG82830.1| 60S ribosomal protein L15 [Metarhizium anisopliae]
 gb|KID67254.1| Ribosomal protein L15e, partial [Metarhizium anisopliae ARSEF 
549]
 gb|KID88474.1| Ribosomal protein L15e [Metarhizium guizhouense ARSEF 977]
Length=203

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = -2

Query  906  MGAYTYVSELWRKKQSDVMRFLLRVRCWEYRQLPSIVRVTRSTRPDKARRLGYKAKQgyv  727
            MGA  YV EL +KKQSDVMRFLLRVRCWEYRQL  I R +R +RPDKARRLGYKAKQGYV
Sbjct  1    MGALKYVEELQKKKQSDVMRFLLRVRCWEYRQLNVIHRASRPSRPDKARRLGYKAKQGYV  60

Query  726  iyrvrvrrggrkrpvpkgIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVLNSYW  547
            IYRVRVRRGGRKRPVPKG  YGKPTNQGV QLK+QRS ++ AEER GR+   LRVLNSYW
Sbjct  61   IYRVRVRRGGRKRPVPKGATYGKPTNQGVNQLKYQRSLKATAEERVGRRCANLRVLNSYW  120

Query  546  INEDSTYKYFEVILVDPAHAAIRNDPRINWLCNPVHKHRELRGLTSAGKKFRGLRGRGHL  367
            IN+DSTYKY+EVILVDP H AIR DPRINW+ NPVHKHRE RGLT+ GKK RGL  +GH 
Sbjct  121  INQDSTYKYYEVILVDPQHKAIRIDPRINWIVNPVHKHREARGLTATGKKSRGL-NKGHR  179

Query  366  HHKARPSRRATWKRNQTLSLRRYR  295
            ++K +  RR TW R+ T SL RYR
Sbjct  180  YNKTQAGRRKTWLRHNTTSLWRYR  203



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2665779346464