BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23649_g1_i1 len=121 path=[17799:0-120]

Length=121
                                                                      Score     E

ref|XP_002268859.2|  PREDICTED: 60S ribosomal protein L9              84.7    1e-18   Vitis vinifera
ref|XP_007143489.1|  hypothetical protein PHAVU_007G076200g           84.0    1e-18   
gb|AHA84178.1|  60S ribosomal protein L9                              84.0    1e-18   
ref|XP_007136368.1|  hypothetical protein PHAVU_009G039400g           84.0    1e-18   
ref|XP_003615495.1|  60S ribosomal protein l9                         83.6    2e-18   
ref|XP_007136370.1|  hypothetical protein PHAVU_009G039600g           83.6    2e-18   
ref|XP_002276785.1|  PREDICTED: 60S ribosomal protein L9              83.2    2e-18   Vitis vinifera
ref|XP_009630547.1|  PREDICTED: 60S ribosomal protein L9-1-like       83.2    3e-18   
ref|XP_009619208.1|  PREDICTED: 60S ribosomal protein L9-1            83.2    3e-18   
ref|XP_007151442.1|  hypothetical protein PHAVU_004G046700g           82.8    3e-18   
ref|XP_006351066.1|  PREDICTED: 60S ribosomal protein L9-1-like       82.8    3e-18   
ref|XP_004244773.1|  PREDICTED: 60S ribosomal protein L9-1            82.8    3e-18   
ref|XP_004173367.1|  PREDICTED: 60S ribosomal protein L9-like         81.3    4e-18   
ref|XP_009775635.1|  PREDICTED: 60S ribosomal protein L9-1-like       82.8    4e-18   
ref|XP_009602099.1|  PREDICTED: 60S ribosomal protein L9-1-like       82.4    4e-18   
gb|AFK37248.1|  unknown                                               82.4    5e-18   
ref|NP_001236502.1|  uncharacterized protein LOC100500079             82.4    5e-18   
gb|KDO49763.1|  hypothetical protein CISIN_1g029052mg                 82.4    5e-18   
ref|XP_007218455.1|  hypothetical protein PRUPE_ppa011825mg           82.4    6e-18   
ref|XP_010529689.1|  PREDICTED: 60S ribosomal protein L9-1-like       82.0    7e-18   
ref|XP_003526775.1|  PREDICTED: 60S ribosomal protein L9-like iso...  82.0    7e-18   
ref|NP_001242289.1|  uncharacterized protein LOC100810086             82.0    7e-18   
ref|XP_010542204.1|  PREDICTED: 60S ribosomal protein L9-1            81.6    9e-18   
ref|XP_006451279.1|  hypothetical protein CICLE_v10009377mg           82.0    9e-18   
ref|XP_002518958.1|  60S ribosomal protein L9, putative               81.6    1e-17   Ricinus communis
ref|XP_004137145.1|  PREDICTED: 60S ribosomal protein L9-like         81.6    1e-17   
ref|XP_008437538.1|  PREDICTED: 60S ribosomal protein L9              81.6    1e-17   
ref|WP_033581565.1|  50S ribosomal protein L6                         79.7    1e-17   
gb|AEI55400.1|  60S ribosomal protein L9                              80.1    1e-17   
ref|XP_002317034.1|  GA family protein                                81.3    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010108337.1|  60S ribosomal protein L9                         81.3    1e-17   
ref|XP_011004365.1|  PREDICTED: 60S ribosomal protein L9              81.3    1e-17   
gb|KHG11208.1|  60S ribosomal L9                                      81.3    1e-17   
ref|XP_008462900.1|  PREDICTED: 60S ribosomal protein L9-like         81.3    1e-17   
ref|XP_003602417.1|  Ribosomal protein L9                             81.3    1e-17   
ref|XP_007039292.1|  Ribosomal protein L6 family isoform 2            81.3    1e-17   
gb|ABK93909.1|  unknown                                               81.3    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_007039291.1|  60S ribosomal protein L9-1 isoform 1             81.6    1e-17   
ref|XP_002317653.1|  GA family protein                                81.3    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010251117.1|  PREDICTED: 60S ribosomal protein L9-like         81.3    1e-17   
gb|KHG09357.1|  60S ribosomal L9                                      81.3    1e-17   
gb|AEC11014.1|  60S ribosomal protein L9                              80.9    1e-17   
gb|ABU90942.1|  ribosomal protein L9                                  80.9    2e-17   Sonneratia alba
gb|ABQ41921.1|  60S ribosomal protein large subunit 9                 80.9    2e-17   Sonneratia caseolaris
gb|ABU90930.1|  ribosomal protein L9                                  80.9    2e-17   Sonneratia alba
ref|XP_004145906.1|  PREDICTED: 60S ribosomal protein L9-like         80.9    2e-17   
gb|AFK44231.1|  unknown                                               80.9    2e-17   
ref|XP_002518960.1|  60S ribosomal protein L9, putative               80.9    2e-17   Ricinus communis
gb|AHZ31412.1|  ribosomal protein L9                                  80.5    2e-17   
gb|AHZ31407.1|  ribosomal protein L9                                  80.5    2e-17   
gb|ABQ41923.1|  60S ribosomal protein large subunit 9                 80.9    2e-17   Sonneratia apetala
ref|NP_001274814.1|  60S ribosomal protein L9-1-like                  80.9    2e-17   
gb|KDO66558.1|  hypothetical protein CISIN_1g029362mg                 79.7    2e-17   
gb|ABU90994.1|  ribosomal protein L9                                  80.5    2e-17   Sonneratia caseolaris
gb|KDP46294.1|  hypothetical protein JCGZ_10134                       80.9    2e-17   
gb|ABQ41922.1|  60S ribosomal protein large subunit 9                 80.5    2e-17   Sonneratia ovata
gb|ABQ41920.1|  60S ribosomal protein large subunit 9                 80.5    2e-17   Sonneratia alba
gb|AHZ31415.1|  ribosomal protein L9                                  80.1    2e-17   
ref|XP_006441975.1|  hypothetical protein CICLE_v10022372mg           80.5    2e-17   
ref|XP_002523389.1|  60S ribosomal protein L9, putative               80.5    2e-17   Ricinus communis
ref|XP_010045313.1|  PREDICTED: 60S ribosomal protein L9              80.5    2e-17   
ref|XP_006451278.1|  hypothetical protein CICLE_v10009377mg           80.9    2e-17   
ref|XP_010277762.1|  PREDICTED: 60S ribosomal protein L9              80.5    2e-17   
gb|AHZ31406.1|  ribosomal protein L9                                  80.1    2e-17   
gb|AHZ31409.1|  ribosomal protein L9                                  80.1    2e-17   
gb|AHZ31405.1|  ribosomal protein L9                                  80.1    3e-17   
ref|XP_002300533.2|  hypothetical protein POPTR_0001s45820g           80.5    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002300530.1|  hypothetical protein POPTR_0001s45810g           80.5    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_006476240.1|  PREDICTED: 60S ribosomal protein L9-like         80.5    3e-17   
ref|XP_004309503.1|  PREDICTED: 60S ribosomal protein L9-1-like       80.5    3e-17   
ref|XP_010034921.1|  PREDICTED: 60S ribosomal protein L9              80.5    3e-17   
ref|XP_006439169.1|  hypothetical protein CICLE_v10022376mg           80.5    3e-17   
emb|CDX96888.1|  BnaC02g30260D                                        80.1    3e-17   
ref|NP_001236893.1|  uncharacterized protein LOC100306058             80.1    3e-17   
gb|KCW46126.1|  hypothetical protein EUGRSUZ_K00048                   80.9    3e-17   
gb|KHG17022.1|  60S ribosomal protein L9                              80.1    3e-17   
ref|XP_006475562.1|  PREDICTED: 60S ribosomal protein L9-1-like       80.1    4e-17   
ref|XP_009123894.1|  PREDICTED: 60S ribosomal protein L9-1-like       80.1    4e-17   
ref|XP_010919070.1|  PREDICTED: 60S ribosomal protein L9              80.1    4e-17   
gb|KDP46295.1|  hypothetical protein JCGZ_10135                       80.1    4e-17   
ref|XP_006288547.1|  hypothetical protein CARUB_v10001828mg           80.5    4e-17   
gb|KCW46125.1|  hypothetical protein EUGRSUZ_K00048                   80.5    4e-17   
ref|XP_006441976.1|  hypothetical protein CICLE_v10022372mg           80.1    4e-17   
ref|XP_004307921.1|  PREDICTED: 60S ribosomal protein L9-1-like       80.1    4e-17   
ref|XP_010093262.1|  60S ribosomal protein L9                         80.1    4e-17   
gb|AIZ73104.1|  ribosomal protein L9                                  79.3    4e-17   
ref|XP_002891031.1|  60S ribosomal protein L9                         79.7    4e-17   
gb|KDP36139.1|  hypothetical protein JCGZ_08783                       79.7    5e-17   
ref|XP_004502780.1|  PREDICTED: 60S ribosomal protein L9-like         79.7    5e-17   
emb|CDY32946.1|  BnaA09g16470D                                        79.7    5e-17   
ref|XP_010499858.1|  PREDICTED: 60S ribosomal protein L9-1            79.7    5e-17   
gb|ABU90976.1|  ribosomal protein L9                                  79.7    5e-17   Sonneratia caseolaris
gb|EPS64502.1|  hypothetical protein M569_10279                       78.6    5e-17   
ref|XP_011038050.1|  PREDICTED: 60S ribosomal protein L9-like         79.7    5e-17   
ref|XP_009123738.1|  PREDICTED: 60S ribosomal protein L9-1            79.7    6e-17   
ref|XP_011038051.1|  PREDICTED: 60S ribosomal protein L9              79.7    6e-17   
ref|XP_008783757.1|  PREDICTED: 60S ribosomal protein L9              79.3    6e-17   
ref|XP_011038049.1|  PREDICTED: 60S ribosomal protein L9-like         79.3    7e-17   
gb|ACJ86147.1|  unknown                                               79.3    7e-17   Medicago truncatula
ref|XP_011075872.1|  PREDICTED: 60S ribosomal protein L9-1-like       79.3    7e-17   
ref|XP_006451280.1|  hypothetical protein CICLE_v10009377mg           79.0    7e-17   
gb|KHG29021.1|  60S ribosomal L9-1 -like protein                      79.3    8e-17   
ref|XP_006415122.1|  hypothetical protein EUTSA_v10008838mg           79.0    9e-17   
gb|AAG51293.1|AC027035_16  ribosomal protein L9, 5' partial           78.2    9e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KHG17021.1|  60S ribosomal protein L9                              79.3    9e-17   
ref|XP_008381567.1|  PREDICTED: 60S ribosomal protein L9-like         79.0    1e-16   
ref|XP_001765770.1|  predicted protein                                79.0    1e-16   
gb|ABK22722.1|  unknown                                               78.6    1e-16   Picea sitchensis
ref|XP_011077247.1|  PREDICTED: 60S ribosomal protein L9-like         79.0    1e-16   
ref|XP_001762945.1|  predicted protein                                78.6    1e-16   
ref|XP_004490523.1|  PREDICTED: 60S ribosomal protein L9-like         78.6    1e-16   
gb|ABK26079.1|  unknown                                               78.6    1e-16   Picea sitchensis
ref|XP_008376845.1|  PREDICTED: 60S ribosomal protein L9              78.6    1e-16   
ref|NP_564417.1|  60S ribosomal protein L9-1                          78.6    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63736.1|  ribosomal protein L9, putative                        78.6    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001274829.1|  60S ribosomal protein L9-1-like                  78.6    1e-16   
ref|XP_006846481.1|  hypothetical protein AMTR_s00018p00131950        78.6    1e-16   
ref|XP_007209629.1|  hypothetical protein PRUPE_ppa011819mg           78.6    1e-16   
ref|XP_006478505.1|  PREDICTED: 60S ribosomal protein L9-1-like       78.2    2e-16   
ref|XP_004241407.1|  PREDICTED: 60S ribosomal protein L9-1-like       78.2    2e-16   
ref|XP_010941184.1|  PREDICTED: 60S ribosomal protein L9-like         78.2    2e-16   
emb|CAA65987.2|  ribosomal protein L9                                 78.2    2e-16   Pisum sativum [garden pea]
gb|AHZ31410.1|  ribosomal protein L9                                  77.8    2e-16   
ref|XP_008788719.1|  PREDICTED: 60S ribosomal protein L9-like         77.8    2e-16   
sp|P30707.1|RL9_PEA  RecName: Full=60S ribosomal protein L9; AltN...  77.8    2e-16   Pisum sativum [garden pea]
ref|XP_006854038.1|  hypothetical protein AMTR_s00048p00062300        77.8    2e-16   
ref|XP_008784621.1|  PREDICTED: 60S ribosomal protein L9-like         77.8    2e-16   
ref|XP_001782330.1|  predicted protein                                77.8    3e-16   
ref|XP_001773604.1|  predicted protein                                77.8    3e-16   
ref|XP_010934895.1|  PREDICTED: 60S ribosomal protein L9-like         77.8    3e-16   
gb|EYU45335.1|  hypothetical protein MIMGU_mgv1a014281mg              77.8    3e-16   
ref|XP_002985482.1|  hypothetical protein SELMODRAFT_269009           77.4    3e-16   
gb|KFK30864.1|  hypothetical protein AALP_AA6G035700                  77.0    5e-16   
ref|XP_002874628.1|  60S ribosomal protein L9                         77.0    5e-16   
emb|CDP08217.1|  unnamed protein product                              76.6    6e-16   
ref|NP_192783.1|  60S ribosomal protein L9-2                          77.0    6e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009384509.1|  PREDICTED: 60S ribosomal protein L9-like         77.0    6e-16   
dbj|BAA19798.1|  YK426                                                76.6    6e-16   Oryza sativa Japonica Group [Japonica rice]
emb|CDM80141.1|  unnamed protein product                              76.6    6e-16   
ref|NP_001045607.1|  Os02g0103700                                     76.6    6e-16   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063520.1|  Os09g0485900                                     76.6    6e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011077248.1|  PREDICTED: 60S ribosomal protein L9-like         76.6    6e-16   
gb|EMS50458.1|  60S ribosomal protein L9                              76.6    6e-16   
ref|XP_006660761.1|  PREDICTED: 60S ribosomal protein L9-like         76.6    6e-16   
dbj|BAD07825.1|  putative 60S ribosomal protein L9                    76.6    7e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EMT29055.1|  60S ribosomal protein L9                              76.6    7e-16   
gb|EYU19706.1|  hypothetical protein MIMGU_mgv1a014306mg              76.6    7e-16   
ref|XP_009401730.1|  PREDICTED: 60S ribosomal protein L9              76.6    8e-16   
ref|XP_004964297.1|  PREDICTED: 60S ribosomal protein L9-like         76.6    8e-16   
ref|XP_009421455.1|  PREDICTED: 60S ribosomal protein L9-like         76.3    9e-16   
ref|XP_010671296.1|  PREDICTED: 60S ribosomal protein L9-like         76.3    9e-16   
emb|CDY43615.1|  BnaC09g17540D                                        75.9    9e-16   
gb|EMT28647.1|  60S ribosomal protein L9                              76.6    1e-15   
emb|CAA63024.1|  60S ribosomal protein L9                             75.9    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31839.1|  hypothetical protein AALP_AA6G165100                  75.9    2e-15   
ref|XP_003562717.1|  PREDICTED: 60S ribosomal protein L9              75.5    2e-15   
ref|XP_003557264.1|  PREDICTED: 60S ribosomal protein L9-like         75.5    2e-15   
gb|EYU19709.1|  hypothetical protein MIMGU_mgv11b023029mg             73.9    2e-15   
gb|ABR25779.1|  60S ribosomal protein l9                              73.2    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_010934051.1|  PREDICTED: 60S ribosomal protein L9-like         75.1    2e-15   
gb|ACR38505.1|  unknown                                               74.7    3e-15   Zea mays [maize]
ref|NP_001147384.1|  60S ribosomal protein L9                         74.7    3e-15   Zea mays [maize]
gb|ACG33227.1|  60S ribosomal protein L9                              74.7    3e-15   Zea mays [maize]
gb|ACG24522.1|  60S ribosomal protein L9                              74.7    3e-15   Zea mays [maize]
dbj|BAJ96848.1|  predicted protein                                    74.7    3e-15   
ref|XP_002437682.1|  hypothetical protein SORBIDRAFT_10g000700        74.7    3e-15   Sorghum bicolor [broomcorn]
gb|AFW86204.1|  hypothetical protein ZEAMMB73_740240                  74.7    4e-15   
gb|AFW75225.1|  hypothetical protein ZEAMMB73_023047                  74.3    4e-15   
gb|AFW86205.1|  hypothetical protein ZEAMMB73_740240                  73.9    4e-15   
ref|NP_001150671.1|  LOC100284304                                     73.9    7e-15   Zea mays [maize]
ref|XP_006397064.1|  hypothetical protein EUTSA_v10028984mg           73.6    8e-15   
ref|NP_001149698.1|  LOC100283325                                     73.6    1e-14   Zea mays [maize]
ref|XP_004954554.1|  PREDICTED: WAT1-related protein At3g30340-like   76.3    1e-14   
emb|CDX94253.1|  BnaC02g29130D                                        72.8    2e-14   
ref|XP_009128711.1|  PREDICTED: 60S ribosomal protein L9-2            72.4    3e-14   
gb|EYU19707.1|  hypothetical protein MIMGU_mgv1a023700mg              70.9    3e-14   
emb|CDX99541.1|  BnaC09g24510D                                        72.0    3e-14   
ref|XP_009113614.1|  PREDICTED: 60S ribosomal protein L9-2-like       72.0    3e-14   
gb|ACG40143.1|  60S ribosomal protein L9                              72.0    4e-14   Zea mays [maize]
gb|EMT15478.1|  60S ribosomal protein L9                              70.1    8e-14   
gb|AFW66830.1|  nodulin protein                                       73.6    1e-13   
gb|KFM26327.1|  60S ribosomal protein L9                              70.1    2e-13   
gb|KHN02144.1|  60S ribosomal protein L9                              69.3    3e-13   
ref|XP_002453127.1|  hypothetical protein SORBIDRAFT_04g000460        67.8    6e-13   Sorghum bicolor [broomcorn]
gb|ACV32429.1|  large subunit ribosomal protein 9                     68.2    7e-13   Pseudodiplogasteroides sp. SB257
ref|XP_004180949.1|  hypothetical protein TBLA_0E03760                68.2    9e-13   
ref|XP_004179288.1|  hypothetical protein TBLA_0B09520                68.2    9e-13   
ref|XP_005849740.1|  hypothetical protein CHLNCDRAFT_59621            67.8    1e-12   
ref|XP_002497546.1|  60S ribosomal protein L9                         67.8    1e-12   Zygosaccharomyces rouxii CBS 732
gb|AHZ34825.1|  large subunit ribosomal protein 9                     67.4    1e-12   
gb|EGA78803.1|  Rpl9ap                                                66.6    1e-12   
gb|KHN01732.1|  60S ribosomal protein L9                              66.2    2e-12   
ref|XP_974780.1|  PREDICTED: 60S ribosomal protein L9 isoform X2      67.4    2e-12   Tribolium castaneum [rust-red flour beetle]
gb|KHN72221.1|  60S ribosomal protein L9                              67.0    2e-12   
gb|AHZ34827.1|  large subunit ribosomal protein 9                     67.0    2e-12   
gb|ERG87740.1|  60s ribosomal protein l9                              67.0    2e-12   
gb|EGA82943.1|  Rpl9ap                                                67.0    2e-12   
gb|ACV32432.1|  large subunit ribosomal protein 9                     67.0    2e-12   Koerneria sudhausi
gb|EDN61974.1|  ribosomal protein L9A                                 67.0    2e-12   Saccharomyces cerevisiae YJM789
ref|NP_014332.1|  ribosomal 60S subunit protein L9B                   67.0    2e-12   Saccharomyces cerevisiae S288C
gb|EGA77101.1|  Rpl9bp                                                67.0    2e-12   
gb|EHN00516.1|  Rpl9bp                                                67.0    2e-12   
gb|EDV10360.1|  ribosomal protein L9A                                 67.0    2e-12   Saccharomyces cerevisiae RM11-1a
gb|AFV95303.1|  large subunit ribosomal protein 9                     67.0    2e-12   
gb|AHZ34826.1|  large subunit ribosomal protein 9                     66.6    2e-12   
ref|XP_003680553.1|  60S ribosomal protein L9                         67.0    3e-12   
ref|XP_003693532.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...  66.6    3e-12   
pdb|3JYW|H  Chain H, Structure Of The 60s Proteins For Eukaryotic...  66.6    3e-12   
gb|EFA77263.1|  60S ribosomal protein L9                              67.0    3e-12   Heterostelium album PN500
ref|XP_623506.1|  PREDICTED: 60S ribosomal protein L9                 66.6    3e-12   Apis mellifera [bee]
gb|EHJ78541.1|  ribosomal protein L9                                  66.6    3e-12   
ref|NP_011368.3|  ribosomal 60S subunit protein L9A                   66.6    3e-12   Saccharomyces cerevisiae S288C
ref|XP_446742.1|  60S ribosomal protein L9                            66.6    3e-12   [Candida] glabrata CBS 138
ref|XP_003955903.1|  hypothetical protein KAFR_0B04710                66.6    3e-12   
ref|XP_003703131.1|  PREDICTED: 60S ribosomal protein L9-like         66.6    3e-12   
emb|CAJ17250.1|  ribosomal protein L9e                                66.6    3e-12   Cephalota litorea
gb|ACV32417.1|  large subunit ribosomal protein 9                     66.6    3e-12   Mononchoides sp. RS5441
gb|ACV32426.1|  large subunit ribosomal protein 9                     66.6    3e-12   Koerneria sp. RS1982
gb|AFV95302.1|  large subunit ribosomal protein 9                     66.6    3e-12   
gb|KIH44344.1|  ribosomal protein L6                                  65.9    3e-12   
gb|ACV32423.1|  large subunit ribosomal protein 9                     66.6    3e-12   Oigolaimella attenuata
gb|ACV32428.1|  large subunit ribosomal protein 9                     66.2    3e-12   Acrostichus sp. RS5083
ref|XP_003684895.1|  60S ribosomal protein L9                         66.6    3e-12   
gb|AFC90092.1|  hypothetical protein                                  65.5    3e-12   
ref|XP_003686364.1|  60S ribosomal protein L9                         66.6    3e-12   
gb|EGA60716.1|  Rpl9bp                                                66.6    4e-12   
emb|CDS08179.1|  hypothetical protein LRAMOSA02127                    66.2    4e-12   
emb|CDH52370.1|  60s ribosomal protein l9                             66.2    4e-12   
gb|EWM26180.1|  60s ribosomal protein l9                              66.2    4e-12   
gb|EFZ14104.1|  hypothetical protein SINV_15854                       66.2    4e-12   
emb|CDH49550.1|  60s ribosomal protein l9                             66.2    4e-12   
gb|AEB54645.1|  ribosomal protein L9                                  66.2    4e-12   
gb|ACV32419.1|  large subunit ribosomal protein 9                     66.2    4e-12   Diplogasteroides sp. 1 RS5444
gb|AFK41222.1|  unknown                                               65.9    4e-12   
emb|CDH57428.1|  60s ribosomal protein l9                             66.2    5e-12   
ref|XP_003959367.1|  hypothetical protein KAFR_0J01670                65.9    5e-12   
gb|EJD75997.1|  60S ribosomal protein L9                              65.9    5e-12   
ref|XP_002494433.1|  60S ribosomal protein L9                         65.9    5e-12   Zygosaccharomyces rouxii CBS 732
ref|XP_006679186.1|  hypothetical protein BATDEDRAFT_88560            65.9    5e-12   
emb|CBN79209.1|  conserved unknown protein                            65.9    5e-12   
ref|XP_003682829.1|  60S ribosomal protein L9                         65.9    6e-12   
gb|EJW85983.1|  60S ribosomal protein L9                              65.9    6e-12   
gb|ACV32420.1|  large subunit ribosomal protein 9                     65.9    6e-12   Micoletzkya sp. WEM-2009
gb|ETN76537.1|  ribosomal protein L6                                  65.9    6e-12   
gb|AFV95304.1|  large subunit ribosomal protein 9                     65.9    6e-12   
ref|XP_001902933.1|  60S ribosomal protein L9                         65.9    6e-12   Brugia malayi [agent of lymphatic filariasis]
gb|AHZ34823.1|  large subunit ribosomal protein 9                     65.9    6e-12   
gb|EYB91393.1|  hypothetical protein Y032_0206g1969                   65.9    6e-12   
gb|KHJ98063.1|  ribosomal protein L6                                  65.5    6e-12   
ref|XP_001527234.1|  60S ribosomal protein L9-B                       65.9    7e-12   Lodderomyces elongisporus NRRL YB-4239
gb|ACV32421.1|  large subunit ribosomal protein 9                     65.5    7e-12   Neodiplogaster sp. WEM-2009
gb|EMG49862.1|  60S ribosomal protein L9-B                            65.5    7e-12   
gb|ACV32427.1|  large subunit ribosomal protein 9                     65.5    7e-12   Diplogasteroides magnus
gb|AFV95306.1|  large subunit ribosomal protein 9                     65.5    7e-12   
gb|KHC36584.1|  60S ribosomal protein L9-B                            65.5    7e-12   
gb|AGR45369.1|  large subunit ribosomal protein 9                     65.5    8e-12   
ref|XP_720065.1|  likely cytosolic ribosomal protein L9               65.5    8e-12   Candida albicans SC5314
ref|XP_004351450.1|  60S ribosomal protein L9                         65.5    8e-12   
emb|CCE40246.1|  hypothetical protein CPAR2_102840                    65.5    8e-12   
ref|NP_001037144.1|  ribosomal protein L9                             65.5    8e-12   Bombyx mori [silk moth]
gb|AGR45359.1|  large subunit ribosomal protein 9                     65.5    8e-12   
ref|XP_007376109.1|  hypothetical protein SPAPADRAFT_61900            65.5    8e-12   
ref|XP_002419181.1|  60S ribosomal protein L9                         65.5    8e-12   Candida dubliniensis CD36
ref|XP_008715993.1|  hypothetical protein HMPREF1541_03420            65.5    8e-12   
gb|AHZ34824.1|  large subunit ribosomal protein 9                     65.5    8e-12   
gb|AHZ34828.1|  large subunit ribosomal protein 9                     65.1    8e-12   
ref|XP_003867555.1|  Rpl9b predicted ribosomal protein L9             65.5    9e-12   
gb|AFV95301.1|  large subunit ribosomal protein 9                     65.5    9e-12   
ref|XP_008192134.1|  PREDICTED: 60S ribosomal protein L9 isoform X1   65.5    9e-12   
sp|Q963B7.1|RL9_SPOFR  RecName: Full=60S ribosomal protein L9         65.5    9e-12   Spodoptera frugiperda
gb|ADT80640.1|  ribosomal protein L9                                  65.5    9e-12   
dbj|GAM27579.1|  hypothetical protein SAMD00019534_107550             65.5    9e-12   
ref|XP_002287532.1|  RL9, ribosomal protein 9                         65.1    9e-12   Thalassiosira pseudonana CCMP1335
gb|KDD76473.1|  hypothetical protein H632_c214p3                      65.1    1e-11   
dbj|BAM19294.1|  ribosomal protein L9                                 65.1    1e-11   
dbj|BAM17714.1|  ribosomal protein L9                                 65.1    1e-11   
gb|ACY95319.1|  ribosomal protein L9                                  65.1    1e-11   Manduca sexta [Carolina sphinx]
gb|AAV91384.1|  ribosomal protein 13                                  65.1    1e-11   Lonomia obliqua
gb|ACV32422.1|  large subunit ribosomal protein 9                     65.1    1e-11   Myctolaimus sp. RS5442
emb|CEG84618.1|  Putative 60S ribosomal protein L9-A                  65.1    1e-11   
gb|AEL28819.1|  ribosomal protein L9                                  65.1    1e-11   
gb|ESA02403.1|  hypothetical protein GLOINDRAFT_337403                65.1    1e-11   
gb|KHC78429.1|  60S ribosomal protein L9-B                            65.5    1e-11   
gb|ACU44988.1|  60s ribosomal protein l9                              64.7    1e-11   
gb|EGI62031.1|  60S ribosomal protein L9                              65.1    1e-11   
ref|XP_005790606.1|  hypothetical protein EMIHUDRAFT_351730           64.7    1e-11   
ref|XP_007797855.1|  putative 60s ribosomal protein l9 protein        64.7    1e-11   
emb|CDS03336.1|  hypothetical protein LRAMOSA00738                    64.7    1e-11   
dbj|GAM24484.1|  hypothetical protein SAMD00019534_076590             65.1    1e-11   
ref|XP_011103413.1|  rpl9ap                                           64.7    2e-11   
ref|XP_011105258.1|  rpl9bp                                           64.7    2e-11   
ref|XP_001652827.1|  60S ribosomal protein L9                         64.7    2e-11   
gb|EWC44348.1|  60S ribosomal protein L9-B                            64.7    2e-11   
gb|ABS57450.1|  ribosomal protein L9                                  64.7    2e-11   
ref|XP_004829842.1|  60S ribosomal protein L6, putative               64.7    2e-11   
ref|XP_009822948.1|  hypothetical protein H257_01446                  64.3    2e-11   
gb|ACV32433.1|  large subunit ribosomal protein 9                     64.3    2e-11   
ref|XP_003676024.1|  hypothetical protein NCAS_0D00790                64.3    2e-11   
ref|XP_006685416.1|  ribosomal protein L6                             64.3    2e-11   
ref|XP_001700532.1|  ribosomal protein L9, component of cytosolic...  64.3    2e-11   
gb|ACV32416.1|  large subunit ribosomal protein 9                     64.3    2e-11   
ref|XP_003675108.1|  hypothetical protein NCAS_0B06530                64.3    2e-11   
gb|ACV32431.1|  large subunit ribosomal protein 9                     64.3    2e-11   
emb|CDS03849.1|  hypothetical protein LRAMOSA06804                    64.3    2e-11   
gb|AIU94840.1|  60S ribosomal protein                                 64.3    2e-11   
gb|AEE61602.1|  unknown                                               64.3    2e-11   
ref|XP_445905.1|  60S ribosomal protein L9                            64.3    2e-11   
ref|XP_008613374.1|  60S ribosomal protein L9                         64.3    2e-11   
ref|XP_008870185.1|  hypothetical protein H310_06784                  63.9    2e-11   
gb|AFV95305.1|  large subunit ribosomal protein 9                     63.9    2e-11   
emb|CDF91082.1|  ZYBA0S09-04390g1_1                                   63.9    2e-11   
ref|XP_002548129.1|  60S ribosomal protein L9-B                       63.9    2e-11   
emb|CDH08808.1|  probable RPL9B-Ribosomal protein L9.e.c14            63.9    2e-11   
gb|EMD43008.1|  60S ribosomal protein L9                              63.9    2e-11   
emb|CDR46035.1|  CYFA0S21e01332g1_1                                   63.9    2e-11   
ref|XP_011109098.1|  hypothetical protein H072_3115                   63.9    2e-11   
dbj|BAK02581.1|  predicted protein                                    63.9    3e-11   
ref|XP_001939267.1|  60S ribosomal protein L9                         63.9    3e-11   
ref|XP_002956876.1|  component of cytosolic 80S ribosome and 60S ...  63.9    3e-11   
ref|XP_003305000.1|  60S ribosomal protein L9                         63.9    3e-11   
gb|KHC78802.1|  60S ribosomal protein L9-B                            63.9    3e-11   
emb|CCK71858.1|  hypothetical protein KNAG_0I00670                    63.9    3e-11   
ref|XP_647818.2|  60S ribosomal protein L9                            63.9    3e-11   
emb|CAJ17273.1|  ribosomal protein L9e                                63.9    3e-11   
gb|EMD45754.1|  60S ribosomal protein L9                              63.2    3e-11   
ref|XP_001734473.1|  60S ribosomal protein L9                         63.9    3e-11   
gb|ETN59397.1|  60S ribosomal protein L9                              63.9    3e-11   
gb|AHW80355.1|  ribosomal protein                                     63.5    3e-11   
ref|XP_652462.1|  60S ribosomal protein L9                            63.9    3e-11   
gb|EFN72386.1|  60S ribosomal protein L9                              63.5    3e-11   
ref|NP_983806.1|  60S ribosomal protein L9                            63.5    3e-11   
ref|XP_003668660.1|  ribosomal protein L9                             63.5    4e-11   
ref|XP_007744134.1|  60S ribosomal protein L9-B                       63.5    4e-11   
ref|XP_002679810.1|  60S ribosomal protein L9                         63.5    4e-11   
emb|CDH11258.1|  probable RPL9B-Ribosomal protein L9.e.c14            63.5    4e-11   
ref|XP_003396322.1|  PREDICTED: 60S ribosomal protein L9-like         63.5    4e-11   
emb|CDR44448.1|  CYFA0S14e02850g1_1                                   63.5    4e-11   
ref|XP_002615334.1|  hypothetical protein CLUG_04216                  63.2    4e-11   
gb|ACV32424.1|  large subunit ribosomal protein 9                     63.5    4e-11   
ref|XP_001798893.1|  hypothetical protein SNOG_08584                  63.5    4e-11   
ref|XP_011060246.1|  PREDICTED: 60S ribosomal protein L9              63.5    4e-11   
gb|ABR18017.1|  unknown                                               63.5    4e-11   
gb|ACV32425.1|  large subunit ribosomal protein 9                     63.5    4e-11   
ref|XP_008025426.1|  hypothetical protein SETTUDRAFT_162978           63.5    4e-11   
gb|EMD46388.1|  60S ribosomal protein L9                              62.8    4e-11   
gb|EFN86034.1|  60S ribosomal protein L9                              63.5    4e-11   
gb|KEF52867.1|  60S ribosomal protein L9-B                            63.5    4e-11   
ref|XP_649368.1|  60S ribosomal protein L9                            63.5    4e-11   
ref|XP_003286013.1|  hypothetical protein DICPUDRAFT_46501            63.5    4e-11   
gb|ABR23490.1|  60S ribosomal protein L9                              63.5    4e-11   
gb|EZA54902.1|  60S ribosomal protein L9                              63.5    4e-11   
ref|XP_001738520.1|  60S ribosomal protein L9                         63.5    4e-11   
emb|CDF91164.1|  ZYBA0S10-01134g1_1                                   63.2    4e-11   
gb|EMD95839.1|  hypothetical protein COCHEDRAFT_1127010               63.2    5e-11   
dbj|BAO42407.1|  60S ribosomal protein L9-B                           63.2    5e-11   
gb|ABW23164.1|  ribosomal protein rpl9                                63.2    5e-11   
dbj|BAO41831.1|  60S ribosomal protein L9-B                           63.2    5e-11   
ref|XP_004334896.1|  ribosomal protein L6, putative                   63.2    5e-11   
ref|XP_006624605.1|  PREDICTED: 60S ribosomal protein L9-like iso...  63.2    5e-11   
ref|XP_007713386.1|  hypothetical protein COCCADRAFT_5961             63.2    5e-11   
gb|ACV32418.1|  large subunit ribosomal protein 9                     63.2    5e-11   
ref|XP_007682794.1|  hypothetical protein COCMIDRAFT_692              63.2    5e-11   
ref|XP_007694252.1|  hypothetical protein COCSADRAFT_32285            63.2    6e-11   
gb|ABM55567.1|  putative ribosomal protein L9                         63.2    6e-11   
ref|XP_002178291.1|  predicted protein                                63.2    6e-11   
ref|XP_003671752.1|  ribosomal protein L9                             63.2    6e-11   
ref|XP_011121443.1|  hypothetical protein AOL_s00076g589              63.2    6e-11   
emb|CCX31931.1|  Similar to 60S ribosomal protein L9-B; acc. no. ...  63.2    6e-11   
ref|XP_002065042.1|  GK14887                                          63.2    6e-11   
ref|XP_001988083.1|  GH10761                                          62.8    6e-11   
ref|XP_005705907.1|  60S ribosomal protein L9e                        62.8    6e-11   
gb|EMD47918.1|  60S ribosomal protein L9                              62.8    6e-11   
ref|XP_001352287.1|  GA19385                                          62.8    6e-11   
ref|XP_001119418.2|  PREDICTED: 60S ribosomal protein L9-like         62.0    6e-11   
ref|XP_002051134.1|  GJ13905                                          62.8    6e-11   
ref|XP_002003897.1|  GI20564                                          62.8    6e-11   
ref|XP_001969883.1|  GG10334                                          62.8    6e-11   
ref|XP_002088317.1|  RpL9                                             62.8    7e-11   
ref|XP_461133.1|  60S ribosomal protein L9                            62.8    7e-11   
gb|ACY71246.1|  ribosomal protein L9                                  62.8    7e-11   
ref|NP_477161.1|  ribosomal protein L9, isoform A                     62.8    7e-11   
pdb|3J39|H  Chain H, Structure Of The D. Melanogaster 60s Ribosom...  62.8    7e-11   
emb|CAA64319.1|  ribosomal protein L9                                 62.8    8e-11   
ref|XP_001963232.1|  GF14045                                          62.8    8e-11   
emb|CDO95543.1|  unnamed protein product                              62.8    8e-11   
ref|XP_765940.1|  60S ribosomal protein L6                            62.8    8e-11   
ref|XP_001739800.1|  60S ribosomal protein L9                         62.4    8e-11   
ref|XP_004194896.1|  Piso0_005418                                     62.4    8e-11   
ref|XP_003004817.1|  60S ribosomal protein L9                         62.4    8e-11   
ref|XP_001386639.1|  60S ribosomal protein L9                         62.4    9e-11   
emb|CDO94600.1|  unnamed protein product                              62.4    9e-11   
gb|KGG50022.1|  hypothetical protein DI09_93p80                       62.4    9e-11   
gb|EFX64853.1|  hypothetical protein DAPPUDRAFT_231875                62.4    9e-11   
ref|XP_007725558.1|  60S ribosomal protein L9-B                       62.4    9e-11   
ref|XP_009042484.1|  hypothetical protein AURANDRAFT_60385            62.4    1e-10   
ref|XP_003659536.1|  hypothetical protein MYCTH_2313759               62.4    1e-10   
emb|CCH45010.1|  hypothetical protein BN7_4589                        62.4    1e-10   
gb|ABY62737.1|  ribosomal protein L9e                                 62.4    1e-10   
ref|XP_003646974.1|  hypothetical protein Ecym_5402                   62.4    1e-10   
ref|XP_001484929.1|  hypothetical protein PGUG_02658                  62.4    1e-10   
ref|XP_002407167.1|  60S ribosomal protein L9, putative               62.4    1e-10   
ref|XP_954331.1|  ribosomal protein l6                                62.4    1e-10   
ref|XP_003645667.1|  hypothetical protein Ecym_3363                   62.4    1e-10   
gb|EHK45319.1|  hypothetical protein TRIATDRAFT_257320                62.4    1e-10   
ref|XP_002840665.1|  60S ribosomal protein L9                         62.4    1e-10   
gb|EHN02484.1|  Rpl9bp                                                62.4    1e-10   
gb|EIE83873.1|  hypothetical protein RO3G_08578                       62.4    1e-10   
ref|XP_504535.1|  60S ribosomal protein L9                            62.4    1e-10   
ref|XP_002490040.1|  60S ribosomal protein L9                         62.4    1e-10   
ref|XP_004226861.1|  PREDICTED: 60S ribosomal protein L9              62.4    1e-10   
gb|EIE89804.1|  hypothetical protein RO3G_14515                       62.0    1e-10   
ref|XP_002555433.1|  60S ribosomal protein L9                         62.0    1e-10   
ref|XP_005187570.1|  PREDICTED: 60S ribosomal protein L9-like         63.2    1e-10   
gb|ACG48268.1|  60S ribosomal protein L9                              62.0    1e-10   
ref|XP_007920094.1|  hypothetical protein MYCFIDRAFT_54650            62.0    1e-10   
ref|XP_009156481.1|  60S ribosomal protein L9-B                       62.0    1e-10   
ref|XP_002489886.1|  60S ribosomal protein L9                         62.0    1e-10   
ref|XP_455283.1|  60S ribosomal protein L9                            62.0    1e-10   
ref|XP_454360.1|  60S ribosomal protein L9                            62.0    1e-10   
ref|XP_002598345.1|  hypothetical protein BRAFLDRAFT_261201           61.6    1e-10   
gb|KFH64166.1|  large subunit ribosomal protein L9e                   62.0    1e-10   
emb|CBK24913.2|  unnamed protein product                              62.0    2e-10   
gb|AAV84245.1|  ribosomal protein L9                                  62.0    2e-10   
ref|XP_009038191.1|  hypothetical protein AURANDRAFT_71877            62.4    2e-10   
ref|XP_003141570.1|  60S ribosomal protein L9                         61.2    2e-10   
gb|EHK26475.1|  hypothetical protein TRIVIDRAFT_92097                 61.6    2e-10   
ref|XP_009021809.1|  hypothetical protein HELRODRAFT_157417           61.6    2e-10   
ref|XP_310188.3|  AGAP009508-PA                                       61.6    2e-10   
ref|XP_004519385.1|  PREDICTED: 60S ribosomal protein L9-like iso...  61.6    2e-10   
ref|XP_001844062.1|  60S ribosomal protein L9                         61.6    2e-10   
ref|XP_003837427.1|  similar to 60s ribosomal protein l9              61.6    2e-10   
gb|ACH56942.1|  60S ribosomal protein L9                              61.6    2e-10   
ref|XP_003099462.1|  CRE-RPL-9 protein                                61.6    2e-10   
ref|XP_003801096.1|  PREDICTED: 60S ribosomal protein L9-like         61.6    2e-10   
gb|ACD65161.1|  putative 60S ribosomal protein RPL9                   61.2    2e-10   
gb|EGT56658.1|  hypothetical protein CAEBREN_21308                    61.6    2e-10   
ref|XP_007738117.1|  60S ribosomal protein L9-B                       61.6    2e-10   
ref|XP_003350970.1|  60S ribosomal protein L9                         61.6    2e-10   
gb|EGZ77743.1|  60S ribosomal protein L9                              61.6    2e-10   
ref|XP_002424794.1|  60S ribosomal protein L9, putative               61.6    2e-10   
ref|XP_007598174.1|  ribosomal protein L6                             61.6    2e-10   
ref|XP_007283467.1|  60s ribosomal protein l9                         62.0    2e-10   
sp|O02376.1|RL9_HAECO  RecName: Full=60S ribosomal protein L9         61.2    2e-10   
gb|KFM80581.1|  60S ribosomal protein L9                              61.6    2e-10   
ref|XP_002642599.1|  C. briggsae CBR-RPL-9 protein                    61.6    2e-10   
emb|CEJ00392.1|  Putative 60S ribosomal protein L9-A                  61.6    2e-10   
gb|AGG11483.1|  hypothetical protein                                  61.6    2e-10   
ref|NP_587694.1|  60S ribosomal protein L9                            61.6    2e-10   
gb|ACV32430.1|  large subunit ribosomal protein 9                     61.6    2e-10   
ref|XP_002554607.1|  60S ribosomal protein L9                         61.6    2e-10   
gb|EQB56781.1|  ribosomal protein L6                                  61.6    2e-10   
ref|XP_007827365.1|  60S ribosomal protein L9-B                       61.6    2e-10   
gb|AAN05606.1|  ribosomal protein L9                                  61.2    2e-10   
ref|XP_005644924.1|  ribosomal protein L9 component of cytosolic ...  61.2    2e-10   
emb|CEJ04157.1|  Putative 60S ribosomal protein L9-A                  61.2    2e-10   
ref|XP_008728757.1|  hypothetical protein G647_06213                  61.2    2e-10   
ref|XP_004348888.1|  60S ribosomal protein L9                         61.2    2e-10   
emb|CEG70551.1|  Putative 60S ribosomal protein L9-A                  61.2    2e-10   
gb|KGB74681.1|  60S ribosomal protein L9                              61.2    2e-10   
gb|EKG10690.1|  Ribosomal protein L6                                  61.2    2e-10   
ref|XP_009856537.1|  60S ribosomal protein L9                         61.2    2e-10   
ref|XP_965129.1|  60S ribosomal protein L9                            61.2    2e-10   
ref|XP_003856972.1|  60S ribosomal protein L9                         61.2    2e-10   
emb|CDR95697.1|  ribosomal protein L9, putative                       61.2    2e-10   
gb|KFB39860.1|  60S ribosomal protein L9                              61.2    2e-10   
tpe|CAL69059.1|  TPA: putative 60S ribosomal protein L9               61.2    2e-10   
ref|XP_001610536.1|  ribosomal protein L9                             61.2    3e-10   
gb|ELW64376.1|  60S ribosomal protein L9                              61.6    3e-10   
ref|XP_009689206.1|  ribosomal protein l6                             61.2    3e-10   
ref|XP_001905056.1|  hypothetical protein                             61.2    3e-10   
emb|CCG82249.1|  60S ribosomal protein L9                             61.2    3e-10   
ref|XP_003191848.1|  60S ribosomal protein l9                         61.2    3e-10   
ref|XP_009217886.1|  60S ribosomal protein L9-A                       61.2    3e-10   
gb|KIH89625.1|  60S ribosomal protein L9-A                            62.0    3e-10   
ref|NP_498660.1|  Protein RPL-9                                       61.2    3e-10   
ref|XP_007758513.1|  60S ribosomal protein L9-B                       61.2    3e-10   
ref|XP_796514.1|  PREDICTED: 60S ribosomal protein L9-like            61.2    3e-10   
gb|EKC42351.1|  60S ribosomal protein L9                              60.8    3e-10   
ref|XP_007917432.1|  putative 60s ribosomal protein l9 protein        61.2    3e-10   
dbj|BAN20941.1|  ribosomal protein L9                                 60.8    3e-10   
gb|EFX04066.1|  60S ribosomal protein                                 60.8    3e-10   
ref|XP_009168944.1|  hypothetical protein T265_05621                  61.6    3e-10   
ref|XP_001545124.1|  60S ribosomal protein L9                         60.8    3e-10   
ref|XP_002769175.1|  60S ribosomal protein L6, putative               60.8    3e-10   
ref|XP_004195983.1|  Piso0_005418                                     60.8    3e-10   
ref|XP_001596964.1|  60S ribosomal protein L9                         60.8    3e-10   
ref|XP_003652053.1|  60S ribosomal protein L9                         60.8    3e-10   
ref|XP_003740744.1|  PREDICTED: 60S ribosomal protein L9-like         60.8    3e-10   
gb|ESZ91866.1|  60S ribosomal protein L9                              60.8    3e-10   
gb|ELR08438.1|  large subunit ribosomal protein L9e                   60.8    3e-10   
gb|AFR92173.1|  large subunit ribosomal protein L9e                   60.8    3e-10   
gb|EPT03727.1|  hypothetical protein FOMPIDRAFT_1022295               60.8    3e-10   
gb|KFH72254.1|  hypothetical protein MVEG_02545                       63.9    3e-10   
emb|CCF45749.1|  ribosomal protein L6                                 60.8    3e-10   
emb|CCH44677.1|  50S ribosomal protein L6                             60.8    4e-10   
ref|XP_007776386.1|  60S ribosomal protein L9-B                       60.8    4e-10   
gb|EDL41723.1|  mCG130981                                             60.8    4e-10   
gb|EQK98553.1|  Ribosomal protein L6                                  60.8    4e-10   
ref|XP_008595380.1|  ribosomal protein L6                             60.8    4e-10   
gb|ACO12412.1|  60S ribosomal protein L9                              60.8    4e-10   



>ref|XP_002268859.2| PREDICTED: 60S ribosomal protein L9 [Vitis vinifera]
Length=226

 Score = 84.7 bits (208),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  98   SRKTTAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  137



>ref|XP_007143489.1| hypothetical protein PHAVU_007G076200g [Phaseolus vulgaris]
 gb|ESW15483.1| hypothetical protein PHAVU_007G076200g [Phaseolus vulgaris]
Length=192

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHVDNLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVDNLITGVTKGYRYKMRFVYAHFPIN  104



>gb|AHA84178.1| 60S ribosomal protein L9 [Phaseolus vulgaris]
Length=193

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHVDNLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVDNLITGVTKGYRYKMRFVYAHFPIN  104



>ref|XP_007136368.1| hypothetical protein PHAVU_009G039400g [Phaseolus vulgaris]
 gb|ESW08362.1| hypothetical protein PHAVU_009G039400g [Phaseolus vulgaris]
Length=193

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHVDNLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVDNLITGVTKGYRYKMRFVYAHFPIN  104



>ref|XP_003615495.1| 60S ribosomal protein l9 [Medicago truncatula]
 gb|AES98453.1| 60S ribosomal protein L6 [Medicago truncatula]
Length=192

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHVDNLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVDNLITGVTKGYRYKMRFVYAHFPIN  104



>ref|XP_007136370.1| hypothetical protein PHAVU_009G039600g [Phaseolus vulgaris]
 gb|ESW08364.1| hypothetical protein PHAVU_009G039600g [Phaseolus vulgaris]
Length=193

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHVDNLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVDNLITGVTKGYRYKMRFVYAHFPIN  104



>ref|XP_002276785.1| PREDICTED: 60S ribosomal protein L9 [Vitis vinifera]
Length=193

 Score = 83.2 bits (204),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTTAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  104



>ref|XP_009630547.1| PREDICTED: 60S ribosomal protein L9-1-like [Nicotiana tomentosiformis]
 ref|XP_009784194.1| PREDICTED: 60S ribosomal protein L9-1-like [Nicotiana sylvestris]
Length=194

 Score = 83.2 bits (204),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTTAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_009619208.1| PREDICTED: 60S ribosomal protein L9-1 [Nicotiana tomentosiformis]
 ref|XP_009803596.1| PREDICTED: 60S ribosomal protein L9-1 [Nicotiana sylvestris]
Length=194

 Score = 83.2 bits (204),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTTAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_007151442.1| hypothetical protein PHAVU_004G046700g [Phaseolus vulgaris]
 gb|AGV54316.1| 60S ribosomal protein l9 [Phaseolus vulgaris]
 gb|ESW23436.1| hypothetical protein PHAVU_004G046700g [Phaseolus vulgaris]
Length=193

 Score = 82.8 bits (203),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+A+IRTALSHVDNLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSASIRTALSHVDNLITGVTKGYRYKMRFVYAHFPIN  104



>ref|XP_006351066.1| PREDICTED: 60S ribosomal protein L9-1-like [Solanum tuberosum]
Length=194

 Score = 82.8 bits (203),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTTAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_004244773.1| PREDICTED: 60S ribosomal protein L9-1 [Solanum lycopersicum]
Length=194

 Score = 82.8 bits (203),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTTAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_004173367.1| PREDICTED: 60S ribosomal protein L9-like, partial [Cucumis sativus]
Length=125

 Score = 81.3 bits (199),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_009775635.1| PREDICTED: 60S ribosomal protein L9-1-like [Nicotiana sylvestris]
Length=194

 Score = 82.8 bits (203),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTTAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_009602099.1| PREDICTED: 60S ribosomal protein L9-1-like [Nicotiana tomentosiformis]
Length=194

 Score = 82.4 bits (202),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTTAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>gb|AFK37248.1| unknown [Lotus japonicus]
Length=192

 Score = 82.4 bits (202),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHVDNLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   TRKTSAAIRTALSHVDNLITGVTKGYRYKMRFVYAHFPIN  104



>ref|NP_001236502.1| uncharacterized protein LOC100500079 [Glycine max]
 gb|ACU14840.1| unknown [Glycine max]
Length=192

 Score = 82.4 bits (202),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  104



>gb|KDO49763.1| hypothetical protein CISIN_1g029052mg [Citrus sinensis]
Length=200

 Score = 82.4 bits (202),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_007218455.1| hypothetical protein PRUPE_ppa011825mg [Prunus persica]
 ref|XP_008234622.1| PREDICTED: 60S ribosomal protein L9-1 [Prunus mume]
 gb|EMJ19654.1| hypothetical protein PRUPE_ppa011825mg [Prunus persica]
Length=194

 Score = 82.4 bits (202),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_010529689.1| PREDICTED: 60S ribosomal protein L9-1-like [Tarenaya hassleriana]
Length=194

 Score = 82.0 bits (201),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHVDNLITGVTKG++YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVDNLITGVTKGFRYKMRFVYAHFPIN  105



>ref|XP_003526775.1| PREDICTED: 60S ribosomal protein L9-like isoform 1 [Glycine max]
 ref|XP_003526777.1| PREDICTED: 60S ribosomal protein L9-like [Glycine max]
 gb|ACU23062.1| unknown [Glycine max]
 gb|KHN19581.1| 60S ribosomal protein L9 [Glycine soja]
Length=192

 Score = 82.0 bits (201),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  104



>ref|NP_001242289.1| uncharacterized protein LOC100810086 [Glycine max]
 gb|ACU13876.1| unknown [Glycine max]
Length=192

 Score = 82.0 bits (201),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  104



>ref|XP_010542204.1| PREDICTED: 60S ribosomal protein L9-1 [Tarenaya hassleriana]
Length=194

 Score = 81.6 bits (200),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHVDNLITGVTKG++YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVDNLITGVTKGFRYKMRFVYAHFPIN  105



>ref|XP_006451279.1| hypothetical protein CICLE_v10009377mg [Citrus clementina]
 gb|ESR64519.1| hypothetical protein CICLE_v10009377mg [Citrus clementina]
Length=218

 Score = 82.0 bits (201),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  102  SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  141



>ref|XP_002518958.1| 60S ribosomal protein L9, putative [Ricinus communis]
 gb|EEF43491.1| 60S ribosomal protein L9, putative [Ricinus communis]
Length=194

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+A+IRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSASIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_004137145.1| PREDICTED: 60S ribosomal protein L9-like [Cucumis sativus]
 gb|KGN53768.1| hypothetical protein Csa_4G124900 [Cucumis sativus]
Length=195

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_008437538.1| PREDICTED: 60S ribosomal protein L9 [Cucumis melo]
 gb|ADN33776.1| 60S ribosomal protein l9 [Cucumis melo subsp. melo]
Length=194

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|WP_033581565.1| 50S ribosomal protein L6, partial [Dickeya zeae]
Length=96

 Score = 79.7 bits (195),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKG++YKMRFVYAHFPIN
Sbjct  56   SRKTSAAIRTALSHVENLITGVTKGFRYKMRFVYAHFPIN  95



>gb|AEI55400.1| 60S ribosomal protein L9 [Rubus idaeus]
Length=125

 Score = 80.1 bits (196),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   TRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_002317034.1| GA family protein [Populus trichocarpa]
 gb|ABK94136.1| unknown [Populus trichocarpa]
 gb|EEE97646.1| GA family protein [Populus trichocarpa]
Length=193

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  104



>ref|XP_010108337.1| 60S ribosomal protein L9 [Morus notabilis]
 gb|EXC55123.1| 60S ribosomal protein L9 [Morus notabilis]
Length=194

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_011004365.1| PREDICTED: 60S ribosomal protein L9 [Populus euphratica]
Length=193

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  104



>gb|KHG11208.1| 60S ribosomal L9 [Gossypium arboreum]
Length=194

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_008462900.1| PREDICTED: 60S ribosomal protein L9-like [Cucumis melo]
Length=195

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_003602417.1| Ribosomal protein L9 [Medicago truncatula]
 gb|AES72668.1| 60S ribosomal protein L6 [Medicago truncatula]
 gb|AFK40143.1| unknown [Medicago truncatula]
Length=193

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKG++YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVENLITGVTKGFRYKMRFVYAHFPIN  104



>ref|XP_007039292.1| Ribosomal protein L6 family isoform 2 [Theobroma cacao]
 gb|EOY23793.1| Ribosomal protein L6 family isoform 2 [Theobroma cacao]
Length=194

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>gb|ABK93909.1| unknown [Populus trichocarpa]
Length=193

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  104



>ref|XP_007039291.1| 60S ribosomal protein L9-1 isoform 1 [Theobroma cacao]
 gb|EOY23792.1| 60S ribosomal protein L9-1 isoform 1 [Theobroma cacao]
Length=243

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_002317653.1| GA family protein [Populus trichocarpa]
 gb|EEE98265.1| GA family protein [Populus trichocarpa]
Length=193

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  104



>ref|XP_010251117.1| PREDICTED: 60S ribosomal protein L9-like [Nelumbo nucifera]
 ref|XP_010251126.1| PREDICTED: 60S ribosomal protein L9-like [Nelumbo nucifera]
Length=193

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTALSHV+NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTTAAIRTALSHVENLIKGVTKGYRYKMRFVYAHFPIN  104



>gb|KHG09357.1| 60S ribosomal L9 [Gossypium arboreum]
Length=194

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>gb|AEC11014.1| 60S ribosomal protein L9, partial [Camellia sinensis]
Length=169

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTA SHVDNLI GVTKGY+YKMRFVYAHFPIN
Sbjct  41   SRKTTAAIRTAFSHVDNLINGVTKGYRYKMRFVYAHFPIN  80



>gb|ABU90942.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90943.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90944.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90945.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90946.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90947.1| ribosomal protein L9 [Sonneratia alba]
Length=185

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  63   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  102



>gb|ABQ41921.1| 60S ribosomal protein large subunit 9 [Sonneratia caseolaris]
 gb|ABU90948.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90949.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90950.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90951.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90952.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90953.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90954.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90955.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90956.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90957.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90958.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90959.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90960.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90961.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90962.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90963.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90964.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90965.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90966.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90967.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90968.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90969.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90970.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90971.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90972.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90973.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90974.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90975.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90986.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90987.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90988.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90989.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90990.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90991.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90992.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90993.1| ribosomal protein L9 [Sonneratia caseolaris]
Length=185

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  63   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  102



>gb|ABU90930.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90931.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90932.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90933.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90934.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90935.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90936.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90937.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90938.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90939.1| ribosomal protein L9 [Sonneratia alba]
Length=185

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  63   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  102



>ref|XP_004145906.1| PREDICTED: 60S ribosomal protein L9-like [Cucumis sativus]
 ref|XP_004160355.1| PREDICTED: 60S ribosomal protein L9-like [Cucumis sativus]
 gb|KGN49915.1| hypothetical protein Csa_5G139920 [Cucumis sativus]
Length=194

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>gb|AFK44231.1| unknown [Medicago truncatula]
Length=193

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKG++YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVENLITGVTKGFRYKMRFVYAHFPIN  104



>ref|XP_002518960.1| 60S ribosomal protein L9, putative [Ricinus communis]
 gb|EEF43493.1| 60S ribosomal protein L9, putative [Ricinus communis]
Length=194

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>gb|AHZ31412.1| ribosomal protein L9, partial [Sonneratia alba]
Length=165

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  54   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  93



>gb|AHZ31407.1| ribosomal protein L9, partial [Sonneratia caseolaris]
Length=165

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  54   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  93



>gb|ABQ41923.1| 60S ribosomal protein large subunit 9 [Sonneratia apetala]
 gb|ABU91338.1| ribosomal protein L9 [Sonneratia apetala]
 gb|ABU91339.1| ribosomal protein L9 [Sonneratia apetala]
 gb|ABU91340.1| ribosomal protein L9 [Sonneratia apetala]
 gb|ABU91341.1| ribosomal protein L9 [Sonneratia apetala]
 gb|ABU91342.1| ribosomal protein L9 [Sonneratia apetala]
 gb|ABU91343.1| ribosomal protein L9 [Sonneratia apetala]
 gb|ABU91344.1| ribosomal protein L9 [Sonneratia apetala]
 gb|ABU91345.1| ribosomal protein L9 [Sonneratia apetala]
 gb|ABU91346.1| ribosomal protein L9 [Sonneratia apetala]
 gb|ABU91347.1| ribosomal protein L9 [Sonneratia apetala]
Length=185

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  63   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  102



>ref|NP_001274814.1| 60S ribosomal protein L9-1-like [Solanum tuberosum]
 ref|XP_004253036.1| PREDICTED: 60S ribosomal protein L9-1-like [Solanum lycopersicum]
 gb|ABA81856.1| unknown [Solanum tuberosum]
Length=194

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK TAAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKATAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>gb|KDO66558.1| hypothetical protein CISIN_1g029362mg [Citrus sinensis]
Length=137

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  105



>gb|ABU90994.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90995.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90996.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90997.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90998.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90999.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU91000.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU91001.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU91002.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU91003.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU91004.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU91005.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU91006.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU91007.1| ribosomal protein L9 [Sonneratia caseolaris]
Length=185

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  63   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  102



>gb|KDP46294.1| hypothetical protein JCGZ_10134 [Jatropha curcas]
Length=194

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>gb|ABQ41922.1| 60S ribosomal protein large subunit 9 [Sonneratia ovata]
 gb|ABU90895.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90896.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90897.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90898.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90899.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90900.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90901.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90902.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90903.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90904.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90905.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90906.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90907.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90908.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90909.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90913.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90914.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90915.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90916.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90917.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90918.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90919.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90920.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90921.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90922.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90923.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90924.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90925.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90926.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90927.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90928.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90929.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU91368.1| ribosomal protein L9 [Sonneratia ovata]
 gb|ABU91369.1| ribosomal protein L9 [Sonneratia ovata]
 gb|ABU91370.1| ribosomal protein L9 [Sonneratia ovata]
 gb|ABU91371.1| ribosomal protein L9 [Sonneratia ovata]
 gb|ABU91372.1| ribosomal protein L9 [Sonneratia ovata]
 gb|ABU91373.1| ribosomal protein L9 [Sonneratia ovata]
 gb|ABU91374.1| ribosomal protein L9 [Sonneratia ovata]
 gb|ABU91375.1| ribosomal protein L9 [Sonneratia ovata]
 gb|ABU91376.1| ribosomal protein L9 [Sonneratia ovata]
 gb|ABU91377.1| ribosomal protein L9 [Sonneratia ovata]
 gb|ACM90068.1| ribosomal protein L9 [Sonneratia ovata]
 gb|ACM90069.1| ribosomal protein L9 [Sonneratia ovata]
 gb|ACM90070.1| ribosomal protein L9 [Sonneratia ovata]
 gb|ACM90071.1| ribosomal protein L9 [Sonneratia ovata]
Length=185

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  63   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  102



>gb|ABQ41920.1| 60S ribosomal protein large subunit 9 [Sonneratia alba]
 gb|ABU90844.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90845.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90846.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90847.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90848.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90849.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90850.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90851.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90852.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90853.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90854.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90855.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90856.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90857.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90858.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90859.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90860.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90861.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90862.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90863.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90864.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90865.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90866.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90867.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90868.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90869.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90870.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90871.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90872.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90873.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90874.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90875.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90876.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90877.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90878.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90879.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90880.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90881.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90882.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90883.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90884.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90885.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90886.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90887.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90888.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90889.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90890.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90891.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90892.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90893.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90894.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90910.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90911.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90912.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90940.1| ribosomal protein L9 [Sonneratia alba]
 gb|ABU90941.1| ribosomal protein L9 [Sonneratia alba]
 gb|ACS68651.1| ribosomal protein L9 [Sonneratia alba]
 gb|ACS68721.1| ribosomal protein L9 [Sonneratia alba]
Length=185

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  63   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  102



>gb|AHZ31415.1| ribosomal protein L9, partial [Sonneratia apetala]
 gb|AIZ73105.1| ribosomal protein L9, partial [Sonneratia apetala]
Length=165

 Score = 80.1 bits (196),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  54   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  93



>ref|XP_006441975.1| hypothetical protein CICLE_v10022372mg [Citrus clementina]
 gb|ESR55215.1| hypothetical protein CICLE_v10022372mg [Citrus clementina]
Length=183

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_002523389.1| 60S ribosomal protein L9, putative [Ricinus communis]
 gb|EEF38968.1| 60S ribosomal protein L9, putative [Ricinus communis]
Length=194

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_010045313.1| PREDICTED: 60S ribosomal protein L9 [Eucalyptus grandis]
 gb|KCW88594.1| hypothetical protein EUGRSUZ_A00971 [Eucalyptus grandis]
 gb|KCW88595.1| hypothetical protein EUGRSUZ_A00971 [Eucalyptus grandis]
Length=194

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   TRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_006451278.1| hypothetical protein CICLE_v10009377mg [Citrus clementina]
 gb|ESR64518.1| hypothetical protein CICLE_v10009377mg [Citrus clementina]
Length=230

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  102  SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  141



>ref|XP_010277762.1| PREDICTED: 60S ribosomal protein L9 [Nelumbo nucifera]
Length=193

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTA+SHV+NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTTAAIRTAISHVENLIKGVTKGYRYKMRFVYAHFPIN  104



>gb|AHZ31406.1| ribosomal protein L9, partial [Sonneratia caseolaris]
Length=165

 Score = 80.1 bits (196),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  54   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  93



>gb|AHZ31409.1| ribosomal protein L9, partial [Sonneratia alba]
Length=165

 Score = 80.1 bits (196),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  54   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  93



>gb|AHZ31405.1| ribosomal protein L9, partial [Sonneratia griffithii]
 gb|AHZ31408.1| ribosomal protein L9, partial [Sonneratia alba]
 gb|AHZ31411.1| ribosomal protein L9, partial [Sonneratia ovata]
 gb|AHZ31413.1| ribosomal protein L9, partial [Sonneratia griffithii]
 gb|AHZ31414.1| ribosomal protein L9, partial [Sonneratia ovata]
Length=165

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  54   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  93



>ref|XP_002300533.2| hypothetical protein POPTR_0001s45820g [Populus trichocarpa]
 gb|EEE85338.2| hypothetical protein POPTR_0001s45820g [Populus trichocarpa]
Length=193

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   TRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  104



>ref|XP_002300530.1| hypothetical protein POPTR_0001s45810g [Populus trichocarpa]
 gb|ABK92894.1| unknown [Populus trichocarpa]
 gb|ABK94074.1| unknown [Populus trichocarpa]
 gb|ABK95313.1| unknown [Populus trichocarpa]
 gb|ABK96007.1| unknown [Populus trichocarpa]
 gb|EEE85335.1| hypothetical protein POPTR_0001s45810g [Populus trichocarpa]
Length=193

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   TRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  104



>ref|XP_006476240.1| PREDICTED: 60S ribosomal protein L9-like [Citrus sinensis]
 gb|KDO76796.1| hypothetical protein CISIN_1g029415mg [Citrus sinensis]
Length=194

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVQNLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_004309503.1| PREDICTED: 60S ribosomal protein L9-1-like [Fragaria vesca subsp. 
vesca]
Length=195

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHVDNLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   TRKTSAAIRTALSHVDNLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_010034921.1| PREDICTED: 60S ribosomal protein L9 [Eucalyptus grandis]
Length=194

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   TRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_006439169.1| hypothetical protein CICLE_v10022376mg [Citrus clementina]
 gb|ESR52409.1| hypothetical protein CICLE_v10022376mg [Citrus clementina]
Length=194

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVQNLITGVTKGYRYKMRFVYAHFPIN  105



>emb|CDX96888.1| BnaC02g30260D [Brassica napus]
Length=194

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK++A+IRTALSHVDNLITGVT+G++YKMRFVYAHFPIN
Sbjct  66   SRKSSASIRTALSHVDNLITGVTRGFRYKMRFVYAHFPIN  105



>ref|NP_001236893.1| uncharacterized protein LOC100306058 [Glycine max]
 gb|ACU14050.1| unknown [Glycine max]
Length=192

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITG TKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVENLITGATKGYRYKMRFVYAHFPIN  104



>gb|KCW46126.1| hypothetical protein EUGRSUZ_K00048 [Eucalyptus grandis]
Length=249

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  124  TRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  163



>gb|KHG17022.1| 60S ribosomal protein L9 [Gossypium arboreum]
Length=194

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRT LSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTTLSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_006475562.1| PREDICTED: 60S ribosomal protein L9-1-like [Citrus sinensis]
 gb|KDO66557.1| hypothetical protein CISIN_1g029362mg [Citrus sinensis]
Length=194

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_009123894.1| PREDICTED: 60S ribosomal protein L9-1-like [Brassica rapa]
 emb|CDY14882.1| BnaA02g22240D [Brassica napus]
Length=194

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK++A+IRTALSHVDNLITGVT+G++YKMRFVYAHFPIN
Sbjct  66   SRKSSASIRTALSHVDNLITGVTRGFRYKMRFVYAHFPIN  105



>ref|XP_010919070.1| PREDICTED: 60S ribosomal protein L9 [Elaeis guineensis]
Length=189

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTA+SHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  62   SRKTTAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPIN  101



>gb|KDP46295.1| hypothetical protein JCGZ_10135 [Jatropha curcas]
Length=194

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_006288547.1| hypothetical protein CARUB_v10001828mg [Capsella rubella]
 gb|EOA21445.1| hypothetical protein CARUB_v10001828mg [Capsella rubella]
Length=244

 Score = 80.5 bits (197),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+A+IRTALSHVDNLI+GVT+G++YKMRFVYAHFPIN
Sbjct  116  SRKTSASIRTALSHVDNLISGVTRGFRYKMRFVYAHFPIN  155



>gb|KCW46125.1| hypothetical protein EUGRSUZ_K00048 [Eucalyptus grandis]
Length=252

 Score = 80.5 bits (197),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  124  TRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  163



>ref|XP_006441976.1| hypothetical protein CICLE_v10022372mg [Citrus clementina]
 gb|ESR55216.1| hypothetical protein CICLE_v10022372mg [Citrus clementina]
 gb|KDO49762.1| hypothetical protein CISIN_1g029052mg [Citrus sinensis]
Length=194

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_004307921.1| PREDICTED: 60S ribosomal protein L9-1-like [Fragaria vesca subsp. 
vesca]
Length=194

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   TRKTSAAIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_010093262.1| 60S ribosomal protein L9 [Morus notabilis]
 gb|EXB53783.1| 60S ribosomal protein L9 [Morus notabilis]
Length=194

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLI+GVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVENLISGVTKGYRYKMRFVYAHFPIN  105



>gb|AIZ73104.1| ribosomal protein L9, partial [Duabanga grandiflora]
Length=165

 Score = 79.3 bits (194),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  54   SRKTSAAIRTALSHVENLIAGVTKGYRYKMRFVYAHFPIN  93



>ref|XP_002891031.1| 60S ribosomal protein L9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67290.1| 60S ribosomal protein L9 [Arabidopsis lyrata subsp. lyrata]
Length=194

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+A+IRTALSHVDNLI+GVT+G++YKMRFVYAHFPIN
Sbjct  66   SRKTSASIRTALSHVDNLISGVTRGFRYKMRFVYAHFPIN  105



>gb|KDP36139.1| hypothetical protein JCGZ_08783 [Jatropha curcas]
Length=194

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+A+IRTALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSASIRTALSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_004502780.1| PREDICTED: 60S ribosomal protein L9-like [Cicer arietinum]
Length=192

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+A+IRTALSHV+NLITGVTKG++YKMRFVYAHFPIN
Sbjct  65   SRKTSASIRTALSHVENLITGVTKGFRYKMRFVYAHFPIN  104



>emb|CDY32946.1| BnaA09g16470D [Brassica napus]
Length=194

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK++A+IRTALSHVDNLITGVT+G++YKMRFVYAHFPIN
Sbjct  66   SRKSSASIRTALSHVDNLITGVTRGFRYKMRFVYAHFPIN  105



>ref|XP_010499858.1| PREDICTED: 60S ribosomal protein L9-1 [Camelina sativa]
 ref|XP_010421581.1| PREDICTED: 60S ribosomal protein L9-1 [Camelina sativa]
 ref|XP_010455091.1| PREDICTED: 60S ribosomal protein L9-1 [Camelina sativa]
 ref|XP_010461134.1| PREDICTED: 60S ribosomal protein L9-1 [Camelina sativa]
 ref|XP_010478719.1| PREDICTED: 60S ribosomal protein L9-1 [Camelina sativa]
 ref|XP_010493980.1| PREDICTED: 60S ribosomal protein L9-1 [Camelina sativa]
Length=194

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+A+IRTALSHVDNLI+GVT+G++YKMRFVYAHFPIN
Sbjct  66   SRKTSASIRTALSHVDNLISGVTRGFRYKMRFVYAHFPIN  105



>gb|ABU90976.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90977.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90978.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90979.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90980.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90981.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90982.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90983.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90984.1| ribosomal protein L9 [Sonneratia caseolaris]
 gb|ABU90985.1| ribosomal protein L9 [Sonneratia caseolaris]
Length=185

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+Y+MRFVYAHFPIN
Sbjct  63   SRKTSAAIRTALSHVGNLITGVTKGYRYRMRFVYAHFPIN  102



>gb|EPS64502.1| hypothetical protein M569_10279, partial [Genlisea aurea]
Length=126

 Score = 78.6 bits (192),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTALSHV NLI GVTKG++YKMRFVYAHFPIN
Sbjct  66   SRKTTAAIRTALSHVSNLIKGVTKGFRYKMRFVYAHFPIN  105



>ref|XP_011038050.1| PREDICTED: 60S ribosomal protein L9-like [Populus euphratica]
Length=193

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHV+NLITGVT+GY+YKMRFVYAHFPIN
Sbjct  65   TRKTSAAIRTALSHVENLITGVTRGYRYKMRFVYAHFPIN  104



>ref|XP_009123738.1| PREDICTED: 60S ribosomal protein L9-1 [Brassica rapa]
 emb|CDX93796.1| BnaA09g23960D [Brassica napus]
 emb|CDX87811.1| BnaC06g08730D [Brassica napus]
Length=194

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK++A+IRTALSHVDNLITGVT+G++YKMRFVYAHFPIN
Sbjct  66   SRKSSASIRTALSHVDNLITGVTRGFRYKMRFVYAHFPIN  105



>ref|XP_011038051.1| PREDICTED: 60S ribosomal protein L9 [Populus euphratica]
Length=193

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHV+NLITGVT+GY+YKMRFVYAHFPIN
Sbjct  65   TRKTSAAIRTALSHVENLITGVTRGYRYKMRFVYAHFPIN  104



>ref|XP_008783757.1| PREDICTED: 60S ribosomal protein L9, partial [Phoenix dactylifera]
Length=173

 Score = 79.3 bits (194),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTA+SHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  46   SRKTTAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPIN  85



>ref|XP_011038049.1| PREDICTED: 60S ribosomal protein L9-like [Populus euphratica]
Length=193

 Score = 79.3 bits (194),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHV+NLITGVT+GY+YKMRFVYAHFPIN
Sbjct  65   TRKTSAAIRTALSHVENLITGVTRGYRYKMRFVYAHFPIN  104



>gb|ACJ86147.1| unknown [Medicago truncatula]
Length=193

 Score = 79.3 bits (194),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKG++YKMRFVY HFPIN
Sbjct  65   SRKTSAAIRTALSHVENLITGVTKGFRYKMRFVYTHFPIN  104



>ref|XP_011075872.1| PREDICTED: 60S ribosomal protein L9-1-like [Sesamum indicum]
Length=194

 Score = 79.3 bits (194),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTALSHV NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTTAAIRTALSHVSNLINGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_006451280.1| hypothetical protein CICLE_v10009377mg [Citrus clementina]
 gb|ESR64520.1| hypothetical protein CICLE_v10009377mg [Citrus clementina]
Length=166

 Score = 79.0 bits (193),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  102  SRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  141



>gb|KHG29021.1| 60S ribosomal L9-1 -like protein [Gossypium arboreum]
Length=194

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSH++NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   TRKTSAAIRTALSHIENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_006415122.1| hypothetical protein EUTSA_v10008838mg [Eutrema salsugineum]
 gb|ESQ33475.1| hypothetical protein EUTSA_v10008838mg [Eutrema salsugineum]
Length=194

 Score = 79.0 bits (193),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK++A+IRTALSHVDNLI+GVT+G++YKMRFVYAHFPIN
Sbjct  66   SRKSSASIRTALSHVDNLISGVTRGFRYKMRFVYAHFPIN  105



>gb|AAG51293.1|AC027035_16 ribosomal protein L9, 5' partial [Arabidopsis thaliana]
Length=149

 Score = 78.2 bits (191),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+A+IRTALSHVDNLI+GVT+G++YKMRFVYAHFPIN
Sbjct  34   TRKTSASIRTALSHVDNLISGVTRGFRYKMRFVYAHFPIN  73



>gb|KHG17021.1| 60S ribosomal protein L9 [Gossypium arboreum]
Length=214

 Score = 79.3 bits (194),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRT LSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTTLSHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_008381567.1| PREDICTED: 60S ribosomal protein L9-like [Malus domestica]
 ref|XP_009351896.1| PREDICTED: 60S ribosomal protein L9-like [Pyrus x bretschneideri]
Length=194

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   TRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_001765770.1| predicted protein [Physcomitrella patens]
 gb|EDQ69361.1| predicted protein [Physcomitrella patens]
Length=189

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT AAIRTA+SHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  62   NRKTMAAIRTAMSHVNNLITGVTKGYRYKMRFVYAHFPIN  101



>gb|ABK22722.1| unknown [Picea sitchensis]
 gb|ABK23381.1| unknown [Picea sitchensis]
 gb|ABK26107.1| unknown [Picea sitchensis]
 gb|ABR17638.1| unknown [Picea sitchensis]
 gb|ABR17695.1| unknown [Picea sitchensis]
 gb|ACN40448.1| unknown [Picea sitchensis]
 gb|ACN40821.1| unknown [Picea sitchensis]
Length=189

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT AAIRTA+SHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  62   SRKTMAAIRTAISHVTNLITGVTKGYRYKMRFVYAHFPIN  101



>ref|XP_011077247.1| PREDICTED: 60S ribosomal protein L9-like [Sesamum indicum]
Length=194

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 37/40 (93%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTALSHV NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTTAAIRTALSHVTNLINGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_001762945.1| predicted protein [Physcomitrella patens]
 gb|EDQ72150.1| predicted protein [Physcomitrella patens]
Length=189

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT AAIRTA+SHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  62   NRKTMAAIRTAMSHVNNLITGVTKGYRYKMRFVYAHFPIN  101



>ref|XP_004490523.1| PREDICTED: 60S ribosomal protein L9-like [Cicer arietinum]
Length=192

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLI GVTKG++YKMRFVYAHFPIN
Sbjct  65   SRKTSAAIRTALSHVENLIAGVTKGFRYKMRFVYAHFPIN  104



>gb|ABK26079.1| unknown [Picea sitchensis]
Length=189

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT AAIRTA+SHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  62   SRKTMAAIRTAISHVTNLITGVTKGYRYKMRFVYAHFPIN  101



>ref|XP_008376845.1| PREDICTED: 60S ribosomal protein L9 [Malus domestica]
 ref|XP_009361253.1| PREDICTED: 60S ribosomal protein L9 [Pyrus x bretschneideri]
Length=194

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   TRKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  105



>ref|NP_564417.1| 60S ribosomal protein L9-1 [Arabidopsis thaliana]
 ref|NP_564418.1| 60S ribosomal protein L9-1 [Arabidopsis thaliana]
 sp|P49209.3|RL91_ARATH RecName: Full=60S ribosomal protein L9-1 [Arabidopsis thaliana]
 gb|AAF97345.1|AC021045_2 Putative 60S ribosomal protein L9 [Arabidopsis thaliana]
 gb|AAF97348.1|AC021045_5 Putative 60S ribosomal protein L9 [Arabidopsis thaliana]
 gb|AAG40039.1|AF324688_1 At1g33120 [Arabidopsis thaliana]
 gb|AAG41455.1|AF326873_1 putative ribosomal protein L9 [Arabidopsis thaliana]
 gb|AAK00376.1|AF339694_1 putative ribosomal protein L9 [Arabidopsis thaliana]
 gb|AAK53003.1|AF375419_1 At1g33140/T9L6_10 [Arabidopsis thaliana]
 gb|AAK62648.1| At1g33140/T9L6_10 [Arabidopsis thaliana]
 gb|AAL06817.1| At1g33140/T9L6_10 [Arabidopsis thaliana]
 gb|AAL24159.1| At1g33140/T9L6_10 [Arabidopsis thaliana]
 gb|AAL62438.1| ribosomal protein L9, putative [Arabidopsis thaliana]
 gb|AAM91310.1| ribosomal protein L9, putative [Arabidopsis thaliana]
 gb|AEE31568.1| 60S ribosomal protein L9-1 [Arabidopsis thaliana]
 gb|AEE31569.1| 60S ribosomal protein L9-1 [Arabidopsis thaliana]
Length=194

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+A+IRTALSHVDNLI+GVT+G++YKMRFVYAHFPIN
Sbjct  66   TRKTSASIRTALSHVDNLISGVTRGFRYKMRFVYAHFPIN  105



>gb|AAM63736.1| ribosomal protein L9, putative [Arabidopsis thaliana]
Length=194

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+A+IRTALSHVDNLI+GVT+G++YKMRFVYAHFPIN
Sbjct  66   TRKTSASIRTALSHVDNLISGVTRGFRYKMRFVYAHFPIN  105



>ref|NP_001274829.1| 60S ribosomal protein L9-1-like [Solanum tuberosum]
 gb|ABB29957.1| unknown [Solanum tuberosum]
Length=194

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK TA+IRTALSHV+NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKATASIRTALSHVNNLIVGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_006846481.1| hypothetical protein AMTR_s00018p00131950 [Amborella trichopoda]
 gb|ERN08156.1| hypothetical protein AMTR_s00018p00131950 [Amborella trichopoda]
Length=190

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT AAIRTA+SHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  62   SRKTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPIN  101



>ref|XP_007209629.1| hypothetical protein PRUPE_ppa011819mg [Prunus persica]
 ref|XP_008239279.1| PREDICTED: 60S ribosomal protein L9-like [Prunus mume]
 gb|EMJ10828.1| hypothetical protein PRUPE_ppa011819mg [Prunus persica]
Length=194

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTA+SHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  66   TRKTSAAIRTAISHVENLITGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_006478505.1| PREDICTED: 60S ribosomal protein L9-1-like [Citrus sinensis]
 ref|XP_006494839.1| PREDICTED: 60S ribosomal protein L9-1-like [Citrus sinensis]
Length=194

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKTSAAIRTALSHVGNLINGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_004241407.1| PREDICTED: 60S ribosomal protein L9-1-like [Solanum lycopersicum]
Length=194

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK TA+IRTALSHV+NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  66   SRKATASIRTALSHVNNLIVGVTKGYRYKMRFVYAHFPIN  105



>ref|XP_010941184.1| PREDICTED: 60S ribosomal protein L9-like [Elaeis guineensis]
Length=189

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTA+SHV NLITGVTKG++YKMRFVYAHFPIN
Sbjct  62   SRKTTAAIRTAISHVQNLITGVTKGFRYKMRFVYAHFPIN  101



>emb|CAA65987.2| ribosomal protein L9 [Pisum sativum]
Length=195

 Score = 78.2 bits (191),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKG++YKMRFVYA FPIN
Sbjct  65   SRKTSAAIRTALSHVENLITGVTKGFRYKMRFVYADFPIN  104



>gb|AHZ31410.1| ribosomal protein L9, partial [Sonneratia caseolaris]
Length=165

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            S KT+AAIRTALSHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  54   SPKTSAAIRTALSHVGNLITGVTKGYRYKMRFVYAHFPIN  93



>ref|XP_008788719.1| PREDICTED: 60S ribosomal protein L9-like [Phoenix dactylifera]
Length=189

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT AAIRTA+SHV NLITGVTKG++YKMRFVYAHFPIN
Sbjct  62   SRKTMAAIRTAISHVQNLITGVTKGFRYKMRFVYAHFPIN  101



>sp|P30707.1|RL9_PEA RecName: Full=60S ribosomal protein L9; AltName: Full=Gibberellin-regulated 
protein GA [Pisum sativum]
 emb|CAA46273.1| GA [Pisum sativum]
Length=193

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AAIRTALSHV+NLITGVTKG++YKMRFVYA FPIN
Sbjct  65   SRKTSAAIRTALSHVENLITGVTKGFRYKMRFVYADFPIN  104



>ref|XP_006854038.1| hypothetical protein AMTR_s00048p00062300 [Amborella trichopoda]
 gb|ERN15505.1| hypothetical protein AMTR_s00048p00062300 [Amborella trichopoda]
Length=190

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT AAIRTA+SHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  62   SRKTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPIN  101



>ref|XP_008784621.1| PREDICTED: 60S ribosomal protein L9-like [Phoenix dactylifera]
Length=188

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTA+IRTA+SHV NLITGVTKG++YKMRFVYAHFPIN
Sbjct  62   SRKTTASIRTAISHVQNLITGVTKGFRYKMRFVYAHFPIN  101



>ref|XP_001782330.1| predicted protein [Physcomitrella patens]
 gb|EDQ52850.1| predicted protein [Physcomitrella patens]
Length=189

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT AAIRTA+SH++NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRKTMAAIRTAISHINNLITGVTKGYRYKMRFVYAHFPIN  101



>ref|XP_001773604.1| predicted protein [Physcomitrella patens]
 gb|EDQ61642.1| predicted protein [Physcomitrella patens]
Length=189

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT AAIRTA+SH++NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRKTMAAIRTAISHINNLITGVTKGYRYKMRFVYAHFPIN  101



>ref|XP_010934895.1| PREDICTED: 60S ribosomal protein L9-like [Elaeis guineensis]
 ref|XP_010934896.1| PREDICTED: 60S ribosomal protein L9-like [Elaeis guineensis]
 ref|XP_010934897.1| PREDICTED: 60S ribosomal protein L9-like [Elaeis guineensis]
 ref|XP_010934898.1| PREDICTED: 60S ribosomal protein L9-like [Elaeis guineensis]
 ref|XP_010934899.1| PREDICTED: 60S ribosomal protein L9-like [Elaeis guineensis]
Length=189

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRT++SHV NLITGVTKG++YKMRFVYAHFPIN
Sbjct  62   SRKTTAAIRTSISHVQNLITGVTKGFRYKMRFVYAHFPIN  101



>gb|EYU45335.1| hypothetical protein MIMGU_mgv1a014281mg [Erythranthe guttata]
 gb|EYU45336.1| hypothetical protein MIMGU_mgv1a014281mg [Erythranthe guttata]
 gb|EYU45337.1| hypothetical protein MIMGU_mgv1a014281mg [Erythranthe guttata]
Length=194

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTA+IRTALSHV NLI GVT+GY+YKMRFVYAHFPIN
Sbjct  66   SRKTTASIRTALSHVSNLIKGVTQGYRYKMRFVYAHFPIN  105



>ref|XP_002985482.1| hypothetical protein SELMODRAFT_269009 [Selaginella moellendorffii]
 ref|XP_002987089.1| hypothetical protein SELMODRAFT_158459 [Selaginella moellendorffii]
 gb|EFJ11932.1| hypothetical protein SELMODRAFT_158459 [Selaginella moellendorffii]
 gb|EFJ13356.1| hypothetical protein SELMODRAFT_269009 [Selaginella moellendorffii]
Length=190

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT AAIRTA+SHV NLITGVTKG+QYKMRFVYAHFPIN
Sbjct  62   SRKTIAAIRTAVSHVKNLITGVTKGFQYKMRFVYAHFPIN  101



>gb|KFK30864.1| hypothetical protein AALP_AA6G035700 [Arabis alpina]
Length=194

 Score = 77.0 bits (188),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+A+IRTALSHVDNLI+GVT+G++YKMRFVYAHFPIN
Sbjct  66   TRKTSASIRTALSHVDNLISGVTRGFRYKMRFVYAHFPIN  105



>ref|XP_002874628.1| 60S ribosomal protein L9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50887.1| 60S ribosomal protein L9 [Arabidopsis lyrata subsp. lyrata]
Length=194

 Score = 77.0 bits (188),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+A+IRTALSHVDNLI GVT+G+ Y+MRFVYAHFPIN
Sbjct  66   SRKTSASIRTALSHVDNLIAGVTQGFLYRMRFVYAHFPIN  105



>emb|CDP08217.1| unnamed protein product [Coffea canephora]
Length=180

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RKTTAAIRTALS V+NLITGVTKGY YKMRFVYAHFPIN
Sbjct  58   RKTTAAIRTALSRVENLITGVTKGYCYKMRFVYAHFPIN  96



>ref|NP_192783.1| 60S ribosomal protein L9-2 [Arabidopsis thaliana]
 sp|Q9SZX9.1|RL92_ARATH RecName: Full=60S ribosomal protein L9-2 [Arabidopsis thaliana]
 emb|CAB40038.1| putative ribosomal protein L9, cytosolic [Arabidopsis thaliana]
 emb|CAB78168.1| putative ribosomal protein L9, cytosolic [Arabidopsis thaliana]
 gb|AAL38735.1| putative ribosomal protein L9 [Arabidopsis thaliana]
 gb|AAM51421.1| putative ribosomal protein L9 [Arabidopsis thaliana]
 gb|AAM63297.1| putative ribosomal protein L9, cytosolic [Arabidopsis thaliana]
 gb|AEE82884.1| 60S ribosomal protein L9-2 [Arabidopsis thaliana]
Length=194

 Score = 77.0 bits (188),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+A+IRTALSHVDNLI GVT+G+ Y+MRFVYAHFPIN
Sbjct  66   SRKTSASIRTALSHVDNLIAGVTQGFLYRMRFVYAHFPIN  105



>ref|XP_009384509.1| PREDICTED: 60S ribosomal protein L9-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score = 77.0 bits (188),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRT++SH+ NLITGVTKGY+YKMR VYAHFPIN
Sbjct  62   SRKTTAAIRTSISHIQNLITGVTKGYRYKMRLVYAHFPIN  101



>dbj|BAA19798.1| YK426 [Oryza sativa (japonica cultivar-group)]
Length=190

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPIN  101



>emb|CDM80141.1| unnamed protein product [Triticum aestivum]
Length=189

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT AAIRTA+SHV NLITGVTKG++YKMRFVYAHFPIN
Sbjct  62   TRKTMAAIRTAISHVQNLITGVTKGFRYKMRFVYAHFPIN  101



>ref|NP_001045607.1| Os02g0103700 [Oryza sativa Japonica Group]
 dbj|BAF07521.1| Os02g0103700 [Oryza sativa Japonica Group]
 dbj|BAG88343.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95431.1| unnamed protein product [Oryza sativa Japonica Group]
Length=192

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  64   TRRTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPIN  103



>ref|NP_001063520.1| Os09g0485900 [Oryza sativa Japonica Group]
 sp|P49210.3|RL9_ORYSJ RecName: Full=60S ribosomal protein L9 [Oryza sativa Japonica 
Group]
 pdb|3J61|H Chain H, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 gb|AAP92747.1| ribosomal L9-like protein [Oryza sativa Japonica Group]
 dbj|BAF25434.1| Os09g0485900 [Oryza sativa Japonica Group]
 gb|EAZ09554.1| hypothetical protein OsI_31831 [Oryza sativa Indica Group]
 gb|EAZ45175.1| hypothetical protein OsJ_29817 [Oryza sativa Japonica Group]
 gb|ABR26147.1| 60S ribosomal protein l9 [Oryza sativa Indica Group]
Length=190

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPIN  101



>ref|XP_011077248.1| PREDICTED: 60S ribosomal protein L9-like [Sesamum indicum]
Length=194

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 36/39 (92%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPI  4
            SRKTTAAIRTALSHV NLI GVTKGY+YKMRFVYAHFPI
Sbjct  66   SRKTTAAIRTALSHVTNLINGVTKGYRYKMRFVYAHFPI  104



>gb|EMS50458.1| 60S ribosomal protein L9 [Triticum urartu]
 emb|CDM80147.1| unnamed protein product [Triticum aestivum]
Length=189

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT AAIRTA+SHV NLITGVTKG++YKMRFVYAHFPIN
Sbjct  62   TRKTMAAIRTAISHVQNLITGVTKGFRYKMRFVYAHFPIN  101



>ref|XP_006660761.1| PREDICTED: 60S ribosomal protein L9-like [Oryza brachyantha]
 ref|XP_006660762.1| PREDICTED: 60S ribosomal protein L9-like [Oryza brachyantha]
Length=190

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPIN  101



>dbj|BAD07825.1| putative 60S ribosomal protein L9 [Oryza sativa Japonica Group]
 gb|EEC72297.1| hypothetical protein OsI_05474 [Oryza sativa Indica Group]
 gb|EEE56134.1| hypothetical protein OsJ_05010 [Oryza sativa Japonica Group]
Length=183

 Score = 76.6 bits (187),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  55   TRRTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPIN  94



>gb|EMT29055.1| 60S ribosomal protein L9 [Aegilops tauschii]
Length=189

 Score = 76.6 bits (187),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT AAIRTA+SHV NLITGVTKG++YKMRFVYAHFPIN
Sbjct  62   TRKTMAAIRTAISHVQNLITGVTKGFRYKMRFVYAHFPIN  101



>gb|EYU19706.1| hypothetical protein MIMGU_mgv1a014306mg [Erythranthe guttata]
Length=194

 Score = 76.6 bits (187),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTA+IRTALSHV NLI GVT+GY+YKMRFVYAHFPIN
Sbjct  66   SRKTTASIRTALSHVSNLIKGVTQGYRYKMRFVYAHFPIN  105



>ref|XP_009401730.1| PREDICTED: 60S ribosomal protein L9 [Musa acuminata subsp. malaccensis]
Length=190

 Score = 76.6 bits (187),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRT++SHV NLI+GVTKGY+YKMR VYAHFPIN
Sbjct  62   SRKTTAAIRTSISHVQNLISGVTKGYRYKMRLVYAHFPIN  101



>ref|XP_004964297.1| PREDICTED: 60S ribosomal protein L9-like [Setaria italica]
Length=190

 Score = 76.6 bits (187),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPIN  101



>ref|XP_009421455.1| PREDICTED: 60S ribosomal protein L9-like [Musa acuminata subsp. 
malaccensis]
Length=189

 Score = 76.3 bits (186),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTAAIRTA+SHV NLI GVTKGY+YKMR VYAHFPIN
Sbjct  62   SRKTTAAIRTAISHVQNLIAGVTKGYRYKMRLVYAHFPIN  101



>ref|XP_010671296.1| PREDICTED: 60S ribosomal protein L9-like [Beta vulgaris subsp. 
vulgaris]
Length=193

 Score = 76.3 bits (186),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+AAIRTA+SH++NLITGVTKGY+YKMR VYAHFPIN
Sbjct  65   TRKTSAAIRTAISHIENLITGVTKGYRYKMRMVYAHFPIN  104



>emb|CDY43615.1| BnaC09g17540D [Brassica napus]
Length=168

 Score = 75.9 bits (185),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK++A+ RTALSHVDNLITGVT+G++YKMRFVYAHFPIN
Sbjct  40   SRKSSASNRTALSHVDNLITGVTRGFRYKMRFVYAHFPIN  79



>gb|EMT28647.1| 60S ribosomal protein L9 [Aegilops tauschii]
Length=212

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT AAIRTA+SHV NLITGVTKG++YKMRFVYAHFPIN
Sbjct  62   TRKTMAAIRTAISHVQNLITGVTKGFRYKMRFVYAHFPIN  101



>emb|CAA63024.1| 60S ribosomal protein L9 [Arabidopsis thaliana]
Length=195

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+ +IRTAL HVDNLI+GVT+G++YKMRFVYAHFPIN
Sbjct  66   TRKTSVSIRTALRHVDNLISGVTRGFRYKMRFVYAHFPIN  105



>gb|KFK31839.1| hypothetical protein AALP_AA6G165100 [Arabis alpina]
Length=194

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RKT+A+IRTALSHVDNLI GVT+G+ YKMRFVYAHFPIN
Sbjct  66   TRKTSASIRTALSHVDNLIAGVTQGFLYKMRFVYAHFPIN  105



>ref|XP_003562717.1| PREDICTED: 60S ribosomal protein L9 [Brachypodium distachyon]
Length=189

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLITGVTKG++YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLITGVTKGFRYKMRFVYAHFPIN  101



>ref|XP_003557264.1| PREDICTED: 60S ribosomal protein L9-like [Brachypodium distachyon]
 ref|XP_010233658.1| PREDICTED: 60S ribosomal protein L9-like [Brachypodium distachyon]
Length=189

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLITGVTKG++YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLITGVTKGFRYKMRFVYAHFPIN  101



>gb|EYU19709.1| hypothetical protein MIMGU_mgv11b023029mg, partial [Erythranthe 
guttata]
Length=112

 Score = 73.9 bits (180),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTA+IRTALSHV NLI GVTKGY+YKM FVY HFPIN
Sbjct  54   SRKTTASIRTALSHVSNLINGVTKGYRYKMHFVYDHFPIN  93



>gb|ABR25779.1| 60S ribosomal protein l9 [Oryza sativa Indica Group]
Length=77

 Score = 73.2 bits (178),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SH  NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  9    TRRTMAAIRTAISHGQNLITGVTKGYRYKMRFVYAHFPIN  48



>ref|XP_010934051.1| PREDICTED: 60S ribosomal protein L9-like [Elaeis guineensis]
Length=189

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFP  7
            SRKTTA+IRTA+SHV NLITGVTKGY+YKMRFVYAHFP
Sbjct  62   SRKTTASIRTAISHVQNLITGVTKGYRYKMRFVYAHFP  99



>gb|ACR38505.1| unknown [Zea mays]
 gb|AFW86203.1| 60S ribosomal protein L9, mRNA [Zea mays]
Length=190

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLIKGVTKGYRYKMRFVYAHFPIN  101



>ref|NP_001147384.1| 60S ribosomal protein L9 [Zea mays]
 gb|ACG27229.1| 60S ribosomal protein L9 [Zea mays]
Length=190

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLIKGVTKGYRYKMRFVYAHFPIN  101



>gb|ACG33227.1| 60S ribosomal protein L9 [Zea mays]
Length=190

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLIKGVTKGYRYKMRFVYAHFPIN  101



>gb|ACG24522.1| 60S ribosomal protein L9 [Zea mays]
 gb|ACG33902.1| 60S ribosomal protein L9 [Zea mays]
 gb|AFW75226.1| 60S ribosomal protein L9 [Zea mays]
Length=190

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLIKGVTKGYRYKMRFVYAHFPIN  101



>dbj|BAJ96848.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=190

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK  AAIRT LSH+ N+ITGVTKGY+YKMR VYAHFPIN
Sbjct  63   SRKQVAAIRTVLSHIKNMITGVTKGYEYKMRLVYAHFPIN  102



>ref|XP_002437682.1| hypothetical protein SORBIDRAFT_10g000700 [Sorghum bicolor]
 gb|EER89049.1| hypothetical protein SORBIDRAFT_10g000700 [Sorghum bicolor]
Length=190

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLIKGVTKGYRYKMRFVYAHFPIN  101



>gb|AFW86204.1| hypothetical protein ZEAMMB73_740240 [Zea mays]
Length=181

 Score = 74.7 bits (182),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLIKGVTKGYRYKMRFVYAHFPIN  101



>gb|AFW75225.1| hypothetical protein ZEAMMB73_023047 [Zea mays]
Length=171

 Score = 74.3 bits (181),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLIKGVTKGYRYKMRFVYAHFPIN  101



>gb|AFW86205.1| hypothetical protein ZEAMMB73_740240 [Zea mays]
Length=144

 Score = 73.9 bits (180),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLIKGVTKGYRYKMRFVYAHFPIN  101



>ref|NP_001150671.1| LOC100284304 [Zea mays]
 gb|ACG39956.1| 60S ribosomal protein L9 [Zea mays]
Length=190

 Score = 73.9 bits (180),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLIKGVTKGYRYKMRFVYAHFPIN  101



>ref|XP_006397064.1| hypothetical protein EUTSA_v10028984mg [Eutrema salsugineum]
 gb|ESQ38517.1| hypothetical protein EUTSA_v10028984mg [Eutrema salsugineum]
Length=194

 Score = 73.6 bits (179),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK +A+IRTALSHV+NLI GVT+G+ YKMRFVYAHFPIN
Sbjct  66   SRKASASIRTALSHVNNLIAGVTQGFLYKMRFVYAHFPIN  105



>ref|NP_001149698.1| LOC100283325 [Zea mays]
 gb|ACG36425.1| 60S ribosomal protein L9 [Zea mays]
 gb|ACN25565.1| unknown [Zea mays]
 gb|ACN30998.1| unknown [Zea mays]
 gb|AFW66831.1| 60S ribosomal protein L9 [Zea mays]
Length=190

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLI GVTKG++YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLIAGVTKGFRYKMRFVYAHFPIN  101



>ref|XP_004954554.1| PREDICTED: WAT1-related protein At3g30340-like [Setaria italica]
Length=613

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPIN  101



>emb|CDX94253.1| BnaC02g29130D [Brassica napus]
Length=194

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK +A+IRTALSHV NLI GVT+G+ YKMRFVYAHFPIN
Sbjct  66   SRKASASIRTALSHVSNLIAGVTQGFLYKMRFVYAHFPIN  105



>ref|XP_009128711.1| PREDICTED: 60S ribosomal protein L9-2 [Brassica rapa]
 emb|CDY25258.1| BnaA02g21980D [Brassica napus]
Length=194

 Score = 72.4 bits (176),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK +A+IRTALSHV NLI GVT+G+ YKMRFVYAHFPIN
Sbjct  66   SRKASASIRTALSHVSNLIAGVTQGFLYKMRFVYAHFPIN  105



>gb|EYU19707.1| hypothetical protein MIMGU_mgv1a023700mg, partial [Erythranthe 
guttata]
Length=109

 Score = 70.9 bits (172),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKTTA+I TALSHV NLI GVTKG++YK+RFVY HFPIN
Sbjct  42   SRKTTASIHTALSHVSNLINGVTKGHRYKLRFVYVHFPIN  81



>emb|CDX99541.1| BnaC09g24510D [Brassica napus]
 emb|CDX86863.1| BnaA09g22530D [Brassica napus]
Length=195

 Score = 72.0 bits (175),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK +A+IRTALSHV NLI GVT+G+ YKMRFVYAHFPIN
Sbjct  66   SRKASASIRTALSHVSNLIAGVTQGFLYKMRFVYAHFPIN  105



>ref|XP_009113614.1| PREDICTED: 60S ribosomal protein L9-2-like [Brassica rapa]
Length=194

 Score = 72.0 bits (175),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRK +A+IRTALSHV NLI GVT+G+ YKMRFVYAHFPIN
Sbjct  66   SRKASASIRTALSHVSNLIAGVTQGFLYKMRFVYAHFPIN  105



>gb|ACG40143.1| 60S ribosomal protein L9 [Zea mays]
Length=190

 Score = 72.0 bits (175),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIR A+SHV NLI GVTKGY+YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRIAISHVQNLIKGVTKGYRYKMRFVYAHFPIN  101



>gb|EMT15478.1| 60S ribosomal protein L9 [Aegilops tauschii]
Length=132

 Score = 70.1 bits (170),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T A IRTA+SHV NLITG+TKG+ YKMRFVYAHFPIN
Sbjct  48   TRRTMAVIRTAISHVRNLITGLTKGFCYKMRFVYAHFPIN  87



>gb|AFW66830.1| nodulin protein [Zea mays]
Length=620

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R+T AAIRTA+SHV NLI GVTKG++YKMRFVYAHFPIN
Sbjct  62   TRRTMAAIRTAISHVQNLIAGVTKGFRYKMRFVYAHFPIN  101



>gb|KFM26327.1| 60S ribosomal protein L9 [Auxenochlorella protothecoides]
Length=192

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK+ A+IRT +SHV NLITGVTKG++YKMR VYAHFPIN
Sbjct  65   RKSLASIRTCISHVQNLITGVTKGFEYKMRLVYAHFPIN  103



>gb|KHN02144.1| 60S ribosomal protein L9 [Glycine soja]
 gb|KHN19580.1| 60S ribosomal protein L9 [Glycine soja]
Length=188

 Score = 69.3 bits (168),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 4/40 (10%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            SRKT+AA    LSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  65   SRKTSAA----LSHVENLITGVTKGYRYKMRFVYAHFPIN  100



>ref|XP_002453127.1| hypothetical protein SORBIDRAFT_04g000460 [Sorghum bicolor]
 gb|EES06103.1| hypothetical protein SORBIDRAFT_04g000460 [Sorghum bicolor]
Length=125

 Score = 67.8 bits (164),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -2

Query  105  AAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            AAIRTA+SHV NLIT VTKG++YKMRFVYAHFPIN
Sbjct  2    AAIRTAISHVQNLITTVTKGFRYKMRFVYAHFPIN  36



>gb|ACV32429.1| large subunit ribosomal protein 9 [Pseudodiplogasteroides sp. 
SB257]
Length=181

 Score = 68.2 bits (165),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  +AIRT  SH+DNLI GVTKGY+YKMR VYAHFPIN
Sbjct  55   NRKEISAIRTVCSHIDNLIKGVTKGYRYKMRSVYAHFPIN  94



>ref|XP_004180949.1| hypothetical protein TBLA_0E03760 [Tetrapisispora blattae CBS 
6284]
 emb|CCH61430.1| hypothetical protein TBLA_0E03760 [Tetrapisispora blattae CBS 
6284]
Length=191

 Score = 68.2 bits (165),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S VDNLITGVTKGY+YKMR+VYAHFPIN
Sbjct  61   DRKHVAALRTVKSLVDNLITGVTKGYKYKMRYVYAHFPIN  100



>ref|XP_004179288.1| hypothetical protein TBLA_0B09520 [Tetrapisispora blattae CBS 
6284]
 emb|CCH59769.1| hypothetical protein TBLA_0B09520 [Tetrapisispora blattae CBS 
6284]
Length=191

 Score = 68.2 bits (165),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S VDNLITGVTKGY+YKMR+VYAHFPIN
Sbjct  61   DRKHVAALRTVKSLVDNLITGVTKGYKYKMRYVYAHFPIN  100



>ref|XP_005849740.1| hypothetical protein CHLNCDRAFT_59621 [Chlorella variabilis]
 gb|EFN57638.1| hypothetical protein CHLNCDRAFT_59621 [Chlorella variabilis]
Length=193

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK  A+IRT  SHV N+ITGVTKG++YKMR VYAHFPIN
Sbjct  65   RKALASIRTCTSHVQNMITGVTKGFEYKMRLVYAHFPIN  103



>ref|XP_002497546.1| 60S ribosomal protein L9 [Zygosaccharomyces rouxii]
 emb|CAR28613.1| ZYRO0F08030p [Zygosaccharomyces rouxii]
Length=190

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S VDNLITGVTKGY+YKMR+VYAHFPIN
Sbjct  61   DRKHVAALRTVKSLVDNLITGVTKGYRYKMRYVYAHFPIN  100



>gb|AHZ34825.1| large subunit ribosomal protein 9, partial [Micoletzkya hylurginophila]
Length=175

 Score = 67.4 bits (163),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  AAIRT  SHV+NLI GVTKGY+YKMR VYAHFPIN
Sbjct  54   NRKEIAAIRTIASHVENLIKGVTKGYRYKMRSVYAHFPIN  93



>gb|EGA78803.1| Rpl9ap [Saccharomyces cerevisiae Vin13]
Length=119

 Score = 66.6 bits (161),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S VDN+ITGVTKGY+YKMR+VYAHFPIN
Sbjct  61   DRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPIN  100



>gb|KHN01732.1| 60S ribosomal protein L9 [Glycine soja]
Length=107

 Score = 66.2 bits (160),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            S+KT +   T LSH++NLITG+TKGY+YKMRFVYAHFPIN
Sbjct  39   SQKTFSTTHTLLSHIENLITGLTKGYRYKMRFVYAHFPIN  78



>ref|XP_974780.1| PREDICTED: 60S ribosomal protein L9 isoform X2 [Tribolium castaneum]
 ref|XP_008192135.1| PREDICTED: 60S ribosomal protein L9 isoform X2 [Tribolium castaneum]
 gb|EFA01805.1| hypothetical protein TcasGA2_TC007406 [Tribolium castaneum]
Length=189

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            ++K  AA+RT  SHV+N++ GVTKGYQYKMR VYAHFPIN
Sbjct  61   TKKELAAVRTVCSHVENMLKGVTKGYQYKMRAVYAHFPIN  100



>gb|KHN72221.1| 60S ribosomal protein L9 [Toxocara canis]
Length=188

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK  AAIRT  SH++N+I GVTKGY+YKMR VYAHFPIN
Sbjct  62   RKEIAAIRTVCSHIENMIKGVTKGYRYKMRSVYAHFPIN  100



>gb|AHZ34827.1| large subunit ribosomal protein 9, partial [Micoletzkya inedia]
Length=175

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  AAIRT  SH++NLI GVTKGY+YKMR VYAHFPIN
Sbjct  54   NRKEIAAIRTIASHIENLIKGVTKGYRYKMRSVYAHFPIN  93



>gb|ERG87740.1| 60s ribosomal protein l9 [Ascaris suum]
Length=188

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK  AAIRT  SH++N+I GVTKGY+YKMR VYAHFPIN
Sbjct  62   RKEIAAIRTVCSHIENMIKGVTKGYRYKMRSVYAHFPIN  100



>gb|EGA82943.1| Rpl9ap [Saccharomyces cerevisiae Lalvin QA23]
Length=191

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S VDN+ITGVTKGY+YKMR+VYAHFPIN
Sbjct  61   DRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPIN  100



>gb|ACV32432.1| large subunit ribosomal protein 9 [Koerneria sudhausi]
Length=182

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            ++K  AAIRT  SH++NLI GVTKGY+YKMR VYAHFPIN
Sbjct  55   TKKEQAAIRTVCSHIENLIKGVTKGYRYKMRSVYAHFPIN  94



>gb|EDN61974.1| ribosomal protein L9A [Saccharomyces cerevisiae YJM789]
 gb|EDZ72258.1| YGL147Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gb|EEU07211.1| Rpl9ap [Saccharomyces cerevisiae JAY291]
 emb|CAY79619.1| Rpl9ap [Saccharomyces cerevisiae EC1118]
 gb|EGA58736.1| Rpl9ap [Saccharomyces cerevisiae FostersB]
 gb|EGA62381.1| Rpl9ap [Saccharomyces cerevisiae FostersO]
 gb|EGA75033.1| Rpl9ap [Saccharomyces cerevisiae AWRI796]
 gb|EGA86902.1| Rpl9ap [Saccharomyces cerevisiae VL3]
 dbj|GAA23249.1| K7_Rpl9ap [Saccharomyces cerevisiae Kyokai no. 7]
 gb|EHN07301.1| Rpl9ap [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EWG86242.1| Rpl9ap [Saccharomyces cerevisiae R008]
 gb|EWG95976.1| Rpl9ap [Saccharomyces cerevisiae R103]
 gb|EWH18590.1| Rpl9ap [Saccharomyces cerevisiae P283]
 gb|AHY79238.1| Rpl9ap [Saccharomyces cerevisiae YJM993]
Length=191

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S VDN+ITGVTKGY+YKMR+VYAHFPIN
Sbjct  61   DRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPIN  100



>ref|NP_014332.1| ribosomal 60S subunit protein L9B [Saccharomyces cerevisiae S288c]
 sp|P51401.1|RL9B_YEAST RecName: Full=60S ribosomal protein L9-B; AltName: Full=L8; AltName: 
Full=RP24; AltName: Full=YL11 [Saccharomyces cerevisiae 
S288c]
 emb|CAA60195.1| putative second copy of ribosomal protein gene YL9A, SWISS_PROT:RL9_YEAST 
[Saccharomyces cerevisiae]
 gb|AAA99644.1| ribosomal protein YL9 [Saccharomyces cerevisiae]
 emb|CAA95940.1| RPL9B [Saccharomyces cerevisiae]
 gb|AAT93148.1| YNL067W [Saccharomyces cerevisiae]
 gb|EDN62745.1| ribosomal protein L9B [Saccharomyces cerevisiae YJM789]
 gb|EDV12320.1| ribosomal protein L9B [Saccharomyces cerevisiae RM11-1a]
 gb|EDZ69669.1| YNL067Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gb|EEU08220.1| Rpl9bp [Saccharomyces cerevisiae JAY291]
 emb|CAY82536.1| Rpl9bp [Saccharomyces cerevisiae EC1118]
 tpg|DAA10479.1| TPA: ribosomal 60S subunit protein L9B [Saccharomyces cerevisiae 
S288c]
 gb|EGA57045.1| Rpl9bp [Saccharomyces cerevisiae FostersB]
 gb|EGA73383.1| Rpl9bp [Saccharomyces cerevisiae AWRI796]
 gb|EGA85078.1| Rpl9bp [Saccharomyces cerevisiae VL3]
 dbj|GAA26029.1| K7_Rpl9bp [Saccharomyces cerevisiae Kyokai no. 7]
 gb|EIW08025.1| Rpl9bp [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|EWG83776.1| Rpl9bp [Saccharomyces cerevisiae R008]
 gb|EWG89162.1| Rpl9bp [Saccharomyces cerevisiae P301]
 gb|EWG93825.1| Rpl9bp [Saccharomyces cerevisiae R103]
 gb|EWH16191.1| Rpl9bp [Saccharomyces cerevisiae P283]
 gb|AHY77028.1| Rpl9bp [Saccharomyces cerevisiae YJM993]
Length=191

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S VDN+ITGVTKGY+YKMR+VYAHFPIN
Sbjct  61   DRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPIN  100



>gb|EGA77101.1| Rpl9bp [Saccharomyces cerevisiae Vin13]
 gb|EGA81187.1| Rpl9bp [Saccharomyces cerevisiae Lalvin QA23]
 gb|EHN04869.1| Rpl9bp [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=191

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S VDN+ITGVTKGY+YKMR+VYAHFPIN
Sbjct  61   DRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPIN  100



>gb|EHN00516.1| Rpl9bp [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EJT43690.1| RPL9B-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=191

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S VDN+ITGVTKGY+YKMR+VYAHFPIN
Sbjct  61   DRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPIN  100



>gb|EDV10360.1| ribosomal protein L9A [Saccharomyces cerevisiae RM11-1a]
Length=191

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S VDN+ITGVTKGY+YKMR+VYAHFPIN
Sbjct  61   DRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPIN  100



>gb|AFV95303.1| large subunit ribosomal protein 9, partial [Micoletzkya japonica]
Length=181

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  AAIRT  SH++NLI GVTKGY+YKMR VYAHFPIN
Sbjct  55   NRKEIAAIRTIASHIENLIKGVTKGYRYKMRSVYAHFPIN  94



>gb|AHZ34826.1| large subunit ribosomal protein 9, partial [Micoletzkya sp. 18 
VS-2014]
Length=175

 Score = 66.6 bits (161),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  AAIRT  SH++NLI GVTKGY+YKMR VYAHFPIN
Sbjct  54   NRKEIAAIRTIASHIENLIKGVTKGYRYKMRSVYAHFPIN  93



>ref|XP_003680553.1| 60S ribosomal protein L9 [Torulaspora delbrueckii]
 emb|CCE91342.1| hypothetical protein TDEL_0C04530 [Torulaspora delbrueckii]
Length=191

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK  AA+RT  S VDNLITGVTKGY+YKMR+VYAHFPIN
Sbjct  62   RKHVAALRTVKSLVDNLITGVTKGYKYKMRYVYAHFPIN  100



>ref|XP_003693532.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L9-like 
[Apis florea]
Length=190

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            ++K  AA+RT  SH++N++ GVTKGYQYKMR VYAHFPIN
Sbjct  61   TKKELAAVRTVCSHIENMLKGVTKGYQYKMRAVYAHFPIN  100



>pdb|3JYW|H Chain H, Structure Of The 60s Proteins For Eukaryotic Ribosome 
Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 
8.9a Resolution
Length=179

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S VDN+ITGVTKGY+YKMR+VYAHFPIN
Sbjct  56   GRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPIN  95



>gb|EFA77263.1| 60S ribosomal protein L9 [Polysphondylium pallidum PN500]
Length=206

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +R   AAI T  SH++N+ITGVTKG++YKMRFVYAHFPIN
Sbjct  78   TRDQIAAISTVASHIENMITGVTKGFEYKMRFVYAHFPIN  117



>ref|XP_623506.1| PREDICTED: 60S ribosomal protein L9 [Apis mellifera]
Length=190

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            ++K  AA+RT  SH++N++ GVTKGYQYKMR VYAHFPIN
Sbjct  61   TKKELAAVRTVCSHIENMLKGVTKGYQYKMRAVYAHFPIN  100



>gb|EHJ78541.1| ribosomal protein L9 [Danaus plexippus]
Length=190

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            S+K  AA+RT  SHVDN+I GVTKG+QYKMR VYAHFPIN
Sbjct  61   SKKELAAVRTVCSHVDNMIKGVTKGFQYKMRAVYAHFPIN  100



>ref|NP_011368.3| ribosomal 60S subunit protein L9A [Saccharomyces cerevisiae S288c]
 sp|P05738.2|RL9A_YEAST RecName: Full=60S ribosomal protein L9-A; AltName: Full=L8; AltName: 
Full=RP24; AltName: Full=YL11 [Saccharomyces cerevisiae 
S288c]
 pdb|1S1I|H Chain H, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex 
From Yeast Obtained By Docking Atomic Models For Rna And Protein 
Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, 
Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 
1s1h.
 pdb|3IZS|F Chain F, Localization Of The Large Subunit Ribosomal Proteins 
Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 
80s Ribosome
 pdb|3O58|I Chain I, Yeast 80s Ribosome. This Entry Consists Of The 60s Subunit 
Of The First 80s In The Asymmetric Unit.
 pdb|3O5H|I Chain I, Yeast 80s Ribosome. This Entry Consists Of The 60s Subunit 
Of The Second 80s In The Asymmetric Unit.
 pdb|3U5E|H Chain H, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. 
This Entry Contains Proteins Of The 60s Subunit, Ribosome 
A
 pdb|3U5I|H Chain H, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. 
This Entry Contains Proteins Of The 60s Subunit, Ribosome 
B
 pdb|3J16|F Chain F, Models Of Ribosome-Bound Dom34p And Rli1p And Their 
Ribosomal Binding Partners
 pdb|4B6A|H Chain H, Cryo-Em Structure Of The 60s Ribosomal Subunit In Complex 
With Arx1 And Rei1
 pdb|4BYN|H Chain H, Cryo-em Reconstruction Of The 80s-eif5b-met-itrnamet 
Eukaryotic Translation Initiation Complex
 pdb|4BYU|H Chain H, Cryo-em Reconstruction Of The 80s-eif5b-met-itrnamet 
Eukaryotic Translation Initiation Complex
 pdb|3J65|F Chain F, Arx1 Pre-60s Particle. This Entry Contains The R-proteins 
And Biogenesis Factors.
 pdb|4CUW|H Chain H, Kluyveromyces Lactis 80s Ribosome In Complex With Crpv-ires
 pdb|1VW8|I Chain I, S. Cerevisiae 80s Ribosome Bound With Taura Syndrome 
Virus (tsv) Ires, 5 Degree Rotation (class Ii). This Entry 
Contains The Large Subunit Ribosomal Proteins.
 pdb|1VWU|I Chain I, S. Cerevisiae 80s Ribosome Bound With Taura Syndrome 
Virus (tsv) Ires, 2 Degree Rotation (class I). This Entry Contains 
The Large Subunit Ribosomal Proteins.
 pdb|1VXV|I Chain I, Structures Of Yeast 80s Ribosome-trna Complexes In The 
Rotated And Non-rotated Conformations (class Ii - Rotated 
Ribosome With 1 Trna, This Entry Contains The Large Ribosomal 
Subunit Proteins)
 pdb|1VXY|I Chain I, Structures Of Yeast 80s Ribosome-trna Complexes In The 
Rotated And Non-rotated Conformations (class I - Non-rotated 
Ribosome With 2 Trnas, This Entry Contains The Large Ribosomal 
Subunit Proteins)
 pdb|4UJG|K Chain K, Crystal Structure Of Narciclasine Bound To The Yeast 
80s Ribosome
 pdb|4UJI|S Chain S, Crystal Structure Of Narciclasine Bound To The Yeast 
80s Ribosome
 pdb|4UJL|K Chain K, Crystal Structure Of Lycorine Bound To The Yeast 80s 
Ribosome
 pdb|4UJN|S Chain S, Crystal Structure Of Lycorine Bound To The Yeast 80s 
Ribosome
 pdb|4UJQ|K Chain K, Crystal Structure Of Lactimidomycin Bound To The Yeast 
80s Ribosome
 pdb|4UJS|S Chain S, Crystal Structure Of Lactimidomycin Bound To The Yeast 
80s Ribosome
 pdb|4UJV|K Chain K, Crystal Structure Of T-2 Toxin Bound To The Yeast 80s 
Ribosome
 pdb|4UJX|S Chain S, Crystal Structure Of T-2 Toxin Bound To The Yeast 80s 
Ribosome
 pdb|4UK0|K Chain K, Crystal Structure Of Anisomycin Bound To The Yeast 80s 
Ribosome
 pdb|4UK2|S Chain S, Crystal Structure Of Anisomycin Bound To The Yeast 80s 
Ribosome
 pdb|4UK5|K Chain K, Crystal Structure Of Cca Trinucleotide Bound To The 
Yeast 80s Ribosome
 pdb|4UK7|S Chain S, Crystal Structure Of Cca Trinucleotide Bound To The 
Yeast 80s Ribosome
 pdb|4UKA|K Chain K, Crystal Structure Of Cycloheximide Bound To The Yeast 
80s Ribosome
 pdb|4UKC|S Chain S, Crystal Structure Of Cycloheximide Bound To The Yeast 
80s Ribosome
 pdb|4UKG|K Chain K, Crystal Structure Of Blasticidin S Bound To The Yeast 
80s Ribosome
 pdb|4UKI|S Chain S, Crystal Structure Of Blasticidin S Bound To The Yeast 
80s Ribosome
 pdb|4UKL|K Chain K, Crystal Structure Of Cryptopleurine Bound To The Yeast 
80s Ribosome
 pdb|4UKN|S Chain S, Crystal Structure Of Cryptopleurine Bound To The Yeast 
80s Ribosome
 pdb|4UKQ|K Chain K, Crystal Structure Of Deoxynivalenol Bound To The Yeast 
80s Ribosome
 pdb|4UKS|S Chain S, Crystal Structure Of Deoxynivalenol Bound To The Yeast 
80s Ribosome
 pdb|4UKV|K Chain K, Crystal Structure Of Edeine Bound To The Yeast 80s Ribosome
 pdb|4UKX|S Chain S, Crystal Structure Of Edeine Bound To The Yeast 80s Ribosome
 pdb|4UL0|K Chain K, Crystal Structure Of Geneticin Bound To The Yeast 80s 
Ribosome
 pdb|4UL2|S Chain S, Crystal Structure Of Geneticin Bound To The Yeast 80s 
Ribosome
 pdb|4UL5|K Chain K, Crystal Structure Of Homoharringtonine Bound To The 
Yeast 80s Ribosome
 pdb|4UL7|S Chain S, Crystal Structure Of Homoharringtonine Bound To The 
Yeast 80s Ribosome
 pdb|4ULA|K Chain K, Crystal Structure Of Nagilactone C Bound To The Yeast 
80s Ribosome
 pdb|4ULC|S Chain S, Crystal Structure Of Nagilactone C Bound To The Yeast 
80s Ribosome
 pdb|4ULF|K Chain K, Crystal Structure Of Pactamycin Bound To The Yeast 80s 
Ribosome
 pdb|4ULH|S Chain S, Crystal Structure Of Pactamycin Bound To The Yeast 80s 
Ribosome
 pdb|4ULK|K Chain K, Crystal Structure Of Phyllanthoside Bound To The Yeast 
80s Ribosome
 pdb|4ULN|S Chain S, Crystal Structure Of Phyllanthoside Bound To The Yeast 
80s Ribosome
 pdb|4ULQ|K Chain K, Crystal Structure Of Verrucarin Bound To The Yeast 80s 
Ribosome
 pdb|4ULS|S Chain S, Crystal Structure Of Verrucarin Bound To The Yeast 80s 
Ribosome
 emb|CAA42746.1| ribosomal protein L9 [Saccharomyces cerevisiae]
 gb|AAA05579.1| ribosomal protein L9 homolog, YL9A protein [Saccharomyces cerevisiae, 
Peptide, 191 aa]
 emb|CAA96859.1| RPL9A [Saccharomyces cerevisiae]
 emb|CAA68215.1| RPL9A [Saccharomyces cerevisiae]
 tpg|DAA07963.1| TPA: ribosomal 60S subunit protein L9A [Saccharomyces cerevisiae 
S288c]
 gb|EIW10209.1| Rpl9ap [Saccharomyces cerevisiae CEN.PK113-7D]
Length=191

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S VDN+ITGVTKGY+YKMR+VYAHFPIN
Sbjct  61   GRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPIN  100



>ref|XP_446742.1| 60S ribosomal protein L9 [Candida glabrata CBS 138]
 emb|CAG59669.1| unnamed protein product [Candida glabrata]
Length=191

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S VDNLITGVTKGY+YK+R+VYAHFPIN
Sbjct  61   DRKHVAALRTVKSLVDNLITGVTKGYKYKLRYVYAHFPIN  100



>ref|XP_003955903.1| hypothetical protein KAFR_0B04710 [Kazachstania africana CBS 
2517]
 emb|CCF56768.1| hypothetical protein KAFR_0B04710 [Kazachstania africana CBS 
2517]
Length=191

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S +DN+ITGVTKGY+YKMR+VYAHFPIN
Sbjct  61   DRKHVAALRTVKSLIDNMITGVTKGYKYKMRYVYAHFPIN  100



>ref|XP_003703131.1| PREDICTED: 60S ribosomal protein L9-like [Megachile rotundata]
Length=190

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            ++K  AA+RT  SH++N++ GVTKGYQYKMR VYAHFPIN
Sbjct  61   TKKELAAVRTVCSHIENMLKGVTKGYQYKMRAVYAHFPIN  100



>emb|CAJ17250.1| ribosomal protein L9e [Cephalota litorea]
Length=189

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            ++K  AA+RT  SH++N++ GVTKGYQYKMR VYAHFPIN
Sbjct  61   TKKELAAVRTVCSHIENMLKGVTKGYQYKMRAVYAHFPIN  100



>gb|ACV32417.1| large subunit ribosomal protein 9 [Mononchoides sp. RS5441]
Length=182

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            ++K  AAIRT  SH++NLI GVTKGY+YKMR VYAHFPIN
Sbjct  55   NKKEIAAIRTVCSHIENLIKGVTKGYRYKMRSVYAHFPIN  94



>gb|ACV32426.1| large subunit ribosomal protein 9 [Koerneria sp. RS1982]
Length=181

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            ++K  AAIRT  SH++NLI GVTKGY+YKMR VYAHFPIN
Sbjct  55   TKKELAAIRTVCSHIENLIKGVTKGYRYKMRSVYAHFPIN  94



>gb|AFV95302.1| large subunit ribosomal protein 9, partial [Micoletzkya sp. 3 
VS-2012]
Length=180

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  AAIRT  SH++NL+ GVTKGY+YKMR VYAHFPIN
Sbjct  55   NRKEIAAIRTVASHIENLVKGVTKGYRYKMRSVYAHFPIN  94



>gb|KIH44344.1| ribosomal protein L6 [Ancylostoma duodenale]
Length=119

 Score = 65.9 bits (159),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK  AAIRT  SH+ N+I GVTKGY+YKMR VYAHFPIN
Sbjct  18   RKEIAAIRTVCSHIQNMIKGVTKGYRYKMRSVYAHFPIN  56



>gb|ACV32423.1| large subunit ribosomal protein 9 [Oigolaimella attenuata]
Length=181

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  +AIRT  SH++NLI GVTKGY+YKMR VYAHFPIN
Sbjct  55   NRKEISAIRTVCSHIENLIKGVTKGYRYKMRSVYAHFPIN  94



>gb|ACV32428.1| large subunit ribosomal protein 9 [Acrostichus sp. RS5083]
Length=181

 Score = 66.2 bits (160),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  AAIRT  SHV+NL  GVTKGY+YKMR VYAHFPIN
Sbjct  55   NRKEIAAIRTVCSHVENLXKGVTKGYRYKMRSVYAHFPIN  94



>ref|XP_003684895.1| 60S ribosomal protein L9 [Tetrapisispora phaffii CBS 4417]
 emb|CCE62461.1| hypothetical protein TPHA_0C03080 [Tetrapisispora phaffii CBS 
4417]
Length=191

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S +DNLITGVT+GY+YKMR+VYAHFPIN
Sbjct  61   ERKHVAALRTVKSLIDNLITGVTRGYKYKMRYVYAHFPIN  100



>gb|AFC90092.1| hypothetical protein, partial [Nicotiana benthamiana]
Length=119

 Score = 65.5 bits (158),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 30/30 (100%), Gaps = 0/30 (0%)
 Frame = -2

Query  90  ALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
           ALSHV+NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  1   ALSHVENLITGVTKGYRYKMRFVYAHFPIN  30



>ref|XP_003686364.1| 60S ribosomal protein L9 [Tetrapisispora phaffii CBS 4417]
 emb|CCE63930.1| hypothetical protein TPHA_0G00940 [Tetrapisispora phaffii CBS 
4417]
Length=191

 Score = 66.6 bits (161),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S +DNLITGVT+GY+YKMR+VYAHFPIN
Sbjct  61   ERKHVAALRTVKSLIDNLITGVTRGYKYKMRYVYAHFPIN  100



>gb|EGA60716.1| Rpl9bp [Saccharomyces cerevisiae FostersO]
Length=201

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S VDN+ITGVTKGY+YKMR+VYAHFPIN
Sbjct  61   DRKHVAALRTVKSLVDNMITGVTKGYKYKMRYVYAHFPIN  100



>emb|CDS08179.1| hypothetical protein LRAMOSA02127 [Absidia idahoensis var. thermophila]
Length=189

 Score = 66.2 bits (160),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  AAIRT  S V+N+ITGVTKG+QYKMR+VYAHFPIN
Sbjct  61   ARKHVAAIRTVRSIVNNMITGVTKGFQYKMRYVYAHFPIN  100



>emb|CDH52370.1| 60s ribosomal protein l9 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=189

 Score = 66.2 bits (160),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  AAIRT  S V+N+ITGVTKG+QYKMR+VYAHFPIN
Sbjct  61   ARKHVAAIRTVRSIVNNMITGVTKGFQYKMRYVYAHFPIN  100



>gb|EWM26180.1| 60s ribosomal protein l9 [Nannochloropsis gaditana]
Length=194

 Score = 66.2 bits (160),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  A IRT  SH++NL+TGVTKG+ Y+MRFVYAHFPIN
Sbjct  69   NRKQLATIRTVCSHIENLMTGVTKGFLYRMRFVYAHFPIN  108



>gb|EFZ14104.1| hypothetical protein SINV_15854 [Solenopsis invicta]
Length=206

 Score = 66.2 bits (160),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            ++K  AA+RT  SH++N++ GVTKGYQYKMR VYAHFPIN
Sbjct  63   TKKELAAVRTVCSHIENMLKGVTKGYQYKMRAVYAHFPIN  102



>emb|CDH49550.1| 60s ribosomal protein l9 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=189

 Score = 66.2 bits (160),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  AAIRT  S V+N+ITGVTKG+QYKMR+VYAHFPIN
Sbjct  61   ARKHVAAIRTVRSIVNNMITGVTKGFQYKMRYVYAHFPIN  100



>gb|AEB54645.1| ribosomal protein L9 [Procambarus clarkii]
Length=192

 Score = 66.2 bits (160),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  AA+RT  SH+ N++TGVT G+QYKMR VYAHFPIN
Sbjct  64   NRKEVAAVRTVCSHISNMVTGVTDGFQYKMRAVYAHFPIN  103



>gb|ACV32419.1| large subunit ribosomal protein 9 [Diplogasteroides sp. 1 RS5444]
Length=181

 Score = 66.2 bits (160),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  +AIRT  SH++NL+ GVTKGY+YKMR VYAHFPIN
Sbjct  55   NRKEISAIRTVCSHIENLVKGVTKGYRYKMRSVYAHFPIN  94



>gb|AFK41222.1| unknown [Lotus japonicus]
Length=173

 Score = 65.9 bits (159),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  96  RTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
           +  LSHVDNLITGVTKGY+YKMRFVYAHFPIN
Sbjct  54  KKKLSHVDNLITGVTKGYRYKMRFVYAHFPIN  85



>emb|CDH57428.1| 60s ribosomal protein l9 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=207

 Score = 66.2 bits (160),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  AAIRT  S ++N+ITGVTKG+QYKMR+VYAHFPIN
Sbjct  79   ARKHVAAIRTVRSIINNMITGVTKGFQYKMRYVYAHFPIN  118



>ref|XP_003959367.1| hypothetical protein KAFR_0J01670 [Kazachstania africana CBS 
2517]
 emb|CCF60232.1| hypothetical protein KAFR_0J01670 [Kazachstania africana CBS 
2517]
Length=191

 Score = 65.9 bits (159),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S +DN++TGVTKGY+YKMR+VYAHFPIN
Sbjct  61   DRKHVAALRTVKSLIDNMVTGVTKGYKYKMRYVYAHFPIN  100



>gb|EJD75997.1| 60S ribosomal protein L9 [Loa loa]
Length=188

 Score = 65.9 bits (159),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK  AAIRT  SH++N+I GVTKG++YKMR VYAHFPIN
Sbjct  62   RKEVAAIRTVCSHIENMIKGVTKGFRYKMRSVYAHFPIN  100



>ref|XP_002494433.1| 60S ribosomal protein L9 [Zygosaccharomyces rouxii]
 emb|CAR25500.1| ZYRO0A01364p [Zygosaccharomyces rouxii]
Length=190

 Score = 65.9 bits (159),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK  AA+RT  S VDNLITGVTKGY+YKMR+VYAHFPIN
Sbjct  62   RKHVAALRTVKSLVDNLITGVTKGYRYKMRYVYAHFPIN  100



>ref|XP_006679186.1| hypothetical protein BATDEDRAFT_88560 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80145.1| hypothetical protein BATDEDRAFT_88560 [Batrachochytrium dendrobatidis 
JAM81]
Length=187

 Score = 65.9 bits (159),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK  A IRT  SHV+N+I GVTKG++YKMRFVYAHFPIN
Sbjct  62   RKHVACIRTICSHVENMIKGVTKGFEYKMRFVYAHFPIN  100



>emb|CBN79209.1| conserved unknown protein [Ectocarpus siliculosus]
Length=189

 Score = 65.9 bits (159),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  A IRT  SHV+N+ITGVTKGY YKMRF YAHFPIN
Sbjct  61   NRKQLACIRTICSHVENMITGVTKGYLYKMRFCYAHFPIN  100



>ref|XP_003682829.1| 60S ribosomal protein L9 [Torulaspora delbrueckii]
 emb|CCE93618.1| hypothetical protein TDEL_0G02510 [Torulaspora delbrueckii]
Length=191

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK  AA+RT  S VDNLITGVTKGY+YKMR+VYAHFPIN
Sbjct  62   RKHVAALRTVKSLVDNLITGVTKGYKYKMRYVYAHFPIN  100



>gb|EJW85983.1| 60S ribosomal protein L9 [Wuchereria bancrofti]
Length=188

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK  AAIRT  SH++N+I GVTKG++YKMR VYAHFPIN
Sbjct  62   RKEVAAIRTVCSHIENMIKGVTKGFRYKMRSVYAHFPIN  100



>gb|ACV32420.1| large subunit ribosomal protein 9 [Micoletzkya sp. WEM-2009]
Length=182

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  AAIRT  SH++NLI GV KGY+YKMR VYAHFPIN
Sbjct  55   NRKEIAAIRTVASHIENLIKGVVKGYRYKMRSVYAHFPIN  94



>gb|ETN76537.1| ribosomal protein L6 [Necator americanus]
Length=188

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK  AAIRT  SH+ N+I GVTKGY+YKMR VYAHFPIN
Sbjct  62   RKEIAAIRTVCSHIQNMIKGVTKGYRYKMRSVYAHFPIN  100



>gb|AFV95304.1| large subunit ribosomal protein 9, partial [Micoletzkya masseyi]
Length=182

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  AAIRT  SH++NLI GV KGY+YKMR VYAHFPIN
Sbjct  55   NRKEIAAIRTVASHIENLIKGVVKGYRYKMRSVYAHFPIN  94



>ref|XP_001902933.1| 60S ribosomal protein L9 [Brugia malayi]
 emb|CDP99758.1| Protein BM-RPL-9, isoform c [Brugia malayi]
Length=188

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK  AAIRT  SH++N+I GVTKG++YKMR VYAHFPIN
Sbjct  62   RKEVAAIRTVCSHIENMIKGVTKGFRYKMRSVYAHFPIN  100



>gb|AHZ34823.1| large subunit ribosomal protein 9, partial [Micoletzkya sp. 7 
VS-2014]
Length=175

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            +RK  AAIRT  SH++NLI GV KGY+YKMR VYAHFPIN
Sbjct  54   NRKEIAAIRTVASHIENLIKGVVKGYRYKMRSVYAHFPIN  93



>gb|EYB91393.1| hypothetical protein Y032_0206g1969 [Ancylostoma ceylanicum]
Length=188

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK  AAIRT  SH+ N+I GVTKGY+YKMR VYAHFPIN
Sbjct  62   RKEIAAIRTVCSHIQNMIKGVTKGYRYKMRSVYAHFPIN  100



>gb|KHJ98063.1| ribosomal protein L6 [Oesophagostomum dentatum]
Length=177

 Score = 65.5 bits (158),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  117  RKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
            RK  AAIRT  SH+ N+I GVTKGY+YKMR VYAHFPIN
Sbjct  62   RKEIAAIRTVCSHIQNMIKGVTKGYRYKMRSVYAHFPIN  100



>ref|XP_001527234.1| 60S ribosomal protein L9-B [Lodderomyces elongisporus NRRL YB-4239]
 gb|EDK43884.1| 60S ribosomal protein L9-B [Lodderomyces elongisporus NRRL YB-4239]
Length=191

 Score = 65.9 bits (159),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  120  SRKTTAAIRTALSHVDNLITGVTKGYQYKMRFVYAHFPIN  1
             RK  AA+RT  S + NLITGVTKGY+YKMRFVYAHFPIN
Sbjct  61   DRKHVAALRTVKSLIANLITGVTKGYKYKMRFVYAHFPIN  100



Lambda      K        H        a         alpha
   0.314    0.135    0.365    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518182412384