BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23641_g1_i1 len=2931 path=[1:0-479 481:480-506 3377:507-609
3480:610-641 3511:642-1117 2766:1118-1260 2115:1261-1284
2139:1285-1422 2277:1423-1446 2301:1447-1449 2304:1450-1480
11012:1481-1735 4598:1736-1761 9567:1762-2177 2898:2178-2930]

Length=2931
                                                                      Score     E

ref|XP_004249852.1|  PREDICTED: bromodomain adjacent to zinc fing...    792   0.0      
ref|XP_009785848.1|  PREDICTED: uncharacterized protein LOC104234...    769   0.0      
ref|XP_006351119.1|  PREDICTED: uncharacterized protein LOC102605978    769   0.0      
ref|XP_009785846.1|  PREDICTED: uncharacterized protein LOC104234...    766   0.0      
ref|XP_009616473.1|  PREDICTED: ubinuclein-1-like                       717   0.0      
ref|XP_009785849.1|  PREDICTED: uncharacterized protein LOC104234...    658   0.0      
emb|CDP11001.1|  unnamed protein product                                654   0.0      
ref|XP_010664166.1|  PREDICTED: uncharacterized protein LOC100255...    631   0.0      
emb|CBI18967.3|  unnamed protein product                                626   0.0      
ref|XP_010664165.1|  PREDICTED: ubinuclein-2-like isoform X1            626   0.0      
ref|XP_010664168.1|  PREDICTED: uncharacterized protein LOC100255...    625   0.0      
ref|XP_006434287.1|  hypothetical protein CICLE_v10000343mg             620   0.0      
ref|XP_010664167.1|  PREDICTED: uncharacterized protein LOC100255...    620   0.0      
gb|KDO80485.1|  hypothetical protein CISIN_1g003939mg                   611   0.0      
ref|XP_006472851.1|  PREDICTED: uncharacterized protein PF11_0207...    609   0.0      
ref|XP_006472852.1|  PREDICTED: uncharacterized protein PF11_0207...    603   0.0      
ref|XP_011102226.1|  PREDICTED: uncharacterized protein LOC105180...    600   0.0      
ref|XP_007019214.1|  Wound-responsive family protein, putative is...    600   0.0      
ref|XP_011102221.1|  PREDICTED: ubinuclein-1-like isoform X2            596   0.0      
ref|XP_008219579.1|  PREDICTED: uncharacterized protein LOC103319...    593   0.0      
ref|XP_011102211.1|  PREDICTED: ubinuclein-1-like isoform X1            593   0.0      
ref|XP_008371547.1|  PREDICTED: ubinuclein-1-like isoform X5            589   0.0      
ref|XP_008219578.1|  PREDICTED: uncharacterized protein LOC103319...    588   0.0      
ref|XP_007019216.1|  Wound-responsive family protein, putative is...    588   0.0      
ref|XP_008219581.1|  PREDICTED: uncharacterized protein LOC103319...    586   0.0      
ref|XP_007226993.1|  hypothetical protein PRUPE_ppa001869mg             584   0.0      
ref|XP_008368922.1|  PREDICTED: ubinuclein-1-like isoform X1            584   0.0      
ref|XP_008219580.1|  PREDICTED: uncharacterized protein LOC103319...    582   0.0      
dbj|BAJ53189.1|  JMS09K11.7                                             582   0.0      
ref|XP_008370189.1|  PREDICTED: ubinuclein-1-like isoform X3            580   0.0      
gb|KDP32859.1|  hypothetical protein JCGZ_12151                         578   0.0      
ref|XP_008369549.1|  PREDICTED: ubinuclein-1-like isoform X2            577   0.0      
gb|KHG20837.1|  Histone promoter control 2                              576   0.0      
ref|XP_008370884.1|  PREDICTED: ubinuclein-1-like isoform X4            573   0.0      
ref|XP_002302222.2|  hypothetical protein POPTR_0002s07900g             568   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004292725.1|  PREDICTED: uncharacterized protein LOC101309510    566   0.0      
ref|XP_011002436.1|  PREDICTED: ubinuclein-1 isoform X1                 563   0.0      
ref|XP_011074816.1|  PREDICTED: uncharacterized protein LOC105159445    561   0.0      
ref|XP_011002437.1|  PREDICTED: ubinuclein-1 isoform X2                 561   0.0      
ref|XP_002520310.1|  conserved hypothetical protein                     556   0.0      Ricinus communis
ref|XP_004160723.1|  PREDICTED: uncharacterized LOC101204246            550   1e-178   
ref|XP_004149441.1|  PREDICTED: uncharacterized protein LOC101204246    549   4e-178   
ref|XP_010063440.1|  PREDICTED: ubinuclein-1 isoform X3                 548   5e-178   
ref|XP_002306653.2|  wound-responsive family protein                    551   6e-178   Populus trichocarpa [western balsam poplar]
ref|XP_010063441.1|  PREDICTED: uncharacterized protein LOC104450...    543   2e-176   
ref|XP_010063438.1|  PREDICTED: uncharacterized protein LOC104450...    543   1e-175   
ref|XP_010270289.1|  PREDICTED: ubinuclein-1-like isoform X4            542   3e-175   
ref|XP_006578958.1|  PREDICTED: uncharacterized protein LOC100778...    539   5e-175   
ref|XP_006581599.1|  PREDICTED: uncharacterized protein LOC100793...    539   8e-175   
ref|XP_003527951.1|  PREDICTED: uncharacterized protein LOC100793...    538   1e-174   
ref|XP_006578957.1|  PREDICTED: uncharacterized protein LOC100778...    538   2e-174   
gb|KHN44301.1|  hypothetical protein glysoja_024521                     537   5e-174   
gb|KHN46987.1|  hypothetical protein glysoja_018354                     535   2e-173   
ref|XP_010063439.1|  PREDICTED: uncharacterized protein LOC104450...    536   3e-173   
ref|XP_010269065.1|  PREDICTED: ubinuclein-1-like isoform X1            536   9e-173   
ref|XP_010270290.1|  PREDICTED: ubinuclein-1-like isoform X5            535   1e-172   
ref|XP_010269067.1|  PREDICTED: ubinuclein-1-like isoform X3            535   2e-172   
gb|EYU32498.1|  hypothetical protein MIMGU_mgv1a002221mg                529   2e-171   
ref|XP_007137473.1|  hypothetical protein PHAVU_009G129800g             528   1e-170   
ref|XP_010270286.1|  PREDICTED: ubinuclein-1-like isoform X1            530   2e-170   
ref|XP_007137474.1|  hypothetical protein PHAVU_009G129800g             527   2e-170   
ref|XP_003545655.1|  PREDICTED: uncharacterized protein LOC100799...    528   3e-170   
ref|XP_010269066.1|  PREDICTED: ubinuclein-1-like isoform X2            529   3e-170   
ref|XP_010270288.1|  PREDICTED: ubinuclein-1-like isoform X3            530   4e-170   
ref|XP_006596223.1|  PREDICTED: uncharacterized protein LOC100799...    527   8e-170   
gb|KHN05178.1|  hypothetical protein glysoja_028076                     524   8e-169   
ref|XP_010270287.1|  PREDICTED: ubinuclein-1-like isoform X2            524   5e-168   
ref|XP_006596224.1|  PREDICTED: uncharacterized protein LOC100799...    520   2e-167   
ref|XP_006593820.1|  PREDICTED: uncharacterized protein LOC100795...    518   2e-166   
gb|KEH35346.1|  wound-responsive family protein                         517   2e-166   
ref|XP_008466757.1|  PREDICTED: ubinuclein-1-like isoform X2            518   3e-166   
gb|KHG04330.1|  Histone promoter control 2                              517   5e-166   
ref|XP_006593818.1|  PREDICTED: uncharacterized protein LOC100795...    517   5e-166   
ref|XP_007161456.1|  hypothetical protein PHAVU_001G070500g             516   9e-166   
ref|XP_004502535.1|  PREDICTED: uncharacterized protein LOC101501927    513   4e-165   
ref|XP_008466756.1|  PREDICTED: ubinuclein-1-like isoform X1            513   1e-164   
ref|XP_006386353.1|  hypothetical protein POPTR_0002s07900g             506   8e-164   
ref|XP_011027457.1|  PREDICTED: uncharacterized protein LOC105127...    506   1e-163   
ref|XP_006593819.1|  PREDICTED: uncharacterized protein LOC100795...    511   1e-163   
ref|XP_011027456.1|  PREDICTED: uncharacterized protein LOC105127...    506   2e-163   
ref|XP_006434286.1|  hypothetical protein CICLE_v10000343mg             495   7e-160   
gb|EYU23863.1|  hypothetical protein MIMGU_mgv1a003415mg                491   2e-158   
ref|XP_011027455.1|  PREDICTED: uncharacterized protein LOC105127...    491   1e-157   
gb|KDO80486.1|  hypothetical protein CISIN_1g003939mg                   487   1e-156   
ref|XP_006596225.1|  PREDICTED: uncharacterized protein LOC100799...    485   8e-155   
ref|XP_010087179.1|  hypothetical protein L484_003819                   474   6e-152   
ref|XP_006593821.1|  PREDICTED: uncharacterized protein LOC100795...    479   2e-151   
ref|XP_008466759.1|  PREDICTED: uncharacterized protein LOC103504...    470   2e-149   
gb|KEH40497.1|  wound-responsive family protein                         475   3e-149   
ref|XP_010677635.1|  PREDICTED: ubinuclein-2 isoform X2                 473   6e-149   
ref|XP_008466758.1|  PREDICTED: uncharacterized protein LOC103504...    465   1e-147   
ref|XP_010677628.1|  PREDICTED: ubinuclein-2 isoform X1                 468   3e-147   
ref|XP_004498357.1|  PREDICTED: uncharacterized protein LOC101491...    464   1e-145   
ref|XP_006596226.1|  PREDICTED: uncharacterized protein LOC100799...    459   3e-145   
ref|XP_011102229.1|  PREDICTED: uncharacterized protein LOC105180...    454   8e-144   
ref|XP_004498358.1|  PREDICTED: uncharacterized protein LOC101491...    457   4e-143   
ref|XP_011027458.1|  PREDICTED: uncharacterized protein LOC105127...    449   6e-142   
ref|XP_006390101.1|  hypothetical protein EUTSA_v10018217mg             448   1e-140   
ref|XP_006306914.1|  hypothetical protein CARUB_v10008479mg             444   6e-139   
gb|KFK44264.1|  hypothetical protein AALP_AA1G235600                    443   1e-138   
ref|XP_010911241.1|  PREDICTED: LOW QUALITY PROTEIN: ubinuclein-1       442   5e-137   
ref|XP_010537364.1|  PREDICTED: ubinuclein-1-like isoform X4            438   8e-137   
ref|XP_009414608.1|  PREDICTED: ubinuclein-1-like                       441   2e-136   
ref|XP_008353916.1|  PREDICTED: uncharacterized protein LOC103417515    426   3e-136   
gb|KFK44263.1|  hypothetical protein AALP_AA1G235600                    436   4e-136   
emb|CDX88358.1|  BnaC06g38020D                                          435   1e-135   
ref|XP_010537362.1|  PREDICTED: ubinuclein-1-like isoform X2            435   2e-135   
ref|XP_010537363.1|  PREDICTED: ubinuclein-1-like isoform X3            433   5e-135   
ref|XP_008805860.1|  PREDICTED: ubinuclein-1-like isoform X1            437   6e-135   
ref|XP_009106395.1|  PREDICTED: uncharacterized protein LOC103832...    430   9e-134   
ref|XP_010537361.1|  PREDICTED: ubinuclein-1-like isoform X1            430   1e-133   
emb|CDX87526.1|  BnaA07g33470D                                          429   3e-133   
ref|XP_010905321.1|  PREDICTED: LOW QUALITY PROTEIN: ubinuclein-1...    431   1e-132   
gb|KFK42129.1|  hypothetical protein AALP_AA2G214600                    427   2e-132   
ref|XP_010537365.1|  PREDICTED: ubinuclein-1-like isoform X5            422   3e-132   
ref|XP_009106396.1|  PREDICTED: uncharacterized protein LOC103832...    426   3e-132   
ref|XP_010539681.1|  PREDICTED: ubinuclein-1-like isoform X3            426   5e-132   
ref|XP_010496324.1|  PREDICTED: uncharacterized protein LOC104773...    425   1e-131   
ref|NP_173580.2|  wound-responsive family protein                       424   3e-131   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185055.1|  wound-responsive family protein                    423   5e-131   
ref|XP_002890446.1|  wound-responsive family protein                    423   5e-131   
ref|XP_010496325.1|  PREDICTED: uncharacterized protein LOC104773...    424   5e-131   
ref|XP_010539679.1|  PREDICTED: ubinuclein-1-like isoform X1            421   2e-130   
ref|XP_010496322.1|  PREDICTED: uncharacterized protein LOC104773...    421   5e-130   
ref|XP_009104627.1|  PREDICTED: uncharacterized protein LOC103830...    419   6e-130   
emb|CDX79196.1|  BnaC06g21070D                                          419   2e-129   
ref|XP_010496326.1|  PREDICTED: uncharacterized protein LOC104773...    419   2e-129   
ref|XP_010496323.1|  PREDICTED: uncharacterized protein LOC104773...    419   3e-129   
gb|KFK42128.1|  hypothetical protein AALP_AA2G214600                    419   3e-129   
ref|NP_973880.1|  wound-responsive family protein                       417   1e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104628.1|  PREDICTED: uncharacterized protein LOC103830...    413   2e-127   
ref|XP_009128218.1|  PREDICTED: uncharacterized protein LOC103853...    409   4e-126   
ref|XP_007019215.1|  Wound-responsive family protein, putative is...    405   4e-126   
ref|XP_009128219.1|  PREDICTED: uncharacterized protein LOC103853...    409   6e-126   
emb|CDX68061.1|  BnaA07g21010D                                          408   9e-126   
ref|XP_009128220.1|  PREDICTED: uncharacterized protein LOC103853...    403   9e-124   
gb|KEH35347.1|  wound-responsive family protein                         399   1e-123   
emb|CDY38353.1|  BnaA02g18460D                                          398   6e-122   
ref|XP_011031129.1|  PREDICTED: ubinuclein-1-like isoform X5            397   3e-121   
ref|XP_008805861.1|  PREDICTED: ubinuclein-2-like isoform X2            398   1e-120   
ref|NP_177855.4|  uncharacterized protein                               394   1e-119   Arabidopsis thaliana [mouse-ear cress]
gb|AAD41413.1|AC007727_2  ESTs gb|T42839 and gb|AA395192 come fro...    391   2e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011031130.1|  PREDICTED: ubinuclein-1-like isoform X6            387   6e-118   
emb|CDY40880.1|  BnaCnng09710D                                          383   3e-117   
ref|XP_006300313.1|  hypothetical protein CARUB_v10019893mg             386   5e-117   
ref|XP_011031124.1|  PREDICTED: uncharacterized protein LOC105130...    385   2e-116   
gb|EEC71910.1|  hypothetical protein OsI_04685                          386   2e-116   Oryza sativa Indica Group [Indian rice]
gb|EPS68725.1|  hypothetical protein M569_06041                         381   2e-115   
ref|XP_010471918.1|  PREDICTED: uncharacterized protein LOC104751...    379   8e-115   
ref|XP_010471921.1|  PREDICTED: uncharacterized protein LOC104751...    379   9e-115   
ref|XP_010428806.1|  PREDICTED: uncharacterized protein LOC104713...    377   4e-114   
ref|XP_011031125.1|  PREDICTED: uncharacterized protein LOC105130...    379   4e-114   
ref|XP_011031127.1|  PREDICTED: uncharacterized protein LOC105130...    379   4e-114   
ref|XP_010537367.1|  PREDICTED: uncharacterized protein LOC104812...    374   1e-113   
ref|XP_010416668.1|  PREDICTED: uncharacterized protein LOC104702...    376   1e-113   
ref|XP_010416665.1|  PREDICTED: uncharacterized protein LOC104702...    375   3e-113   
ref|XP_010471920.1|  PREDICTED: uncharacterized protein LOC104751...    372   3e-112   
ref|XP_006646537.1|  PREDICTED: uncharacterized protein LOC102710554    373   5e-111   
ref|XP_010416667.1|  PREDICTED: uncharacterized protein LOC104702...    369   6e-111   
emb|CDM85459.1|  unnamed protein product                                363   9e-108   
ref|XP_011031128.1|  PREDICTED: uncharacterized protein LOC105130...    355   2e-105   
dbj|BAJ94008.1|  predicted protein                                      355   1e-104   
ref|XP_002306272.1|  hypothetical protein POPTR_0005s06890g             348   2e-104   Populus trichocarpa [western balsam poplar]
ref|XP_009128221.1|  PREDICTED: uncharacterized protein LOC103853...    348   2e-104   
ref|XP_010231358.1|  PREDICTED: ubinuclein-2-like isoform X2            354   2e-104   
gb|KDO80487.1|  hypothetical protein CISIN_1g003939mg                   341   3e-103   
ref|XP_002887676.1|  hypothetical protein ARALYDRAFT_476896             341   5e-100   
gb|AAV24767.1|  unknow protein                                          336   3e-98    Oryza sativa Japonica Group [Japonica rice]
gb|EYU23864.1|  hypothetical protein MIMGU_mgv1a003415mg                328   8e-98    
gb|AAC34359.1|  Hypothetical protein                                    327   5e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AAG29192.1|AC078898_2  unknown protein                               332   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006465112.1|  PREDICTED: uncharacterized protein LOC102619...    319   3e-92    
gb|EMT33534.1|  hypothetical protein F775_15647                         317   7e-89    
ref|XP_006465110.1|  PREDICTED: uncharacterized protein LOC102619...    310   8e-89    
ref|XP_006847173.1|  hypothetical protein AMTR_s00017p00245850          308   3e-87    
ref|XP_008783318.1|  PREDICTED: uncharacterized protein LOC103702...    300   2e-86    
ref|XP_010459876.1|  PREDICTED: uncharacterized protein LOC104740...    290   4e-85    
ref|XP_007048469.1|  Wound-responsive family protein isoform 1          299   6e-85    
ref|XP_011022885.1|  PREDICTED: uncharacterized protein LOC105124...    299   1e-84    
ref|NP_001045013.2|  Os01g0883200                                       289   2e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008783317.1|  PREDICTED: uncharacterized protein LOC103702...    296   2e-84    
ref|XP_010459875.1|  PREDICTED: uncharacterized protein LOC104740...    286   2e-83    
ref|XP_011031131.1|  PREDICTED: uncharacterized protein LOC105130...    291   2e-83    
ref|NP_001055588.2|  Os05g0422600                                       293   8e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011022888.1|  PREDICTED: uncharacterized protein LOC105124...    290   2e-82    
ref|XP_011022883.1|  PREDICTED: uncharacterized protein LOC105124...    290   2e-81    
ref|XP_011022884.1|  PREDICTED: uncharacterized protein LOC105124...    289   5e-81    
gb|KHG06858.1|  (-)-trans-carveol dehydrogenase                         285   3e-80    
ref|XP_006655339.1|  PREDICTED: uncharacterized protein LOC102722582    281   8e-80    
ref|XP_007048471.1|  Wound-responsive family protein isoform 3          277   2e-78    
ref|XP_007048470.1|  Wound-responsive family protein isoform 1          277   3e-78    
ref|XP_009420998.1|  PREDICTED: uncharacterized protein LOC104000...    276   1e-76    
ref|XP_004970812.1|  PREDICTED: uncharacterized protein LOC101765842    271   3e-75    
ref|XP_002456749.1|  hypothetical protein SORBIDRAFT_03g041880          273   5e-75    Sorghum bicolor [broomcorn]
gb|EEE63774.1|  hypothetical protein OsJ_18595                          270   1e-74    Oryza sativa Japonica Group [Japonica rice]
gb|EEC79254.1|  hypothetical protein OsI_20017                          267   2e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_008674734.1|  PREDICTED: uncharacterized protein LOC103650918    271   3e-74    
ref|XP_003567336.1|  PREDICTED: ubinuclein-1-like isoform X2            269   2e-73    
ref|XP_010232653.1|  PREDICTED: ubinuclein-1-like isoform X1            268   7e-73    
gb|EMS49370.1|  hypothetical protein TRIUR3_32737                       259   8e-71    
ref|XP_009420990.1|  PREDICTED: uncharacterized protein LOC104000...    261   9e-71    
gb|EMT18280.1|  hypothetical protein F775_10685                         256   8e-70    
ref|XP_010232654.1|  PREDICTED: ubinuclein-1-like isoform X3            258   1e-69    
ref|XP_010231359.1|  PREDICTED: ubinuclein-2-like isoform X3            253   4e-68    
ref|XP_003568423.1|  PREDICTED: uncharacterized protein LOC100826...    253   6e-68    
dbj|BAJ98239.1|  predicted protein                                      250   6e-67    
tpg|DAA56508.1|  TPA: hypothetical protein ZEAMMB73_820373              243   3e-64    
ref|XP_002981398.1|  hypothetical protein SELMODRAFT_444826             238   2e-63    
ref|XP_002969922.1|  hypothetical protein SELMODRAFT_440877             235   9e-63    
ref|XP_010501545.1|  PREDICTED: uncharacterized protein LOC104778812    226   2e-60    
ref|XP_007048472.1|  Wound-responsive family protein isoform 4          206   4e-54    
ref|XP_001771064.1|  predicted protein                                  211   5e-54    
gb|EMS50906.1|  hypothetical protein TRIUR3_23085                       207   1e-52    
ref|XP_001781658.1|  predicted protein                                  199   1e-49    
ref|XP_010459873.1|  PREDICTED: uncharacterized protein LOC104740...    182   7e-47    
ref|XP_010459872.1|  PREDICTED: uncharacterized protein LOC104740...    181   2e-46    
ref|XP_010459870.1|  PREDICTED: uncharacterized protein LOC104740...    181   3e-46    
ref|XP_010459874.1|  PREDICTED: uncharacterized protein LOC104740...    181   3e-46    
ref|XP_010459869.1|  PREDICTED: uncharacterized protein LOC104740...    180   8e-46    
ref|XP_009421005.1|  PREDICTED: uncharacterized protein LOC104000...    183   6e-45    
ref|XP_006432117.1|  hypothetical protein CICLE_v10002136mg             171   6e-44    
ref|XP_002961073.1|  hypothetical protein SELMODRAFT_402672             179   8e-44    
ref|XP_002966934.1|  hypothetical protein SELMODRAFT_408197             176   6e-43    
gb|KFK41011.1|  hypothetical protein AALP_AA2G073700                    155   1e-38    
ref|XP_006380393.1|  hypothetical protein POPTR_0007s04600g             155   1e-37    
gb|AAL17693.1|  wound-responsive protein 14.05                          144   4e-36    Castanea sativa
ref|XP_010087180.1|  hypothetical protein L484_003820                   141   3e-34    
ref|XP_002967163.1|  hypothetical protein SELMODRAFT_408609             140   7e-33    
ref|XP_002960851.1|  hypothetical protein SELMODRAFT_402260             130   1e-29    
gb|ACU17249.1|  unknown                                                 105   7e-22    Glycine max [soybeans]
gb|AAT44256.1|  unknown protein                                       67.0    7e-09    Oryza sativa Japonica Group [Japonica rice]
gb|AFW84369.1|  hypothetical protein ZEAMMB73_776342                  66.2    1e-08    
gb|AAD02829.1|  unknown                                               63.2    1e-07    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008783505.1|  PREDICTED: uncharacterized protein LOC103702731  60.5    8e-07    
gb|KDO57500.1|  hypothetical protein CISIN_1g044291mg                 52.0    2e-04    
ref|NP_001132603.1|  uncharacterized protein LOC100194075             52.0    4e-04    Zea mays [maize]
ref|XP_002306271.1|  hypothetical protein POPTR_0005s06880g           50.8    5e-04    Populus trichocarpa [western balsam poplar]



>ref|XP_004249852.1| PREDICTED: bromodomain adjacent to zinc finger domain protein 
2B-like [Solanum lycopersicum]
Length=749

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/772 (60%), Positives = 539/772 (70%), Gaps = 73/772 (9%)
 Frame = +2

Query  185   IDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngap  364
             +D G +GGEP VGR STSYEAAGGR+RFTVELRPGETTIVSWKKLLK+A           
Sbjct  1     MDGGFTGGEP-VGRASTSYEAAGGRRRFTVELRPGETTIVSWKKLLKDAN----------  49

Query  365   gpaprasaaaaELQPLILPPHNDSPGPG------FSPEQPVEKEAKDAPPGNRLNAVIEK  526
                     +   + P+  P    +P P        +P QP +KE KDAPPGNRLNAVIEK
Sbjct  50    KSNVNVVGSGPTMMPVGAPASIQTPVPHPALEARLAPGQPADKEVKDAPPGNRLNAVIEK  109

Query  527   IERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKL  706
             IERLYVGKQSDD+EDL+D PD+DEYDTEDSFIDDTELD+YFQVDNSAIKHDGFFVNRGKL
Sbjct  110   IERLYVGKQSDDEEDLNDFPDDDEYDTEDSFIDDTELDEYFQVDNSAIKHDGFFVNRGKL  169

Query  707   ERIEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYG  886
             ERIEP S +NQ P KRR+KD  K   G DDG NP+KP KVGKKAGK VP+ + TS PS+G
Sbjct  170   ERIEPVSPKNQQPKKRRRKDLAKSHVGDDDGHNPSKPVKVGKKAGKLVPVVSETSHPSHG  229

Query  887   VVMPTLYRE-----NANVHN---------------------------QEVNFDMQKAEVL  970
             V +  +  E       NV                             +E + D QK  V 
Sbjct  230   VALQNVSHEEKFPNQLNVSEIPTTKKAADTQDMSELSPSASLRGNSAEEKDLDQQKIGVT  289

Query  971   HSKNVVDKLKESSET---SNQRSNERISVPQEKSS-GRSANISNGLDQSFQQGEKSVIYD  1138
              SKN+ DKLK+ SE    S+QR ++R S  QEKS+ GRS NIS+G+DQS Q+       D
Sbjct  290   QSKNLGDKLKDGSEISGKSSQRLHDRSSYAQEKSNVGRSVNISDGIDQSVQR------RD  343

Query  1139  QRLDASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQD  1300
             ++ + S  EGK S QT+      R++GSS R K TMLEKAIRDLEK VAE RPPN EVQD
Sbjct  344   EKFNVSGFEGKNSGQTMKDPAMQRKEGSSGRPKGTMLEKAIRDLEKIVAELRPPNMEVQD  403

Query  1301  GDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLK  1480
              DNSSQAIKRRLP EIKQ+LAKVAR AQASHGK+S ELI+RLMSIVGHL+QLRTLKRNLK
Sbjct  404   ADNSSQAIKRRLPLEIKQRLAKVARLAQASHGKISNELISRLMSIVGHLIQLRTLKRNLK  463

Query  1481  IMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEA  1660
             IM+NMGLSAKQEKDNRVQ IKREVAEMIK R+P+MKSK +EQQ G SDDFQ  + EEKEA
Sbjct  464   IMVNMGLSAKQEKDNRVQHIKREVAEMIKLRIPVMKSKLLEQQAGASDDFQEASAEEKEA  523

Query  1661  FKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAIC  1840
             FKRKY MD ALE++ICDLYD +VEGL+EDAGPQVRKLYAELA  WPNGFMDNHGIKRAIC
Sbjct  524   FKRKYSMDVALEDKICDLYDHFVEGLDEDAGPQVRKLYAELAGCWPNGFMDNHGIKRAIC  583

Query  1841  RAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGST  2020
             RAKDRR+ L+ R K+ EK+RRNK+ A KE +  RV+     Q V IQEK  V   DH ST
Sbjct  584   RAKDRRRALHARRKDGEKIRRNKLLATKEGDTSRVDAGPIAQSVHIQEKIVV---DHSST  640

Query  2021  ATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHITTDALTKKKMKRK  2200
             +TNKP+ S+AA+N   R+ V    G+ ++R K EK+KG   S+      DA+ KKK+KRK
Sbjct  641   STNKPVYSSAAVNASARVHVSIANGSDVNRLKQEKLKGVSGSSVDPRGADAVPKKKVKRK  700

Query  2201  PEPELGEGQYLPEKLSSKQAEYKPQ-EPIAAAPVPKPSIQLNEPPS-FEELT  2350
              E ELGE  +  EKL+S QAE K +       P PKP+   N   S FE+LT
Sbjct  701   HESELGESLFHSEKLTSTQAEEKNKTNKHTGCPTPKPN---NVSTSGFEQLT  749



>ref|XP_009785848.1| PREDICTED: uncharacterized protein LOC104234054 isoform X2 [Nicotiana 
sylvestris]
Length=741

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/737 (62%), Positives = 528/737 (72%), Gaps = 63/737 (9%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R STSYEAA GR+RFTVELRPGETTIVSWKKLLK+AT  QSN     GPAP  S+AAA  
Sbjct  14    RTSTSYEAAAGRRRFTVELRPGETTIVSWKKLLKDATISQSNAPNGAGPAPTTSSAAAAA  73

Query  404   QPLILPPHNDSPGPGF----SPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSddded  571
               +I PP    P P      +  QP +KE KDAPPGNRLNAVIEKIERLYVGKQSDD+ED
Sbjct  74    --VIQPP---LPHPSLETRLASGQPADKEVKDAPPGNRLNAVIEKIERLYVGKQSDDEED  128

Query  572   lddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNK  751
             L+D PD+DEYDTEDSFIDDTELD+YFQVDNSAIKHDGFFVNRGKLER+E  S +NQ P K
Sbjct  129   LNDFPDDDEYDTEDSFIDDTELDEYFQVDNSAIKHDGFFVNRGKLERVELVSPKNQQPKK  188

Query  752   RRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENANVHN  931
             RR+KD  K   G +DG +P+KP KVGKKAGK VP+  G+S PS+GV +  +  E     N
Sbjct  189   RRRKDLAKGHVGDNDGHSPSKPVKVGKKAGKPVPVVIGSSHPSHGVALQNVSHEGEKFLN  248

Query  932   ---------------------------------QEVNFDMQKAEVLHSKNVVDKLKESSE  1012
                                              QE +FD QK  V+ SKN+     E S 
Sbjct  249   QLNASEIPITKKAADTQSMLEQSPSVSLRGDSAQEKDFDQQKIGVIQSKNL--DGSEISG  306

Query  1013  TSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTV  1189
              S QR +++ S  QE++  GR  N+S+G+DQS Q+       D++ + S  EGK S QT+
Sbjct  307   NSTQR-HDKSSFAQERTVVGRPVNVSDGVDQSVQR------RDEKFNVSG-EGKNSVQTM  358

Query  1190  ------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIK  1351
                   R++GSS R K TMLEKAIRDLEK VAESRPPN EVQD DNSSQAIKRRLPPE+K
Sbjct  359   KGPAMQRKEGSSGRPKGTMLEKAIRDLEKIVAESRPPNMEVQDADNSSQAIKRRLPPEVK  418

Query  1352  QKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRV  1531
             QKLAKVAR AQASHGK+S++LINRLMSIVGHL+QLRTLKRNLKIM+NMGLSAKQEKDNRV
Sbjct  419   QKLAKVARLAQASHGKISQDLINRLMSIVGHLIQLRTLKRNLKIMVNMGLSAKQEKDNRV  478

Query  1532  QQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICD  1711
              QIKREVAEMIK R+PLMKSK +EQQ G SDDFQ  + EEKEAFKRKY MD ALE++ICD
Sbjct  479   HQIKREVAEMIKLRIPLMKSKLLEQQAGASDDFQEASAEEKEAFKRKYSMDVALEDKICD  538

Query  1712  LYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQE  1891
             LYD +VEGL+EDAGPQVRKLYAELA +WPNGFMDNHGIKRAICRAKDRR+ L+ R K+ E
Sbjct  539   LYDHFVEGLDEDAGPQVRKLYAELAGFWPNGFMDNHGIKRAICRAKDRRRALHARRKDGE  598

Query  1892  KMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGR  2071
             K+RRNK+ A K EE  RV+     Q V IQEK  +   DH ST+TNKP+SSTAA+N   R
Sbjct  599   KIRRNKLLASKVEETGRVDAVPIAQSVHIQEKVVI---DHSSTSTNKPLSSTAAVNASTR  655

Query  2072  IPVPSPGGTSLDRPKPEKVKGTGNSTDRHITTDALTKKKMKRKPEPELGEGQYLPEKLSS  2251
             +PV S  G  +DR K EK+KG   S+      DAL KKK+KRK E ELGE Q+  EKL+S
Sbjct  656   MPVSSANGPDVDRLKQEKLKGASGSSVDPRAADALPKKKIKRKQESELGESQFHTEKLTS  715

Query  2252  KQAEYKPQEPIAAAPVP  2302
             ++ + K  +P    P P
Sbjct  716   EE-KNKTNKPTVCPPKP  731



>ref|XP_006351119.1| PREDICTED: uncharacterized protein LOC102605978 [Solanum tuberosum]
Length=753

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/772 (60%), Positives = 540/772 (70%), Gaps = 69/772 (9%)
 Frame = +2

Query  185   IDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngap  364
             +D G +GGEP VGR STSYEAAGGR+RFTVELRPGETTIVSWKKLLK+A       N   
Sbjct  1     MDGGFTGGEP-VGRTSTSYEAAGGRRRFTVELRPGETTIVSWKKLLKDAN----KSNVNV  55

Query  365   gpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYV  544
               +     A A +Q  +  P  ++     +P QP +KE KDAPPGNRLNAVIEKIERLYV
Sbjct  56    VGSGPTVGAPASIQTPVPHPALEAR---LAPGQPADKEVKDAPPGNRLNAVIEKIERLYV  112

Query  545   GKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPT  724
             GKQSDD+EDL+D PD+DEYDTEDSFIDDTELD+YFQVDNSAIKHDGFFVNRGKLERIEP 
Sbjct  113   GKQSDDEEDLNDFPDDDEYDTEDSFIDDTELDEYFQVDNSAIKHDGFFVNRGKLERIEPV  172

Query  725   SQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTL  904
             S +NQ P KRR+KD  K   G DDG NP+KP KVGKKAGK VP+ +  S PS+GV +  +
Sbjct  173   SPKNQQPKKRRRKDLAKSHVGDDDGHNPSKPVKVGKKAGKPVPVVSEASHPSHGVALQNV  232

Query  905   YREN-----------------ANVHN---------------QEVNFDMQKAEVLHSKNVV  988
               E                  A+  N               +E + D QK  V  SKN+ 
Sbjct  233   SHEENFPNQLNVSEIPITKKAADTQNMLELSPSASLRGNSEEEKDLDQQKIGVTQSKNLG  292

Query  989   DKLKESSET---SNQRSNERISVPQEKSS-GRSANISNGLDQSFQQGEKSVIYDQRLDAS  1156
             DKLK+ SE    S+QR ++R S  QEKS+ GRS NIS+G+DQS Q+       D++ + S
Sbjct  293   DKLKDGSEISGKSSQRLHDRSSYAQEKSNVGRSVNISDGIDQSVQR------RDEKFNVS  346

Query  1157  APEGKRSTQTV-------------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQ  1297
               EGK S QT+             R++GSS R K TMLEKAIRDLEK VAE RPPN EVQ
Sbjct  347   GFEGKNSAQTMVLPKTIQKDPAMQRKEGSSGRPKGTMLEKAIRDLEKIVAELRPPNMEVQ  406

Query  1298  DGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNL  1477
             D DNSSQAIKRRLP EIKQ+LAKVAR AQASHGK+S ELI+RLMSIVGHL+QLRTLKRNL
Sbjct  407   DADNSSQAIKRRLPLEIKQRLAKVARLAQASHGKISNELISRLMSIVGHLIQLRTLKRNL  466

Query  1478  KIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKE  1657
             KIM+NMGLSAKQEKDNRVQ IK+EVAEMIK R+P+MKSK +EQQ G SDDFQ  + EEKE
Sbjct  467   KIMVNMGLSAKQEKDNRVQHIKKEVAEMIKLRIPVMKSKLLEQQAGASDDFQEASPEEKE  526

Query  1658  AFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAI  1837
             AFKRKY MD ALE++ICDLYD +VEGL+EDAGPQVRKLYAELA  WPNGFMDNHGIKRAI
Sbjct  527   AFKRKYSMDVALEDKICDLYDHFVEGLDEDAGPQVRKLYAELAGCWPNGFMDNHGIKRAI  586

Query  1838  CRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGS  2017
             CRAKDRR+ L+ R K+ EK+RRNK+ A KE +  RV+     Q V IQEK  V   DH S
Sbjct  587   CRAKDRRRALHARRKDGEKIRRNKLLATKEGDTTRVDAGPIAQSVHIQEKIVV---DHSS  643

Query  2018  TATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHITTDALTKKKMKR  2197
             T+TNKP+SS+A++N   R+ V    G+ ++R K EK+KG   S+      DA+ KKKMKR
Sbjct  644   TSTNKPVSSSASVNASARMHVSIANGSDVNRLKQEKLKGGSGSSGDPRGPDAVPKKKMKR  703

Query  2198  KPEPELGEGQYLPEKLSSKQAEYKPQ-EPIAAAPVPKPSIQLNEPPSFEELT  2350
             K E ELGE  +  EKL+S QAE K +       P PKP+        FE+LT
Sbjct  704   KHESELGESLFHSEKLTSAQAEEKNKTNKHTGCPTPKPNNVATS--GFEQLT  753



>ref|XP_009785846.1| PREDICTED: uncharacterized protein LOC104234054 isoform X1 [Nicotiana 
sylvestris]
Length=749

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/745 (61%), Positives = 528/745 (71%), Gaps = 71/745 (10%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R STSYEAA GR+RFTVELRPGETTIVSWKKLLK+AT  QSN     GPAP  S+AAA  
Sbjct  14    RTSTSYEAAAGRRRFTVELRPGETTIVSWKKLLKDATISQSNAPNGAGPAPTTSSAAAAA  73

Query  404   QPLILPPHNDSPGPGF----SPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSddded  571
               +I PP    P P      +  QP +KE KDAPPGNRLNAVIEKIERLYVGKQSDD+ED
Sbjct  74    --VIQPP---LPHPSLETRLASGQPADKEVKDAPPGNRLNAVIEKIERLYVGKQSDDEED  128

Query  572   lddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNK  751
             L+D PD+DEYDTEDSFIDDTELD+YFQVDNSAIKHDGFFVNRGKLER+E  S +NQ P K
Sbjct  129   LNDFPDDDEYDTEDSFIDDTELDEYFQVDNSAIKHDGFFVNRGKLERVELVSPKNQQPKK  188

Query  752   RRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENANVHN  931
             RR+KD  K   G +DG +P+KP KVGKKAGK VP+  G+S PS+GV +  +  E     N
Sbjct  189   RRRKDLAKGHVGDNDGHSPSKPVKVGKKAGKPVPVVIGSSHPSHGVALQNVSHEGEKFLN  248

Query  932   ---------------------------------QEVNFDMQKAEVLHSKNVVDKLKESSE  1012
                                              QE +FD QK  V+ SKN+     E S 
Sbjct  249   QLNASEIPITKKAADTQSMLEQSPSVSLRGDSAQEKDFDQQKIGVIQSKNL--DGSEISG  306

Query  1013  TSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTV  1189
              S QR +++ S  QE++  GR  N+S+G+DQS Q+       D++ + S  EGK S QT+
Sbjct  307   NSTQR-HDKSSFAQERTVVGRPVNVSDGVDQSVQR------RDEKFNVSG-EGKNSVQTM  358

Query  1190  --------------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIK  1327
                           R++GSS R K TMLEKAIRDLEK VAESRPPN EVQD DNSSQAIK
Sbjct  359   VSCLLSTLKGPAMQRKEGSSGRPKGTMLEKAIRDLEKIVAESRPPNMEVQDADNSSQAIK  418

Query  1328  RRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSA  1507
             RRLPPE+KQKLAKVAR AQASHGK+S++LINRLMSIVGHL+QLRTLKRNLKIM+NMGLSA
Sbjct  419   RRLPPEVKQKLAKVARLAQASHGKISQDLINRLMSIVGHLIQLRTLKRNLKIMVNMGLSA  478

Query  1508  KQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDN  1687
             KQEKDNRV QIKREVAEMIK R+PLMKSK +EQQ G SDDFQ  + EEKEAFKRKY MD 
Sbjct  479   KQEKDNRVHQIKREVAEMIKLRIPLMKSKLLEQQAGASDDFQEASAEEKEAFKRKYSMDV  538

Query  1688  ALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
             ALE++ICDLYD +VEGL+EDAGPQVRKLYAELA +WPNGFMDNHGIKRAICRAKDRR+ L
Sbjct  539   ALEDKICDLYDHFVEGLDEDAGPQVRKLYAELAGFWPNGFMDNHGIKRAICRAKDRRRAL  598

Query  1868  YNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISST  2047
             + R K+ EK+RRNK+ A K EE  RV+     Q V IQEK  +   DH ST+TNKP+SST
Sbjct  599   HARRKDGEKIRRNKLLASKVEETGRVDAVPIAQSVHIQEKVVI---DHSSTSTNKPLSST  655

Query  2048  AAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHITTDALTKKKMKRKPEPELGEGQ  2227
             AA+N   R+PV S  G  +DR K EK+KG   S+      DAL KKK+KRK E ELGE Q
Sbjct  656   AAVNASTRMPVSSANGPDVDRLKQEKLKGASGSSVDPRAADALPKKKIKRKQESELGESQ  715

Query  2228  YLPEKLSSKQAEYKPQEPIAAAPVP  2302
             +  EKL+S++ + K  +P    P P
Sbjct  716   FHTEKLTSEE-KNKTNKPTVCPPKP  739



>ref|XP_009616473.1| PREDICTED: ubinuclein-1-like [Nicotiana tomentosiformis]
Length=703

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/666 (61%), Positives = 477/666 (72%), Gaps = 62/666 (9%)
 Frame = +2

Query  461   QPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELD  640
             QP +KE KDAPPGNRLNAVIEKIERLYVGKQSDD+EDL+D PD+DEYDTEDSFIDDTELD
Sbjct  42    QPADKEVKDAPPGNRLNAVIEKIERLYVGKQSDDEEDLNDFPDDDEYDTEDSFIDDTELD  101

Query  641   DYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPA  820
             +YFQVDNSAIKHDGFFVNRGKLER+E  S +NQ P KRR+KD  K   G DDG +P+KP 
Sbjct  102   EYFQVDNSAIKHDGFFVNRGKLERVELASPKNQQPKKRRRKDLAKSHVGDDDGHSPSKPV  161

Query  821   KVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENANVHN-----------------------  931
             KVGKKAGK VP+ +G+S PS+GV +  +  E     N                       
Sbjct  162   KVGKKAGKPVPVVSGSSHPSHGVALQNVSHEGEKFLNQLNASEIPITKKAADTQSMLEQS  221

Query  932   ----------QEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKS-SGRSA  1078
                       QE +FD QK  V+ SKN+     E S  S QR +++ S  QE+S  GR  
Sbjct  222   PSVSLRGDSAQEKDFDQQKIGVIQSKNL--DGSEISGNSTQR-HDKSSYAQERSVVGRPV  278

Query  1079  NISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTV--------------RRDGSSVRS  1216
             N+S+G+DQS Q+       D++ + S  EGK S QT+              R++GS+ R 
Sbjct  279   NVSDGVDQSVQR------RDEKFNVSG-EGKNSVQTMVSCLLPTLKGPAMQRKEGSTGRP  331

Query  1217  KITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHG  1396
             K TMLEKAIRDLEK VAESRPPN EVQD DNSSQAIKRRLPPE+KQKLAKVAR AQASHG
Sbjct  332   KGTMLEKAIRDLEKIVAESRPPNMEVQDADNSSQAIKRRLPPEVKQKLAKVARLAQASHG  391

Query  1397  KLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRV  1576
             K+S++LINRLMSIVGHL+QLRTLKRNLKIM+NMGLSAKQEKDNRV QIKREVAEMIK R+
Sbjct  392   KISQDLINRLMSIVGHLIQLRTLKRNLKIMVNMGLSAKQEKDNRVHQIKREVAEMIKLRI  451

Query  1577  PLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGP  1756
             PLMKSK +EQQ G SDDFQ  + EEKEAFKRKY MD ALE++ICDLYD +VEGL+EDAGP
Sbjct  452   PLMKSKLLEQQAGASDDFQEASAEEKEAFKRKYSMDVALEDKICDLYDHFVEGLDEDAGP  511

Query  1757  QVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEG  1936
             QVRKLYAELA +WPNGFMDNHGIKRAICRAKDRR+ L+ R K+ EK+RRNK+ A K EE 
Sbjct  512   QVRKLYAELAGFWPNGFMDNHGIKRAICRAKDRRRALHARRKDGEKIRRNKLLASKVEET  571

Query  1937  YRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRPK  2116
              RV+     Q V IQEK  +   DH ST+TNKP+SSTAA++   R+PV S  G  +DR K
Sbjct  572   GRVDAVPIAQSVHIQEKVVI---DHSSTSTNKPLSSTAAVSASTRMPVSSANGPDVDRLK  628

Query  2117  PEKVKGTGNSTDRHITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQ-EPIAAA  2293
              EK+KG   S+      DAL KKK+KRK E ELGE Q+  EKL+S QAE K +       
Sbjct  629   QEKLKGVSGSSVDPRAADALPKKKIKRKQESELGESQFHTEKLTSIQAEEKNKTNKQTVC  688

Query  2294  PVPKPS  2311
             P PKP+
Sbjct  689   PPPKPN  694



>ref|XP_009785849.1| PREDICTED: uncharacterized protein LOC104234054 isoform X3 [Nicotiana 
sylvestris]
Length=605

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/605 (64%), Positives = 441/605 (73%), Gaps = 67/605 (11%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R STSYEAA GR+RFTVELRPGETTIVSWKKLLK+AT  QSN     GPAP  S+AAA  
Sbjct  14    RTSTSYEAAAGRRRFTVELRPGETTIVSWKKLLKDATISQSNAPNGAGPAPTTSSAAAAA  73

Query  404   QPLILPPHNDSPGPGF----SPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSddded  571
               +I PP    P P      +  QP +KE KDAPPGNRLNAVIEKIERLYVGKQSDD+ED
Sbjct  74    --VIQPP---LPHPSLETRLASGQPADKEVKDAPPGNRLNAVIEKIERLYVGKQSDDEED  128

Query  572   lddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNK  751
             L+D PD+DEYDTEDSFIDDTELD+YFQVDNSAIKHDGFFVNRGKLER+E  S +NQ P K
Sbjct  129   LNDFPDDDEYDTEDSFIDDTELDEYFQVDNSAIKHDGFFVNRGKLERVELVSPKNQQPKK  188

Query  752   RRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENANVHN  931
             RR+KD  K   G +DG +P+KP KVGKKAGK VP+  G+S PS+GV +  +  E     N
Sbjct  189   RRRKDLAKGHVGDNDGHSPSKPVKVGKKAGKPVPVVIGSSHPSHGVALQNVSHEGEKFLN  248

Query  932   ---------------------------------QEVNFDMQKAEVLHSKNVVDKLKESSE  1012
                                              QE +FD QK  V+ SKN+     E S 
Sbjct  249   QLNASEIPITKKAADTQSMLEQSPSVSLRGDSAQEKDFDQQKIGVIQSKNL--DGSEISG  306

Query  1013  TSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTV  1189
              S QR +++ S  QE++  GR  N+S+G+DQS Q+       D++ + S  EGK S QT+
Sbjct  307   NSTQR-HDKSSFAQERTVVGRPVNVSDGVDQSVQR------RDEKFNVSG-EGKNSVQTM  358

Query  1190  --------------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIK  1327
                           R++GSS R K TMLEKAIRDLEK VAESRPPN EVQD DNSSQAIK
Sbjct  359   VSCLLSTLKGPAMQRKEGSSGRPKGTMLEKAIRDLEKIVAESRPPNMEVQDADNSSQAIK  418

Query  1328  RRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSA  1507
             RRLPPE+KQKLAKVAR AQASHGK+S++LINRLMSIVGHL+QLRTLKRNLKIM+NMGLSA
Sbjct  419   RRLPPEVKQKLAKVARLAQASHGKISQDLINRLMSIVGHLIQLRTLKRNLKIMVNMGLSA  478

Query  1508  KQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDN  1687
             KQEKDNRV QIKREVAEMIK R+PLMKSK +EQQ G SDDFQ  + EEKEAFKRKY MD 
Sbjct  479   KQEKDNRVHQIKREVAEMIKLRIPLMKSKLLEQQAGASDDFQEASAEEKEAFKRKYSMDV  538

Query  1688  ALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
             ALE++ICDLYD +VEGL+EDAGPQVRKLYAELA +WPNGFMDNHGIKRAICRAKDRR+ L
Sbjct  539   ALEDKICDLYDHFVEGLDEDAGPQVRKLYAELAGFWPNGFMDNHGIKRAICRAKDRRRAL  598

Query  1868  YNRHK  1882
             + R K
Sbjct  599   HARRK  603



>emb|CDP11001.1| unnamed protein product [Coffea canephora]
Length=817

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/679 (57%), Positives = 466/679 (69%), Gaps = 51/679 (8%)
 Frame = +2

Query  449   FSPEQPVEKEAKDAP-PGNRLNAVIEKIERLYVGKQSdddedlddvp-dedeydtedSFI  622
             FS  Q  EK   DAP P NRLN VIE+IERLYVG+ S D+EDL+DV  D+DEYDTEDSFI
Sbjct  140   FSGGQVGEKGETDAPQPPNRLNTVIERIERLYVGRASSDEEDLNDVVPDDDEYDTEDSFI  199

Query  623   DDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSDDGC  802
             DDTELD+YFQVDNSAIKHDGFFVNRGKLER+EP+   N+ P KRR+KD  K   GSDD  
Sbjct  200   DDTELDEYFQVDNSAIKHDGFFVNRGKLERVEPSMLPNEQPKKRRRKD-GKGLDGSDDAL  258

Query  803   NPNKPAKVGKKAGKSVPLAAGTSS--PSYGVVMPTLYRENANVHNQ----EVN-------  943
             NP K  K GKKAGK VP+    +S  P+  + +P ++ E+    NQ    EV+       
Sbjct  259   NPGKHLKAGKKAGKPVPMFGRNASGLPTV-IALPNVHGEDLKFQNQVNALEVSSKKRSHD  317

Query  944   --------------------FDMQKAEVLHSKNVVDKLKES---SETSNQRSNERISVPQ  1054
                                  + QK     + N  +++KE    S+TSNQRS E+ S  Q
Sbjct  318   SGEQPPLGVMNGDAVTLGKVSEQQKLGTHLANNQGNQMKEGCEYSDTSNQRSQEKTSYSQ  377

Query  1055  EKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR------RDGSSVRS  1216
              K     A  +  LDQS  Q EKS I  +R +    + K S Q VR      R+GSS R 
Sbjct  378   SKPLPGKALNNAALDQSIPQKEKSGIR-ERSEVGVADSKNSMQNVRVSYMQKREGSSARP  436

Query  1217  KITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHG  1396
             K T+LEKAIRDLEK VAESRPP AE QD DNSSQ +KRRLPPEIKQKLAKVAR AQASHG
Sbjct  437   KSTLLEKAIRDLEKMVAESRPPTAEAQDADNSSQGVKRRLPPEIKQKLAKVARLAQASHG  496

Query  1397  KLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRV  1576
             K+SKEL+NRLMSIVGHL+QLRTLKRNLKIM++MGLSAKQEKDNRVQ +K+EVAEMIK R+
Sbjct  497   KISKELVNRLMSIVGHLIQLRTLKRNLKIMVSMGLSAKQEKDNRVQLVKKEVAEMIKMRI  556

Query  1577  PLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGP  1756
             P MKSKA EQQ GTSDDFQ I+ EEKEAFKRKY +D+ALE++ICDLYDLY+EGLEEDAGP
Sbjct  557   PFMKSKAAEQQAGTSDDFQEISAEEKEAFKRKYSLDDALEDKICDLYDLYIEGLEEDAGP  616

Query  1757  QVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEG  1936
             QVRKLYAEL A WP+GFMDNHGIKRAI RAKDRR+ LY RHK+ EK++R K+ A+K E  
Sbjct  617   QVRKLYAELTALWPSGFMDNHGIKRAIYRAKDRRRALYGRHKDPEKIKRKKMLARKTEAA  676

Query  1937  YRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRPK  2116
              R+E  T  QPV IQEKS  D+ DHG+   N+P SS        R+PV    G+++DRPK
Sbjct  677   -RMEVHTVAQPVYIQEKSVADSSDHGTVLVNRPASSNTVAGAAVRMPVNFLNGSNVDRPK  735

Query  2117  PEKVKGTGNSTDRHITTDALTKKKMKRKPEPELGE-GQYLPEKLSSKQAE--YKPQEPIA  2287
              EK+KG+ ++    I ++ L  KK+KRKPE ELG+  Q+ PEKL S Q +   K  +   
Sbjct  736   QEKIKGSASAHPDAIASEILQSKKIKRKPETELGDAAQFRPEKLLSVQGDDKNKSHKVQV  795

Query  2288  AAPVPKPSIQLNEPPSFEE  2344
             A  +PK +     P +FE+
Sbjct  796   AGSLPKSNPHPTGPTNFEQ  814


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  230  STSYEAAGGRQRFTVELRPGETTIVSWKKLLKE  328
            +TS E  G R RF VELRPGETTIVSWKKLLK+
Sbjct  31   TTSVEVGGERLRFRVELRPGETTIVSWKKLLKD  63



>ref|XP_010664166.1| PREDICTED: uncharacterized protein LOC100255662 isoform X2 [Vitis 
vinifera]
Length=771

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/732 (53%), Positives = 485/732 (66%), Gaps = 75/732 (10%)
 Frame = +2

Query  227   VSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQ  406
             VS+ +  AG RQRFTVELRPGETTIVSWK+L+++A     + + AP              
Sbjct  30    VSSGFVKAGERQRFTVELRPGETTIVSWKRLIRDAQKASGSTSAAPEA------------  77

Query  407   PLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedldd  580
                  P N  P      +P QP E E  DAP  NR +AVIEKIERLY+GKQS D+EDLDD
Sbjct  78    -----PANAHPALESRIAPGQPAEGELNDAPAPNRFSAVIEKIERLYMGKQSSDEEDLDD  132

Query  581   vpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRK  760
              PD+D+YDTEDSFIDD ELD+YFQVDNSAIKHDGFFVNRGKLERIEP    N    KRR+
Sbjct  133   FPDDDQYDTEDSFIDDAELDEYFQVDNSAIKHDGFFVNRGKLERIEPPLSPNHQSKKRRR  192

Query  761   KDQTKCQSGSDDGCNPNKPAKVGKK-AGKSVPLAAGTSS-PSYGVVMPTLYRENANVHNQ  934
             KD  K Q  SDD   PNK  KVGK  +GKS  L A  +S PS    + + + E+    NQ
Sbjct  193   KDLAKAQGESDDANVPNKHVKVGKTVSGKSAALVAKNASVPSQAPAVTSEHGEDMKHQNQ  252

Query  935   ------------------------------------EVNFDMQKAEVLHSKNVVDKLKES  1006
                                                 EV  + QK  VL SKN+ +K+K++
Sbjct  253   SNASVICSKKKSADTKTTLDPSSLKVSNGSSSVALAEVKDERQKTVVLPSKNLGNKMKDA  312

Query  1007  ---SETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKR  1174
                S+ S+QR +++ +  Q KS SGR ++  + L+ + +  EK+ +  +  + +  E K 
Sbjct  313   SGFSDASHQRYHDKNAYTQLKSQSGRLSDNLSPLEVAARPREKNGVR-ELPETNVSESKC  371

Query  1175  STQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRL  1336
               QT       R+DGSS R K TMLEKAI +LE+ VAESRPP  +VQDGD SSQA+KRRL
Sbjct  372   MMQTTKASHIHRKDGSSARPKGTMLEKAITELERMVAESRPPTMDVQDGDTSSQAVKRRL  431

Query  1337  PPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQE  1516
             PPEIK KLAKVAR AQASHGK+SKEL+NRLMSI+GHL+QLRTLKRNLK+MINMGLSAKQE
Sbjct  432   PPEIKLKLAKVARLAQASHGKISKELLNRLMSILGHLIQLRTLKRNLKVMINMGLSAKQE  491

Query  1517  KDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALE  1696
             KD+R QQIK+EV EMIK RVP  +SK  +QQ G+SDDFQ I +EEK   KRK+ M + +E
Sbjct  492   KDDRFQQIKKEVIEMIKMRVPSPRSKGFDQQVGSSDDFQEIGSEEKGVLKRKFSMGDEME  551

Query  1697  NRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNR  1876
             ++ICDLYDLYV+GLE+DAGPQ+RKLYAELA  WPNG MDNHGIKRAICRAKDR++ LY+R
Sbjct  552   DKICDLYDLYVDGLEDDAGPQIRKLYAELAELWPNGSMDNHGIKRAICRAKDRKRALYSR  611

Query  1877  HKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPI--SSTA  2050
             HK+QEK++R K+   + E+  RVE+++  QP   +E+ A D+  HG TA++KP+  ++TA
Sbjct  612   HKDQEKIKRKKLLTSRTEDAVRVESSSIAQPQYARERPATDSGTHGLTASSKPVPNTTTA  671

Query  2051  AINMVGRIPVPSPGGTSLDRPKPEKVK-GTGNSTDRHITTDALTKKKMKRKPEPELGEGQ  2227
             A+    R+P PS  G SLD+ K EKVK  +GNS D     D    KK  +KPE E GE  
Sbjct  672   AV----RMPSPSVNGPSLDKVKQEKVKISSGNSLDDPRGVDGALPKKKAKKPELESGEAH  727

Query  2228  YLPEKLSSKQAE  2263
             + PEKL S+Q E
Sbjct  728   FRPEKLPSQQGE  739



>emb|CBI18967.3| unnamed protein product [Vitis vinifera]
Length=699

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/689 (55%), Positives = 471/689 (68%), Gaps = 61/689 (9%)
 Frame = +2

Query  227   VSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQ  406
             VS+ +  AG RQRFTVELRPGETTIVSWK+L+++A     + + AP              
Sbjct  30    VSSGFVKAGERQRFTVELRPGETTIVSWKRLIRDAQKASGSTSAAPEA------------  77

Query  407   PLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedldd  580
                  P N  P      +P QP E E  DAP  NR +AVIEKIERLY+GKQS D+EDLDD
Sbjct  78    -----PANAHPALESRIAPGQPAEGELNDAPAPNRFSAVIEKIERLYMGKQSSDEEDLDD  132

Query  581   vpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRK  760
              PD+D+YDTEDSFIDD ELD+YFQVDNSAIKHDGFFVNRGKLERIEP    N    KRR+
Sbjct  133   FPDDDQYDTEDSFIDDAELDEYFQVDNSAIKHDGFFVNRGKLERIEPPLSPNHQSKKRRR  192

Query  761   KDQTKCQSGSDDGCNPNKPAKVGKK-AGKSVPLAAGTSSPSYGVVMPTLYRENANVHNQE  937
             KD  K Q  SDD   PNK  KVGK  +GKS  L    +S    VV+P             
Sbjct  193   KDLAKAQGESDDANVPNKHVKVGKTVSGKSAALNQSNAST---VVLP-------------  236

Query  938   VNFDMQKAEVLHSKNVVDKLKES---SETSNQRSNERISVPQEKS-SGRSANISNGLDQS  1105
                         SKN+ +K+K++   S+ S+QR +++ +  Q KS SGR ++  + L+ +
Sbjct  237   ------------SKNLGNKMKDASGFSDASHQRYHDKNAYTQLKSQSGRLSDNLSPLEVA  284

Query  1106  FQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPN  1285
              +  EK+ +  + L  +     +S+   R+DGSS R K TMLEKAI +LE+ VAESRPP 
Sbjct  285   ARPREKNGV--RELPETNVSESKSSHIHRKDGSSARPKGTMLEKAITELERMVAESRPPT  342

Query  1286  AEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTL  1465
              +VQDGD SSQA+KRRLPPEIK KLAKVAR AQASHGK+SKEL+NRLMSI+GHL+QLRTL
Sbjct  343   MDVQDGDTSSQAVKRRLPPEIKLKLAKVARLAQASHGKISKELLNRLMSILGHLIQLRTL  402

Query  1466  KRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIAT  1645
             KRNLK+MINMGLSAKQEKD+R QQIK+EV EMIK RVP  +SK  +QQ G+SDDFQ I +
Sbjct  403   KRNLKVMINMGLSAKQEKDDRFQQIKKEVIEMIKMRVPSPRSKGFDQQVGSSDDFQEIGS  462

Query  1646  EEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGI  1825
             EEK   KRK+ M + +E++ICDLYDLYV+GLE+DAGPQ+RKLYAELA  WPNG MDNHGI
Sbjct  463   EEKGVLKRKFSMGDEMEDKICDLYDLYVDGLEDDAGPQIRKLYAELAELWPNGSMDNHGI  522

Query  1826  KRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDAR  2005
             KRAICRAKDR++ LY+RHK+QEK++R K+   + E+  RVE+++  QP   +E+ A D+ 
Sbjct  523   KRAICRAKDRKRALYSRHKDQEKIKRKKLLTSRTEDAVRVESSSIAQPQYARERPATDSG  582

Query  2006  DHGSTATNKPI--SSTAAINMVGRIPVPSPGGTSLDRPKPEKVK-GTGNSTDRHITTDAL  2176
              HG TA++KP+  ++TAA+    R+P PS  G SLD+ K EKVK  +GNS D     D  
Sbjct  583   THGLTASSKPVPNTTTAAV----RMPSPSVNGPSLDKVKQEKVKISSGNSLDDPRGVDGA  638

Query  2177  TKKKMKRKPEPELGEGQYLPEKLSSKQAE  2263
               KK  +KPE E GE  + PEKL S+Q E
Sbjct  639   LPKKKAKKPELESGEAHFRPEKLPSQQGE  667



>ref|XP_010664165.1| PREDICTED: ubinuclein-2-like isoform X1 [Vitis vinifera]
Length=772

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/733 (53%), Positives = 485/733 (66%), Gaps = 76/733 (10%)
 Frame = +2

Query  227   VSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQ  406
             VS+ +  AG RQRFTVELRPGETTIVSWK+L+++A     + + AP              
Sbjct  30    VSSGFVKAGERQRFTVELRPGETTIVSWKRLIRDAQKASGSTSAAPEA------------  77

Query  407   PLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedldd  580
                  P N  P      +P QP E E  DAP  NR +AVIEKIERLY+GKQS D+EDLDD
Sbjct  78    -----PANAHPALESRIAPGQPAEGELNDAPAPNRFSAVIEKIERLYMGKQSSDEEDLDD  132

Query  581   vpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRR  757
              PD+D+YDTEDSFIDD ELD+YFQVDNSAIKHDGFFVNRGKLERI EP    N    KRR
Sbjct  133   FPDDDQYDTEDSFIDDAELDEYFQVDNSAIKHDGFFVNRGKLERISEPPLSPNHQSKKRR  192

Query  758   KKDQTKCQSGSDDGCNPNKPAKVGKK-AGKSVPLAAGTSS-PSYGVVMPTLYRENANVHN  931
             +KD  K Q  SDD   PNK  KVGK  +GKS  L A  +S PS    + + + E+    N
Sbjct  193   RKDLAKAQGESDDANVPNKHVKVGKTVSGKSAALVAKNASVPSQAPAVTSEHGEDMKHQN  252

Query  932   Q------------------------------------EVNFDMQKAEVLHSKNVVDKLKE  1003
             Q                                    EV  + QK  VL SKN+ +K+K+
Sbjct  253   QSNASVICSKKKSADTKTTLDPSSLKVSNGSSSVALAEVKDERQKTVVLPSKNLGNKMKD  312

Query  1004  S---SETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGK  1171
             +   S+ S+QR +++ +  Q KS SGR ++  + L+ + +  EK+ +  +  + +  E K
Sbjct  313   ASGFSDASHQRYHDKNAYTQLKSQSGRLSDNLSPLEVAARPREKNGVR-ELPETNVSESK  371

Query  1172  RSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRR  1333
                QT       R+DGSS R K TMLEKAI +LE+ VAESRPP  +VQDGD SSQA+KRR
Sbjct  372   CMMQTTKASHIHRKDGSSARPKGTMLEKAITELERMVAESRPPTMDVQDGDTSSQAVKRR  431

Query  1334  LPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQ  1513
             LPPEIK KLAKVAR AQASHGK+SKEL+NRLMSI+GHL+QLRTLKRNLK+MINMGLSAKQ
Sbjct  432   LPPEIKLKLAKVARLAQASHGKISKELLNRLMSILGHLIQLRTLKRNLKVMINMGLSAKQ  491

Query  1514  EKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNAL  1693
             EKD+R QQIK+EV EMIK RVP  +SK  +QQ G+SDDFQ I +EEK   KRK+ M + +
Sbjct  492   EKDDRFQQIKKEVIEMIKMRVPSPRSKGFDQQVGSSDDFQEIGSEEKGVLKRKFSMGDEM  551

Query  1694  ENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYN  1873
             E++ICDLYDLYV+GLE+DAGPQ+RKLYAELA  WPNG MDNHGIKRAICRAKDR++ LY+
Sbjct  552   EDKICDLYDLYVDGLEDDAGPQIRKLYAELAELWPNGSMDNHGIKRAICRAKDRKRALYS  611

Query  1874  RHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPI--SST  2047
             RHK+QEK++R K+   + E+  RVE+++  QP   +E+ A D+  HG TA++KP+  ++T
Sbjct  612   RHKDQEKIKRKKLLTSRTEDAVRVESSSIAQPQYARERPATDSGTHGLTASSKPVPNTTT  671

Query  2048  AAINMVGRIPVPSPGGTSLDRPKPEKVK-GTGNSTDRHITTDALTKKKMKRKPEPELGEG  2224
             AA+    R+P PS  G SLD+ K EKVK  +GNS D     D    KK  +KPE E GE 
Sbjct  672   AAV----RMPSPSVNGPSLDKVKQEKVKISSGNSLDDPRGVDGALPKKKAKKPELESGEA  727

Query  2225  QYLPEKLSSKQAE  2263
              + PEKL S+Q E
Sbjct  728   HFRPEKLPSQQGE  740



>ref|XP_010664168.1| PREDICTED: uncharacterized protein LOC100255662 isoform X4 [Vitis 
vinifera]
Length=770

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/732 (53%), Positives = 484/732 (66%), Gaps = 76/732 (10%)
 Frame = +2

Query  227   VSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQ  406
             VS+ +  AG RQRFTVELRPGETTIVSWK+L+++A     + + AP              
Sbjct  30    VSSGFVKAGERQRFTVELRPGETTIVSWKRLIRDAQKASGSTSAAPEA------------  77

Query  407   PLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedldd  580
                  P N  P      +P QP E E  DAP  NR +AVIEKIERLY+GKQS D+EDLDD
Sbjct  78    -----PANAHPALESRIAPGQPAEGELNDAPAPNRFSAVIEKIERLYMGKQSSDEEDLDD  132

Query  581   vpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRK  760
              PD+D+YDTEDSFIDD ELD+YFQVDNSAIKHDGFFVNRGKLERIEP    N    KRR+
Sbjct  133   FPDDDQYDTEDSFIDDAELDEYFQVDNSAIKHDGFFVNRGKLERIEPPLSPNHQSKKRRR  192

Query  761   KDQTKCQSGSDDGCNPNKPAKVGKK-AGKSVPLAAGTSS-PSYGVVMPTLYRENANVHNQ  934
             KD  K Q  SDD   PNK  KVGK  +GKS  L A  +S PS    + + + E+    NQ
Sbjct  193   KDLAKAQGESDDANVPNKHVKVGKTVSGKSAALVAKNASVPSQAPAVTSEHGEDMKHQNQ  252

Query  935   ------------------------------------EVNFDMQKAEVLHSKNVVDKLKES  1006
                                                 EV  + QK  VL SKN+ +K+K++
Sbjct  253   SNASVICSKKKSADTKTTLDPSSLKVSNGSSSVALAEVKDERQKTVVLPSKNLGNKMKDA  312

Query  1007  ---SETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKR  1174
                S+ S+QR +++ +  Q KS SGR ++  + L+ + +  EK+ +  +  + +  E K 
Sbjct  313   SGFSDASHQRYHDKNAYTQLKSQSGRLSDNLSPLEVAARPREKNGVR-ELPETNVSESKC  371

Query  1175  STQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRL  1336
               QT       R+DGSS R K TMLEKAI +LE+ VAESRPP  +VQDGD SSQA+KRRL
Sbjct  372   MMQTTKASHIHRKDGSSARPKGTMLEKAITELERMVAESRPPTMDVQDGDTSSQAVKRRL  431

Query  1337  PPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQE  1516
             PPEIK KLAKVAR A ASHGK+SKEL+NRLMSI+GHL+QLRTLKRNLK+MINMGLSAKQE
Sbjct  432   PPEIKLKLAKVARLA-ASHGKISKELLNRLMSILGHLIQLRTLKRNLKVMINMGLSAKQE  490

Query  1517  KDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALE  1696
             KD+R QQIK+EV EMIK RVP  +SK  +QQ G+SDDFQ I +EEK   KRK+ M + +E
Sbjct  491   KDDRFQQIKKEVIEMIKMRVPSPRSKGFDQQVGSSDDFQEIGSEEKGVLKRKFSMGDEME  550

Query  1697  NRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNR  1876
             ++ICDLYDLYV+GLE+DAGPQ+RKLYAELA  WPNG MDNHGIKRAICRAKDR++ LY+R
Sbjct  551   DKICDLYDLYVDGLEDDAGPQIRKLYAELAELWPNGSMDNHGIKRAICRAKDRKRALYSR  610

Query  1877  HKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPI--SSTA  2050
             HK+QEK++R K+   + E+  RVE+++  QP   +E+ A D+  HG TA++KP+  ++TA
Sbjct  611   HKDQEKIKRKKLLTSRTEDAVRVESSSIAQPQYARERPATDSGTHGLTASSKPVPNTTTA  670

Query  2051  AINMVGRIPVPSPGGTSLDRPKPEKVK-GTGNSTDRHITTDALTKKKMKRKPEPELGEGQ  2227
             A+    R+P PS  G SLD+ K EKVK  +GNS D     D    KK  +KPE E GE  
Sbjct  671   AV----RMPSPSVNGPSLDKVKQEKVKISSGNSLDDPRGVDGALPKKKAKKPELESGEAH  726

Query  2228  YLPEKLSSKQAE  2263
             + PEKL S+Q E
Sbjct  727   FRPEKLPSQQGE  738



>ref|XP_006434287.1| hypothetical protein CICLE_v10000343mg [Citrus clementina]
 gb|ESR47527.1| hypothetical protein CICLE_v10000343mg [Citrus clementina]
Length=785

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/757 (53%), Positives = 498/757 (66%), Gaps = 74/757 (10%)
 Frame = +2

Query  239   YEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLIL  418
             +  +G RQ F VELRPGETT VSWKKL+K+A                 S +  + QP+  
Sbjct  46    FLKSGDRQVFVVELRPGETTYVSWKKLMKDAN----------KANKIPSKSTPDPQPVPR  95

Query  419   PPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdede  598
             P        G    Q  E + KD P  NR +AVIEKIERLY+GK S DDE+L+D+PD+D+
Sbjct  96    PNIESRVATG----QVEENKGKDEPAPNRFSAVIEKIERLYMGKDSSDDEELNDIPDDDQ  151

Query  599   ydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTK  775
             YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EPT   NQ P KRR+KD  K
Sbjct  152   YDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPTIMPNQQPKKRRRKDLPK  211

Query  776   CQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGV----------VMP--------  898
               + +DDG  PNK AK+ K A  KS PL  G + P+  +          V P        
Sbjct  212   AHNQNDDGRVPNKHAKLTKAATSKSAPL-VGKNIPTQNLGSKSGAHCDEVRPQNQLNASG  270

Query  899   ------------TLYRENANVHNQEVNFDMQKAE--------VLHSKNVVDKLKE---SS  1009
                         TL   +  V N + +  + +A+         L SK+V +KLK+    S
Sbjct  271   ISPKKKSSDHKTTLDPSSIKVLNGDASVSLAEAKDADRLKTGNLQSKSVSNKLKDISGPS  330

Query  1010  ETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQT  1186
             + S+Q+ +++ +  Q K  SG+     +GL+ S +Q EK+  + + LD +  EGK   QT
Sbjct  331   DASHQKYHDQNAHIQSKFQSGKLLQNIDGLEPSARQREKNGSH-ELLDINVSEGKHPLQT  389

Query  1187  V------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEI  1348
                    R+DGSSVR K +MLEKAIR+LEK VAESRPP  E Q+ DNSSQA+KRRLP EI
Sbjct  390   TKASHMHRKDGSSVRPKGSMLEKAIRELEKMVAESRPPAIENQEADNSSQAVKRRLPREI  449

Query  1349  KQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNR  1528
             K KLAKVAR AQAS GK+SKELINRLMSI+GHL+QLRTLKRNLKIMI+MGLSAKQEKDNR
Sbjct  450   KLKLAKVARLAQASQGKISKELINRLMSILGHLIQLRTLKRNLKIMISMGLSAKQEKDNR  509

Query  1529  VQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRIC  1708
              QQIK+EV EMIK+RVP ++SKA EQQ G SDDFQ I +EEK   KRKY MD+ALE++IC
Sbjct  510   FQQIKKEVVEMIKERVPSLESKAFEQQAGASDDFQEIGSEEKGVLKRKYRMDSALEDKIC  569

Query  1709  DLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQ  1888
             DLYDLYV+GL+EDAGPQ+RKLY ELA  WP GFMDNHGIKRAICRAK+R++ LY+RHK+Q
Sbjct  570   DLYDLYVDGLDEDAGPQIRKLYLELAELWPKGFMDNHGIKRAICRAKERKRELYSRHKDQ  629

Query  1889  EKMRRNKISAQK-EEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMV  2065
             EK++R K+ A K EEE  RVE ++  Q   ++E+S  D+  H     NKPI +TAA    
Sbjct  630   EKIKRKKMLATKIEEETVRVEASSTTQSQFMKERSVTDSGGHNLALANKPICNTAA---A  686

Query  2066  GRIPVPSP-GGTSLDRPKPEKVKG-TGNSTDRHITTD-ALTKKKMKRKPEPELGEGQYLP  2236
              +IP PS    +SLDR K EK+KG T NS D     D A+TKKK+KRKPE E+    + P
Sbjct  687   MKIPNPSANAASSLDRLKHEKLKGITINSMDEPKMVDGAITKKKVKRKPEQEVDGTYFHP  746

Query  2237  EKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             EKL+ +  E + +    +  +P K ++QLN P +FE+
Sbjct  747   EKLAGQSNEERHKSHKQSEILPQKLNLQLNSPSNFEQ  783



>ref|XP_010664167.1| PREDICTED: uncharacterized protein LOC100255662 isoform X3 [Vitis 
vinifera]
Length=771

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/733 (53%), Positives = 484/733 (66%), Gaps = 77/733 (11%)
 Frame = +2

Query  227   VSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQ  406
             VS+ +  AG RQRFTVELRPGETTIVSWK+L+++A     + + AP              
Sbjct  30    VSSGFVKAGERQRFTVELRPGETTIVSWKRLIRDAQKASGSTSAAPEA------------  77

Query  407   PLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedldd  580
                  P N  P      +P QP E E  DAP  NR +AVIEKIERLY+GKQS D+EDLDD
Sbjct  78    -----PANAHPALESRIAPGQPAEGELNDAPAPNRFSAVIEKIERLYMGKQSSDEEDLDD  132

Query  581   vpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRR  757
              PD+D+YDTEDSFIDD ELD+YFQVDNSAIKHDGFFVNRGKLERI EP    N    KRR
Sbjct  133   FPDDDQYDTEDSFIDDAELDEYFQVDNSAIKHDGFFVNRGKLERISEPPLSPNHQSKKRR  192

Query  758   KKDQTKCQSGSDDGCNPNKPAKVGKK-AGKSVPLAAGTSS-PSYGVVMPTLYRENANVHN  931
             +KD  K Q  SDD   PNK  KVGK  +GKS  L A  +S PS    + + + E+    N
Sbjct  193   RKDLAKAQGESDDANVPNKHVKVGKTVSGKSAALVAKNASVPSQAPAVTSEHGEDMKHQN  252

Query  932   Q------------------------------------EVNFDMQKAEVLHSKNVVDKLKE  1003
             Q                                    EV  + QK  VL SKN+ +K+K+
Sbjct  253   QSNASVICSKKKSADTKTTLDPSSLKVSNGSSSVALAEVKDERQKTVVLPSKNLGNKMKD  312

Query  1004  S---SETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGK  1171
             +   S+ S+QR +++ +  Q KS SGR ++  + L+ + +  EK+ +  +  + +  E K
Sbjct  313   ASGFSDASHQRYHDKNAYTQLKSQSGRLSDNLSPLEVAARPREKNGVR-ELPETNVSESK  371

Query  1172  RSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRR  1333
                QT       R+DGSS R K TMLEKAI +LE+ VAESRPP  +VQDGD SSQA+KRR
Sbjct  372   CMMQTTKASHIHRKDGSSARPKGTMLEKAITELERMVAESRPPTMDVQDGDTSSQAVKRR  431

Query  1334  LPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQ  1513
             LPPEIK KLAKVAR A ASHGK+SKEL+NRLMSI+GHL+QLRTLKRNLK+MINMGLSAKQ
Sbjct  432   LPPEIKLKLAKVARLA-ASHGKISKELLNRLMSILGHLIQLRTLKRNLKVMINMGLSAKQ  490

Query  1514  EKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNAL  1693
             EKD+R QQIK+EV EMIK RVP  +SK  +QQ G+SDDFQ I +EEK   KRK+ M + +
Sbjct  491   EKDDRFQQIKKEVIEMIKMRVPSPRSKGFDQQVGSSDDFQEIGSEEKGVLKRKFSMGDEM  550

Query  1694  ENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYN  1873
             E++ICDLYDLYV+GLE+DAGPQ+RKLYAELA  WPNG MDNHGIKRAICRAKDR++ LY+
Sbjct  551   EDKICDLYDLYVDGLEDDAGPQIRKLYAELAELWPNGSMDNHGIKRAICRAKDRKRALYS  610

Query  1874  RHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPI--SST  2047
             RHK+QEK++R K+   + E+  RVE+++  QP   +E+ A D+  HG TA++KP+  ++T
Sbjct  611   RHKDQEKIKRKKLLTSRTEDAVRVESSSIAQPQYARERPATDSGTHGLTASSKPVPNTTT  670

Query  2048  AAINMVGRIPVPSPGGTSLDRPKPEKVK-GTGNSTDRHITTDALTKKKMKRKPEPELGEG  2224
             AA+    R+P PS  G SLD+ K EKVK  +GNS D     D    KK  +KPE E GE 
Sbjct  671   AAV----RMPSPSVNGPSLDKVKQEKVKISSGNSLDDPRGVDGALPKKKAKKPELESGEA  726

Query  2225  QYLPEKLSSKQAE  2263
              + PEKL S+Q E
Sbjct  727   HFRPEKLPSQQGE  739



>gb|KDO80485.1| hypothetical protein CISIN_1g003939mg [Citrus sinensis]
Length=785

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/757 (52%), Positives = 496/757 (66%), Gaps = 74/757 (10%)
 Frame = +2

Query  239   YEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLIL  418
             +  +G RQ F VELRPGETT VSWKKL+K+A                 S +A + QP+  
Sbjct  46    FLKSGDRQVFVVELRPGETTYVSWKKLMKDAN----------KANKIPSKSAPDPQPVPR  95

Query  419   PPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdede  598
             P        G    Q  E + K+ P  NR +AVIEKIERLY+GK S DDE+L+D+PD+D+
Sbjct  96    PNIESRVASG----QAEENKGKEEPAPNRFSAVIEKIERLYMGKDSSDDEELNDIPDDDQ  151

Query  599   ydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTK  775
             YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EPT   NQ P KRR+KD  K
Sbjct  152   YDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPTIMPNQQPKKRRRKDLPK  211

Query  776   CQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGV----------VMP--------  898
               + +DDG  PNK AK+ K A  KS PL  G + P+  +          V P        
Sbjct  212   AHNQNDDGRVPNKHAKLTKAATSKSAPL-VGKNIPTQNLGSKSGAHCDEVRPQNQLNASG  270

Query  899   ------------TLYRENANVHNQEVNFDMQKAE--------VLHSKNVVDKLKE---SS  1009
                         TL   +  V N + +  + +A+         L SK+V +KLK+    S
Sbjct  271   ISPKKKSSDHKTTLDPSSIKVLNGDASVSLAEAKDADRLKTGNLQSKSVSNKLKDISGPS  330

Query  1010  ETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQT  1186
             + S+Q+ +++ +  Q K  SG+     + L+ S +Q EK+  + + LD +  EGK   QT
Sbjct  331   DASHQKYHDQNAHIQSKFQSGKLLQNIDDLEPSARQREKNGSH-ELLDINVSEGKHPLQT  389

Query  1187  V------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEI  1348
                    R+DGSSVR K +MLEKAIR+LEK VAESRPP  E Q+ DNSSQA+KRRLP EI
Sbjct  390   TKASHMHRKDGSSVRPKGSMLEKAIRELEKMVAESRPPAIENQEADNSSQAVKRRLPREI  449

Query  1349  KQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNR  1528
             K KLAKVAR AQAS GK+SKELINRLMSI+GHL+QLRTLKRNLKIMI+MGLSAKQEKDNR
Sbjct  450   KLKLAKVARLAQASQGKISKELINRLMSILGHLIQLRTLKRNLKIMISMGLSAKQEKDNR  509

Query  1529  VQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRIC  1708
              QQIK+EV EMIK+RVP ++SKA EQQ G SDDFQ I +EEK   KRKY MD+ALE++IC
Sbjct  510   FQQIKKEVVEMIKERVPSLESKAYEQQAGASDDFQEIGSEEKGVLKRKYRMDSALEDKIC  569

Query  1709  DLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQ  1888
             DLYDLYV+GL+EDAGPQ+RKLY ELA  WP GFMDNHGIKRAICRAK+R++ LY+RHK+Q
Sbjct  570   DLYDLYVDGLDEDAGPQIRKLYLELAELWPKGFMDNHGIKRAICRAKERKRELYSRHKDQ  629

Query  1889  EKMRRNKISAQK-EEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMV  2065
             EK++R K+ A K EEE  RVE ++  Q   ++E+   D+  H     NKPI +T A    
Sbjct  630   EKIKRKKMLATKIEEETVRVEASSTTQSQFMKERLVTDSGGHNLALANKPICNTTA---A  686

Query  2066  GRIPVPSP-GGTSLDRPKPEKVKG-TGNSTDRHITTD-ALTKKKMKRKPEPELGEGQYLP  2236
              +IP PS    +SLDR K EK+KG T NS D     D A+TKKK+KRKPE E+    + P
Sbjct  687   MKIPNPSANAASSLDRLKHEKLKGITINSMDEPKMVDGAITKKKVKRKPEQEVDGTYFHP  746

Query  2237  EKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             EKL+ +  E + +    +  +P K ++QLN P +FE+
Sbjct  747   EKLAGQSNEERHKSHKQSEILPQKLNLQLNTPSNFEQ  783



>ref|XP_006472851.1| PREDICTED: uncharacterized protein PF11_0207-like isoform X1 
[Citrus sinensis]
Length=785

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/757 (52%), Positives = 495/757 (65%), Gaps = 74/757 (10%)
 Frame = +2

Query  239   YEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLIL  418
             +  +G RQ F VELRPGETT VSWKKL+K+A                 S +A + QP+  
Sbjct  46    FLKSGDRQVFVVELRPGETTYVSWKKLMKDAN----------KANKIPSKSAPDPQPVPR  95

Query  419   PPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdede  598
             P        G    Q  E + K+ P  NR +AVIEKIERLY+GK S DDE+L+D+PD+D+
Sbjct  96    PNIESRVASG----QAEENKGKEEPAPNRFSAVIEKIERLYMGKDSSDDEELNDIPDDDQ  151

Query  599   ydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTK  775
             YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EPT   NQ P KRR+KD  K
Sbjct  152   YDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPTIMPNQQPKKRRRKDLPK  211

Query  776   CQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGV----------VMP--------  898
               + +DDG  PNK AK+ K A  KS PL  G + P+  +          V P        
Sbjct  212   AHNQNDDGRVPNKHAKLTKAATSKSAPLV-GKNIPTQNLGLKSGAHCDEVRPQNQLNASG  270

Query  899   ------------TLYRENANVHNQEVNFDMQKAE--------VLHSKNVVDKLKE---SS  1009
                         TL   +  V N + +  + +A+         L SK+V +KLK+    S
Sbjct  271   ISSKKKSSDHKTTLDPSSIKVSNGDASLSLAEAKDADRLKTGNLQSKSVSNKLKDISGPS  330

Query  1010  ETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQT  1186
             + S+Q+ +++ +  Q K  SG+     + L+ S +Q EK+  + + LD +  EGK   QT
Sbjct  331   DASHQKYHDQNAHIQSKFQSGKLLQNIDDLEPSARQREKNGSH-ELLDINVSEGKHPLQT  389

Query  1187  V------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEI  1348
                    R+DGSSVR K +MLEKAIR+LEK VAESRPP  E Q+ DNSSQA+KRRLP EI
Sbjct  390   TKASHMHRKDGSSVRPKGSMLEKAIRELEKMVAESRPPAIENQEADNSSQAVKRRLPREI  449

Query  1349  KQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNR  1528
             K KLAKVAR AQAS GK+SKELINRLMSI+GHL+QLRTLKRNLKIMI+MGLSAKQEKDNR
Sbjct  450   KLKLAKVARLAQASQGKISKELINRLMSILGHLIQLRTLKRNLKIMISMGLSAKQEKDNR  509

Query  1529  VQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRIC  1708
              QQIK+EV EMIK+RVP ++SKA EQQ G SDDFQ I +EEK   KRKY MD+ALE++IC
Sbjct  510   FQQIKKEVVEMIKERVPSLESKAYEQQAGASDDFQEIGSEEKGVLKRKYRMDSALEDKIC  569

Query  1709  DLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQ  1888
             DLYDLYV+GL+EDAGPQ+RKLY ELA  WP GFMDNHGIKRAICRAK+R++ LY+RHK+Q
Sbjct  570   DLYDLYVDGLDEDAGPQIRKLYLELAELWPKGFMDNHGIKRAICRAKERKRELYSRHKDQ  629

Query  1889  EKMRRNKISAQK-EEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMV  2065
             EK++R K+ A K EEE  RVE ++  Q   ++E+   D+  H     NKPI +T A    
Sbjct  630   EKIKRKKMLATKIEEETVRVEASSTTQSQFMKERLVTDSGGHNLALANKPICNTTA---A  686

Query  2066  GRIPVPSP-GGTSLDRPKPEKVKG-TGNSTDRHITTD-ALTKKKMKRKPEPELGEGQYLP  2236
              +IP PS    +SLDR K EK+KG T NS D     D A+TKKK+KRKPE E+    + P
Sbjct  687   MKIPNPSANAASSLDRLKHEKLKGITINSMDEPKMVDGAITKKKVKRKPEQEMDGTYFHP  746

Query  2237  EKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             EKL+ +  E + +    +  +P K ++QLN   +FE+
Sbjct  747   EKLAGQSNEERHKSHKQSEILPQKLNLQLNTSSNFEQ  783



>ref|XP_006472852.1| PREDICTED: uncharacterized protein PF11_0207-like isoform X2 
[Citrus sinensis]
Length=784

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/757 (52%), Positives = 494/757 (65%), Gaps = 75/757 (10%)
 Frame = +2

Query  239   YEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLIL  418
             +  +G RQ F VELRPGETT VSWKKL+K+A                 S +A + QP+  
Sbjct  46    FLKSGDRQVFVVELRPGETTYVSWKKLMKDAN----------KANKIPSKSAPDPQPVPR  95

Query  419   PPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdede  598
             P        G    Q  E + K+ P  NR +AVIEKIERLY+GK S DDE+L+D+PD+D+
Sbjct  96    PNIESRVASG----QAEENKGKEEPAPNRFSAVIEKIERLYMGKDSSDDEELNDIPDDDQ  151

Query  599   ydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTK  775
             YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EPT   NQ P KRR+KD  K
Sbjct  152   YDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPTIMPNQQPKKRRRKDLPK  211

Query  776   CQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGV----------VMP--------  898
               + +DDG  PNK AK+ K A  KS PL  G + P+  +          V P        
Sbjct  212   AHNQNDDGRVPNKHAKLTKAATSKSAPLV-GKNIPTQNLGLKSGAHCDEVRPQNQLNASG  270

Query  899   ------------TLYRENANVHNQEVNFDMQKAE--------VLHSKNVVDKLKE---SS  1009
                         TL   +  V N + +  + +A+         L SK+V +KLK+    S
Sbjct  271   ISSKKKSSDHKTTLDPSSIKVSNGDASLSLAEAKDADRLKTGNLQSKSVSNKLKDISGPS  330

Query  1010  ETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQT  1186
             + S+Q+ +++ +  Q K  SG+     + L+ S +Q EK+  + + LD +  EGK   QT
Sbjct  331   DASHQKYHDQNAHIQSKFQSGKLLQNIDDLEPSARQREKNGSH-ELLDINVSEGKHPLQT  389

Query  1187  V------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEI  1348
                    R+DGSSVR K +MLEKAIR+LEK VAESRPP  E Q+ DNSSQA+KRRLP EI
Sbjct  390   TKASHMHRKDGSSVRPKGSMLEKAIRELEKMVAESRPPAIENQEADNSSQAVKRRLPREI  449

Query  1349  KQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNR  1528
             K KLAKVAR A AS GK+SKELINRLMSI+GHL+QLRTLKRNLKIMI+MGLSAKQEKDNR
Sbjct  450   KLKLAKVARLA-ASQGKISKELINRLMSILGHLIQLRTLKRNLKIMISMGLSAKQEKDNR  508

Query  1529  VQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRIC  1708
              QQIK+EV EMIK+RVP ++SKA EQQ G SDDFQ I +EEK   KRKY MD+ALE++IC
Sbjct  509   FQQIKKEVVEMIKERVPSLESKAYEQQAGASDDFQEIGSEEKGVLKRKYRMDSALEDKIC  568

Query  1709  DLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQ  1888
             DLYDLYV+GL+EDAGPQ+RKLY ELA  WP GFMDNHGIKRAICRAK+R++ LY+RHK+Q
Sbjct  569   DLYDLYVDGLDEDAGPQIRKLYLELAELWPKGFMDNHGIKRAICRAKERKRELYSRHKDQ  628

Query  1889  EKMRRNKISAQK-EEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMV  2065
             EK++R K+ A K EEE  RVE ++  Q   ++E+   D+  H     NKPI +T A    
Sbjct  629   EKIKRKKMLATKIEEETVRVEASSTTQSQFMKERLVTDSGGHNLALANKPICNTTA---A  685

Query  2066  GRIPVPSP-GGTSLDRPKPEKVKG-TGNSTDRHITTD-ALTKKKMKRKPEPELGEGQYLP  2236
              +IP PS    +SLDR K EK+KG T NS D     D A+TKKK+KRKPE E+    + P
Sbjct  686   MKIPNPSANAASSLDRLKHEKLKGITINSMDEPKMVDGAITKKKVKRKPEQEMDGTYFHP  745

Query  2237  EKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             EKL+ +  E + +    +  +P K ++QLN   +FE+
Sbjct  746   EKLAGQSNEERHKSHKQSEILPQKLNLQLNTSSNFEQ  782



>ref|XP_011102226.1| PREDICTED: uncharacterized protein LOC105180235 isoform X3 [Sesamum 
indicum]
Length=727

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/726 (50%), Positives = 474/726 (65%), Gaps = 29/726 (4%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R  +S+E+AGGR RFTVELRPGETTIVSWKKLL+EAT      +   G  P AS  ++E 
Sbjct  14    RPMSSFESAGGRLRFTVELRPGETTIVSWKKLLREATS-----SKVSGSGPSASCPSSEA  68

Query  404   QPLILPPHNDSPGPGFSPEQPVEKEAKDAPPG----NRLNAVIEKIERLYVGKQSddded  571
                 +      P    S +QP E EAKD P G    NRL+ VIEKIER+Y G  S ++ED
Sbjct  69    YQQPVSQPPLPPPTVASLKQPEENEAKD-PQGQAGTNRLSTVIEKIERMYAGHGSSEEED  127

Query  572   lddvpdedeydted--SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLP  745
             +      D+ + +   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER+EPT   NQ P
Sbjct  128   VPLDDVPDDDEYDTEDSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERMEPTISTNQQP  187

Query  746   NKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENANV  925
              KRR+KD TK Q G DDG NPNK  K+G K    V L   T      +++  L   + + 
Sbjct  188   KKRRRKDVTKGQVGMDDGHNPNKHVKIGNKDAAEVSLKKKTVDTQ--IMVDPLGLSSVDG  245

Query  926   HNQEVNFDMQKAEVLHSKNVVDKLKESSE----TSNQRSNERISVPQEKSSGRSANISNG  1093
               Q+ + D Q+  V+ S+N  +  KESSE    T  QR N++ S   +  SG+  +  +G
Sbjct  246   IRQDKDADQQRTRVISSQNHNNHRKESSELQDDTLAQRPNDKSSHVSKSHSGKQLSNVDG  305

Query  1094  LDQSFQQGEKSVIYDQRLDASAPEGKRSTQTV-----RRDGSSVRSKITMLEKAIRDLEK  1258
             LDQ+ Q+ EK  +  +R D + P  + S  T      R++GS  R KI ML+KAIR+LEK
Sbjct  306   LDQAIQRKEKGGLV-ERFDLNIPASRDSQITKVPLMPRKEGSHFRQKIAMLDKAIRELEK  364

Query  1259  FVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIV  1438
              VAESRPP+ EVQD DNSSQA+KRRLPPEIKQKLAKVAR AQAS+GK+ K++I+RLMSI+
Sbjct  365   IVAESRPPSTEVQDPDNSSQAVKRRLPPEIKQKLAKVARLAQASYGKIPKDVISRLMSIL  424

Query  1439  GHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGT  1618
             GHL+QLRTLKRNLK+M N+GLSAKQEKD+R+Q+IK+E+AEM+K R+P + SK +E Q   
Sbjct  425   GHLMQLRTLKRNLKVMANLGLSAKQEKDDRLQKIKQEIAEMVKQRIPYINSK-VEHQTTN  483

Query  1619  SDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWP  1798
             SD+FQ    + K+ F++KY MD+ LEN+ICDLYDLYVE LEED GP VR+LY ELAA WP
Sbjct  484   SDNFQEAGAQGKDTFRQKYSMDDVLENKICDLYDLYVEKLEEDLGPPVRRLYEELAALWP  543

Query  1799  NGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQI  1978
             +G MD  GIKRAI ++KDRR+ L  R K+QEKM++ K+ A K E   R E  + +  + +
Sbjct  544   SGVMDTDGIKRAIYKSKDRRRALSGRRKDQEKMKK-KMLAPKTENTTRGEAVSVNPALPV  602

Query  1979  QEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTD-R  2155
              EK    + D     T+KP+ S AA++   R+PVP     ++D+ K E++KG+ +S    
Sbjct  603   HEKLLAGSCDQALPLTSKPVLS-AAVSPAARMPVPLANSQNVDKLKHERLKGSSSSNPVD  661

Query  2156  HITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAEYKP-QEPIAAAPVPKPSIQLNEPP  2332
              ++TD L KKK+KRKP  E+ E QY  +KL   Q E +       A P+PK  +Q   P 
Sbjct  662   AVSTDVLPKKKVKRKPNSEIVEAQYRLDKLEVSQVEERHRHHKHMAVPLPKSDLQPAAPS  721

Query  2333  SFEELT  2350
               E L+
Sbjct  722   GSENLS  727



>ref|XP_007019214.1| Wound-responsive family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY16439.1| Wound-responsive family protein, putative isoform 1 [Theobroma 
cacao]
Length=740

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/696 (54%), Positives = 473/696 (68%), Gaps = 38/696 (5%)
 Frame = +2

Query  248   AGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPH  427
             AG RQ FTVELRPGETT VSWKKL+K+A     +   A   A   SA          PP 
Sbjct  30    AGDRQVFTVELRPGETTYVSWKKLVKDANRGNGSSAAAAMVAVATSAPE--------PPP  81

Query  428   NDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedey  601
             N  P      +P Q  EKE KD PP NR +AVIEKIERLY+GK S D+E+LD+ PD+D+Y
Sbjct  82    NAHPNLQSRIAPGQAAEKETKDEPPPNRFSAVIEKIERLYMGKDSSDEEELDETPDDDQY  141

Query  602   dtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKC  778
             DTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLER+ EP    NQ P KRR+KD  K 
Sbjct  142   DTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERVNEPLVILNQQPKKRRRKDAAKP  201

Query  779   QSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGVVMPTLYRENANV--HNQEVNFD  949
                SDDG   NK  K  K   G++ P + G ++ ++   +  L  +  +V   NQ    D
Sbjct  202   AGESDDGRVSNKHVKAAKMTPGRAEP-SLGRNNSNHSQNLTALNEQYGDVKAQNQLSVSD  260

Query  950   MQKAE-----VLHSKNVV-DKLKESS---ETSNQRSNERISVPQEKS-SGRSANISNGLD  1099
             ++  E     VL SKNVV +KLK++S   +  +Q+ +++ +  Q KS  G+     + L+
Sbjct  261   VKDTEKSKMGVLQSKNVVSNKLKDASGSYDVLHQKYHDKNAYLQSKSPHGKPIGNVDELE  320

Query  1100  QSFQQGEKSVIYDQRLDASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKF  1261
              S +  EK+ I + + D +  +GK +  T       +RDGS++R K +MLEKAIR+LEK 
Sbjct  321   LSVRLREKNGIRELQ-DTNVSDGKYAMHTAKSSHMQKRDGSTLRPKSSMLEKAIRELEKM  379

Query  1262  VAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVG  1441
             VAESRPP  E QD DNSSQ IKRRLP EIK KLAKVAR A AS GK+SKEL+NRLMSI+G
Sbjct  380   VAESRPPAMENQDADNSSQGIKRRLPREIKFKLAKVARLA-ASQGKVSKELLNRLMSILG  438

Query  1442  HLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTS  1621
             HL+QLRTLKRNLKIMI+ GLSAKQEKD+R QQ+K+EV EMIK RVP ++ KA+EQQ G S
Sbjct  439   HLIQLRTLKRNLKIMISTGLSAKQEKDDRFQQVKKEVVEMIKTRVPSLEPKALEQQAGAS  498

Query  1622  DDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPN  1801
             D FQ + TEE+ A KRK+ MD +LE++ICDLYDLYV+GL+ED+GPQ+RKLY ELA  WPN
Sbjct  499   DGFQEVGTEER-ALKRKFSMDTSLEDKICDLYDLYVDGLDEDSGPQIRKLYIELAQLWPN  557

Query  1802  GFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQ  1981
             G MDNHGIKRAICRAK+RR+ +YNRHK+QEK+RR K+ A + EE  RVE+ +  Q    +
Sbjct  558   GLMDNHGIKRAICRAKERRRAMYNRHKDQEKIRRKKMLAPRLEESVRVESASSAQIQHSR  617

Query  1982  EKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKG-TGNSTDRH  2158
             E+ A D+  H   +TNK +SS  A  +  R P PS  G+SLDR K +K+KG + N+ D  
Sbjct  618   ERLAPDSGSHAIPSTNKSVSSAPAGAV--RTPSPSTNGSSLDRLKQDKLKGISSNAMDEM  675

Query  2159  ITTD-ALTKKKMKRKPEPELGEGQYLPEKLSSKQAE  2263
                D +L KKK+KRKPE EL E  + PEKL  +Q +
Sbjct  676   KVADGSLPKKKVKRKPEMELDETHFRPEKLPLQQGD  711



>ref|XP_011102221.1| PREDICTED: ubinuclein-1-like isoform X2 [Sesamum indicum]
Length=762

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/759 (49%), Positives = 483/759 (64%), Gaps = 60/759 (8%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R  +S+E+AGGR RFTVELRPGETTIVSWKKLL+EAT      +   G  P AS  ++E 
Sbjct  14    RPMSSFESAGGRLRFTVELRPGETTIVSWKKLLREATS-----SKVSGSGPSASCPSSEA  68

Query  404   QPLILPPHNDSPGPGFSPEQPVEKEAKDAPPG----NRLNAVIEKIERLYVGKQSddded  571
                 +      P    S +QP E EAKD P G    NRL+ VIEKIER+Y G  S ++ED
Sbjct  69    YQQPVSQPPLPPPTVASLKQPEENEAKD-PQGQAGTNRLSTVIEKIERMYAGHGSSEEED  127

Query  572   lddvpdedeydted--SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLP  745
             +      D+ + +   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER+EPT   NQ P
Sbjct  128   VPLDDVPDDDEYDTEDSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERMEPTISTNQQP  187

Query  746   NKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTS-SPSYGVVMPTLYREN--  916
              KRR+KD TK Q G DDG NPNK  K+G K  K++      S + S+ V +P+++R +  
Sbjct  188   KKRRRKDVTKGQVGMDDGHNPNKHVKIGNKGRKALSSNERNSMNQSHIVALPSVHRSDLL  247

Query  917   --------ANVH-----------------------NQEVNFDMQKAEVLHSKNVVDKLKE  1003
                     A V                         Q+ + D Q+  V+ S+N  +  KE
Sbjct  248   FEASPTDAAEVSLKKKTVDTQIMVDPLGLSSVDGIRQDKDADQQRTRVISSQNHNNHRKE  307

Query  1004  SSE----TSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGK  1171
             SSE    T  QR N++ S   +  SG+  +  +GLDQ+ Q+ EK  +  +R D + P  +
Sbjct  308   SSELQDDTLAQRPNDKSSHVSKSHSGKQLSNVDGLDQAIQRKEKGGLV-ERFDLNIPASR  366

Query  1172  RSTQTV----RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLP  1339
              S  TV    R++GS  R KI ML+KAIR+LEK VAESRPP+ EVQD DNSSQA+KRRLP
Sbjct  367   DSQITVPLMPRKEGSHFRQKIAMLDKAIRELEKIVAESRPPSTEVQDPDNSSQAVKRRLP  426

Query  1340  PEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEK  1519
             PEIKQKLAKVAR AQAS+GK+ K++I+RLMSI+GHL+QLRTLKRNLK+M N+GLSAKQEK
Sbjct  427   PEIKQKLAKVARLAQASYGKIPKDVISRLMSILGHLMQLRTLKRNLKVMANLGLSAKQEK  486

Query  1520  DNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALEN  1699
             D+R+Q+IK+E+AEM+K R+P + SK +E Q   SD+FQ    + K+ F++KY MD+ LEN
Sbjct  487   DDRLQKIKQEIAEMVKQRIPYINSK-VEHQTTNSDNFQEAGAQGKDTFRQKYSMDDVLEN  545

Query  1700  RICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRH  1879
             +ICDLYDLYVE LEED GP VR+LY ELAA WP+G MD  GIKRAI ++KDRR+ L  R 
Sbjct  546   KICDLYDLYVEKLEEDLGPPVRRLYEELAALWPSGVMDTDGIKRAIYKSKDRRRALSGRR  605

Query  1880  KNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAIN  2059
             K+QEKM++ K+ A K E   R E  + +  + + EK    + D     T+KP+ S AA++
Sbjct  606   KDQEKMKK-KMLAPKTENTTRGEAVSVNPALPVHEKLLAGSCDQALPLTSKPVLS-AAVS  663

Query  2060  MVGRIPVPSPGGTSLDRPKPEKVKGTGNSTD-RHITTDALTKKKMKRKPEPELGEGQYLP  2236
                R+PVP     ++D+ K E++KG+ +S     ++TD L KKK+KRKP  E+ E QY  
Sbjct  664   PAARMPVPLANSQNVDKLKHERLKGSSSSNPVDAVSTDVLPKKKVKRKPNSEIVEAQYRL  723

Query  2237  EKLSSKQAEYKP-QEPIAAAPVPKPSIQLNEPPSFEELT  2350
             +KL   Q E +       A P+PK  +Q   P   E L+
Sbjct  724   DKLEVSQVEERHRHHKHMAVPLPKSDLQPAAPSGSENLS  762



>ref|XP_008219579.1| PREDICTED: uncharacterized protein LOC103319767 isoform X2 [Prunus 
mume]
Length=751

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/776 (50%), Positives = 501/776 (65%), Gaps = 83/776 (11%)
 Frame = +2

Query  185   IDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngap  364
             ++E   GGE    R S+ +  AG RQ FTVELRPGETTIVSWKKLLK+   +      + 
Sbjct  1     MEEEKGGGESS--RASSRFVKAGDRQMFTVELRPGETTIVSWKKLLKDTNKVNGPSTSSA  58

Query  365   gpaprasaaaaELQPLILPPHNDSPG--PGFSPEQPVE-KEAKDAPPGNRLNAVIEKIER  535
                          +P   PP N  P      +P Q +   E KD    +R +AVIEKIER
Sbjct  59    P------------EP---PPANAHPALESRIAPVQQLSGDEVKDEAAPHRFSAVIEKIER  103

Query  536   LYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI  715
             LY+GK S DDEDL+D+PD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI
Sbjct  104   LYMGKDSSDDEDLNDIPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERI  163

Query  716   EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVP--LAAGTSSPSYGV  889
              P +  NQLP KRR+K + K    +DD   PNK AKVGK A   +   L   +S+P   V
Sbjct  164   VPAALPNQLPKKRRRK-EAKGPGENDDSHVPNKHAKVGKTAAAKITSTLVKNSSAPIQTV  222

Query  890   VMPTLYRENANVHNQ------------------------------------EV-NFDMQK  958
              +PT + E+    NQ                                    EV + D QK
Sbjct  223   TVPTEHCEDVKFQNQLNVCGLSSTKKSTDSKTILDPSLLKVSEGDAAALQAEVKDMDKQK  282

Query  959   AEVLHSKNVVDKLKE---SSETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEKS  1126
               +L SK+  ++ K+   SS+ S Q+ +E+ +  Q K  SGR ++ ++ + ++ +  EK+
Sbjct  283   TGILLSKDPSNRFKDAGGSSDGSYQKYHEKSAYAQTKPQSGRPSSNADEM-ETVRAREKN  341

Query  1127  VIYDQRLDASAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNA  1288
              +  +  D +  +GK +  T +      RD SSVRSK +MLEKAI DLEK VAESRPP A
Sbjct  342   GVC-EIPDLNLTDGKYAVPTTKPSHGHKRDSSSVRSKSSMLEKAITDLEKMVAESRPPAA  400

Query  1289  EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLK  1468
             + QD DN SQAIKRRLP EIK KLAKVAR AQASHGK++KEL+NRLM+I+GHL+QLRTLK
Sbjct  401   DNQDADNLSQAIKRRLPREIKAKLAKVARLAQASHGKITKELLNRLMNILGHLIQLRTLK  460

Query  1469  RNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATE  1648
             RNLK+MI+MGLSAK+EKD+R QQIKREV +MIK + P  +SKA++QQ G SDDFQ I++ 
Sbjct  461   RNLKVMISMGLSAKKEKDDRFQQIKREVIDMIKIKAPSSESKALQQQSGASDDFQEISSG  520

Query  1649  EKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIK  1828
              KE  KRK+ MD ALE++ICDLYDL+V+GL+EDAGPQ+RKLYAELA  WPNGFMDNHGIK
Sbjct  521   AKELSKRKFSMDAALEDKICDLYDLFVDGLDEDAGPQIRKLYAELAGLWPNGFMDNHGIK  580

Query  1829  RAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARD  2008
             RAICR+K+RR+  Y R+K+QEKMRR K+ A + EE  R+E ++  Q   ++E+ A +   
Sbjct  581   RAICRSKERRRERYGRNKDQEKMRRKKMLAPRTEETVRLEASSIAQQQYMRERLATEPSS  640

Query  2009  HGSTATNKPISSTAAINMVGRIPVPSP-GGTSLDRPKPEKVKGTGNST--DRHITTDALT  2179
             H  + TNK +S TAA      +  PSP  G S DR K EK+KG+ +++  D  +   ALT
Sbjct  641   H--SLTNKAVSGTAAA-----VRTPSPINGPSFDRLKQEKLKGSSSNSPDDARVGDGALT  693

Query  2180  KKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             KKK+KRKPE EL E +  PEKL S+Q E + +    AA +P K ++Q    PS E+
Sbjct  694   KKKVKRKPEQELDETRIRPEKLPSQQGEERHKSLKQAAGLPHKSNLQSTVLPSVEQ  749



>ref|XP_011102211.1| PREDICTED: ubinuclein-1-like isoform X1 [Sesamum indicum]
Length=763

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/760 (49%), Positives = 482/760 (63%), Gaps = 61/760 (8%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R  +S+E+AGGR RFTVELRPGETTIVSWKKLL+EAT      +   G  P AS  ++E 
Sbjct  14    RPMSSFESAGGRLRFTVELRPGETTIVSWKKLLREATS-----SKVSGSGPSASCPSSEA  68

Query  404   QPLILPPHNDSPGPGFSPEQPVEKEAKDAPPG----NRLNAVIEKIERLYVGKQSddded  571
                 +      P    S +QP E EAKD P G    NRL+ VIEKIER+Y G  S ++ED
Sbjct  69    YQQPVSQPPLPPPTVASLKQPEENEAKD-PQGQAGTNRLSTVIEKIERMYAGHGSSEEED  127

Query  572   lddvpdedeydted--SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLP  745
             +      D+ + +   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER+EPT   NQ P
Sbjct  128   VPLDDVPDDDEYDTEDSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERMEPTISTNQQP  187

Query  746   NKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTS-SPSYGVVMPTLYREN--  916
              KRR+KD TK Q G DDG NPNK  K+G K  K++      S + S+ V +P+++R +  
Sbjct  188   KKRRRKDVTKGQVGMDDGHNPNKHVKIGNKGRKALSSNERNSMNQSHIVALPSVHRSDLL  247

Query  917   --------ANVH-----------------------NQEVNFDMQKAEVLHSKNVVDKLKE  1003
                     A V                         Q+ + D Q+  V+ S+N  +  KE
Sbjct  248   FEASPTDAAEVSLKKKTVDTQIMVDPLGLSSVDGIRQDKDADQQRTRVISSQNHNNHRKE  307

Query  1004  SSE----TSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGK  1171
             SSE    T  QR N++ S   +  SG+  +  +GLDQ+ Q+ EK  +  +R D + P  +
Sbjct  308   SSELQDDTLAQRPNDKSSHVSKSHSGKQLSNVDGLDQAIQRKEKGGLV-ERFDLNIPASR  366

Query  1172  RSTQTV-----RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRL  1336
              S  T      R++GS  R KI ML+KAIR+LEK VAESRPP+ EVQD DNSSQA+KRRL
Sbjct  367   DSQITKVPLMPRKEGSHFRQKIAMLDKAIRELEKIVAESRPPSTEVQDPDNSSQAVKRRL  426

Query  1337  PPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQE  1516
             PPEIKQKLAKVAR AQAS+GK+ K++I+RLMSI+GHL+QLRTLKRNLK+M N+GLSAKQE
Sbjct  427   PPEIKQKLAKVARLAQASYGKIPKDVISRLMSILGHLMQLRTLKRNLKVMANLGLSAKQE  486

Query  1517  KDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALE  1696
             KD+R+Q+IK+E+AEM+K R+P + SK +E Q   SD+FQ    + K+ F++KY MD+ LE
Sbjct  487   KDDRLQKIKQEIAEMVKQRIPYINSK-VEHQTTNSDNFQEAGAQGKDTFRQKYSMDDVLE  545

Query  1697  NRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNR  1876
             N+ICDLYDLYVE LEED GP VR+LY ELAA WP+G MD  GIKRAI ++KDRR+ L  R
Sbjct  546   NKICDLYDLYVEKLEEDLGPPVRRLYEELAALWPSGVMDTDGIKRAIYKSKDRRRALSGR  605

Query  1877  HKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAI  2056
              K+QEKM++ K+ A K E   R E  + +  + + EK    + D     T+KP+ S AA+
Sbjct  606   RKDQEKMKK-KMLAPKTENTTRGEAVSVNPALPVHEKLLAGSCDQALPLTSKPVLS-AAV  663

Query  2057  NMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTD-RHITTDALTKKKMKRKPEPELGEGQYL  2233
             +   R+PVP     ++D+ K E++KG+ +S     ++TD L KKK+KRKP  E+ E QY 
Sbjct  664   SPAARMPVPLANSQNVDKLKHERLKGSSSSNPVDAVSTDVLPKKKVKRKPNSEIVEAQYR  723

Query  2234  PEKLSSKQAEYKP-QEPIAAAPVPKPSIQLNEPPSFEELT  2350
              +KL   Q E +       A P+PK  +Q   P   E L+
Sbjct  724   LDKLEVSQVEERHRHHKHMAVPLPKSDLQPAAPSGSENLS  763



>ref|XP_008371547.1| PREDICTED: ubinuclein-1-like isoform X5 [Malus domestica]
Length=730

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/742 (51%), Positives = 490/742 (66%), Gaps = 62/742 (8%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S+ +  AG RQ FTV+LRPGETTIVSW+KL+K+   +    + +              
Sbjct  14    RPSSKFVKAGDRQMFTVDLRPGETTIVSWRKLMKDTNKVNGGPSTSAP------------  61

Query  404   QPLILPPHNDSPG------PGFSPEQPVEKEAKD-----APPGNRLNAVIEKIERLYVGK  550
             +P   PP N  P       P F  +Q    EAKD     A P NR +AVIEKIERLY+GK
Sbjct  62    EP---PPVNAHPALESRIAPLFQVQQTSGDEAKDEGKDEAAP-NRFSAVIEKIERLYMGK  117

Query  551   QSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIE-PTS  727
              S DDE  +DVPD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRG LERI  P +
Sbjct  118   DSSDDEGPNDVPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGTLERINVPAA  177

Query  728   QQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSV----PLAAGTSSPSYGVVM  895
               NQ P KRR+K + K    +DD   PNK  KV  K    +    P +   S+ S  V+ 
Sbjct  178   LPNQQPKKRRRK-EAKGPGENDDIHVPNKHTKVDVKFQNQLHVSGPSSTRKSTESKTVMD  236

Query  896   PTLYR---ENANVHNQEV-NFDMQKAEVLHSKNVVDKLKE---SSETSNQRSNERISVPQ  1054
             P+  +    +A V   +V + D QKA VL SK+  +K K+   S + S QR +++ +  Q
Sbjct  237   PSFMKVSDGDALVLQADVKDIDKQKAGVLLSKDSSNKFKDAGGSCDGSYQRYHDKSAYAQ  296

Query  1055  EKS-SGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR------RDGSSVR  1213
              K  SGR+++  + L+ S +   K+ I  +  D +  +GK S  T +      +DGSS++
Sbjct  297   TKHQSGRASSNVDELESSVRARHKNGIR-EIPDLNLSDGKYSLPTTKPSHVHKKDGSSIK  355

Query  1214  SKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASH  1393
             SK +MLEKAIR+LEK VAESRPP A+ Q+GDNSSQAIKRRLP E+K KLAKVAR AQASH
Sbjct  356   SKSSMLEKAIRELEKMVAESRPPAADNQEGDNSSQAIKRRLPRELKMKLAKVARLAQASH  415

Query  1394  GKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDR  1573
             GK++KEL+NRLMSI+GHL+QLRTLKRNLK+MI+MG+SAK+EKD R Q +K+EV +MIK +
Sbjct  416   GKITKELLNRLMSILGHLIQLRTLKRNLKVMISMGISAKKEKDERFQHVKKEVIDMIKIK  475

Query  1574  VPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAG  1753
              P ++SKA+EQ  G SDDFQ  A+  KE  KRK+ MD ALE++ICDLYDLYV+GL+EDAG
Sbjct  476   APSLESKALEQHAGASDDFQETASGTKELSKRKFSMDAALEDKICDLYDLYVDGLDEDAG  535

Query  1754  PQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEE  1933
             PQ+RKLYAELAA WPNGFMDNHGIKRAICR+K+RR+  Y+R+K QEK+RR K+   + EE
Sbjct  536   PQIRKLYAELAALWPNGFMDNHGIKRAICRSKERRRERYSRNKEQEKIRRKKMLTPRTEE  595

Query  1934  GYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSP-GGTSLDR  2110
               RVE +   Q + +QE+ A +   +  + TNKPIS T A      + VP P  G S DR
Sbjct  596   TIRVERSITQQ-LLMQERMATEQ--NSQSPTNKPISGTTAA-----LGVPGPINGPSFDR  647

Query  2111  PKPEKVKGTGNST--DRHITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAE--YKPQE  2278
              K EK+KG+ +S+  D  +   ALTKKK KRKPE EL E +  PEKL S+  E  +K  +
Sbjct  648   LKQEKLKGSSSSSADDTRVGDGALTKKKTKRKPEQELDESRIRPEKLPSQSGEERHKSLK  707

Query  2279  PIAAAPVPKPSIQLNEPPSFEE  2344
             P AA P  K ++Q    PS E+
Sbjct  708   P-AAGPPHKSNLQSTVVPSVEQ  728



>ref|XP_008219578.1| PREDICTED: uncharacterized protein LOC103319767 isoform X1 [Prunus 
mume]
Length=752

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/777 (50%), Positives = 501/777 (64%), Gaps = 84/777 (11%)
 Frame = +2

Query  185   IDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngap  364
             ++E   GGE    R S+ +  AG RQ FTVELRPGETTIVSWKKLLK+   +      + 
Sbjct  1     MEEEKGGGESS--RASSRFVKAGDRQMFTVELRPGETTIVSWKKLLKDTNKVNGPSTSSA  58

Query  365   gpaprasaaaaELQPLILPPHNDSPG--PGFSPEQPVE-KEAKDAPPGNRLNAVIEKIER  535
                          +P   PP N  P      +P Q +   E KD    +R +AVIEKIER
Sbjct  59    P------------EP---PPANAHPALESRIAPVQQLSGDEVKDEAAPHRFSAVIEKIER  103

Query  536   LYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI  715
             LY+GK S DDEDL+D+PD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI
Sbjct  104   LYMGKDSSDDEDLNDIPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERI  163

Query  716   E-PTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVP--LAAGTSSPSYG  886
               P +  NQLP KRR+K + K    +DD   PNK AKVGK A   +   L   +S+P   
Sbjct  164   SVPAALPNQLPKKRRRK-EAKGPGENDDSHVPNKHAKVGKTAAAKITSTLVKNSSAPIQT  222

Query  887   VVMPTLYRENANVHNQ------------------------------------EV-NFDMQ  955
             V +PT + E+    NQ                                    EV + D Q
Sbjct  223   VTVPTEHCEDVKFQNQLNVCGLSSTKKSTDSKTILDPSLLKVSEGDAAALQAEVKDMDKQ  282

Query  956   KAEVLHSKNVVDKLKE---SSETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEK  1123
             K  +L SK+  ++ K+   SS+ S Q+ +E+ +  Q K  SGR ++ ++ + ++ +  EK
Sbjct  283   KTGILLSKDPSNRFKDAGGSSDGSYQKYHEKSAYAQTKPQSGRPSSNADEM-ETVRAREK  341

Query  1124  SVIYDQRLDASAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPN  1285
             + +  +  D +  +GK +  T +      RD SSVRSK +MLEKAI DLEK VAESRPP 
Sbjct  342   NGVC-EIPDLNLTDGKYAVPTTKPSHGHKRDSSSVRSKSSMLEKAITDLEKMVAESRPPA  400

Query  1286  AEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTL  1465
             A+ QD DN SQAIKRRLP EIK KLAKVAR AQASHGK++KEL+NRLM+I+GHL+QLRTL
Sbjct  401   ADNQDADNLSQAIKRRLPREIKAKLAKVARLAQASHGKITKELLNRLMNILGHLIQLRTL  460

Query  1466  KRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIAT  1645
             KRNLK+MI+MGLSAK+EKD+R QQIKREV +MIK + P  +SKA++QQ G SDDFQ I++
Sbjct  461   KRNLKVMISMGLSAKKEKDDRFQQIKREVIDMIKIKAPSSESKALQQQSGASDDFQEISS  520

Query  1646  EEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGI  1825
               KE  KRK+ MD ALE++ICDLYDL+V+GL+EDAGPQ+RKLYAELA  WPNGFMDNHGI
Sbjct  521   GAKELSKRKFSMDAALEDKICDLYDLFVDGLDEDAGPQIRKLYAELAGLWPNGFMDNHGI  580

Query  1826  KRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDAR  2005
             KRAICR+K+RR+  Y R+K+QEKMRR K+ A + EE  R+E ++  Q   ++E+ A +  
Sbjct  581   KRAICRSKERRRERYGRNKDQEKMRRKKMLAPRTEETVRLEASSIAQQQYMRERLATEPS  640

Query  2006  DHGSTATNKPISSTAAINMVGRIPVPSP-GGTSLDRPKPEKVKGTGNST--DRHITTDAL  2176
              H  + TNK +S TAA      +  PSP  G S DR K EK+KG+ +++  D  +   AL
Sbjct  641   SH--SLTNKAVSGTAAA-----VRTPSPINGPSFDRLKQEKLKGSSSNSPDDARVGDGAL  693

Query  2177  TKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             TKKK+KRKPE EL E +  PEKL S+Q E + +    AA +P K ++Q    PS E+
Sbjct  694   TKKKVKRKPEQELDETRIRPEKLPSQQGEERHKSLKQAAGLPHKSNLQSTVLPSVEQ  750



>ref|XP_007019216.1| Wound-responsive family protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY16441.1| Wound-responsive family protein, putative isoform 3 [Theobroma 
cacao]
Length=773

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/728 (52%), Positives = 474/728 (65%), Gaps = 69/728 (9%)
 Frame = +2

Query  248   AGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPH  427
             AG RQ FTVELRPGETT VSWKKL+K+A     +   A   A   SA          PP 
Sbjct  30    AGDRQVFTVELRPGETTYVSWKKLVKDANRGNGSSAAAAMVAVATSAPE--------PPP  81

Query  428   NDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedey  601
             N  P      +P Q  EKE KD PP NR +AVIEKIERLY+GK S D+E+LD+ PD+D+Y
Sbjct  82    NAHPNLQSRIAPGQAAEKETKDEPPPNRFSAVIEKIERLYMGKDSSDEEELDETPDDDQY  141

Query  602   dtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKC  778
             DTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLER+ EP    NQ P KRR+KD  K 
Sbjct  142   DTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERVNEPLVILNQQPKKRRRKDAAKP  201

Query  779   QSGSDDGCNPNKPAKVGKKA-GKSVP-LAAGTSSPS---------YGVVM----------  895
                SDDG   NK  K  K   G++ P L    S+ S         YG V           
Sbjct  202   AGESDDGRVSNKHVKAAKMTPGRAEPSLGRNNSNHSQNLTALNEQYGDVKAQNQLSVSGI  261

Query  896   --------------PTLYRENANVHNQEVNFDMQKAE-----VLHSKNVV-DKLKESS--  1009
                           P+ Y + +N +      D++  E     VL SKNVV +KLK++S  
Sbjct  262   SSKKKSSETRLALDPSSYLKVSNGNTSVPLADVKDTEKSKMGVLQSKNVVSNKLKDASGS  321

Query  1010  -ETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQ  1183
              +  +Q+ +++ +  Q KS  G+     + L+ S +  EK+ I + + D +  +GK +  
Sbjct  322   YDVLHQKYHDKNAYLQSKSPHGKPIGNVDELELSVRLREKNGIRELQ-DTNVSDGKYAMH  380

Query  1184  TVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPE  1345
             T +      RDGS++R K +MLEKAIR+LEK VAESRPP  E QD DNSSQ IKRRLP E
Sbjct  381   TAKSSHMQKRDGSTLRPKSSMLEKAIRELEKMVAESRPPAMENQDADNSSQGIKRRLPRE  440

Query  1346  IKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDN  1525
             IK KLAKVAR A AS GK+SKEL+NRLMSI+GHL+QLRTLKRNLKIMI+ GLSAKQEKD+
Sbjct  441   IKFKLAKVARLA-ASQGKVSKELLNRLMSILGHLIQLRTLKRNLKIMISTGLSAKQEKDD  499

Query  1526  RVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRI  1705
             R QQ+K+EV EMIK RVP ++ KA+EQQ G SD FQ + TEE+ A KRK+ MD +LE++I
Sbjct  500   RFQQVKKEVVEMIKTRVPSLEPKALEQQAGASDGFQEVGTEER-ALKRKFSMDTSLEDKI  558

Query  1706  CDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKN  1885
             CDLYDLYV+GL+ED+GPQ+RKLY ELA  WPNG MDNHGIKRAICRAK+RR+ +YNRHK+
Sbjct  559   CDLYDLYVDGLDEDSGPQIRKLYIELAQLWPNGLMDNHGIKRAICRAKERRRAMYNRHKD  618

Query  1886  QEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMV  2065
             QEK+RR K+ A + EE  RVE+ +  Q    +E+ A D+  H   +TNK +SS  A  + 
Sbjct  619   QEKIRRKKMLAPRLEESVRVESASSAQIQHSRERLAPDSGSHAIPSTNKSVSSAPAGAV-  677

Query  2066  GRIPVPSPGGTSLDRPKPEKVKG-TGNSTDRHITTD-ALTKKKMKRKPEPELGEGQYLPE  2239
              R P PS  G+SLDR K +K+KG + N+ D     D +L KKK+KRKPE EL E  + PE
Sbjct  678   -RTPSPSTNGSSLDRLKQDKLKGISSNAMDEMKVADGSLPKKKVKRKPEMELDETHFRPE  736

Query  2240  KLSSKQAE  2263
             KL  +Q +
Sbjct  737   KLPLQQGD  744



>ref|XP_008219581.1| PREDICTED: uncharacterized protein LOC103319767 isoform X4 [Prunus 
mume]
Length=750

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/776 (50%), Positives = 500/776 (64%), Gaps = 84/776 (11%)
 Frame = +2

Query  185   IDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngap  364
             ++E   GGE    R S+ +  AG RQ FTVELRPGETTIVSWKKLLK+   +      + 
Sbjct  1     MEEEKGGGESS--RASSRFVKAGDRQMFTVELRPGETTIVSWKKLLKDTNKVNGPSTSSA  58

Query  365   gpaprasaaaaELQPLILPPHNDSPG--PGFSPEQPVE-KEAKDAPPGNRLNAVIEKIER  535
                          +P   PP N  P      +P Q +   E KD    +R +AVIEKIER
Sbjct  59    P------------EP---PPANAHPALESRIAPVQQLSGDEVKDEAAPHRFSAVIEKIER  103

Query  536   LYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI  715
             LY+GK S DDEDL+D+PD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI
Sbjct  104   LYMGKDSSDDEDLNDIPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERI  163

Query  716   EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSV--PLAAGTSSPSYGV  889
              P +  NQLP KRR+K + K    +DD   PNK AKVGK A   +   L   +S+P   V
Sbjct  164   VPAALPNQLPKKRRRK-EAKGPGENDDSHVPNKHAKVGKTAAAKITSTLVKNSSAPIQTV  222

Query  890   VMPTLYRENANVHNQ------------------------------------EV-NFDMQK  958
              +PT + E+    NQ                                    EV + D QK
Sbjct  223   TVPTEHCEDVKFQNQLNVCGLSSTKKSTDSKTILDPSLLKVSEGDAAALQAEVKDMDKQK  282

Query  959   AEVLHSKNVVDKLKE---SSETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEKS  1126
               +L SK+  ++ K+   SS+ S Q+ +E+ +  Q K  SGR ++ ++ + ++ +  EK+
Sbjct  283   TGILLSKDPSNRFKDAGGSSDGSYQKYHEKSAYAQTKPQSGRPSSNADEM-ETVRAREKN  341

Query  1127  VIYDQRLDASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNA  1288
              +  +  D +  +GK +  T       +RD SSVRSK +MLEKAI DLEK VAESRPP A
Sbjct  342   GVC-EIPDLNLTDGKYAVPTTKPSHGHKRDSSSVRSKSSMLEKAITDLEKMVAESRPPAA  400

Query  1289  EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLK  1468
             + QD DN SQAIKRRLP EIK KLAKVAR A ASHGK++KEL+NRLM+I+GHL+QLRTLK
Sbjct  401   DNQDADNLSQAIKRRLPREIKAKLAKVARLA-ASHGKITKELLNRLMNILGHLIQLRTLK  459

Query  1469  RNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATE  1648
             RNLK+MI+MGLSAK+EKD+R QQIKREV +MIK + P  +SKA++QQ G SDDFQ I++ 
Sbjct  460   RNLKVMISMGLSAKKEKDDRFQQIKREVIDMIKIKAPSSESKALQQQSGASDDFQEISSG  519

Query  1649  EKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIK  1828
              KE  KRK+ MD ALE++ICDLYDL+V+GL+EDAGPQ+RKLYAELA  WPNGFMDNHGIK
Sbjct  520   AKELSKRKFSMDAALEDKICDLYDLFVDGLDEDAGPQIRKLYAELAGLWPNGFMDNHGIK  579

Query  1829  RAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARD  2008
             RAICR+K+RR+  Y R+K+QEKMRR K+ A + EE  R+E ++  Q   ++E+ A +   
Sbjct  580   RAICRSKERRRERYGRNKDQEKMRRKKMLAPRTEETVRLEASSIAQQQYMRERLATEPSS  639

Query  2009  HGSTATNKPISSTAAINMVGRIPVPSP-GGTSLDRPKPEKVKGTGNST--DRHITTDALT  2179
             H  + TNK +S TAA      +  PSP  G S DR K EK+KG+ +++  D  +   ALT
Sbjct  640   H--SLTNKAVSGTAAA-----VRTPSPINGPSFDRLKQEKLKGSSSNSPDDARVGDGALT  692

Query  2180  KKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             KKK+KRKPE EL E +  PEKL S+Q E + +    AA +P K ++Q    PS E+
Sbjct  693   KKKVKRKPEQELDETRIRPEKLPSQQGEERHKSLKQAAGLPHKSNLQSTVLPSVEQ  748



>ref|XP_007226993.1| hypothetical protein PRUPE_ppa001869mg [Prunus persica]
 gb|EMJ28192.1| hypothetical protein PRUPE_ppa001869mg [Prunus persica]
Length=751

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/777 (50%), Positives = 499/777 (64%), Gaps = 85/777 (11%)
 Frame = +2

Query  185   IDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngap  364
             ++E   GGE    R S+ +  AG RQ FTVELRPGETTIVSWKKLLK+   +      + 
Sbjct  1     MEEEKGGGESS--RASSKFVKAGDRQMFTVELRPGETTIVSWKKLLKDTNKVNGPSTSSA  58

Query  365   gpaprasaaaaELQPLILPPHNDSPG--PGFSPEQPVE-KEAKDAPPGNRLNAVIEKIER  535
                          +P   PP N  P      +P Q +   E KD    +R +AVIEKIER
Sbjct  59    P------------EP---PPANAHPALESRIAPVQQLSGDEVKDEAAPHRFSAVIEKIER  103

Query  536   LYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI  715
             LY+GK S DDEDL+D+PD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI
Sbjct  104   LYMGKDSSDDEDLNDIPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERI  163

Query  716   E-PTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSV--PLAAGTSSPSYG  886
               P +  NQ P KRR+K + K    +DD   PNK AKVGK A   +   L   +S+P   
Sbjct  164   SVPAALPNQQPKKRRRK-EVKGPGENDDSHVPNKHAKVGKTASAKITSTLVKNSSAPIQT  222

Query  887   VVMPTLYRENANVHNQ------------------------------------EV-NFDMQ  955
             V +PT + E+    NQ                                    EV + D Q
Sbjct  223   VTVPTEHSEDVKFQNQLNVCGLSSTKKSTDSKTILDPSLLKVSEGDAAALQAEVKDMDKQ  282

Query  956   KAEVLHSKNVVDKLKE---SSETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEK  1123
             K  VL SK+  ++ K+   SS+ S Q+ +E+ +  Q K  SGR ++ ++ + ++ +  EK
Sbjct  283   KTGVLLSKDPSNRFKDAGGSSDGSYQKYHEKSAYAQTKPQSGRPSSNADEM-ETVRAREK  341

Query  1124  SVIYDQRLDASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPN  1285
             + +  +  D +  +GK +  T       +RD SSVRSK +MLEKAI DLEK VAESRPP 
Sbjct  342   NGVC-EIPDLNLTDGKYAVPTTKPSHGHKRDSSSVRSKSSMLEKAITDLEKMVAESRPPA  400

Query  1286  AEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTL  1465
             A+ QD DN SQAIKRRLP EIK KLAKVAR A ASHGK++KEL+NRLM+I+GHL+QLRTL
Sbjct  401   ADNQDADNLSQAIKRRLPREIKAKLAKVARLA-ASHGKITKELLNRLMNILGHLIQLRTL  459

Query  1466  KRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIAT  1645
             KRNLK+MI+MGLSAK+EKD+R QQIKREV +MIK + P ++SKA++QQ G SDDFQ I++
Sbjct  460   KRNLKVMISMGLSAKKEKDDRFQQIKREVIDMIKIKAPSLESKALQQQSGASDDFQEISS  519

Query  1646  EEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGI  1825
               KE  KRK+ MD ALE++ICDLYDL+V+GL+EDAGPQ+RKLYAELA  WPNGFMDNHGI
Sbjct  520   GAKELSKRKFSMDAALEDKICDLYDLFVDGLDEDAGPQIRKLYAELAGLWPNGFMDNHGI  579

Query  1826  KRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDAR  2005
             KRAICR+K+RR+  Y R+K+QEKMRR K+ A + EE  RVE ++  Q   ++E+ A +  
Sbjct  580   KRAICRSKERRRERYGRNKDQEKMRRKKMLAPRTEETVRVEASSIAQQQYMRERLATEPS  639

Query  2006  DHGSTATNKPISSTAAINMVGRIPVPSP-GGTSLDRPKPEKVKGTGNST--DRHITTDAL  2176
              H  + TNK +S TAA      +  PSP  G S DR K EK+KG+ +S+  D  +   AL
Sbjct  640   SH--SLTNKAVSGTAAA-----VRTPSPINGPSFDRLKQEKLKGSSSSSPDDARVGDGAL  692

Query  2177  TKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             TKKK KRKPE EL E +  PEKL S+Q E + +    AA +P K ++Q    PS E+
Sbjct  693   TKKKAKRKPEQELDETRIRPEKLPSQQGEERHKSLKQAAGLPHKSNLQSTVLPSVEQ  749



>ref|XP_008368922.1| PREDICTED: ubinuclein-1-like isoform X1 [Malus domestica]
Length=761

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/773 (50%), Positives = 492/773 (64%), Gaps = 93/773 (12%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S+ +  AG RQ FTV+LRPGETTIVSW+KL+K+   +    + +              
Sbjct  14    RPSSKFVKAGDRQMFTVDLRPGETTIVSWRKLMKDTNKVNGGPSTSAP------------  61

Query  404   QPLILPPHNDSPG------PGFSPEQPVEKEAKD-----APPGNRLNAVIEKIERLYVGK  550
             +P   PP N  P       P F  +Q    EAKD     A P NR +AVIEKIERLY+GK
Sbjct  62    EP---PPVNAHPALESRIAPLFQVQQTSGDEAKDEGKDEAAP-NRFSAVIEKIERLYMGK  117

Query  551   QSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIE-PTS  727
              S DDE  +DVPD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRG LERI  P +
Sbjct  118   DSSDDEGPNDVPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGTLERINVPAA  177

Query  728   QQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSV-------------------  850
               NQ P KRR+K + K    +DD   PNK  KVGK A   +                   
Sbjct  178   LPNQQPKKRRRK-EAKGPGENDDIHVPNKHTKVGKTAPAKITPTLVKNSSTPTQTITGTT  236

Query  851   ----------------PLAAGTSSPSYGVVMPTLYR---ENANVHNQEV-NFDMQKAEVL  970
                             P +   S+ S  V+ P+  +    +A V   +V + D QKA VL
Sbjct  237   EHRADVKFQNQLHVSGPSSTRKSTESKTVMDPSFMKVSDGDALVLQADVKDIDKQKAGVL  296

Query  971   HSKNVVDKLKE---SSETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYD  1138
              SK+  +K K+   S + S QR +++ +  Q K  SGR+++  + L+ S +   K+ I  
Sbjct  297   LSKDSSNKFKDAGGSCDGSYQRYHDKSAYAQTKHQSGRASSNVDELESSVRARHKNGIR-  355

Query  1139  QRLDASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQD  1300
             +  D +  +GK S  T       ++DGSS++SK +MLEKAIR+LEK VAESRPP A+ Q+
Sbjct  356   EIPDLNLSDGKYSLPTTKPSHVHKKDGSSIKSKSSMLEKAIRELEKMVAESRPPAADNQE  415

Query  1301  GDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLK  1480
             GDNSSQAIKRRLP E+K KLAKVAR AQASHGK++KEL+NRLMSI+GHL+QLRTLKRNLK
Sbjct  416   GDNSSQAIKRRLPRELKMKLAKVARLAQASHGKITKELLNRLMSILGHLIQLRTLKRNLK  475

Query  1481  IMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEA  1660
             +MI+MG+SAK+EKD R Q +K+EV +MIK + P ++SKA+EQ  G SDDFQ  A+  KE 
Sbjct  476   VMISMGISAKKEKDERFQHVKKEVIDMIKIKAPSLESKALEQHAGASDDFQETASGTKEL  535

Query  1661  FKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAIC  1840
              KRK+ MD ALE++ICDLYDLYV+GL+EDAGPQ+RKLYAELAA WPNGFMDNHGIKRAIC
Sbjct  536   SKRKFSMDAALEDKICDLYDLYVDGLDEDAGPQIRKLYAELAALWPNGFMDNHGIKRAIC  595

Query  1841  RAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGST  2020
             R+K+RR+  Y+R+K QEK+RR K+   + EE  RVE +   Q + +QE+ A +   +  +
Sbjct  596   RSKERRRERYSRNKEQEKIRRKKMLTPRTEETIRVERSITQQ-LLMQERMATE--QNSQS  652

Query  2021  ATNKPISSTAAINMVGRIPVPSP-GGTSLDRPKPEKVKGTGNST--DRHITTDALTKKKM  2191
              TNKPIS T A      + VP P  G S DR K EK+KG+ +S+  D  +   ALTKKK 
Sbjct  653   PTNKPISGTTAA-----LGVPGPINGPSFDRLKQEKLKGSSSSSADDTRVGDGALTKKKT  707

Query  2192  KRKPEPELGEGQYLPEKLSSKQAE--YKPQEPIAAAPVPKPSIQLNEPPSFEE  2344
             KRKPE EL E +  PEKL S+  E  +K  +P AA P  K ++Q    PS E+
Sbjct  708   KRKPEQELDESRIRPEKLPSQSGEERHKSLKP-AAGPPHKSNLQSTVVPSVEQ  759



>ref|XP_008219580.1| PREDICTED: uncharacterized protein LOC103319767 isoform X3 [Prunus 
mume]
Length=751

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/777 (50%), Positives = 500/777 (64%), Gaps = 85/777 (11%)
 Frame = +2

Query  185   IDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngap  364
             ++E   GGE    R S+ +  AG RQ FTVELRPGETTIVSWKKLLK+   +      + 
Sbjct  1     MEEEKGGGESS--RASSRFVKAGDRQMFTVELRPGETTIVSWKKLLKDTNKVNGPSTSSA  58

Query  365   gpaprasaaaaELQPLILPPHNDSPG--PGFSPEQPVE-KEAKDAPPGNRLNAVIEKIER  535
                          +P   PP N  P      +P Q +   E KD    +R +AVIEKIER
Sbjct  59    P------------EP---PPANAHPALESRIAPVQQLSGDEVKDEAAPHRFSAVIEKIER  103

Query  536   LYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI  715
             LY+GK S DDEDL+D+PD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI
Sbjct  104   LYMGKDSSDDEDLNDIPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERI  163

Query  716   E-PTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSV--PLAAGTSSPSYG  886
               P +  NQLP KRR+K + K    +DD   PNK AKVGK A   +   L   +S+P   
Sbjct  164   SVPAALPNQLPKKRRRK-EAKGPGENDDSHVPNKHAKVGKTAAAKITSTLVKNSSAPIQT  222

Query  887   VVMPTLYRENANVHNQ------------------------------------EV-NFDMQ  955
             V +PT + E+    NQ                                    EV + D Q
Sbjct  223   VTVPTEHCEDVKFQNQLNVCGLSSTKKSTDSKTILDPSLLKVSEGDAAALQAEVKDMDKQ  282

Query  956   KAEVLHSKNVVDKLKE---SSETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEK  1123
             K  +L SK+  ++ K+   SS+ S Q+ +E+ +  Q K  SGR ++ ++ + ++ +  EK
Sbjct  283   KTGILLSKDPSNRFKDAGGSSDGSYQKYHEKSAYAQTKPQSGRPSSNADEM-ETVRAREK  341

Query  1124  SVIYDQRLDASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPN  1285
             + +  +  D +  +GK +  T       +RD SSVRSK +MLEKAI DLEK VAESRPP 
Sbjct  342   NGVC-EIPDLNLTDGKYAVPTTKPSHGHKRDSSSVRSKSSMLEKAITDLEKMVAESRPPA  400

Query  1286  AEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTL  1465
             A+ QD DN SQAIKRRLP EIK KLAKVAR A ASHGK++KEL+NRLM+I+GHL+QLRTL
Sbjct  401   ADNQDADNLSQAIKRRLPREIKAKLAKVARLA-ASHGKITKELLNRLMNILGHLIQLRTL  459

Query  1466  KRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIAT  1645
             KRNLK+MI+MGLSAK+EKD+R QQIKREV +MIK + P  +SKA++QQ G SDDFQ I++
Sbjct  460   KRNLKVMISMGLSAKKEKDDRFQQIKREVIDMIKIKAPSSESKALQQQSGASDDFQEISS  519

Query  1646  EEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGI  1825
               KE  KRK+ MD ALE++ICDLYDL+V+GL+EDAGPQ+RKLYAELA  WPNGFMDNHGI
Sbjct  520   GAKELSKRKFSMDAALEDKICDLYDLFVDGLDEDAGPQIRKLYAELAGLWPNGFMDNHGI  579

Query  1826  KRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDAR  2005
             KRAICR+K+RR+  Y R+K+QEKMRR K+ A + EE  R+E ++  Q   ++E+ A +  
Sbjct  580   KRAICRSKERRRERYGRNKDQEKMRRKKMLAPRTEETVRLEASSIAQQQYMRERLATEPS  639

Query  2006  DHGSTATNKPISSTAAINMVGRIPVPSP-GGTSLDRPKPEKVKGTGNST--DRHITTDAL  2176
              H  + TNK +S TAA      +  PSP  G S DR K EK+KG+ +++  D  +   AL
Sbjct  640   SH--SLTNKAVSGTAAA-----VRTPSPINGPSFDRLKQEKLKGSSSNSPDDARVGDGAL  692

Query  2177  TKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             TKKK+KRKPE EL E +  PEKL S+Q E + +    AA +P K ++Q    PS E+
Sbjct  693   TKKKVKRKPEQELDETRIRPEKLPSQQGEERHKSLKQAAGLPHKSNLQSTVLPSVEQ  749



>dbj|BAJ53189.1| JMS09K11.7 [Jatropha curcas]
Length=759

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/764 (49%), Positives = 487/764 (64%), Gaps = 78/764 (10%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R++ SY   G RQ FTVELRPGETT VSWKKL+K+A  + S    A  P           
Sbjct  15    RLTPSYVKLGDRQIFTVELRPGETTFVSWKKLMKDANKVNSGSAPASDP-----------  63

Query  404   QPLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedld  577
                  PP N  P      +P QP E E KDAP  +R +AVIEKIERLY+GK S D+EDL 
Sbjct  64    -----PPANAHPNLESRLAPGQPAENEDKDAPAPSRFSAVIEKIERLYMGKDSSDEEDLK  118

Query  578   dvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKR  754
             D+PD+D+YDT+DSFIDD ELD+YF+VDNSAIKH+GFFVNRGKLERI EPT   NQ   KR
Sbjct  119   DIPDDDQYDTDDSFIDDAELDEYFEVDNSAIKHNGFFVNRGKLERINEPTVIPNQQAKKR  178

Query  755   RKKDQTKCQSGSDDGCNPNKPAKVGKK-AGKSVPLAAGTSS-PSYGVVMP----------  898
             R+KD TK     DD  + NK  K+GK  AGK+  L    SS PS  +V+           
Sbjct  179   RRKDLTKAPGEGDDRIS-NKHVKLGKSAAGKTAVLVGKNSSNPSQSLVVTNERYEEVKTP  237

Query  899   -TLY-------------------RENANVHNQEVNFDMQKAE--------VLHSKNVVDK  994
               LY                     +  V N +V+  + +A+            KNV  K
Sbjct  238   NVLYASGISAKKKSAETKINLDPSSSVKVSNGDVSVSLAEAKDVEKPKTGGFQGKNVT-K  296

Query  995   LKESS---ETSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPE  1165
              K++S   + S+Q+ +++ + PQ K   +S    N ++ S +  EK+ +  +  D + P+
Sbjct  297   SKDTSGSLDVSHQKYHDKSAYPQSKLQAKSITSGNEIEPSVRSREKNGVR-ELPDLNMPD  355

Query  1166  GKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIK  1327
             GK S Q        R+DGSSVRSK +MLE AIR+LE+ VAESRPP  E Q+GD SSQ IK
Sbjct  356   GKTSMQVTKPSHVHRKDGSSVRSKSSMLENAIRELERMVAESRPPALENQEGDASSQTIK  415

Query  1328  RRLPPEIKQKLAKVARY-AQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLS  1504
             RRLP EIK KLAKVAR  AQAS GK+SKELINRLMSI+GHL+QLRTLKRNLK+MI+MGLS
Sbjct  416   RRLPREIKLKLAKVARLAAQASQGKVSKELINRLMSILGHLIQLRTLKRNLKVMISMGLS  475

Query  1505  AKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMD  1684
             AKQEKD+R QQIK+EVAEMIK  VP ++SKA+EQQ G SDDFQ   ++EK + KRK+ MD
Sbjct  476   AKQEKDDRFQQIKKEVAEMIKTHVPSLESKALEQQAGASDDFQENVSQEKGSLKRKFSMD  535

Query  1685  NALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKT  1864
               LE++ICDLYDL+V+GL++DAGPQVRKLY ELA  WP+GFMDNHGIKRAICRAK+RR+ 
Sbjct  536   AVLEDKICDLYDLFVDGLDDDAGPQVRKLYLELAELWPSGFMDNHGIKRAICRAKERRRA  595

Query  1865  LYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISS  2044
             LYNRHK++EK++R K+ A + +E  R E  +  Q   ++E+   +         +K I S
Sbjct  596   LYNRHKDEEKIKRKKMLAPRLDETARAEAGSVAQQQYMRERLPAETVGPVLALASKSIPS  655

Query  2045  TAAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNS--TDRHITTD-ALTKKKMKRKPEPEL  2215
             +A   +  R+P PS    +++R K +K KG+ ++   +  I  D AL KKK+KR+ E EL
Sbjct  656   SATTAV--RVPSPSRNAPNVERLKQDKPKGSSSNPMDEAKIGLDGALVKKKVKRRSEQEL  713

Query  2216  GEGQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
              E  +  EKL ++ +E + +     + +P K ++QLN P SFE+
Sbjct  714   DETHFRSEKLHNQSSEERQKSVKQVSSLPQKLNLQLNTPSSFEQ  757



>ref|XP_008370189.1| PREDICTED: ubinuclein-1-like isoform X3 [Malus domestica]
Length=758

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/769 (49%), Positives = 489/769 (64%), Gaps = 88/769 (11%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S+ +  AG RQ FTV+LRPGETTIVSW+KL+K+   +    + +              
Sbjct  14    RPSSKFVKAGDRQMFTVDLRPGETTIVSWRKLMKDTNKVNGGPSTSAP------------  61

Query  404   QPLILPPHNDSPG--PGFSPEQ-----PVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdd  562
             +P   PP N  P      +P Q       + E KD    NR +AVIEKIERLY+GK S D
Sbjct  62    EP---PPVNAHPALESRIAPVQQTSGDEAKDEGKDEAAPNRFSAVIEKIERLYMGKDSSD  118

Query  563   dedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIE-PTSQQNQ  739
             DE  +DVPD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRG LERI  P +  NQ
Sbjct  119   DEGPNDVPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGTLERINVPAALPNQ  178

Query  740   LPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSV-----------------------  850
              P KRR+K + K    +DD   PNK  KVGK A   +                       
Sbjct  179   QPKKRRRK-EAKGPGENDDIHVPNKHTKVGKTAPAKITPTLVKNSSTPTQTITGTTEHRA  237

Query  851   ------------PLAAGTSSPSYGVVMPTLYR---ENANVHNQEV-NFDMQKAEVLHSKN  982
                         P +   S+ S  V+ P+  +    +A V   +V + D QKA VL SK+
Sbjct  238   DVKFQNQLHVSGPSSTRKSTESKTVMDPSFMKVSDGDALVLQADVKDIDKQKAGVLLSKD  297

Query  983   VVDKLKE---SSETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYDQRLD  1150
               +K K+   S + S QR +++ +  Q K  SGR+++  + L+ S +   K+ I  +  D
Sbjct  298   SSNKFKDAGGSCDGSYQRYHDKSAYAQTKHQSGRASSNVDELESSVRARHKNGIR-EIPD  356

Query  1151  ASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNS  1312
              +  +GK S  T       ++DGSS++SK +MLEKAIR+LEK VAESRPP A+ Q+GDNS
Sbjct  357   LNLSDGKYSLPTTKPSHVHKKDGSSIKSKSSMLEKAIRELEKMVAESRPPAADNQEGDNS  416

Query  1313  SQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMIN  1492
             SQAIKRRLP E+K KLAKVAR AQASHGK++KEL+NRLMSI+GHL+QLRTLKRNLK+MI+
Sbjct  417   SQAIKRRLPRELKMKLAKVARLAQASHGKITKELLNRLMSILGHLIQLRTLKRNLKVMIS  476

Query  1493  MGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRK  1672
             MG+SAK+EKD R Q +K+EV +MIK + P ++SKA+EQ  G SDDFQ  A+  KE  KRK
Sbjct  477   MGISAKKEKDERFQHVKKEVIDMIKIKAPSLESKALEQHAGASDDFQETASGTKELSKRK  536

Query  1673  YCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKD  1852
             + MD ALE++ICDLYDLYV+GL+EDAGPQ+RKLYAELAA WPNGFMDNHGIKRAICR+K+
Sbjct  537   FSMDAALEDKICDLYDLYVDGLDEDAGPQIRKLYAELAALWPNGFMDNHGIKRAICRSKE  596

Query  1853  RRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNK  2032
             RR+  Y+R+K QEK+RR K+   + EE  RVE +   Q + +QE+ A +   +  + TNK
Sbjct  597   RRRERYSRNKEQEKIRRKKMLTPRTEETIRVERSITQQ-LLMQERMATE--QNSQSPTNK  653

Query  2033  PISSTAAINMVGRIPVPSP-GGTSLDRPKPEKVKGTGNST--DRHITTDALTKKKMKRKP  2203
             PIS T A      + VP P  G S DR K EK+KG+ +S+  D  +   ALTKKK KRKP
Sbjct  654   PISGTTAA-----LGVPGPINGPSFDRLKQEKLKGSSSSSADDTRVGDGALTKKKTKRKP  708

Query  2204  EPELGEGQYLPEKLSSKQAE--YKPQEPIAAAPVPKPSIQLNEPPSFEE  2344
             E EL E +  PEKL S+  E  +K  +P AA P  K ++Q    PS E+
Sbjct  709   EQELDESRIRPEKLPSQSGEERHKSLKP-AAGPPHKSNLQSTVVPSVEQ  756



>gb|KDP32859.1| hypothetical protein JCGZ_12151 [Jatropha curcas]
Length=761

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/766 (49%), Positives = 486/766 (63%), Gaps = 80/766 (10%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R++ SY   G RQ FTVELRPGETT VSWKKL+K+A  + S    A  P           
Sbjct  15    RLTPSYVKLGDRQIFTVELRPGETTFVSWKKLMKDANKVNSGSAPASDP-----------  63

Query  404   QPLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedld  577
                  PP N  P      +P QP E E KDAP  +R +AVIEKIERLY+GK S D+EDL 
Sbjct  64    -----PPANAHPNLESRLAPGQPAENEDKDAPAPSRFSAVIEKIERLYMGKDSSDEEDLK  118

Query  578   dvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKR  754
             D+PD+D+YDT+DSFIDD ELD+YF+VDNSAIKH+GFFVNRGKLERI EPT   NQ   KR
Sbjct  119   DIPDDDQYDTDDSFIDDAELDEYFEVDNSAIKHNGFFVNRGKLERINEPTVIPNQQAKKR  178

Query  755   RKKDQTKCQSGSDDGCNPNKPAKVGKK-AGKSVPLAAGTSS-PSYGVVMP----------  898
             R+KD TK     DD  + NK  K+GK  AGK+  L    SS PS  +V+           
Sbjct  179   RRKDLTKAPGEGDDRIS-NKHVKLGKSAAGKTAVLVGKNSSNPSQSLVVTNERYEEVKTP  237

Query  899   -TLY-------------------RENANVHNQEVNFDMQKAE--------VLHSKNVVDK  994
               LY                     +  V N +V+  + +A+            KNV  K
Sbjct  238   NVLYASGISAKKKSAETKINLDPSSSVKVSNGDVSVSLAEAKDVEKPKTGGFQGKNVT-K  296

Query  995   LKESS---ETSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPE  1165
              K++S   + S+Q+ +++ + PQ K   +S    N ++ S +  EK+ + +   D + P+
Sbjct  297   SKDTSGSLDVSHQKYHDKSAYPQSKLQAKSITSGNEIEPSVRSREKNGVRELP-DLNMPD  355

Query  1166  GKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIK  1327
             GK S Q        R+DGSSVRSK +MLE AIR+LE+ VAESRPP  E Q+GD SSQ IK
Sbjct  356   GKTSMQVTKPSHVHRKDGSSVRSKSSMLENAIRELERMVAESRPPALENQEGDASSQTIK  415

Query  1328  RRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSA  1507
             RRLP EIK KLAKVAR A AS GK+SKELINRLMSI+GHL+QLRTLKRNLK+MI+MGLSA
Sbjct  416   RRLPREIKLKLAKVARLAAASQGKVSKELINRLMSILGHLIQLRTLKRNLKVMISMGLSA  475

Query  1508  KQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDN  1687
             KQEKD+R QQIK+EVAEMIK  VP ++SKA+EQQ G SDDFQ   ++EK + KRK+ MD 
Sbjct  476   KQEKDDRFQQIKKEVAEMIKTHVPSLESKALEQQAGASDDFQENVSQEKGSLKRKFSMDA  535

Query  1688  ALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
              LE++ICDLYDL+V+GL++DAGPQVRKLY ELA  WP+GFMDNHGIKRAICRAK+RR+ L
Sbjct  536   VLEDKICDLYDLFVDGLDDDAGPQVRKLYLELAELWPSGFMDNHGIKRAICRAKERRRAL  595

Query  1868  YNRHK---NQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPI  2038
             YNRHK   ++EK++R K+ A + +E  R E  +  Q   ++E+   +         +K I
Sbjct  596   YNRHKVHEDEEKIKRKKMLAPRLDETARAEAGSVAQQQYMRERLPAETVGPVLALASKSI  655

Query  2039  SSTAAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNS--TDRHITTD-ALTKKKMKRKPEP  2209
              S+A   +  R+P PS    +++R K +K KG+ ++   +  I  D AL KKK+KR+ E 
Sbjct  656   PSSATTAV--RVPSPSRNAPNVERLKQDKPKGSSSNPMDEAKIGLDGALVKKKVKRRSEQ  713

Query  2210  ELGEGQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             EL E  +  EKL ++ +E + +     + +P K ++QLN P SFE+
Sbjct  714   ELDETHFRSEKLHNQSSEERQKSVKQVSSLPQKLNLQLNTPSSFEQ  759



>ref|XP_008369549.1| PREDICTED: ubinuclein-1-like isoform X2 [Malus domestica]
Length=760

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/773 (49%), Positives = 491/773 (64%), Gaps = 94/773 (12%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S+ +  AG RQ FTV+LRPGETTIVSW+KL+K+   +    + +              
Sbjct  14    RPSSKFVKAGDRQMFTVDLRPGETTIVSWRKLMKDTNKVNGGPSTSAP------------  61

Query  404   QPLILPPHNDSPG------PGFSPEQPVEKEAKD-----APPGNRLNAVIEKIERLYVGK  550
             +P   PP N  P       P F  +Q    EAKD     A P NR +AVIEKIERLY+GK
Sbjct  62    EP---PPVNAHPALESRIAPLFQVQQTSGDEAKDEGKDEAAP-NRFSAVIEKIERLYMGK  117

Query  551   QSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIE-PTS  727
              S DDE  +DVPD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRG LERI  P +
Sbjct  118   DSSDDEGPNDVPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGTLERINVPAA  177

Query  728   QQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSV-------------------  850
               NQ P KRR+K + K    +DD   PNK  KVGK A   +                   
Sbjct  178   LPNQQPKKRRRK-EAKGPGENDDIHVPNKHTKVGKTAPAKITPTLVKNSSTPTQTITGTT  236

Query  851   ----------------PLAAGTSSPSYGVVMPTLYR---ENANVHNQEV-NFDMQKAEVL  970
                             P +   S+ S  V+ P+  +    +A V   +V + D QKA VL
Sbjct  237   EHRADVKFQNQLHVSGPSSTRKSTESKTVMDPSFMKVSDGDALVLQADVKDIDKQKAGVL  296

Query  971   HSKNVVDKLKE---SSETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYD  1138
              SK+  +K K+   S + S QR +++ +  Q K  SGR+++  + L+ S +   K+ I  
Sbjct  297   LSKDSSNKFKDAGGSCDGSYQRYHDKSAYAQTKHQSGRASSNVDELESSVRARHKNGIR-  355

Query  1139  QRLDASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQD  1300
             +  D +  +GK S  T       ++DGSS++SK +MLEKAIR+LEK VAESRPP A+ Q+
Sbjct  356   EIPDLNLSDGKYSLPTTKPSHVHKKDGSSIKSKSSMLEKAIRELEKMVAESRPPAADNQE  415

Query  1301  GDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLK  1480
             GDNSSQAIKRRLP E+K KLAKVAR A ASHGK++KEL+NRLMSI+GHL+QLRTLKRNLK
Sbjct  416   GDNSSQAIKRRLPRELKMKLAKVARLA-ASHGKITKELLNRLMSILGHLIQLRTLKRNLK  474

Query  1481  IMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEA  1660
             +MI+MG+SAK+EKD R Q +K+EV +MIK + P ++SKA+EQ  G SDDFQ  A+  KE 
Sbjct  475   VMISMGISAKKEKDERFQHVKKEVIDMIKIKAPSLESKALEQHAGASDDFQETASGTKEL  534

Query  1661  FKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAIC  1840
              KRK+ MD ALE++ICDLYDLYV+GL+EDAGPQ+RKLYAELAA WPNGFMDNHGIKRAIC
Sbjct  535   SKRKFSMDAALEDKICDLYDLYVDGLDEDAGPQIRKLYAELAALWPNGFMDNHGIKRAIC  594

Query  1841  RAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGST  2020
             R+K+RR+  Y+R+K QEK+RR K+   + EE  RVE +   Q + +QE+ A +   +  +
Sbjct  595   RSKERRRERYSRNKEQEKIRRKKMLTPRTEETIRVERSITQQ-LLMQERMATE--QNSQS  651

Query  2021  ATNKPISSTAAINMVGRIPVPSP-GGTSLDRPKPEKVKGTGNST--DRHITTDALTKKKM  2191
              TNKPIS T A      + VP P  G S DR K EK+KG+ +S+  D  +   ALTKKK 
Sbjct  652   PTNKPISGTTAA-----LGVPGPINGPSFDRLKQEKLKGSSSSSADDTRVGDGALTKKKT  706

Query  2192  KRKPEPELGEGQYLPEKLSSKQAE--YKPQEPIAAAPVPKPSIQLNEPPSFEE  2344
             KRKPE EL E +  PEKL S+  E  +K  +P AA P  K ++Q    PS E+
Sbjct  707   KRKPEQELDESRIRPEKLPSQSGEERHKSLKP-AAGPPHKSNLQSTVVPSVEQ  758



>gb|KHG20837.1| Histone promoter control 2 [Gossypium arboreum]
Length=770

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/763 (49%), Positives = 480/763 (63%), Gaps = 76/763 (10%)
 Frame = +2

Query  194   GSSGGEPGVGRVST-SYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgp  370
             G++GG     R++      +G RQ FTVELRPGETT VSW+KL+K+A     +   A   
Sbjct  7     GAAGGTAESSRLAAPKVMKSGDRQVFTVELRPGETTYVSWRKLVKDANRANGSSAAASVL  66

Query  371   aprasaaaaELQPLILPPHNDSPG--PGFSPEQPVEKEAKDAPPG-NRLNAVIEKIERLY  541
                         P   PP N  P      +P Q  EKEAKD  PG NR +AVIEKIERLY
Sbjct  67    TV----------PAPEPPPNAHPNLQSRIAPGQAAEKEAKDEAPGPNRFSAVIEKIERLY  116

Query  542   VGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-E  718
             +G+ S D+E+LD+ PD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLER+ E
Sbjct  117   MGRDSSDEEELDETPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERVNE  176

Query  719   PTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMP  898
             P +  NQ P KRR+KD +K  S SDDG  PNK  K  K     V  + G ++      + 
Sbjct  177   PPAIPNQQPKKRRRKDTSKPPSESDDGHVPNKHVKTVKVTAGRVEPSLGKNNSDSAQNLT  236

Query  899   TLYRENANVHNQE-----------------VNFDMQ-----------------------K  958
             TL  ++ +V  Q                  V  D                         K
Sbjct  237   TLSEQHGDVKAQNQLSVSGVPSKKKSSETRVALDSSAYLKVPNGDTSVPLADVKDTEKSK  296

Query  959   AEVLHSKNVV-DKLKESSETSN---QRSNERISVPQEKSS-GRSANISNGLDQSFQQGEK  1123
                + SKNVV +KLK+++ +S+   Q+ +++ +  Q KS  G+  + ++ L+QSF+  EK
Sbjct  297   MGFVQSKNVVSNKLKDATGSSDVLQQKYHDKNAYAQSKSQHGKRISNADELEQSFRPREK  356

Query  1124  SVIYDQRLDASAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPN  1285
             + I  +  +A+  +GK + QT +      +DGS++R K ++LEKAIR+LEK VAESRPP 
Sbjct  357   NGIR-ELPEANISDGKHAMQTAKSSHMSKKDGSTLRPKSSILEKAIRELEKLVAESRPPA  415

Query  1286  AEVQDGDNSSQAIKRRLPPEIKQKLAKVARYA-QASHGKLSKELINRLMSIVGHLVQLRT  1462
              E Q+ D SSQ IKRRLP EIK KLAKVAR A QAS GK+SKEL+NRLMSI+GHL+QLRT
Sbjct  416   VENQEADASSQGIKRRLPREIKVKLAKVARLAAQASQGKVSKELLNRLMSILGHLIQLRT  475

Query  1463  LKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIA  1642
             LKRNLK+MINMG+SAKQEKD R QQIK+EV EMIK R+P  ++K +E  PG SDDFQ   
Sbjct  476   LKRNLKVMINMGVSAKQEKDARFQQIKKEVIEMIKTRIPSFETKILEPPPGASDDFQGTG  535

Query  1643  TEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHG  1822
             +EE+   +RK+ MD +LEN+ICDLYDLYV+GL+EDAGPQ+RKLY ELA  WPNG MDNH 
Sbjct  536   SEER-VNRRKFGMDASLENKICDLYDLYVDGLDEDAGPQIRKLYVELAQLWPNGMMDNHE  594

Query  1823  IKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDA  2002
             IKRAICR K+RRK  YNR K QEK++R KI A   EE  RVE+    QP   +E+ A D+
Sbjct  595   IKRAICREKERRKARYNRCKEQEKVKRKKIMAPGLEESVRVESALSAQPQHTRERLATDS  654

Query  2003  RDHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKG-TGNSTDRHITTDALT  2179
                   +TNK  SST A  +  +IP PS  G+SLDR K EK+KG + N+ +     D+L 
Sbjct  655   ASQVLPSTNKLTSSTTAAAV--QIPGPSTNGSSLDRVKQEKLKGISSNAMEEIKVADSLL  712

Query  2180  -KKKMKRKPEPELGEGQYLPEKLSSKQAEYK---PQEPIAAAP  2296
              KKK+KRKPE EL    + PEK S +  + +    ++P+ A P
Sbjct  713   PKKKVKRKPETELDAAHFRPEKSSLQPGDDRHKSTKQPVNATP  755



>ref|XP_008370884.1| PREDICTED: ubinuclein-1-like isoform X4 [Malus domestica]
Length=757

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/769 (49%), Positives = 488/769 (63%), Gaps = 89/769 (12%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S+ +  AG RQ FTV+LRPGETTIVSW+KL+K+   +    + +              
Sbjct  14    RPSSKFVKAGDRQMFTVDLRPGETTIVSWRKLMKDTNKVNGGPSTSAP------------  61

Query  404   QPLILPPHNDSPG--PGFSPEQ-----PVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdd  562
             +P   PP N  P      +P Q       + E KD    NR +AVIEKIERLY+GK S D
Sbjct  62    EP---PPVNAHPALESRIAPVQQTSGDEAKDEGKDEAAPNRFSAVIEKIERLYMGKDSSD  118

Query  563   dedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIE-PTSQQNQ  739
             DE  +DVPD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRG LERI  P +  NQ
Sbjct  119   DEGPNDVPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGTLERINVPAALPNQ  178

Query  740   LPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSV-----------------------  850
              P KRR+K + K    +DD   PNK  KVGK A   +                       
Sbjct  179   QPKKRRRK-EAKGPGENDDIHVPNKHTKVGKTAPAKITPTLVKNSSTPTQTITGTTEHRA  237

Query  851   ------------PLAAGTSSPSYGVVMPTLYR---ENANVHNQEV-NFDMQKAEVLHSKN  982
                         P +   S+ S  V+ P+  +    +A V   +V + D QKA VL SK+
Sbjct  238   DVKFQNQLHVSGPSSTRKSTESKTVMDPSFMKVSDGDALVLQADVKDIDKQKAGVLLSKD  297

Query  983   VVDKLKE---SSETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYDQRLD  1150
               +K K+   S + S QR +++ +  Q K  SGR+++  + L+ S +   K+ I  +  D
Sbjct  298   SSNKFKDAGGSCDGSYQRYHDKSAYAQTKHQSGRASSNVDELESSVRARHKNGIR-EIPD  356

Query  1151  ASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNS  1312
              +  +GK S  T       ++DGSS++SK +MLEKAIR+LEK VAESRPP A+ Q+GDNS
Sbjct  357   LNLSDGKYSLPTTKPSHVHKKDGSSIKSKSSMLEKAIRELEKMVAESRPPAADNQEGDNS  416

Query  1313  SQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMIN  1492
             SQAIKRRLP E+K KLAKVAR A ASHGK++KEL+NRLMSI+GHL+QLRTLKRNLK+MI+
Sbjct  417   SQAIKRRLPRELKMKLAKVARLA-ASHGKITKELLNRLMSILGHLIQLRTLKRNLKVMIS  475

Query  1493  MGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRK  1672
             MG+SAK+EKD R Q +K+EV +MIK + P ++SKA+EQ  G SDDFQ  A+  KE  KRK
Sbjct  476   MGISAKKEKDERFQHVKKEVIDMIKIKAPSLESKALEQHAGASDDFQETASGTKELSKRK  535

Query  1673  YCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKD  1852
             + MD ALE++ICDLYDLYV+GL+EDAGPQ+RKLYAELAA WPNGFMDNHGIKRAICR+K+
Sbjct  536   FSMDAALEDKICDLYDLYVDGLDEDAGPQIRKLYAELAALWPNGFMDNHGIKRAICRSKE  595

Query  1853  RRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNK  2032
             RR+  Y+R+K QEK+RR K+   + EE  RVE +   Q + +QE+ A +   +  + TNK
Sbjct  596   RRRERYSRNKEQEKIRRKKMLTPRTEETIRVERSITQQ-LLMQERMATE--QNSQSPTNK  652

Query  2033  PISSTAAINMVGRIPVPSP-GGTSLDRPKPEKVKGTGNST--DRHITTDALTKKKMKRKP  2203
             PIS T A      + VP P  G S DR K EK+KG+ +S+  D  +   ALTKKK KRKP
Sbjct  653   PISGTTAA-----LGVPGPINGPSFDRLKQEKLKGSSSSSADDTRVGDGALTKKKTKRKP  707

Query  2204  EPELGEGQYLPEKLSSKQAE--YKPQEPIAAAPVPKPSIQLNEPPSFEE  2344
             E EL E +  PEKL S+  E  +K  +P AA P  K ++Q    PS E+
Sbjct  708   EQELDESRIRPEKLPSQSGEERHKSLKP-AAGPPHKSNLQSTVVPSVEQ  755



>ref|XP_002302222.2| hypothetical protein POPTR_0002s07900g [Populus trichocarpa]
 gb|EEE81495.2| hypothetical protein POPTR_0002s07900g [Populus trichocarpa]
Length=768

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/761 (49%), Positives = 475/761 (62%), Gaps = 72/761 (9%)
 Frame = +2

Query  227   VSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQ  406
             V+ SY   G RQ FTVELRPGETT VSWKKL+K+A  + +    A    P  +A    L+
Sbjct  21    VTPSYVKLGDRQIFTVELRPGETTFVSWKKLMKDANKVNNRSAPAAPDPPPVNAHP-NLE  79

Query  407   PLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvp  586
               I PP            Q  E E KD PP NR +AVIEKIERLY GK S D+EDL D P
Sbjct  80    SRIAPP------------QVTENEVKDDPPPNRFSAVIEKIERLYTGKDSSDEEDLMDAP  127

Query  587   dedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKK  763
             D+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRG+LERI EP    N+ P KRR+K
Sbjct  128   DDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGELERINEPPVVPNEKPKKRRRK  187

Query  764   DQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSP--SYGVVMPTLYRENANVHNQE  937
             D  K  + SDDG   NK AK+GK A + +    G +S   S  + M +   EN    NQ 
Sbjct  188   DLLKAPNDSDDGHMSNKLAKLGKSAAEKMAPPPGKNSLNLSQNLTMISEQYENVKFQNQS  247

Query  938   --------------------------VNFDMQ------------KAEVLHSKNVVDKLKE  1003
                                       +N D              K   L  KN+  K K+
Sbjct  248   NSPGISSKKKPAETKMKLDPSLSVKVLNGDAYASLEETTDNEKPKTGCLLPKNLTSKPKD  307

Query  1004  SS---ETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIY---DQRLDAS--  1156
             +S   E+SNQ+ +E+ +  Q KS S ++ +  + L+ S +  EK+ +    D  L+ S  
Sbjct  308   ASGFSESSNQKYHEKSAYVQPKSQSAKTVDHCDDLEPSVRLIEKNGVRELPDLNLNISDS  367

Query  1157  --APEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKR  1330
                 +  R++   R+DGSSVR K +MLEKAIR+LEK VAESRPP  E QD D S+QAIKR
Sbjct  368   KIYTQAARTSHVHRKDGSSVRPKSSMLEKAIRELEKMVAESRPPAVENQDTDASAQAIKR  427

Query  1331  RLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             RLP EIK KLAKVAR A AS GKLSKEL+NRLMSI+GHL+QLRTLKRNLKIMIN GLSAK
Sbjct  428   RLPTEIKLKLAKVARLA-ASQGKLSKELLNRLMSILGHLIQLRTLKRNLKIMINTGLSAK  486

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNA  1690
             QEK +R QQIK+EVAEMI  R+P ++S A+ QQ G SDDFQ + ++E+   K+K+ MD  
Sbjct  487   QEKADRFQQIKKEVAEMIMTRIPSVESNALVQQAGASDDFQEMVSDERGGLKKKFSMDAV  546

Query  1691  LENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY  1870
             LE++ICDLYDL+VEGL+ED+GPQVRKLY ELA +WP+G MDNHGIKRAICRAK+RR+ +Y
Sbjct  547   LEDKICDLYDLFVEGLDEDSGPQVRKLYVELAQFWPSGLMDNHGIKRAICRAKERRRVMY  606

Query  1871  NRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTA  2050
              R+K+Q+K++  K+   K+EEG R+E+ +  QP  +QE+ A D          KP+ ++ 
Sbjct  607   IRNKDQDKIKSKKMFTPKQEEGVRIESGSVAQPQHVQERLATDMVGPVLALARKPVPNSI  666

Query  2051  AINMVGRIPVPSPGGTSLDRPKPEKVKG-TGNSTD--RHITTDALTKKKMKRKPEPELGE  2221
             A  +  + P PS  G  LD+ K EK KG + NS D  +     AL KKK++RKPE EL  
Sbjct  667   AAAV--QFPSPSANGLVLDKLKQEKPKGSSSNSMDGAKMGVDGALPKKKVRRKPEQELDG  724

Query  2222  GQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFE  2341
                  EKL  + +  + +    A+ +P K ++Q + PPS E
Sbjct  725   THPRSEKLHPQSSGERHKSLKHASGLPQKLNLQSSAPPSLE  765



>ref|XP_004292725.1| PREDICTED: uncharacterized protein LOC101309510 [Fragaria vesca 
subsp. vesca]
Length=754

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/771 (48%), Positives = 475/771 (62%), Gaps = 94/771 (12%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R STS   +G RQ FTVELRPGETTIVSWKKL+++   + +                  L
Sbjct  12    RPSTSVLKSGDRQMFTVELRPGETTIVSWKKLVRDTNKVNA------------------L  53

Query  404   QPLILP--PHNDSPG--PGFSPEQP------VEKEAKDAPPGNRLNAVIEKIERLYVGKQ  553
              P+  P  P N  P      +P QP        +E KD    NR +AVIEKIERLY+GK 
Sbjct  54    PPVTAPEPPANAHPNLESRIAPVQPSGEGEGEGEEGKDEAGPNRFSAVIEKIERLYMGKD  113

Query  554   SdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQ  733
             S DDED +   D+     + SFIDD ELD+YF+VDNSAIKHDGFFVNRG+LERI  T+  
Sbjct  114   SSDDEDQNIPDDDQYDTED-SFIDDAELDEYFEVDNSAIKHDGFFVNRGQLERINTTAAL  172

Query  734   -NQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVP--LAAGTSSPSYGVVMPTL  904
              NQ P KRR+K + K    +DD   PNK AK+GK AG  +   LA  +S P+  + + T 
Sbjct  173   PNQQPKKRRRK-EAKSPGENDDSHLPNKQAKLGKTAGAKITSGLAKNSSGPAT-IAVTTG  230

Query  905   YRENANVHN-------------------------------------QEVNFDMQKAEVLH  973
             YRE+    N                                        N D  K+  L 
Sbjct  231   YREDVKFQNPLYASGYSSTKKSADSKTVVNPSPLKALDGDASALLGDVKNIDKPKSGSLL  290

Query  974   SKNVVDKLKE---SSETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEKSVIYDQ  1141
              K+  ++ K+   SS+TS  + +++ +  Q K  SG+ ++ ++ L+ S +   K+ I  Q
Sbjct  291   PKDSSNRFKDASGSSDTSYHKYHDKSAYSQTKIQSGKLSSNADELESSIRARAKNGIR-Q  349

Query  1142  RLDASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDG  1303
               D +  +GK S  T       R++GSSVR K +MLEKAIRDLE+ VAESRPP  E  +G
Sbjct  350   IPDLNLSDGKYSVPTTKTSHVHRKEGSSVRPKGSMLEKAIRDLERMVAESRPPAMENAEG  409

Query  1304  DNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKI  1483
             DNSSQAIKRRLP EIK KLAKVAR AQASHGK+SKEL+NRLMS +GHL+QLRTLKRNLK+
Sbjct  410   DNSSQAIKRRLPREIKMKLAKVARLAQASHGKISKELLNRLMSSLGHLIQLRTLKRNLKV  469

Query  1484  MINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAF  1663
             MI+MGLSAK+EKD+R QQIK+EV +M+K     ++SKA+EQQ G+SDDFQ  +   KE  
Sbjct  470   MISMGLSAKKEKDDRFQQIKKEVIDMVKMNASSLESKALEQQAGSSDDFQDTSG-AKEVS  528

Query  1664  KRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICR  1843
             KRK+ MD  LE++ICDLYDLY +GL+ED GPQ+RKLYAELA  WP+GFMDNHGIK AICR
Sbjct  529   KRKFSMDPVLEDKICDLYDLYADGLDEDVGPQIRKLYAELAGLWPSGFMDNHGIKSAICR  588

Query  1844  AKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTA  2023
             AKDRR+  Y+++K+QEKMRR K+   K EE  RVE ++  Q   I+E+ A +   HGS  
Sbjct  589   AKDRRRERYSQNKDQEKMRRKKMLTPKVEESVRVEGSSIPQQQYIRERLATEPGSHGS--  646

Query  2024  TNKPISSTAAINMVGRIPVPSP-GGTSLDRPKPEKVKGTGNST--DRHITTDALTKKKMK  2194
              NKP+S T A      + +PSP  G S DR K EK+KG+ +++  D  +   A+ KKK+K
Sbjct  647   GNKPVSGTTAA-----VRIPSPINGPSFDRLKQEKLKGSASNSPDDTRVGDGAVIKKKVK  701

Query  2195  RKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             RKP+ EL E +  PEKL S+Q E + +    AA VP K + Q    PS E+
Sbjct  702   RKPDQELDETRIRPEKLPSQQGEERQKSFKQAAGVPHKSNHQSTGLPSVEQ  752



>ref|XP_011002436.1| PREDICTED: ubinuclein-1 isoform X1 [Populus euphratica]
Length=766

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/762 (49%), Positives = 480/762 (63%), Gaps = 72/762 (9%)
 Frame = +2

Query  227   VSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQ  406
             ++ SY   G RQ FTVELRPGETT VSWKKL+K+A  + S    A   AP      A   
Sbjct  17    LTPSYVKLGDRQIFTVELRPGETTFVSWKKLMKDANKVNSGSAPAAPAAPDPPPVNAH--  74

Query  407   PLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvp  586
                  P+ +S     +P    E E  + PP NR +AVIEKIERLY GK S D+EDL DVP
Sbjct  75    -----PNLES---RIAPAPVTENEVNEDPPPNRFSAVIEKIERLYTGKDSSDEEDLMDVP  126

Query  587   dedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKK  763
             D+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EP    N+ P KR++K
Sbjct  127   DDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPPVVPNEKPKKRQRK  186

Query  764   DQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAG--TSSPSYGVVMPTLYRENANVHNQ-  934
             D  K  + SDDG   NK AK+GK   + + L  G  +S+ S  + M +   EN    +Q 
Sbjct  187   DLLKAPNESDDGRISNKLAKLGKSTVEKLALPPGKNSSNLSQNLTMISEQYENVKFQSQS  246

Query  935   ------------EVNF-----------------------DMQKAEV--LHSKNVVDKLKE  1003
                         E                          D++K++   L  KN+  K KE
Sbjct  247   NSPGNSSKKKSAETKMKLDPSLSVRGSNGDAYASLAETKDIEKSKTGGLQPKNLTSKPKE  306

Query  1004  SS---ETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEKSVIYDQ-RLDASAPEG  1168
             +S   ++SNQ+S+E+ +  Q K  + ++ N +  L+ S +  EK+ + +   L+ +  +G
Sbjct  307   ASGLSDSSNQKSHEKSAYMQPKLQTAKTVNNAEDLESSVRSKEKNGVRELPDLNLNISDG  366

Query  1169  KRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKR  1330
             K  TQ        R+DGSSVR K +MLEKAIR+LEK VAESRPP  E Q+ D S+QAIKR
Sbjct  367   KIYTQAAKTSHVHRKDGSSVRPKSSMLEKAIRELEKMVAESRPPAMENQETDTSAQAIKR  426

Query  1331  RLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             RLP EIK KLAKVAR A AS GK+SKEL+NRLMSI+GHL+QLRTLKRNLKIMIN GLS K
Sbjct  427   RLPTEIKLKLAKVARLA-ASQGKMSKELLNRLMSILGHLIQLRTLKRNLKIMINTGLSVK  485

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNA  1690
             QEKD+R QQIK+EV EMI  R+P ++S A+ QQ G SDDFQ I +EEKEA K+K+ MD  
Sbjct  486   QEKDDRFQQIKKEVTEMITTRIPSVESNALVQQAGASDDFQEIGSEEKEALKKKFSMDVL  545

Query  1691  LENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY  1870
             LE++ICDLYDL+VEGL+ED+GPQVRKLY ELA  WP+G MDNHGIKRAICRAK+RR+ +Y
Sbjct  546   LEDKICDLYDLFVEGLDEDSGPQVRKLYVELAQLWPSGLMDNHGIKRAICRAKERRRVVY  605

Query  1871  NRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTA  2050
              R+K+ EKM+  K+   K+EE  R E+    QP  +QE+ A++         +KP+S++ 
Sbjct  606   CRNKDLEKMKSKKMLTLKQEEVVRAESGLVAQP-HVQERVAMEMAGPVLALASKPVSNST  664

Query  2051  AINMVGRIPVPSPGGTSLDRPKPEKVKG-TGNSTDRH-ITTD-ALTKKKMKRKPEPELGE  2221
             A ++  R+P PS  G  +D+ K EK KG + NS D   +  D ALTKKK+KRKPE EL E
Sbjct  665   AASV--RLPSPSTNGLVVDKLK-EKPKGSSSNSMDESKMGVDGALTKKKVKRKPEQELDE  721

Query  2222  GQYLPEKL--SSKQAEYKPQEPIAAAPVPKPSIQLNEPPSFE  2341
                  EKL   S    +K  +  +  P  K ++    P SFE
Sbjct  722   THLRTEKLHPQSSGERHKSHKHASVLPPQKLNLPSTAPSSFE  763



>ref|XP_011074816.1| PREDICTED: uncharacterized protein LOC105159445 [Sesamum indicum]
Length=748

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/739 (50%), Positives = 469/739 (63%), Gaps = 61/739 (8%)
 Frame = +2

Query  230   STSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQP  409
             ++S+EAAGGR RFTVELRPGETTIVSWKKLL+EA   +SN  G         A    +  
Sbjct  19    TSSFEAAGGRLRFTVELRPGETTIVSWKKLLREANSSKSNRPGPSNSGQSFEAQRQPVAQ  78

Query  410   LILPPHNDSPGPGFSPEQPVEKEAKDAPP---GNRLNAVIEKIERLYVGKQSdddedldd  580
                PP   +P    S +Q  E E KD+      NRL+ VIE+IER+Y G  S D+ED+  
Sbjct  79    PPPPPPPLAPS---SSKQTTEAEPKDSQAQAGSNRLSTVIERIERMYAGNGSSDEEDVVL  135

Query  581   vp--dedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKR  754
                 D+DEYDTEDSFIDDTELDDYFQVDN AIKHDGFFVNRGKLE IEPT   NQ P KR
Sbjct  136   DNIPDDDEYDTEDSFIDDTELDDYFQVDNLAIKHDGFFVNRGKLEPIEPTICTNQQPKKR  195

Query  755   RKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYREN-----A  919
             R+KD TK   GSDDG NPNK  KVG +  K       ++S S+GV MP ++ E+     A
Sbjct  196   RRKDLTKGHGGSDDGHNPNKIVKVGNRGRKR-----NSASQSHGVSMPNIHGEDMQFQAA  250

Query  920   NVHNQEVNF-----DMQKAEVLHSKNVV--DKLKESSET----------SNQRSNERISV  1048
               +  EV+      DMQ A  +H   ++  D ++E +ET          +N  +  ++S 
Sbjct  251   LANASEVSLKKKTTDMQTA--VHPSELLNGDAIREDTETDLKIPGDPSSTNHITKWKVSE  308

Query  1049  PQEKSSGRSANIS---------------NGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQ  1183
              Q+ S+ RS + S               + LDQS QQ  KS +  +R D + P  + S  
Sbjct  309   FQDTSTQRSNDKSPHLSKSHTEKQLYNIDDLDQSTQQKGKSGLA-ERFDLNIPASRDSLP  367

Query  1184  TVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLA  1363
             T R++G+ VR K   LEKAIR+LEK VAE RPP+ EVQD D SSQA+KRRLP EIKQKL 
Sbjct  368   TTRKEGAGVRPKGATLEKAIRELEKIVAEFRPPSTEVQDPDISSQAVKRRLPAEIKQKLG  427

Query  1364  KVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIK  1543
             K+AR AQAS GK+ K++INRLMSIVGHL+Q+RTLKRNLK+M NMGLSAKQEK++R+Q+IK
Sbjct  428   KIARLAQASTGKIPKDVINRLMSIVGHLMQIRTLKRNLKVMANMGLSAKQEKEDRIQKIK  487

Query  1544  REVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDL  1723
             +EVAEM+K R+P MKSK I+QQ   SDDF+    EEKEA KRKY +D+ LEN+ICDLYDL
Sbjct  488   QEVAEMVKLRIPYMKSK-IQQQTANSDDFKEAGPEEKEALKRKYSLDDVLENKICDLYDL  546

Query  1724  YVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRR  1903
             YVE LEED+GP VRKLY ELA  WP GFMD  GIKRAI RAK+ RK L +  K+++K+++
Sbjct  547   YVERLEEDSGPPVRKLYEELAVLWPCGFMDTGGIKRAIYRAKN-RKGLCSLRKDRDKIKK  605

Query  1904  NKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVP  2083
              K+ A K  +   V      Q   I EK   D+RD  S  T+KPI S A     G +PV 
Sbjct  606   KKVLAPKAVDAMNVT-----QAQHIHEKKLSDSRDQVSALTSKPILSAAVAQGAGLLPVA  660

Query  2084  SPGGTSLDRPKPEKVKGTGNSTDRHIT-TDALTKKKMKRKPEPELGEGQYLPEKLSSKQA  2260
                G+++D+ K  K  G+ +     +  +D L KKK+KRKP  E+ E Q+  EKL S+  
Sbjct  661   FANGSNIDKLKQAKKNGSSSKGPVPVMPSDVLPKKKVKRKPNAEVNEAQFCLEKLVSQGE  720

Query  2261  EYKPQEPIAAAPVPKPSIQ  2317
             E +     AA P+ K ++Q
Sbjct  721   ERRRHPKHAALPLSKSNLQ  739



>ref|XP_011002437.1| PREDICTED: ubinuclein-1 isoform X2 [Populus euphratica]
Length=745

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/755 (49%), Positives = 474/755 (63%), Gaps = 79/755 (10%)
 Frame = +2

Query  227   VSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQ  406
             ++ SY   G RQ FTVELRPGETT VSWKKL+K+A  + S    A   AP      A   
Sbjct  17    LTPSYVKLGDRQIFTVELRPGETTFVSWKKLMKDANKVNSGSAPAAPAAPDPPPVNAH--  74

Query  407   PLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvp  586
                  P+ +S     +P    E E  + PP NR +AVIEKIERLY GK S D+EDL DVP
Sbjct  75    -----PNLES---RIAPAPVTENEVNEDPPPNRFSAVIEKIERLYTGKDSSDEEDLMDVP  126

Query  587   dedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKK  763
             D+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EP    N+ P KR++K
Sbjct  127   DDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPPVVPNEKPKKRQRK  186

Query  764   DQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAG--TSSPSYGVVMPTLYRENANVHNQ-  934
             D  K  + SDDG   NK AK+GK   + + L  G  +S+ S  + M +   EN    +Q 
Sbjct  187   DLLKAPNESDDGRISNKLAKLGKSTVEKLALPPGKNSSNLSQNLTMISEQYENVKFQSQS  246

Query  935   ------------EVNF-----------------------DMQKAEV--LHSKNVVDKLKE  1003
                         E                          D++K++   L  KN+  K KE
Sbjct  247   NSPGNSSKKKSAETKMKLDPSLSVRGSNGDAYASLAETKDIEKSKTGGLQPKNLTSKPKE  306

Query  1004  S---SETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGK  1171
             +   S++SNQ+S+E+ +  Q K  + ++ N +  L+ S +  EK+             GK
Sbjct  307   ASGLSDSSNQKSHEKSAYMQPKLQTAKTVNNAEDLESSVRSKEKN-------------GK  353

Query  1172  RSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIK  1351
              ++   R+DGSSVR K +MLEKAIR+LEK VAESRPP  E Q+ D S+QAIKRRLP EIK
Sbjct  354   -TSHVHRKDGSSVRPKSSMLEKAIRELEKMVAESRPPAMENQETDTSAQAIKRRLPTEIK  412

Query  1352  QKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRV  1531
              KLAKVAR A AS GK+SKEL+NRLMSI+GHL+QLRTLKRNLKIMIN GLS KQEKD+R 
Sbjct  413   LKLAKVARLA-ASQGKMSKELLNRLMSILGHLIQLRTLKRNLKIMINTGLSVKQEKDDRF  471

Query  1532  QQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICD  1711
             QQIK+EV EMI  R+P ++S A+ QQ G SDDFQ I +EEKEA K+K+ MD  LE++ICD
Sbjct  472   QQIKKEVTEMITTRIPSVESNALVQQAGASDDFQEIGSEEKEALKKKFSMDVLLEDKICD  531

Query  1712  LYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQE  1891
             LYDL+VEGL+ED+GPQVRKLY ELA  WP+G MDNHGIKRAICRAK+RR+ +Y R+K+ E
Sbjct  532   LYDLFVEGLDEDSGPQVRKLYVELAQLWPSGLMDNHGIKRAICRAKERRRVVYCRNKDLE  591

Query  1892  KMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGR  2071
             KM+  K+   K+EE  R E+    QP  +QE+ A++         +KP+S++ A ++  R
Sbjct  592   KMKSKKMLTLKQEEVVRAESGLVAQP-HVQERVAMEMAGPVLALASKPVSNSTAASV--R  648

Query  2072  IPVPSPGGTSLDRPKPEKVKG-TGNSTDRH-ITTD-ALTKKKMKRKPEPELGEGQYLPEK  2242
             +P PS  G  +D+ K EK KG + NS D   +  D ALTKKK+KRKPE EL E     EK
Sbjct  649   LPSPSTNGLVVDKLK-EKPKGSSSNSMDESKMGVDGALTKKKVKRKPEQELDETHLRTEK  707

Query  2243  L--SSKQAEYKPQEPIAAAPVPKPSIQLNEPPSFE  2341
             L   S    +K  +  +  P  K ++    P SFE
Sbjct  708   LHPQSSGERHKSHKHASVLPPQKLNLPSTAPSSFE  742



>ref|XP_002520310.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42096.1| conserved hypothetical protein [Ricinus communis]
Length=756

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/758 (49%), Positives = 485/758 (64%), Gaps = 78/758 (10%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             RV+ SY   G RQ FTVELRPGETT VSWKKL+K+A  + S    AP           + 
Sbjct  24    RVTPSYVKLGDRQIFTVELRPGETTFVSWKKLMKDANKVNSGSTPAP-----------DP  72

Query  404   QPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddv  583
              P+ L P+ +S     +  QP E EAK+ P  NR +AVIEKIERLY+GK S DDEDL DV
Sbjct  73    PPVNLHPNLES---RLAAGQPTENEAKEPPAPNRFSAVIEKIERLYMGKDSSDDEDLKDV  129

Query  584   pdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRK  760
             PD+D+YDT+DSFIDD +LD+YF+VDNSAIKH GFFVNRGKLERI EPT   NQ   KRR+
Sbjct  130   PDDDQYDTDDSFIDDADLDEYFEVDNSAIKHSGFFVNRGKLERINEPTIMPNQQVKKRRR  189

Query  761   KDQTKCQSGSDDGCNPNKPAKVGKK-AGKSVPLAAGTS-SPSYGVVMPTLYREN------  916
             KD  K    SDDG   NK  KVGK  AGK+ PL    S +P   + + + + E+      
Sbjct  190   KDLNKAPGESDDGRTLNKHVKVGKSAAGKTAPLPGKNSFNPLQVLAVTSEHNEDVKSQNP  249

Query  917   ------------------------ANVHNQEVNF------DMQKAEV--LHSKNVVDKLK  1000
                                       V N +V+       D++K +   L  KN+ +K K
Sbjct  250   SFSSGISSKKKSAESKMNVDPSSSVKVSNGDVSVSLPEANDIEKPKTGGLQMKNLTNKSK  309

Query  1001  ESS---ETSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGK  1171
             ++S   + S+Q+   ++       S +S    +  + S +  EK+ ++ +  D + P+GK
Sbjct  310   DASGSLDASHQKYQSKL------QSAKSITRIDEHEPSVRSKEKNGVH-ELPDLNMPDGK  362

Query  1172  RSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIK  1351
             + +   +RDGSS R K ++LE AIR+LEK VAESRPP  E Q+ D SSQAIKRRLP E+K
Sbjct  363   KPSHVHKRDGSSGRHKGSVLENAIRELEKMVAESRPPTLENQEADTSSQAIKRRLPREVK  422

Query  1352  QKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRV  1531
              KLAKVAR A AS GK+SK+LINRLMSI+GHL+QLRTLKRNLK+MI+M LSAKQEKD+R 
Sbjct  423   LKLAKVARLA-ASQGKVSKDLINRLMSILGHLIQLRTLKRNLKVMISMSLSAKQEKDDRF  481

Query  1532  QQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICD  1711
             QQIK+EVAEMIK R P ++SKA+E   G SD+FQ I+ +EK A KRK+ MD  +E++ICD
Sbjct  482   QQIKKEVAEMIKTRGPSLESKALEHA-GASDNFQEISPQEKGAPKRKFSMDAVVEDKICD  540

Query  1712  LYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQE  1891
             LYDL+V+GL+EDAGPQVRKLY ELA  WP+GFMDNHGIKRAICRAK+RR+ LYNRHK QE
Sbjct  541   LYDLFVDGLDEDAGPQVRKLYVELAGLWPSGFMDNHGIKRAICRAKERRRALYNRHKEQE  600

Query  1892  KMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHG-STATNK-PISSTAAINMV  2065
             K++RNK+ A + +E   VE  +      ++E+  +D      + A+N  P S+TAA+   
Sbjct  601   KLKRNKMLAPRLDESAGVEAGSVALQQPMRERLPIDTGGPVLALASNSIPNSATAAV---  657

Query  2066  GRIPVPSPGGTSLDRPKPEKVKGTGNS--TDRHITTD-ALTKKKMKRKPEPELGEGQYL-  2233
              RIP P     +++R K EK KG+ ++   +  +  D AL KKK KRKPEPEL E     
Sbjct  658   -RIPSPPTNAPNVERLKQEKPKGSSSNPMDEAKMGVDGALAKKKTKRKPEPELDETHIRS  716

Query  2234  PEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
              EKL S+ +E + +    AA +  K ++QL  P SFE+
Sbjct  717   SEKLHSQSSEERHKSLKQAAGLSQKLNLQLTTPSSFEQ  754



>ref|XP_004160723.1| PREDICTED: uncharacterized LOC101204246 [Cucumis sativus]
Length=761

 Score =   550 bits (1417),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 367/775 (47%), Positives = 469/775 (61%), Gaps = 86/775 (11%)
 Frame = +2

Query  194   GSSGGEPGVG---RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngap  364
             G+  G  G G   R S+S+  +G RQ FTVELRPGETTIVSWKKL+K+A  +        
Sbjct  13    GTRTGNGGAGDSSRASSSFLKSGDRQMFTVELRPGETTIVSWKKLVKDANKVNGLNTVPE  72

Query  365   gpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYV  544
              PA    A    + P                 QP+E E KD    NR NAVIEKIERLY+
Sbjct  73    PPANPNPAVECRIDP----------------GQPIEDEVKDPTAPNRFNAVIEKIERLYM  116

Query  545   GKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPT  724
             GK S D+EDL    D+ + +   SFIDDTELD+YF+VD+SAIKHDGFFVNRGKLERIEP+
Sbjct  117   GKDSSDEEDLIPDDDQYDTED--SFIDDTELDEYFEVDDSAIKHDGFFVNRGKLERIEPS  174

Query  725   SQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGT-SSPSYGVVMP  898
              Q NQ   KRR+KD  K    + DG + NK +KVGK   GKS  + A + S+ S  +V+ 
Sbjct  175   GQPNQQLKKRRRKDLEKGHPENHDGRSSNKHSKVGKTTTGKSALMVAKSFSNLSQNMVIT  234

Query  899   TLYRENANVHN------------------------------------QEV-NFDMQKAEV  967
               + E+  + N                                     EV + D  K  V
Sbjct  235   HEHLEDGKLQNPLMPGHSSKKKSGDTKMILDPSPSLKVYNGDTSTSVAEVKDADPSKPGV  294

Query  968   LHSKNVVDKLKES---SETSNQRSNERIS-VPQEKSSGRSANISNGLDQSFQQGEKSVIY  1135
                KN   K KES   S++  Q   E+++  P +   GR    ++ +D S Q  EK  + 
Sbjct  295   FPPKNPGSKSKESCGPSDSLQQNILEKVAHAPSKPQPGRPC--TDEIDSSIQMKEKHGVR  352

Query  1136  DQRLDASAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQ  1297
              +  D + P  K S QT +      +DGSSVR K ++LEKAIR+LEK VAESRPP  E  
Sbjct  353   -ELPDINLPVAKYSMQTAKTPYVHKKDGSSVRPKSSLLEKAIRELEKMVAESRPPLTENP  411

Query  1298  DGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNL  1477
             + DNSSQAIKRRLP EIK KLAKVAR A AS+GKLSK LINRLMS +GH +QLRTLKRNL
Sbjct  412   EADNSSQAIKRRLPREIKLKLAKVARLA-ASNGKLSKGLINRLMSSLGHFIQLRTLKRNL  470

Query  1478  KIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKE  1657
             KIM+NMG+S KQEKD+R QQIK+EV EMIK R   ++ K IEQQ G   D + + +EEK 
Sbjct  471   KIMVNMGISVKQEKDDRFQQIKKEVIEMIKIRPLSLELKVIEQQGGAPQDVRELVSEEKG  530

Query  1658  AFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAI  1837
               ++K+ MD +LE++ICDLYDL+V+GL+EDAGPQ+RKLYAELA  WPNGFMDNHGIKRAI
Sbjct  531   VPRKKFAMDPSLEDKICDLYDLFVDGLDEDAGPQIRKLYAELAELWPNGFMDNHGIKRAI  590

Query  1838  CRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGS  2017
             CRAK+RR+ L+ RHK+QEK++R KI   + +E  R E  T  QP   +E+ A ++   G 
Sbjct  591   CRAKERRRALHGRHKDQEKIKRKKILPPRVDETVRNEVGTVAQPQYARERLASES---GL  647

Query  2018  TATNKPISSTAAINMVGRIPVPSPGGT-SLDRPKPEKVKGTGNST--DRHITTDALTKKK  2188
               T  P +  A+++MV    + S     ++DR K EK+K + +S+  D  I   ALTKKK
Sbjct  648   QPT--PATKPASVSMVAAAQLQSASSVGNIDRLKSEKMKVSSSSSHEDARIVDGALTKKK  705

Query  2189  MKRKPEPELGEGQYLPEKLSSKQAEYKPQ---EPIAAAPVPKPSIQLNEPPSFEE  2344
              KRK E EL E    PEK S++  + K +   +P A+ P PKP+IQ   P S E+
Sbjct  706   TKRKAEVELEETHNRPEKASTQHGDEKHKSTNKPTASLP-PKPNIQSAAPSSLEQ  759



>ref|XP_004149441.1| PREDICTED: uncharacterized protein LOC101204246 [Cucumis sativus]
 gb|KGN47689.1| hypothetical protein Csa_6G381790 [Cucumis sativus]
Length=761

 Score =   549 bits (1414),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 367/775 (47%), Positives = 468/775 (60%), Gaps = 86/775 (11%)
 Frame = +2

Query  194   GSSGGEPGVG---RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngap  364
             G+  G  G G   R S+S+  +G RQ FTVELRPGETTIVSWKKL+K+A  +        
Sbjct  13    GTRTGNGGAGDSSRASSSFLKSGDRQMFTVELRPGETTIVSWKKLVKDANKVNGLNTVPE  72

Query  365   gpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYV  544
              PA    A    + P                 QP+E E KD    NR NAVIEKIERLY+
Sbjct  73    PPANPNPAVECRIDP----------------GQPIEDEVKDPTAPNRFNAVIEKIERLYM  116

Query  545   GKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPT  724
             GK S D+EDL    D+ + +   SFIDDTELD+YF+VD+SAIKHDGFFVNRGKLERIEP+
Sbjct  117   GKDSSDEEDLIPDDDQYDTED--SFIDDTELDEYFEVDDSAIKHDGFFVNRGKLERIEPS  174

Query  725   SQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGT-SSPSYGVVMP  898
              Q NQ   KRR+KD  K    + DG + NK +KVGK   GKS  + A + S+ S  +V+ 
Sbjct  175   GQPNQQLKKRRRKDLEKGHPENHDGRSSNKHSKVGKTTTGKSALMVAKSFSNLSQNMVIT  234

Query  899   TLYRENANVHN------------------------------------QEV-NFDMQKAEV  967
               + E+  + N                                     EV + D  K  V
Sbjct  235   HEHLEDGKLQNPLMPGHSSKKKSGDTKMILDPSPSLKVYNGDTSTSVAEVKDADPSKPGV  294

Query  968   LHSKNVVDKLKES---SETSNQRSNERIS-VPQEKSSGRSANISNGLDQSFQQGEKSVIY  1135
                KN   K KES   S++  Q   E+++  P +   GR    ++ +D S Q  EK  + 
Sbjct  295   FPPKNPGSKSKESCGPSDSLQQNILEKVAHAPSKPQPGRPC--TDEIDSSIQMKEKHGVR  352

Query  1136  DQRLDASAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQ  1297
              +  D + P  K S QT +      +DGSSVR K ++LEKAIR+LEK VAESRPP  E  
Sbjct  353   -ELPDINLPVAKYSMQTAKTPYVHKKDGSSVRPKSSLLEKAIRELEKMVAESRPPLTENP  411

Query  1298  DGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNL  1477
             + DNSSQAIKRRLP EIK KLAKVAR A AS+GKLSK LINRLMS +GH +QLRTLKRNL
Sbjct  412   EADNSSQAIKRRLPREIKLKLAKVARLA-ASNGKLSKGLINRLMSSLGHFIQLRTLKRNL  470

Query  1478  KIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKE  1657
             KIM+NMG+S KQEKD+R QQIK+EV EMIK R   ++ K IEQQ G   D + + +EEK 
Sbjct  471   KIMVNMGISVKQEKDDRFQQIKKEVIEMIKIRPLSLELKVIEQQGGAPQDVRELVSEEKG  530

Query  1658  AFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAI  1837
               ++K+ MD +LE++ICDLYDL+V+GL+EDAGPQ+RKLYAELA  WPNGFMDNHGIKRAI
Sbjct  531   VPRKKFAMDPSLEDKICDLYDLFVDGLDEDAGPQIRKLYAELAELWPNGFMDNHGIKRAI  590

Query  1838  CRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGS  2017
             CRAK+RR+ L+ RHK+QEK++R KI   + +E  R E  T  QP   +E+ A ++   G 
Sbjct  591   CRAKERRRALHGRHKDQEKIKRKKILPPRVDETVRNEVGTVAQPQYARERLASES---GL  647

Query  2018  TATNKPISSTAAINMVGRIPVPSPGGT-SLDRPKPEKVKGTGNST--DRHITTDALTKKK  2188
               T  P +  A+++MV    + S     ++DR K EK+K + +S+  D  I   ALTKKK
Sbjct  648   QPT--PATKPASVSMVAAAQLQSASSVGNIDRLKSEKMKVSSSSSHEDARIVDGALTKKK  705

Query  2189  MKRKPEPELGEGQYLPEKLSSKQAEYKPQ---EPIAAAPVPKPSIQLNEPPSFEE  2344
              KRK E EL E    PEK S +  + K +   +P A+ P PKP+IQ   P S E+
Sbjct  706   TKRKAEVELEETHNRPEKASIQHGDEKHKSTNKPTASLP-PKPNIQSAAPSSLEQ  759



>ref|XP_010063440.1| PREDICTED: ubinuclein-1 isoform X3 [Eucalyptus grandis]
Length=736

 Score =   548 bits (1411),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 365/727 (50%), Positives = 466/727 (64%), Gaps = 38/727 (5%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT----GLQsngngapgpaprasaa  391
             RV +S+  +G RQ F+VELRPGETTIVSWKKL+K+A     G  S    A       +A 
Sbjct  26    RVLSSFVKSGDRQVFSVELRPGETTIVSWKKLVKDANKPDGGSSSAAAVAEAAVATVAAP  85

Query  392   aaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSddded  571
             ++      L P          P QPVE+E K+A P N  +AVIEKIERLY+GK S DDED
Sbjct  86    SSAAPHAALEPRA-------VPGQPVERETKEAAPLNSFSAVIEKIERLYMGKDSSDDED  138

Query  572   lddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPN  748
             L+D+PDED+YDTEDSFIDD ELD+YF+V+N+ IK+DGFFVNRGKLE I +PT   NQ P 
Sbjct  139   LNDIPDEDQYDTEDSFIDDAELDEYFEVENADIKYDGFFVNRGKLECINKPTVPPNQQPK  198

Query  749   KRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENANVH  928
             KRR++D  K      DG  PNK  KV K         AG  S +      T   EN    
Sbjct  199   KRRRRDFAKINGEKGDGFVPNKHVKVDKPGPAKAATLAGKHSSNPSQSSATEPNENLKSQ  258

Query  929   NQEVNFDMQKAEVLHSKNVVD-----KLKESSETSNQRSNERISVPQEKSSGRSANISNG  1093
             NQ ++    + + + SK +VD     K+      ++    + I       SGR     + 
Sbjct  259   NQYLSGSGSRKKSVDSKVIVDPAPYAKVVNGDALASLTDTKDID-KHNMQSGRQLKNVDD  317

Query  1094  LDQSFQQGEKSVIYDQRLDASAPEGKRSTQ------TVRRDGSSVRSKITMLEKAIRDLE  1255
              + S +  EKS +  +  D + P+GK + +      + R+DGSS R K TMLEKAIRDLE
Sbjct  318   PEASNRPKEKSNVR-EVPDLNMPDGKHAIEISKPPHSHRKDGSSFRPKSTMLEKAIRDLE  376

Query  1256  KFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSI  1435
             K VAESRPP AE QD D SSQ++KRRLP ++K KLAKVAR AQ+SHGK+SKELINRLMSI
Sbjct  377   KIVAESRPPAAENQDADYSSQSVKRRLPSDVKLKLAKVARLAQSSHGKISKELINRLMSI  436

Query  1436  VGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPG  1615
             +GHLVQLRTLKRNLK+M+ MGLSAKQ+K+NR QQIK+EVA+M++ R+P +++KA++ Q G
Sbjct  437   LGHLVQLRTLKRNLKVMVTMGLSAKQDKENRFQQIKKEVADMVRMRIPSLETKALQHQSG  496

Query  1616  TSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYW  1795
              SDDFQ   +EEK   K++Y MD A+E++ICDLYDL+++GL+ED GPQVRKLYAELA  W
Sbjct  497   ASDDFQE--SEEKTIPKKQYDMDAAMEDKICDLYDLFIDGLDEDTGPQVRKLYAELAELW  554

Query  1796  PNGFMDNHGIKRAICRAKDRRKTLYNRHK-NQEKMRRNKISAQKEEEGYRVETTTRDQPV  1972
             PNGFMDNHGIKRAIC+AK+RR+ LY+RHK +QEK+RR K+ A K EE  RVE  +  QP 
Sbjct  555   PNGFMDNHGIKRAICKAKERRRALYSRHKEDQEKIRRKKMLAPKIEESVRVEGVSVAQPQ  614

Query  1973  QIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKGTGN--S  2146
                E+ ++D+  HGST+ ++PI S  A     RIP PS    S DR K EK K T +  S
Sbjct  615   PPPERLSIDSGIHGSTSASRPIHSPTA--ATARIPSPS-ANVSSDRIKQEKTKVTSSNFS  671

Query  2147  TDRHITTDALTKKKMKRKPEPELGEGQYLPEKLS-SKQAEYKPQEPIAAAPVPKPSIQLN  2323
              D       + KKK+KRKPE +L E  +  EK    K    KP   +     PK ++Q  
Sbjct  672   EDARHGEAIVPKKKVKRKPEVDLNEMPFHSEKFGEEKIVSSKPNPSLP----PKINLQPT  727

Query  2324  EPPSFEE  2344
               PSFE+
Sbjct  728   AAPSFEQ  734



>ref|XP_002306653.2| wound-responsive family protein [Populus trichocarpa]
 gb|EEE93649.2| wound-responsive family protein [Populus trichocarpa]
Length=842

 Score =   551 bits (1420),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 370/778 (48%), Positives = 475/778 (61%), Gaps = 90/778 (12%)
 Frame = +2

Query  227   VSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQ  406
             ++ SY   G RQ FTVELRPGETT VSWKKL+K+A  + S         P  +A      
Sbjct  79    LTPSYVKLGDRQIFTVELRPGETTFVSWKKLMKDANKVNSGSAPPAPDPPPVNAH-----  133

Query  407   PLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvp  586
                  P+ +S     +P    E E  D PP NR +AVIEKIERLY GK S D+EDL DVP
Sbjct  134   -----PNLES---RIAPAPVTENEVNDDPPPNRFSAVIEKIERLYTGKDSSDEEDLMDVP  185

Query  587   dedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKK  763
             D+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EP    N+ P KR++K
Sbjct  186   DDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPPVVPNEKPKKRQRK  245

Query  764   DQTKCQSGSDDGCNPNKPAKVGKKAGKSV--PLAAGTSSPSYGVVM--------------  895
             D  K  + SDDG   NKPAK+GK   + +  P    +S+ S  + M              
Sbjct  246   DLLKAPNDSDDGRISNKPAKLGKSTVEKLAPPPGKNSSNLSQNLTMISDQYEKFQSQSNS  305

Query  896   -----------------PTLYRENAN-----VHNQEVNFDMQKAEVLHSKNVVDKLKESS  1009
                              P+L    +N        +  + +  K   L  KN+  K K++S
Sbjct  306   PGNSSKKKSAETKMKLDPSLSVRGSNGDAYASLAEPQDIEKSKTGGLQPKNLTSKPKDAS  365

Query  1010  ---ETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEKSVIYDQ-RLDASAPEGKR  1174
                ++SNQ+S+E+ +  Q K  + ++   +  L+ S +  EK+ + +   L+ +  +GK 
Sbjct  366   GLSDSSNQKSHEKSAYVQPKLQTAKTVYNAEDLESSARSKEKNGVRELPDLNLNISDGKI  425

Query  1175  STQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRL  1336
              TQ        R+DGSSVR K ++LEKAIR+LEK VAESRPP  E Q+ D S Q IKRRL
Sbjct  426   YTQAAKTSHVHRKDGSSVRPKSSILEKAIRELEKMVAESRPPAMENQETDTSGQGIKRRL  485

Query  1337  PPEIKQKLAKVARYA------------------QASHGKLSKELINRLMSIVGHLVQLRT  1462
             P EIK KLAKVAR A                  QAS GK+SKEL+NRLMSI+GHL+QLRT
Sbjct  486   PTEIKLKLAKVARLALYMEAAKKCKMFTFQWLQQASQGKMSKELLNRLMSILGHLIQLRT  545

Query  1463  LKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIA  1642
             LKRNLKIMIN GLS KQEKD+R QQIK+EVAEMI  R+P ++S A+ QQ G SDDFQ I 
Sbjct  546   LKRNLKIMINTGLSVKQEKDDRFQQIKKEVAEMITTRIPSVESNALVQQAGASDDFQEIG  605

Query  1643  TEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHG  1822
             +EEK A K+K+ MD  LE++ICDLYDL+VEGL+ED+GPQVRKLY ELA  WP+G MDNHG
Sbjct  606   SEEKGALKKKFSMDVVLEDKICDLYDLFVEGLDEDSGPQVRKLYVELAQLWPSGLMDNHG  665

Query  1823  IKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDA  2002
             IKRAICRAK+RR+ +Y R+K+ EKM+  K+   K+EEG R E+    QP  +QE+ A++ 
Sbjct  666   IKRAICRAKERRRVVYCRNKDLEKMKSKKMLTLKQEEGVRAESGLVAQP-HVQERVAMEM  724

Query  2003  RDHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKG-TGNSTD--RHITTDA  2173
                     +KP+S++AA ++  R+P PS  G  +D+ K EK KG + NS D  +     A
Sbjct  725   AGPVLALASKPVSNSAAASV--RLPSPSANGLVVDKLK-EKPKGSSSNSMDESKMGVDGA  781

Query  2174  LTKKKMKRKPEPELGEGQYLPEKL--SSKQAEYKPQEPIAAAPVPKPSIQLNEPPSFE  2341
             LTKKK+KRKPE EL E     EKL   S    +K  +  +  P  K ++    P SFE
Sbjct  782   LTKKKVKRKPEQELDETHLRSEKLHPQSSGERHKSLKHASVLPPQKLNLPSTAPSSFE  839



>ref|XP_010063441.1| PREDICTED: uncharacterized protein LOC104450543 isoform X4 [Eucalyptus 
grandis]
Length=718

 Score =   543 bits (1398),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 346/689 (50%), Positives = 441/689 (64%), Gaps = 63/689 (9%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT----GLQsngngapgpaprasaa  391
             RV +S+  +G RQ F+VELRPGETTIVSWKKL+K+A     G  S    A       +A 
Sbjct  26    RVLSSFVKSGDRQVFSVELRPGETTIVSWKKLVKDANKPDGGSSSAAAVAEAAVATVAAP  85

Query  392   aaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSddded  571
             ++      L P          P QPVE+E K+A P N  +AVIEKIERLY+GK S DDED
Sbjct  86    SSAAPHAALEPR-------AVPGQPVERETKEAAPLNSFSAVIEKIERLYMGKDSSDDED  138

Query  572   lddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPN  748
             L+D+PDED+YDTEDSFIDD ELD+YF+V+N+ IK+DGFFVNRGKLE I +PT   NQ P 
Sbjct  139   LNDIPDEDQYDTEDSFIDDAELDEYFEVENADIKYDGFFVNRGKLECINKPTVPPNQQPK  198

Query  749   KRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENANVH  928
             KRR++D  K      DG  PNK  KV K         AG  S +      T   EN    
Sbjct  199   KRRRRDFAKINGEKGDGFVPNKHVKVDKPGPAKAATLAGKHSSNPSQSSATEPNENLKSQ  258

Query  929   NQEVNFDMQKAEVLHSKNVVD-----------KLKESSETSNQRSNERISVPQEKSSG--  1069
             NQ ++    + + + SK +VD            L   ++T +   +  +++  +  SG  
Sbjct  259   NQYLSGSGSRKKSVDSKVIVDPAPYAKVVNGDALASLTDTKDIDKHNMVNLQSKNHSGKL  318

Query  1070  ------------RSANISNGLDQSFQQ-------------GEKSVIYDQRLDASAPEGKR  1174
                         R  + S  L QS +Q              EKS +  +  D + P+GK 
Sbjct  319   KDPSGPSDVLHHRHHDKSGFLQQSGRQLKNVDDPEASNRPKEKSNVR-EVPDLNMPDGKH  377

Query  1175  STQ------TVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRL  1336
             + +      + R+DGSS R K TMLEKAIRDLEK VAESRPP AE QD D SSQ++KRRL
Sbjct  378   AIEISKPPHSHRKDGSSFRPKSTMLEKAIRDLEKIVAESRPPAAENQDADYSSQSVKRRL  437

Query  1337  PPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQE  1516
             P ++K KLAKVAR AQ+SHGK+SKELINRLMSI+GHLVQLRTLKRNLK+M+ MGLSAKQ+
Sbjct  438   PSDVKLKLAKVARLAQSSHGKISKELINRLMSILGHLVQLRTLKRNLKVMVTMGLSAKQD  497

Query  1517  KDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALE  1696
             K+NR QQIK+EVA+M++ R+P +++KA++ Q G SDDFQ   +EEK   K++Y MD A+E
Sbjct  498   KENRFQQIKKEVADMVRMRIPSLETKALQHQSGASDDFQE--SEEKTIPKKQYDMDAAME  555

Query  1697  NRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNR  1876
             ++ICDLYDL+++GL+ED GPQVRKLYAELA  WPNGFMDNHGIKRAIC+AK+RR+ LY+R
Sbjct  556   DKICDLYDLFIDGLDEDTGPQVRKLYAELAELWPNGFMDNHGIKRAICKAKERRRALYSR  615

Query  1877  HK-NQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAA  2053
             HK +QEK+RR K+ A K EE  RVE  +  QP    E+ ++D+  HGST+ ++PI S  A
Sbjct  616   HKEDQEKIRRKKMLAPKIEESVRVEGVSVAQPQPPPERLSIDSGIHGSTSASRPIHSPTA  675

Query  2054  INMVGRIPVPSPGGTSLDRPKPEKVKGTG  2140
                  RIP PS    S DR K EK K TG
Sbjct  676   --ATARIPSPS-ANVSSDRIKQEKTKLTG  701



>ref|XP_010063438.1| PREDICTED: uncharacterized protein LOC104450543 isoform X1 [Eucalyptus 
grandis]
Length=770

 Score =   543 bits (1398),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 369/760 (49%), Positives = 473/760 (62%), Gaps = 70/760 (9%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT----GLQsngngapgpaprasaa  391
             RV +S+  +G RQ F+VELRPGETTIVSWKKL+K+A     G  S    A       +A 
Sbjct  26    RVLSSFVKSGDRQVFSVELRPGETTIVSWKKLVKDANKPDGGSSSAAAVAEAAVATVAAP  85

Query  392   aaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSddded  571
             ++      L P          P QPVE+E K+A P N  +AVIEKIERLY+GK S DDED
Sbjct  86    SSAAPHAALEPRA-------VPGQPVERETKEAAPLNSFSAVIEKIERLYMGKDSSDDED  138

Query  572   lddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPN  748
             L+D+PDED+YDTEDSFIDD ELD+YF+V+N+ IK+DGFFVNRGKLE I +PT   NQ P 
Sbjct  139   LNDIPDEDQYDTEDSFIDDAELDEYFEVENADIKYDGFFVNRGKLECINKPTVPPNQQPK  198

Query  749   KRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENANVH  928
             KRR++D  K      DG  PNK  KV K         AG  S +      T   EN    
Sbjct  199   KRRRRDFAKINGEKGDGFVPNKHVKVDKPGPAKAATLAGKHSSNPSQSSATEPNENLKSQ  258

Query  929   NQEVNFDMQKAEVLHSKNVVD-----------KLKESSETSNQRSNERISVPQEKSSG--  1069
             NQ ++    + + + SK +VD            L   ++T +   +  +++  +  SG  
Sbjct  259   NQYLSGSGSRKKSVDSKVIVDPAPYAKVVNGDALASLTDTKDIDKHNMVNLQSKNHSGKL  318

Query  1070  ------------RSANISNGLDQSFQQ-------------GEKSVIYDQRLDASAPEGKR  1174
                         R  + S  L QS +Q              EKS +  +  D + P+GK 
Sbjct  319   KDPSGPSDVLHHRHHDKSGFLQQSGRQLKNVDDPEASNRPKEKSNVR-EVPDLNMPDGKH  377

Query  1175  STQ------TVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRL  1336
             + +      + R+DGSS R K TMLEKAIRDLEK VAESRPP AE QD D SSQ++KRRL
Sbjct  378   AIEISKPPHSHRKDGSSFRPKSTMLEKAIRDLEKIVAESRPPAAENQDADYSSQSVKRRL  437

Query  1337  PPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQE  1516
             P ++K KLAKVAR AQ+SHGK+SKELINRLMSI+GHLVQLRTLKRNLK+M+ MGLSAKQ+
Sbjct  438   PSDVKLKLAKVARLAQSSHGKISKELINRLMSILGHLVQLRTLKRNLKVMVTMGLSAKQD  497

Query  1517  KDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALE  1696
             K+NR QQIK+EVA+M++ R+P +++KA++ Q G SDDFQ   +EEK   K++Y MD A+E
Sbjct  498   KENRFQQIKKEVADMVRMRIPSLETKALQHQSGASDDFQE--SEEKTIPKKQYDMDAAME  555

Query  1697  NRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNR  1876
             ++ICDLYDL+++GL+ED GPQVRKLYAELA  WPNGFMDNHGIKRAIC+AK+RR+ LY+R
Sbjct  556   DKICDLYDLFIDGLDEDTGPQVRKLYAELAELWPNGFMDNHGIKRAICKAKERRRALYSR  615

Query  1877  HK-NQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAA  2053
             HK +QEK+RR K+ A K EE  RVE  +  QP    E+ ++D+  HGST+ ++PI S  A
Sbjct  616   HKEDQEKIRRKKMLAPKIEESVRVEGVSVAQPQPPPERLSIDSGIHGSTSASRPIHSPTA  675

Query  2054  INMVGRIPVPSPGGTSLDRPKPEKVKGTGN--STDRHITTDALTKKKMKRKPEPELGEGQ  2227
                  RIP PS    S DR K EK K T +  S D       + KKK+KRKPE +L E  
Sbjct  676   --ATARIPSPS-ANVSSDRIKQEKTKVTSSNFSEDARHGEAIVPKKKVKRKPEVDLNEMP  732

Query  2228  YLPEKLS-SKQAEYKPQEPIAAAPVPKPSIQLNEPPSFEE  2344
             +  EK    K    KP   +     PK ++Q    PSFE+
Sbjct  733   FHSEKFGEEKIVSSKPNPSLP----PKINLQPTAAPSFEQ  768



>ref|XP_010270289.1| PREDICTED: ubinuclein-1-like isoform X4 [Nelumbo nucifera]
Length=790

 Score =   542 bits (1396),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 373/793 (47%), Positives = 482/793 (61%), Gaps = 96/793 (12%)
 Frame = +2

Query  197   SSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpap  376
             SS   P  G  S+S  A+   + FTVELRPGETTIVSWKKL+KEA               
Sbjct  15    SSSFAPETGGASSSTYASKNGRWFTVELRPGETTIVSWKKLIKEAN--------------  60

Query  377   rasaaaaELQPLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGK  550
                  A++  P    P    P      +P QP E E+KDAPPGNR +AVIEKIERLYVGK
Sbjct  61    ----KASQSTPASEAPSGAHPALESRLAPGQPAEGESKDAPPGNRFSAVIEKIERLYVGK  116

Query  551   QSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTS  727
             +S D+E+LD VPD+D+YDTEDSFIDDTELD+YFQVD S+ KH+GFFVNRGKLERI EP +
Sbjct  117   ESSDEEELDGVPDDDQYDTEDSFIDDTELDEYFQVDKSSTKHNGFFVNRGKLERINEPVA  176

Query  728   QQNQLPNKRRKKDQTKCQSGSD----------DGCN-PNKPAKVG----KKAGKSVPLAA  862
               +  P KRR+KD  K +   D          DG + P+K AK+G    K A ++ PL  
Sbjct  177   SPDHQPKKRRRKDLAKSRIEKDGENVPNKHTKDGDHIPSKNAKLGNVRMKAAARTAPLGG  236

Query  863   G-TSSPSYGVVMPTLYRENANVHNQ-----------------------------------  934
               +SSPS  +   + Y E+  V NQ                                   
Sbjct  237   TKSSSPSQSLAAISEYYEDEKVQNQLNAPVGLSKKKSTDSSTKPDNPSSAKILNKDASVF  296

Query  935   --EVNFDMQKAEVLHSKNVVDKLKESSETSNQ----RSNERISVPQEKSSGRSANISNGL  1096
                 + + Q+   +  + +  KLK SSE+S+       ++  S   E  S R  N  N L
Sbjct  297   PEAKDIERQRTGTVQHRELGSKLKVSSESSDALLHLYRDKNTSSQIEPQSNRQLNDMNEL  356

Query  1097  DQS--FQQGEKSVIYDQRLDASAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDL  1252
             + S   +Q EK+    Q  D ++   K   QT +      ++GS+VR K TMLE+AIR+L
Sbjct  357   ELSTKVRQKEKNC-SSQLPDLNSSVIKYPVQTAKTSSMHVKEGSTVRPKGTMLERAIREL  415

Query  1253  EKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMS  1432
             EK VAESRPP  EVQD D SSQA+KRRLP E+KQKLAKVAR AQ+S GK+S+ELINRLMS
Sbjct  416   EKMVAESRPPIMEVQDADASSQAVKRRLPREVKQKLAKVARLAQSSQGKISEELINRLMS  475

Query  1433  IVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQP  1612
             I+GHLVQL+TLKRNLK M+ +GL+AKQ KD+R QQIK+E+ EMIK +   +KSKA E + 
Sbjct  476   ILGHLVQLKTLKRNLKEMVELGLTAKQAKDDRFQQIKKEIVEMIKVQALSLKSKASEPRD  535

Query  1613  GTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAY  1792
             G SDDFQ     E++  K KYCMD+A+E+++CDLYDL+VEG++ED GPQ+RKLY ELA  
Sbjct  536   GASDDFQEPLGSEEKGVKGKYCMDDAMEDKLCDLYDLFVEGMDEDKGPQIRKLYVELAEL  595

Query  1793  WPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQ-KEEEGYRVETTTRDQP  1969
             WPNG MDNHGIK A+CRAK+R++ +Y++HK+QEK+RR K+S+  + EE    ET+T  QP
Sbjct  596   WPNGSMDNHGIKSAVCRAKERKRAMYSKHKDQEKIRRKKLSSTPRTEEIVHGETSTIAQP  655

Query  1970  VQIQEKSAVDARDHGSTATNKPISSTAA----INMVGRIPVPSPGGTSLDR-PKPEKVK-  2131
               +QE+   D   H  T+ N+  S+  A    I+  GR+   S  G +LDR PK EKVK 
Sbjct  656   RFLQERLVYDPSSHVLTSPNRMTSNMTAASQHISAPGRVLNSSTNGLNLDRPPKQEKVKD  715

Query  2132  GTGNSTDRHITTDA-LTKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAA-PVPK  2305
              +G   D    TD  L KKK+KRKPE   GE  Y  +KLS ++ + K + P  A   + K
Sbjct  716   SSGTFLDEVRGTDGKLVKKKLKRKPESIFGEVHYHADKLSIQKVKEKHKFPKQAGNQLQK  775

Query  2306  PSIQLNEPPSFEE  2344
             PS+Q    PS E+
Sbjct  776   PSVQSTGLPSSEQ  788



>ref|XP_006578958.1| PREDICTED: uncharacterized protein LOC100778848 isoform X2 [Glycine 
max]
Length=722

 Score =   539 bits (1389),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 362/765 (47%), Positives = 468/765 (61%), Gaps = 108/765 (14%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R  +S+   G RQ FTVEL PGETTIVSWKKLLK+A                        
Sbjct  6     RAPSSFVKKGDRQMFTVELWPGETTIVSWKKLLKDAN-----------------------  42

Query  404   QPLILPPHNDSPGP----GFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSddded  571
                    HN S         +P QPVE E  D    NR +AVIEKIERLY GK S DDED
Sbjct  43    ------KHNGSTSAPQHVAIAPGQPVEVEETDPSQPNRFSAVIEKIERLYTGKDSSDDED  96

Query  572   lddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPN  748
             L DVPD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EP    NQ P 
Sbjct  97    LLDVPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPPVLPNQQPK  156

Query  749   KRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPL-AAGTSSPSYGVVMPTLYRENAN  922
             KRR+KD  K    ++DG   NK  KVG+ A  K+  L A    + S  +V P  + E+  
Sbjct  157   KRRRKDILKNAGENNDGHGSNKNVKVGRPASAKTASLQAKNMLNLSENLVAPGDHIEDLK  216

Query  923   VHNQE-------------------------------------VNFDMQKAEVLHSKNVVD  991
             + NQ                                       + D QK     SKN+ D
Sbjct  217   LPNQSDVSGIISKKKTADTKPILNPSVSLKTSSDDAPAVTDAKDVDKQKIGAFQSKNISD  276

Query  992   KLKESS---ETSNQRSNERISVPQEKSS-GRSANISNGLDQSFQQGEKSVIYDQRLDASA  1159
             K  + S   + S+ + NE+ +    KS  GR    S+ +D      EK+ +  +  D + 
Sbjct  277   KYIDGSGSFDASHHKYNEKSAYAHSKSQPGRP---SSNIDDINWTKEKNGMR-ELPDLNL  332

Query  1160  PEGKRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQA  1321
              EGK +TQ  +      ++GSSVR K +MLEKA+R+LEK VAESRPP  + Q+ D +SQA
Sbjct  333   SEGKSATQATKSENMHKKEGSSVRPKTSMLEKALRELEKMVAESRPPAVDNQEADATSQA  392

Query  1322  IKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGL  1501
             +KRRLP EIK KLAKVAR A A+HGK+SKELINRLMSI+GHL+QLRTLKRNLKIMINMGL
Sbjct  393   VKRRLPREIKLKLAKVARLA-ATHGKVSKELINRLMSILGHLIQLRTLKRNLKIMINMGL  451

Query  1502  SAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCM  1681
             SAKQE+DNR QQIK+EV ++IK + P ++SK ++ +   S DFQ   T+ K   KRK+ M
Sbjct  452   SAKQEEDNRFQQIKKEVVDLIKMQAPTLESKQLKGE--ASGDFQEFGTDGKPITKRKFTM  509

Query  1682  DNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRK  1861
             D ALE++ICDLYDL+V+GL+E+AGPQ+RKLYAELA  WP+G+MDNHGIKR ICRAK+RR+
Sbjct  510   DAALEDKICDLYDLFVDGLDENAGPQIRKLYAELAQLWPSGYMDNHGIKRGICRAKERRR  569

Query  1862  TLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPIS  2041
              LYN+HK+QEK++R K+ A K++E  R +T T      ++E+SA ++  H  T+ NK +S
Sbjct  570   ALYNKHKDQEKIKRKKLLAPKQQENVRFDTNTITSQQNLRERSAPESSSHAYTSGNKQVS  629

Query  2042  STAAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHI-TTDALTKKKMKRKPEPELG  2218
             +T+          PSP    ++  K EK KG+ +S+   +   D +  KK+KRKPE EL 
Sbjct  630   NTS---------TPSP----MNGLKQEKAKGSSSSSVDDVRVADGVLTKKVKRKPELEL-  675

Query  2219  EGQYL-PEKLSSKQAEYKPQE-PIAAAPVP-KPSIQLNEPPSFEE  2344
             EG +L PEK++S Q E +P+    +  P+P K ++Q    P  E+
Sbjct  676   EGAHLGPEKVASLQGEERPRSLKQSTGPLPTKSNLQPTSLPDLEQ  720



>ref|XP_006581599.1| PREDICTED: uncharacterized protein LOC100793966 isoform X2 [Glycine 
max]
Length=735

 Score =   539 bits (1389),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 360/763 (47%), Positives = 467/763 (61%), Gaps = 100/763 (13%)
 Frame = +2

Query  230   STSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQP  409
             ++S+   G RQ FTVELRPGETTIVSWKKLLK+A                          
Sbjct  13    ASSFVKKGDRQMFTVELRPGETTIVSWKKLLKDAN-------------------------  47

Query  410   LILPPHNDSPGPGF---SPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedldd  580
                 P+  +  P +   +P QPVE E  D    NR +AVIEKIERLY+GK S DDEDL D
Sbjct  48    ---KPNGSTSVPQYVAIAPGQPVEVEETDPSQPNRFSAVIEKIERLYMGKDSSDDEDLLD  104

Query  581   vpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRR  757
             VPD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EP    NQ P KRR
Sbjct  105   VPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPPVLPNQQPKKRR  164

Query  758   KKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPL-AAGTSSPSYGVVMPTLYRENANVHN  931
             +KD  K    S+DG   NK  KVG+ A  K+  L A    + S  +V P  + E+  + N
Sbjct  165   RKDILKNAGESNDGHGSNKNVKVGRPASAKTASLQAKNMLNSSENLVTPGEHIEDLKLPN  224

Query  932   Q-------------------------------------EVNFDMQKAEVLHSKNVVDKLK  1000
             Q                                       + D QK     SKN+ DK K
Sbjct  225   QPDVSGIISKRKTADTKPILNPSVSLKTSSDDVPAVTDAKDADKQKIGAFQSKNISDKYK  284

Query  1001  ESS---ETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEG  1168
             + S   + S+ + NE+ +    KS +GR  +  + L+   +  EK+ +  +  D +  EG
Sbjct  285   DDSGSFDASHHKYNEKSAYAHSKSQAGRPLSNIDDLENINRTKEKNGMR-ELPDLNLSEG  343

Query  1169  KRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKR  1330
             K +TQ  +      ++GSSVR K +MLEKA+ +LEK VAESRPP  + Q+ D +SQA+KR
Sbjct  344   KSATQATKSENMHKKEGSSVRPKTSMLEKALCELEKMVAESRPPAVDNQEADATSQAVKR  403

Query  1331  RLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             RLP EIK KLAKVAR A A+HGK+SKELINRLMSI+GHL+QLRTLKRNLKIMINMGLSAK
Sbjct  404   RLPREIKLKLAKVARLA-ATHGKVSKELINRLMSILGHLIQLRTLKRNLKIMINMGLSAK  462

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPG-TSDDFQSIATEEKEAFKRKYCMDN  1687
             QE+DNR QQIK+EV ++IK + P ++SK  +QQ G  S DFQ    + K   KRK+ MD 
Sbjct  463   QEEDNRFQQIKKEVVDLIKMQAPTLESK--QQQKGEASGDFQEFGPDGKPITKRKFTMDA  520

Query  1688  ALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
             ALE++ICDLYDL+V+GL+E+AGPQ+RKLYAELA  WP+G+MDNHGIKR ICRAK+RR+ L
Sbjct  521   ALEDKICDLYDLFVDGLDENAGPQIRKLYAELAQLWPSGYMDNHGIKRGICRAKERRRAL  580

Query  1868  YNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISST  2047
             YN+HK+QEK++R K+   K+EE  R +  +       +E+SA ++  H  T+ NK  S+T
Sbjct  581   YNKHKDQEKIKRKKLLVPKQEENVRFDINSIASQQNPRERSAPESSSHAYTSGNKQASNT  640

Query  2048  AAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHI-TTDALTKKKMKRKPEPELGEG  2224
             +     GR+P P  G       K EK KG+ +S+   +   D +  KK+KRKPE EL  G
Sbjct  641   ST---TGRVPCPMNG------LKQEKTKGSSSSSVDDVRAADGVLTKKVKRKPELELEGG  691

Query  2225  QYLPEKLSSKQAEYKP---QEPIAAAPVPKPSIQLNEPPSFEE  2344
                 EK++S Q E +P   ++ I + P  K ++Q    P  E+
Sbjct  692   HLGAEKVASLQGEERPRSLKQSIGSLPT-KSNLQPTSLPDLEQ  733



>ref|XP_003527951.1| PREDICTED: uncharacterized protein LOC100793966 isoform X1 [Glycine 
max]
Length=734

 Score =   538 bits (1387),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 358/762 (47%), Positives = 466/762 (61%), Gaps = 99/762 (13%)
 Frame = +2

Query  230   STSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQP  409
             ++S+   G RQ FTVELRPGETTIVSWKKLLK+A                          
Sbjct  13    ASSFVKKGDRQMFTVELRPGETTIVSWKKLLKDAN-------------------------  47

Query  410   LILPPHNDSPGPGF---SPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedldd  580
                 P+  +  P +   +P QPVE E  D    NR +AVIEKIERLY+GK S DDEDL D
Sbjct  48    ---KPNGSTSVPQYVAIAPGQPVEVEETDPSQPNRFSAVIEKIERLYMGKDSSDDEDLLD  104

Query  581   vpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRR  757
             VPD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EP    NQ P KRR
Sbjct  105   VPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPPVLPNQQPKKRR  164

Query  758   KKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPL-AAGTSSPSYGVVMPTLYRENANVHN  931
             +KD  K    S+DG   NK  KVG+ A  K+  L A    + S  +V P  + E+  + N
Sbjct  165   RKDILKNAGESNDGHGSNKNVKVGRPASAKTASLQAKNMLNSSENLVTPGEHIEDLKLPN  224

Query  932   Q-------------------------------------EVNFDMQKAEVLHSKNVVDKLK  1000
             Q                                       + D QK     SKN+ DK K
Sbjct  225   QPDVSGIISKRKTADTKPILNPSVSLKTSSDDVPAVTDAKDADKQKIGAFQSKNISDKYK  284

Query  1001  ESS---ETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEG  1168
             + S   + S+ + NE+ +    KS +GR  +  + L+   +  EK+ +  +  D +  EG
Sbjct  285   DDSGSFDASHHKYNEKSAYAHSKSQAGRPLSNIDDLENINRTKEKNGMR-ELPDLNLSEG  343

Query  1169  KRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKR  1330
             K +TQ  +      ++GSSVR K +MLEKA+ +LEK VAESRPP  + Q+ D +SQA+KR
Sbjct  344   KSATQATKSENMHKKEGSSVRPKTSMLEKALCELEKMVAESRPPAVDNQEADATSQAVKR  403

Query  1331  RLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             RLP EIK KLAKVAR A A+HGK+SKELINRLMSI+GHL+QLRTLKRNLKIMINMGLSAK
Sbjct  404   RLPREIKLKLAKVARLA-ATHGKVSKELINRLMSILGHLIQLRTLKRNLKIMINMGLSAK  462

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNA  1690
             QE+DNR QQIK+EV ++IK + P ++SK  +Q+   S DFQ    + K   KRK+ MD A
Sbjct  463   QEEDNRFQQIKKEVVDLIKMQAPTLESK--QQKGEASGDFQEFGPDGKPITKRKFTMDAA  520

Query  1691  LENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY  1870
             LE++ICDLYDL+V+GL+E+AGPQ+RKLYAELA  WP+G+MDNHGIKR ICRAK+RR+ LY
Sbjct  521   LEDKICDLYDLFVDGLDENAGPQIRKLYAELAQLWPSGYMDNHGIKRGICRAKERRRALY  580

Query  1871  NRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTA  2050
             N+HK+QEK++R K+   K+EE  R +  +       +E+SA ++  H  T+ NK  S+T+
Sbjct  581   NKHKDQEKIKRKKLLVPKQEENVRFDINSIASQQNPRERSAPESSSHAYTSGNKQASNTS  640

Query  2051  AINMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHI-TTDALTKKKMKRKPEPELGEGQ  2227
                  GR+P P  G       K EK KG+ +S+   +   D +  KK+KRKPE EL  G 
Sbjct  641   T---TGRVPCPMNG------LKQEKTKGSSSSSVDDVRAADGVLTKKVKRKPELELEGGH  691

Query  2228  YLPEKLSSKQAEYKP---QEPIAAAPVPKPSIQLNEPPSFEE  2344
                EK++S Q E +P   ++ I + P  K ++Q    P  E+
Sbjct  692   LGAEKVASLQGEERPRSLKQSIGSLPT-KSNLQPTSLPDLEQ  732



>ref|XP_006578957.1| PREDICTED: uncharacterized protein LOC100778848 isoform X1 [Glycine 
max]
Length=723

 Score =   538 bits (1385),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 364/766 (48%), Positives = 468/766 (61%), Gaps = 109/766 (14%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R  +S+   G RQ FTVEL PGETTIVSWKKLLK+A                        
Sbjct  6     RAPSSFVKKGDRQMFTVELWPGETTIVSWKKLLKDAN-----------------------  42

Query  404   QPLILPPHNDSPGP----GFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSddded  571
                    HN S         +P QPVE E  D    NR +AVIEKIERLY GK S DDED
Sbjct  43    ------KHNGSTSAPQHVAIAPGQPVEVEETDPSQPNRFSAVIEKIERLYTGKDSSDDED  96

Query  572   lddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPN  748
             L DVPD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EP    NQ P 
Sbjct  97    LLDVPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPPVLPNQQPK  156

Query  749   KRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPL-AAGTSSPSYGVVMPTLYRENAN  922
             KRR+KD  K    ++DG   NK  KVG+ A  K+  L A    + S  +V P  + E+  
Sbjct  157   KRRRKDILKNAGENNDGHGSNKNVKVGRPASAKTASLQAKNMLNLSENLVAPGDHIEDLK  216

Query  923   VHNQE-------------------------------------VNFDMQKAEVLHSKNVVD  991
             + NQ                                       + D QK     SKN+ D
Sbjct  217   LPNQSDVSGIISKKKTADTKPILNPSVSLKTSSDDAPAVTDAKDVDKQKIGAFQSKNISD  276

Query  992   KLKESS---ETSNQRSNERISVPQEKSS-GRSANISNGLDQSFQQGEKSVIYDQRLDASA  1159
             K  + S   + S+ + NE+ +    KS  GR    S+ +D      EK+ +  +  D + 
Sbjct  277   KYIDGSGSFDASHHKYNEKSAYAHSKSQPGRP---SSNIDDINWTKEKNGMR-ELPDLNL  332

Query  1160  PEGKRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQA  1321
              EGK +TQ  +      ++GSSVR K +MLEKA+R+LEK VAESRPP  + Q+ D +SQA
Sbjct  333   SEGKSATQATKSENMHKKEGSSVRPKTSMLEKALRELEKMVAESRPPAVDNQEADATSQA  392

Query  1322  IKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGL  1501
             +KRRLP EIK KLAKVAR A A+HGK+SKELINRLMSI+GHL+QLRTLKRNLKIMINMGL
Sbjct  393   VKRRLPREIKLKLAKVARLA-ATHGKVSKELINRLMSILGHLIQLRTLKRNLKIMINMGL  451

Query  1502  SAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPG-TSDDFQSIATEEKEAFKRKYC  1678
             SAKQE+DNR QQIK+EV ++IK + P ++SK  +Q  G  S DFQ   T+ K   KRK+ 
Sbjct  452   SAKQEEDNRFQQIKKEVVDLIKMQAPTLESK--QQLKGEASGDFQEFGTDGKPITKRKFT  509

Query  1679  MDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRR  1858
             MD ALE++ICDLYDL+V+GL+E+AGPQ+RKLYAELA  WP+G+MDNHGIKR ICRAK+RR
Sbjct  510   MDAALEDKICDLYDLFVDGLDENAGPQIRKLYAELAQLWPSGYMDNHGIKRGICRAKERR  569

Query  1859  KTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPI  2038
             + LYN+HK+QEK++R K+ A K++E  R +T T      ++E+SA ++  H  T+ NK +
Sbjct  570   RALYNKHKDQEKIKRKKLLAPKQQENVRFDTNTITSQQNLRERSAPESSSHAYTSGNKQV  629

Query  2039  SSTAAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHI-TTDALTKKKMKRKPEPEL  2215
             S+T+          PSP    ++  K EK KG+ +S+   +   D +  KK+KRKPE EL
Sbjct  630   SNTS---------TPSP----MNGLKQEKAKGSSSSSVDDVRVADGVLTKKVKRKPELEL  676

Query  2216  GEGQYL-PEKLSSKQAEYKPQE-PIAAAPVP-KPSIQLNEPPSFEE  2344
              EG +L PEK++S Q E +P+    +  P+P K ++Q    P  E+
Sbjct  677   -EGAHLGPEKVASLQGEERPRSLKQSTGPLPTKSNLQPTSLPDLEQ  721



>gb|KHN44301.1| hypothetical protein glysoja_024521 [Glycine soja]
Length=739

 Score =   537 bits (1384),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 368/784 (47%), Positives = 474/784 (60%), Gaps = 112/784 (14%)
 Frame = +2

Query  173   MKPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsng  352
             M P +  G S       R  +S+   G RQ FTVEL PGETTIVSWKKLLK+A       
Sbjct  6     MAPLVGGGDSSS--ATARAQSSFVKKGDRQMFTVELWPGETTIVSWKKLLKDAN------  57

Query  353   ngapgpaprasaaaaELQPLILPPHNDSPGP----GFSPEQPVEKEAKDAPPGNRLNAVI  520
                                     HN S         +P QPVE E  D    NR +AVI
Sbjct  58    -----------------------KHNGSTSAPQHVAIAPGQPVEVEETDPSQPNRFSAVI  94

Query  521   EKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRG  700
             EKIERLY GK S DDEDL DVPD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRG
Sbjct  95    EKIERLYTGKDSSDDEDLLDVPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRG  154

Query  701   KLERI-EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPL-AAGTS  871
             KLERI EP    NQ P KRR+KD  K    ++DG   NK  KVG+ A  K+  L A    
Sbjct  155   KLERINEPPVLPNQQPKKRRRKDILKNAGENNDGHGSNKNVKVGRPASAKTASLQAKNML  214

Query  872   SPSYGVVMPTLYRENANVHNQE-------------------------------------V  940
             + S  +V P  + E+  + NQ                                       
Sbjct  215   NLSENLVAPGDHIEDLKLPNQSDVSGIISKKKTADTKPILNPSVSLKTSSDDAPAVTDAK  274

Query  941   NFDMQKAEVLHSKNVVDKLKESS---ETSNQRSNERISVPQEKSS-GRSANISNGLDQSF  1108
             + D QK     SKN+ DK  + S   + S+ + NE+ +    KS  GR    S+ +D   
Sbjct  275   DVDKQKIGAFQSKNISDKYIDGSGSFDASHHKYNEKSAYAHSKSQPGRP---SSNIDDIN  331

Query  1109  QQGEKSVIYDQRLDASAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAE  1270
                EK+ +  +  D +  EGK +TQ  +      ++GSSVR K +MLEKA+R+LEK VAE
Sbjct  332   WTKEKNGMR-ELPDLNLSEGKSATQATKSENMHKKEGSSVRPKTSMLEKALRELEKMVAE  390

Query  1271  SRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLV  1450
             SRPP  + Q+ D +SQA+KRRLP EIK KLAKVAR A A+HGK+SKELINRLMSI+GHL+
Sbjct  391   SRPPAVDNQEADATSQAVKRRLPREIKLKLAKVARLA-ATHGKVSKELINRLMSILGHLI  449

Query  1451  QLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPG-TSDD  1627
             QLRTLKRNLKIMINMGLSAKQE+DNR QQIK+EV ++IK + P ++SK  +Q  G  S D
Sbjct  450   QLRTLKRNLKIMINMGLSAKQEEDNRFQQIKKEVVDLIKMQAPTLESK--QQLKGEASGD  507

Query  1628  FQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGF  1807
             FQ   T+ K   KRK+ MD ALE++ICDLYDL+V+GL+E+AGPQ+RKLYAELA  WP+G+
Sbjct  508   FQEFGTDGKPITKRKFTMDAALEDKICDLYDLFVDGLDENAGPQIRKLYAELAQLWPSGY  567

Query  1808  MDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEK  1987
             MDNHGIKR ICRAK+RR+ LYN+HK+QEK++R K+ A K++E  R +T T      ++E+
Sbjct  568   MDNHGIKRGICRAKERRRALYNKHKDQEKIKRKKLLAPKQQENVRFDTNTITSQQNLRER  627

Query  1988  SAVDARDHGSTAT-NKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHI-  2161
             SA ++  H  T++ NK +S+T+          PSP    ++  K EK KG+ +S+   + 
Sbjct  628   SAPESSSHAYTSSGNKQVSNTS---------TPSP----MNGLKQEKAKGSSSSSVDDVR  674

Query  2162  TTDALTKKKMKRKPEPELGEGQYL-PEKLSSKQAEYKPQE-PIAAAPVP-KPSIQLNEPP  2332
               D +  KK+KRKPE EL EG +L PEK++S Q E +P+    +  P+P K ++Q    P
Sbjct  675   VADGVLTKKVKRKPELEL-EGAHLGPEKVASLQGEERPRSLKQSTGPLPTKSNLQPTSLP  733

Query  2333  SFEE  2344
               E+
Sbjct  734   DLEQ  737



>gb|KHN46987.1| hypothetical protein glysoja_018354 [Glycine soja]
Length=729

 Score =   535 bits (1379),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 359/763 (47%), Positives = 466/763 (61%), Gaps = 100/763 (13%)
 Frame = +2

Query  230   STSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQP  409
             ++S+   G RQ FTVELRPGETTIVSWKKLLK+A                          
Sbjct  7     ASSFVKKGDRQMFTVELRPGETTIVSWKKLLKDAN-------------------------  41

Query  410   LILPPHNDSPGPGF---SPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedldd  580
                 P+  +  P +   +P QPVE E  D    NR +AVIEKIERLY+GK S DDEDL D
Sbjct  42    ---KPNGSTSVPQYVAIAPGQPVEVEETDPSQPNRFSAVIEKIERLYMGKDSSDDEDLLD  98

Query  581   vpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRR  757
             VPD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EP    NQ P KRR
Sbjct  99    VPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPPVLPNQQPKKRR  158

Query  758   KKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPL-AAGTSSPSYGVVMPTLYRENANVHN  931
             +KD  K    ++DG   NK  KVG+ A  K+  L A    + S  +V P  + E+  + N
Sbjct  159   RKDILKNAGENNDGHGSNKNVKVGRPASAKTASLQAKHMLNSSENLVAPGEHIEDLKLPN  218

Query  932   Q-------------------------------------EVNFDMQKAEVLHSKNVVDKLK  1000
             Q                                       + D QK     SKN+ DK K
Sbjct  219   QPDVSGIISKRKTADTKPILNPSVSLKTSSDDVPAVTDAKDADKQKIGAFQSKNISDKYK  278

Query  1001  ESS---ETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEG  1168
             + S   + S+ + NE+ +    KS +GR  +  + L+   +  EK+ +  +  D +  EG
Sbjct  279   DDSGSFDASHHKYNEKSAYAHSKSQAGRPLSNIDDLENINRTKEKNGMR-ELPDLNLSEG  337

Query  1169  KRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKR  1330
             K +TQ  +      ++GSSVR K +MLEKA+ +LEK VAESRPP  + Q+ D +SQA+KR
Sbjct  338   KSATQATKSENMHKKEGSSVRPKTSMLEKALCELEKMVAESRPPAVDNQEADATSQAVKR  397

Query  1331  RLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             RLP EIK KLAKVAR A A+HGK+SKELINRLMSI+GHL+QLRTLKRNLKIMINMGLSAK
Sbjct  398   RLPREIKLKLAKVARLA-ATHGKVSKELINRLMSILGHLIQLRTLKRNLKIMINMGLSAK  456

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPG-TSDDFQSIATEEKEAFKRKYCMDN  1687
             QE+DNR QQIK+EV ++IK + P ++SK  +QQ G  S DFQ    + K   KRK+ MD 
Sbjct  457   QEEDNRFQQIKKEVVDLIKMQAPTLESK--QQQKGEASGDFQEFGPDGKPITKRKFTMDA  514

Query  1688  ALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
             ALE++ICDLYDL+V+GL+E+AGPQ+RKLYAELA  WP+G+MDNHGIKR ICRAK+RR+ L
Sbjct  515   ALEDKICDLYDLFVDGLDENAGPQIRKLYAELAQLWPSGYMDNHGIKRGICRAKERRRAL  574

Query  1868  YNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISST  2047
             YN+HK+QEK++R K+   K+EE  R +  +       +E+SA ++  H  T+ NK  S+T
Sbjct  575   YNKHKDQEKIKRKKLLVPKQEENVRFDINSIASQQNPRERSAPESSSHAYTSGNKQASNT  634

Query  2048  AAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHI-TTDALTKKKMKRKPEPELGEG  2224
             +     GR P P  G       K EK KG+ +S+   +   D +  KK+KRKPE EL  G
Sbjct  635   ST---TGRFPCPMNG------LKQEKTKGSSSSSVDDVRAADGVLTKKVKRKPELELEGG  685

Query  2225  QYLPEKLSSKQAEYKP---QEPIAAAPVPKPSIQLNEPPSFEE  2344
                 EK++S Q E +P   ++ I + P  K ++Q    P  E+
Sbjct  686   HLGAEKVASLQGEERPRSLKQSIGSLPT-KSNLQPTSLPDLEQ  727



>ref|XP_010063439.1| PREDICTED: uncharacterized protein LOC104450543 isoform X2 [Eucalyptus 
grandis]
Length=769

 Score =   536 bits (1381),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 368/760 (48%), Positives = 472/760 (62%), Gaps = 71/760 (9%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT----GLQsngngapgpaprasaa  391
             RV +S+  +G RQ F+VELRPGETTIVSWKKL+K+A     G  S    A       +A 
Sbjct  26    RVLSSFVKSGDRQVFSVELRPGETTIVSWKKLVKDANKPDGGSSSAAAVAEAAVATVAAP  85

Query  392   aaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSddded  571
             ++      L P          P QPVE+E K+A P N  +AVIEKIERLY+GK S DDED
Sbjct  86    SSAAPHAALEPRA-------VPGQPVERETKEAAPLNSFSAVIEKIERLYMGKDSSDDED  138

Query  572   lddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPN  748
             L+D+PDED+YDTEDSFIDD ELD+YF+V+N+ IK+DGFFVNRGKLE I +PT   NQ P 
Sbjct  139   LNDIPDEDQYDTEDSFIDDAELDEYFEVENADIKYDGFFVNRGKLECINKPTVPPNQQPK  198

Query  749   KRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENANVH  928
             KRR++D  K      DG  PNK  KV K         AG  S +      T   EN    
Sbjct  199   KRRRRDFAKINGEKGDGFVPNKHVKVDKPGPAKAATLAGKHSSNPSQSSATEPNENLKSQ  258

Query  929   NQEVNFDMQKAEVLHSKNVVD-----------KLKESSETSNQRSNERISVPQEKSSG--  1069
             NQ ++    + + + SK +VD            L   ++T +   +  +++  +  SG  
Sbjct  259   NQYLSGSGSRKKSVDSKVIVDPAPYAKVVNGDALASLTDTKDIDKHNMVNLQSKNHSGKL  318

Query  1070  ------------RSANISNGLDQSFQQ-------------GEKSVIYDQRLDASAPEGKR  1174
                         R  + S  L QS +Q              EKS +  +  D + P+GK 
Sbjct  319   KDPSGPSDVLHHRHHDKSGFLQQSGRQLKNVDDPEASNRPKEKSNVR-EVPDLNMPDGKH  377

Query  1175  STQ------TVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRL  1336
             + +      + R+DGSS R K TMLEKAIRDLEK VAESRPP AE QD D SSQ++KRRL
Sbjct  378   AIEISKPPHSHRKDGSSFRPKSTMLEKAIRDLEKIVAESRPPAAENQDADYSSQSVKRRL  437

Query  1337  PPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQE  1516
             P ++K KLAKVAR A +SHGK+SKELINRLMSI+GHLVQLRTLKRNLK+M+ MGLSAKQ+
Sbjct  438   PSDVKLKLAKVARLA-SSHGKISKELINRLMSILGHLVQLRTLKRNLKVMVTMGLSAKQD  496

Query  1517  KDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALE  1696
             K+NR QQIK+EVA+M++ R+P +++KA++ Q G SDDFQ   +EEK   K++Y MD A+E
Sbjct  497   KENRFQQIKKEVADMVRMRIPSLETKALQHQSGASDDFQE--SEEKTIPKKQYDMDAAME  554

Query  1697  NRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNR  1876
             ++ICDLYDL+++GL+ED GPQVRKLYAELA  WPNGFMDNHGIKRAIC+AK+RR+ LY+R
Sbjct  555   DKICDLYDLFIDGLDEDTGPQVRKLYAELAELWPNGFMDNHGIKRAICKAKERRRALYSR  614

Query  1877  HK-NQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAA  2053
             HK +QEK+RR K+ A K EE  RVE  +  QP    E+ ++D+  HGST+ ++PI S  A
Sbjct  615   HKEDQEKIRRKKMLAPKIEESVRVEGVSVAQPQPPPERLSIDSGIHGSTSASRPIHSPTA  674

Query  2054  INMVGRIPVPSPGGTSLDRPKPEKVKGTGN--STDRHITTDALTKKKMKRKPEPELGEGQ  2227
                  RIP PS    S DR K EK K T +  S D       + KKK+KRKPE +L E  
Sbjct  675   --ATARIPSPS-ANVSSDRIKQEKTKVTSSNFSEDARHGEAIVPKKKVKRKPEVDLNEMP  731

Query  2228  YLPEKLS-SKQAEYKPQEPIAAAPVPKPSIQLNEPPSFEE  2344
             +  EK    K    KP   +     PK ++Q    PSFE+
Sbjct  732   FHSEKFGEEKIVSSKPNPSLP----PKINLQPTAAPSFEQ  767



>ref|XP_010269065.1| PREDICTED: ubinuclein-1-like isoform X1 [Nelumbo nucifera]
Length=789

 Score =   536 bits (1380),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 371/774 (48%), Positives = 461/774 (60%), Gaps = 105/774 (14%)
 Frame = +2

Query  266   FTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDSPGP  445
             FTVELRPGETTIVSWKKL+KEA                        QP +         P
Sbjct  38    FTVELRPGETTIVSWKKLIKEANKAN--------------------QPPLASEAPSGAHP  77

Query  446   GF----SPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydted  613
                   +P QPVE E KDAPP NR +AVIEKIERLY+GK S D+E+LD VPD+D+YDTED
Sbjct  78    ALESRIAPGQPVESELKDAPPANRFSAVIEKIERLYMGKHSSDEEELDGVPDDDQYDTED  137

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKCQSGS  790
             SFIDDTELD+YFQVD SA KH GFFVNRGKLERI EP +  +  P KRR+KD  K + G 
Sbjct  138   SFIDDTELDEYFQVDKSATKHIGFFVNRGKLERINEPVASPDYQPKKRRRKDPAKSR-GE  196

Query  791   DDGCN------------PNKPAKVG----KKAGKSVPLAAGTSSPSYGVVMPTL--YREN  916
              DG +            P+K AKVG    K A ++ PL  GT S      + T+  Y E+
Sbjct  197   KDGEHVSNRNAKDSEHLPSKHAKVGNVRMKAAARTAPLV-GTKSYGSSQSLATISEYYED  255

Query  917   ANVHNQ-------------------------------------EVNFDMQKAEVLHSKNV  985
               V NQ                                       N + QK+ ++  + V
Sbjct  256   EKVQNQLNSLGPSKKKSTDSNTKLENPNSSKTSNRDASMFPIEAKNIEKQKSGIMQPREV  315

Query  986   VDKLKESSETSNQ----RSNERISVPQEKSSGRSANISNGLDQS--FQQGEKSVIYDQRL  1147
              +KLK  S  S+       ++  S   E   GR  N    ++ S   +Q EK+   +Q  
Sbjct  316   GNKLKVPSVPSDAVHQIYRDKGASTQIEPQPGRQLNDMTEIELSTKVRQKEKNS-SNQLP  374

Query  1148  DASAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDN  1309
             D ++   K   QT +      R+GSSVR K TMLE+AIR+LEK VA SRPP  EVQDGD 
Sbjct  375   DLNSSGIKYPVQTAKIPSMHAREGSSVRPKGTMLERAIRELEKIVAVSRPPIMEVQDGDV  434

Query  1310  SSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMI  1489
             SSQAIKRRLP E+KQKLAKVAR AQ+S GK+S ELINRLMSI+GHLVQL+TLKRNLK M+
Sbjct  435   SSQAIKRRLPREVKQKLAKVARLAQSSQGKISDELINRLMSILGHLVQLKTLKRNLKEMV  494

Query  1490  NMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKR  1669
              +GLSAKQEKD+  QQIK+EV EMIK +   +KSK  EQ+ G S DFQ +   E++  K 
Sbjct  495   ELGLSAKQEKDDHFQQIKKEVVEMIKMQASSLKSKVPEQRDGASVDFQEVLDSEEKGVKG  554

Query  1670  KYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAK  1849
             KY MD+A+E++ICDLYDLYVEG++ED GPQ+RKLY ELA  WPNG MDNHGIK A+CR+K
Sbjct  555   KYSMDDAMEDKICDLYDLYVEGMDEDKGPQIRKLYVELAELWPNGSMDNHGIKTAVCRSK  614

Query  1850  DRRKTLYNRHKNQEKMRRNKIS-AQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTAT  2026
             +R++ + ++HKNQ K+RR K+S A + EEG   E  T      IQE+   D   H  T  
Sbjct  615   ERKRAMLSKHKNQ-KIRRKKLSTAPRAEEGICGEAITTAHARLIQERLVTDMNCHVLTPP  673

Query  2027  NKPISSTAA----INMVGRIPVPSPGGTSLDR-PKPEKVKG-TGNSTDRHITTD-ALTKK  2185
             N+  S+ A     I+   R+P  S  G +LDR PK EKVKG TG   +    TD +L KK
Sbjct  674   NRMTSNMAVASQHISTSVRMPNSSTNGFNLDRMPKQEKVKGSTGTFLNEVQRTDGSLVKK  733

Query  2186  KMKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             K+KRKPE  LGE  +  +KLS +Q + K + P     +P KPSIQ    PS E+
Sbjct  734   KLKRKPESVLGEIHFHSDKLSLQQEKEKHKYPKLTGSLPHKPSIQSTGLPSSEQ  787



>ref|XP_010270290.1| PREDICTED: ubinuclein-1-like isoform X5 [Nelumbo nucifera]
Length=789

 Score =   535 bits (1379),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 372/793 (47%), Positives = 481/793 (61%), Gaps = 97/793 (12%)
 Frame = +2

Query  197   SSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpap  376
             SS   P  G  S+S  A+   + FTVELRPGETTIVSWKKL+KEA               
Sbjct  15    SSSFAPETGGASSSTYASKNGRWFTVELRPGETTIVSWKKLIKEAN--------------  60

Query  377   rasaaaaELQPLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGK  550
                  A++  P    P    P      +P QP E E+KDAPPGNR +AVIEKIERLYVGK
Sbjct  61    ----KASQSTPASEAPSGAHPALESRLAPGQPAEGESKDAPPGNRFSAVIEKIERLYVGK  116

Query  551   QSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTS  727
             +S D+E+LD VPD+D+YDTEDSFIDDTELD+YFQVD S+ KH+GFFVNRGKLERI EP +
Sbjct  117   ESSDEEELDGVPDDDQYDTEDSFIDDTELDEYFQVDKSSTKHNGFFVNRGKLERINEPVA  176

Query  728   QQNQLPNKRRKKDQTKCQSGSD----------DGCN-PNKPAKVG----KKAGKSVPLAA  862
               +  P KRR+KD  K +   D          DG + P+K AK+G    K A ++ PL  
Sbjct  177   SPDHQPKKRRRKDLAKSRIEKDGENVPNKHTKDGDHIPSKNAKLGNVRMKAAARTAPLGG  236

Query  863   G-TSSPSYGVVMPTLYRENANVHNQ-----------------------------------  934
               +SSPS  +   + Y E+  V NQ                                   
Sbjct  237   TKSSSPSQSLAAISEYYEDEKVQNQLNAPVGLSKKKSTDSSTKPDNPSSAKILNKDASVF  296

Query  935   --EVNFDMQKAEVLHSKNVVDKLKESSETSNQ----RSNERISVPQEKSSGRSANISNGL  1096
                 + + Q+   +  + +  KLK SSE+S+       ++  S   E  S R  N  N L
Sbjct  297   PEAKDIERQRTGTVQHRELGSKLKVSSESSDALLHLYRDKNTSSQIEPQSNRQLNDMNEL  356

Query  1097  DQS--FQQGEKSVIYDQRLDASAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDL  1252
             + S   +Q EK+    Q  D ++   K   QT +      ++GS+VR K TMLE+AIR+L
Sbjct  357   ELSTKVRQKEKNC-SSQLPDLNSSVIKYPVQTAKTSSMHVKEGSTVRPKGTMLERAIREL  415

Query  1253  EKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMS  1432
             EK VAESRPP  EVQD D SSQA+KRRLP E+KQKLAKVAR A +S GK+S+ELINRLMS
Sbjct  416   EKMVAESRPPIMEVQDADASSQAVKRRLPREVKQKLAKVARLA-SSQGKISEELINRLMS  474

Query  1433  IVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQP  1612
             I+GHLVQL+TLKRNLK M+ +GL+AKQ KD+R QQIK+E+ EMIK +   +KSKA E + 
Sbjct  475   ILGHLVQLKTLKRNLKEMVELGLTAKQAKDDRFQQIKKEIVEMIKVQALSLKSKASEPRD  534

Query  1613  GTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAY  1792
             G SDDFQ     E++  K KYCMD+A+E+++CDLYDL+VEG++ED GPQ+RKLY ELA  
Sbjct  535   GASDDFQEPLGSEEKGVKGKYCMDDAMEDKLCDLYDLFVEGMDEDKGPQIRKLYVELAEL  594

Query  1793  WPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQ-KEEEGYRVETTTRDQP  1969
             WPNG MDNHGIK A+CRAK+R++ +Y++HK+QEK+RR K+S+  + EE    ET+T  QP
Sbjct  595   WPNGSMDNHGIKSAVCRAKERKRAMYSKHKDQEKIRRKKLSSTPRTEEIVHGETSTIAQP  654

Query  1970  VQIQEKSAVDARDHGSTATNKPISSTAA----INMVGRIPVPSPGGTSLDR-PKPEKVK-  2131
               +QE+   D   H  T+ N+  S+  A    I+  GR+   S  G +LDR PK EKVK 
Sbjct  655   RFLQERLVYDPSSHVLTSPNRMTSNMTAASQHISAPGRVLNSSTNGLNLDRPPKQEKVKD  714

Query  2132  GTGNSTDRHITTDA-LTKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAA-PVPK  2305
              +G   D    TD  L KKK+KRKPE   GE  Y  +KLS ++ + K + P  A   + K
Sbjct  715   SSGTFLDEVRGTDGKLVKKKLKRKPESIFGEVHYHADKLSIQKVKEKHKFPKQAGNQLQK  774

Query  2306  PSIQLNEPPSFEE  2344
             PS+Q    PS E+
Sbjct  775   PSVQSTGLPSSEQ  787



>ref|XP_010269067.1| PREDICTED: ubinuclein-1-like isoform X3 [Nelumbo nucifera]
Length=788

 Score =   535 bits (1378),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 371/773 (48%), Positives = 460/773 (60%), Gaps = 104/773 (13%)
 Frame = +2

Query  266   FTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDSPGP  445
             FTVELRPGETTIVSWKKL+KEA                        QP +         P
Sbjct  38    FTVELRPGETTIVSWKKLIKEANKAN--------------------QPPLASEAPSGAHP  77

Query  446   GF----SPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydted  613
                   +P QPVE E KDAPP NR +AVIEKIERLY+GK S D+E+LD VPD+D+YDTED
Sbjct  78    ALESRIAPGQPVESELKDAPPANRFSAVIEKIERLYMGKHSSDEEELDGVPDDDQYDTED  137

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKCQSGS  790
             SFIDDTELD+YFQVD SA KH GFFVNRGKLERI EP +  +  P KRR+KD  K + G 
Sbjct  138   SFIDDTELDEYFQVDKSATKHIGFFVNRGKLERINEPVASPDYQPKKRRRKDPAKSR-GE  196

Query  791   DDGCN------------PNKPAKVG----KKAGKSVPLAAGTSSPSYGVVMPTL--YREN  916
              DG +            P+K AKVG    K A ++ PL  GT S      + T+  Y E+
Sbjct  197   KDGEHVSNRNAKDSEHLPSKHAKVGNVRMKAAARTAPLV-GTKSYGSSQSLATISEYYED  255

Query  917   ANVHNQ-------------------------------------EVNFDMQKAEVLHSKNV  985
               V NQ                                       N + QK+ ++  + V
Sbjct  256   EKVQNQLNSLGPSKKKSTDSNTKLENPNSSKTSNRDASMFPIEAKNIEKQKSGIMQPREV  315

Query  986   VDKLKESSETSNQ----RSNERISVPQEKSSGRSANISNGLDQS--FQQGEKSVIYDQRL  1147
              +KLK  S  S+       ++  S   E   GR  N    ++ S   +Q EK+   +Q  
Sbjct  316   GNKLKVPSVPSDAVHQIYRDKGASTQIEPQPGRQLNDMTEIELSTKVRQKEKNS-SNQLP  374

Query  1148  DASAPEGKRSTQTV-----RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNS  1312
             D ++   K   QT       R+GSSVR K TMLE+AIR+LEK VA SRPP  EVQDGD S
Sbjct  375   DLNSSGIKYPVQTAIPSMHAREGSSVRPKGTMLERAIRELEKIVAVSRPPIMEVQDGDVS  434

Query  1313  SQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMIN  1492
             SQAIKRRLP E+KQKLAKVAR AQ+S GK+S ELINRLMSI+GHLVQL+TLKRNLK M+ 
Sbjct  435   SQAIKRRLPREVKQKLAKVARLAQSSQGKISDELINRLMSILGHLVQLKTLKRNLKEMVE  494

Query  1493  MGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRK  1672
             +GLSAKQEKD+  QQIK+EV EMIK +   +KSK  EQ+ G S DFQ +   E++  K K
Sbjct  495   LGLSAKQEKDDHFQQIKKEVVEMIKMQASSLKSKVPEQRDGASVDFQEVLDSEEKGVKGK  554

Query  1673  YCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKD  1852
             Y MD+A+E++ICDLYDLYVEG++ED GPQ+RKLY ELA  WPNG MDNHGIK A+CR+K+
Sbjct  555   YSMDDAMEDKICDLYDLYVEGMDEDKGPQIRKLYVELAELWPNGSMDNHGIKTAVCRSKE  614

Query  1853  RRKTLYNRHKNQEKMRRNKIS-AQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATN  2029
             R++ + ++HKNQ K+RR K+S A + EEG   E  T      IQE+   D   H  T  N
Sbjct  615   RKRAMLSKHKNQ-KIRRKKLSTAPRAEEGICGEAITTAHARLIQERLVTDMNCHVLTPPN  673

Query  2030  KPISSTAA----INMVGRIPVPSPGGTSLDR-PKPEKVKG-TGNSTDRHITTD-ALTKKK  2188
             +  S+ A     I+   R+P  S  G +LDR PK EKVKG TG   +    TD +L KKK
Sbjct  674   RMTSNMAVASQHISTSVRMPNSSTNGFNLDRMPKQEKVKGSTGTFLNEVQRTDGSLVKKK  733

Query  2189  MKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             +KRKPE  LGE  +  +KLS +Q + K + P     +P KPSIQ    PS E+
Sbjct  734   LKRKPESVLGEIHFHSDKLSLQQEKEKHKYPKLTGSLPHKPSIQSTGLPSSEQ  786



>gb|EYU32498.1| hypothetical protein MIMGU_mgv1a002221mg [Erythranthe guttata]
Length=699

 Score =   529 bits (1363),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 352/697 (51%), Positives = 443/697 (64%), Gaps = 58/697 (8%)
 Frame = +2

Query  251   GGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHN  430
             G R RFTVELRPGETTIVSW+KLLKEAT  + N  G     P         QP+  P   
Sbjct  26    GDRLRFTVELRPGETTIVSWRKLLKEATSNKPNAPGPSISRPPTEIRQ---QPVSQPQLP  82

Query  431   DSPGPGFSPEQPVEKEAKD--APPGNRLNAVIEKIERLYVGKQSdddedl--ddvpdede  598
                      ++P E E  D  A P NRL+ VIE+IER+Y G  S ++ED+  DDVPD+DE
Sbjct  83    PPAAAAAVSKKPAEDEVNDPLAQP-NRLSTVIERIERMYAGDGSSEEEDVILDDVPDDDE  141

Query  599   ydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKC  778
             YDTEDSFIDD ELDDYFQVDNS IKHDGFFVNRGKLER+E     +Q P KRR+KD  K 
Sbjct  142   YDTEDSFIDDAELDDYFQVDNSEIKHDGFFVNRGKLERVETAIPTHQQPKKRRRKDVAKG  201

Query  779   QSGSDDGCNPNKPAKV---GKKAGKSVPL--------AAGTSSPSYGVVMPTLYRENANV  925
             Q G DD   PNK  K+   G+KA  S            A  S  S      +L ++NA+ 
Sbjct  202   QGGDDDSHTPNKHLKIENKGRKATSSFERNSTSQSLRVAAASVQSSDAAEVSLKKKNADS  261

Query  926   HNQEVNFDMQKAEVLH----SKNVVDKLKESSE---TSNQRSNERISVPQEKSSGRSANI  1084
                     + KA+ +     S++   KLKESSE   TS QRSN++ S   +  SG+  N 
Sbjct  262   QITMDPLALSKADGVRQDKDSQSHNHKLKESSEPQETSGQRSNDKSSHVSKSHSGKQVNN  321

Query  1085  SNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFV  1264
             +  LD + Q+ EKS +  +R D + P  + S+QT + +GSSVR K TML+KAIR+LEK V
Sbjct  322   AGELDLATQRKEKSGLV-ERFDLNVPASRDSSQTTK-EGSSVRPKTTMLDKAIRELEKIV  379

Query  1265  AESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGH  1444
             AESRPP+ EVQD D SSQ++KRRLPPEIKQKLAKVAR AQA +GK+  ++I+RLMSIVGH
Sbjct  380   AESRPPSTEVQDAD-SSQSVKRRLPPEIKQKLAKVARLAQAVYGKIPMDVIDRLMSIVGH  438

Query  1445  LVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSD  1624
             L+QLRTLKRN+K+M  +GLSAKQEKD+R+Q+IK+EV EM++ RV  MKSK +EQQ   +D
Sbjct  439   LMQLRTLKRNIKVMATLGLSAKQEKDDRLQKIKQEVVEMVRQRVQHMKSK-VEQQTTNTD  497

Query  1625  DFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNG  1804
             DF+    EEK A KRKY +D+ALEN+ICDLYDLYVE L++D          +LAA WP+G
Sbjct  498   DFEEAGPEEKGALKRKYSIDDALENKICDLYDLYVE-LDDD----------DLAALWPSG  546

Query  1805  FMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQE  1984
              MD  GIKRAI +AKDRR+ L  R K++EKM+  K+ AQK E+  + E    +  + I E
Sbjct  547   AMDTDGIKRAISKAKDRRRALSGRRKDEEKMKNKKLLAQKTEDTIKKEVINVNPALHIHE  606

Query  1985  KSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNS----TD  2152
             K A       ST  +KP+ S        R+P+PS    + D+PK EK K + NS     D
Sbjct  607   KDA-------STLPSKPVQSAT------RVPLPSANVPNTDKPKQEKAKRSPNSNNNPVD  653

Query  2153  RHITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAE  2263
               + TDAL KKKMKRK   ++ E Q+  EK S  QAE
Sbjct  654   ADVATDALPKKKMKRKASTDIVEVQFHSEKASVSQAE  690



>ref|XP_007137473.1| hypothetical protein PHAVU_009G129800g [Phaseolus vulgaris]
 gb|ESW09467.1| hypothetical protein PHAVU_009G129800g [Phaseolus vulgaris]
Length=719

 Score =   528 bits (1360),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 357/764 (47%), Positives = 474/764 (62%), Gaps = 109/764 (14%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S+S+   G RQ FTVELRPGETTIVSWKKL+K++                        
Sbjct  6     RASSSFVKKGDRQMFTVELRPGETTIVSWKKLMKDSN-----------------------  42

Query  404   QPLILPPHNDSPGP-GFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedldd  580
             +P+     N +P     +P +PV+ E  D    NR +AVIEKIERLY+GK S DDEDL D
Sbjct  43    KPI---GSNSAPQQVAIAPGEPVDGEENDPSQPNRFSAVIEKIERLYMGKDSSDDEDLLD  99

Query  581   vpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRR  757
             VPD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EP +  NQ P KRR
Sbjct  100   VPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPPALPNQQPKKRR  159

Query  758   KKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPL-AAGTSSPSYGVVMPTLYRENANVHN  931
             +KD  K    ++DG   NK  KVG+ A GK+  L A    + S  +V    + E+  + N
Sbjct  160   RKDVLKNAGENNDGHGSNKNVKVGRPASGKAASLQAKNMLNSSENLVAHDEHHEDLKLSN  219

Query  932   QE-------------------------------------VNFDMQKAEVLHSKNVVDKLK  1000
             +                                       + D QK     SKN+ DK K
Sbjct  220   RSDVSGIISKKKTVDSKLTLDPSISLKAPNDDVPGVTDAKDADKQKIGAFQSKNISDKCK  279

Query  1001  ESS---ETSNQRSNERISVPQEKSS-GRSANISNGLDQSFQQGEKSVIYDQRLDASAPEG  1168
             + +   + S+Q+ NE+ +    KS  G+  N  + L+   +  EKS +  +  D +  EG
Sbjct  280   DGTGLFDASHQKYNEKSAYAHSKSQPGKPPNSIDDLENIIRTKEKSGMC-ELPDLNLSEG  338

Query  1169  KRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKR  1330
             K +TQ ++      ++GSSVR K +MLEKA+R+LE+ VAESRPP  + QD      A+KR
Sbjct  339   KSATQAIKSENMQKKEGSSVRPKTSMLEKALRELERMVAESRPPAVDNQD------AVKR  392

Query  1331  RLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             RLP +IK KLAKVAR A A+HGK+SKELINRLMSI+GHL+QLRTLKRNLKIMI+MGLSAK
Sbjct  393   RLPRDIKLKLAKVARLA-ATHGKVSKELINRLMSILGHLIQLRTLKRNLKIMISMGLSAK  451

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPG-TSDDFQSIATEEKEAFKRKYCMDN  1687
             QE+DNR QQIK+EV +MIK + P ++SK  +QQ G  S DFQ    + K   K+K+ MD 
Sbjct  452   QEEDNRFQQIKKEVVDMIKMQPPTLESK--QQQKGEASGDFQEFGPDGKAITKKKFAMDA  509

Query  1688  ALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
             ALE++ICDLYDL+V+GL+E+AGPQ+RKLY ELA  WP+G+MDNHGIKR ICRAK+RR+ L
Sbjct  510   ALEDKICDLYDLFVDGLDENAGPQIRKLYYELAELWPSGYMDNHGIKRGICRAKERRRAL  569

Query  1868  YNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISST  2047
             YN+HK+QEK++R K+   K+EE  R +T +      ++E+SA +     S++ +K +S+T
Sbjct  570   YNKHKDQEKIKRKKLLVPKQEENVRFDTNSITSQQILRERSAPE-----SSSGSKQVSNT  624

Query  2048  AAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNST--DRHITTDALTKKKMKRKPEPELGE  2221
             +     GR+P P  G       K EK KG+ +S+  D  I   ALT KK+KRKPE EL E
Sbjct  625   SP---TGRVPSPING------IKQEKAKGSSSSSLDDARIAEGALT-KKVKRKPELEL-E  673

Query  2222  GQYLPEKLSSKQAEYKPQ--EPIAAAPVP-KPSIQLNEPPSFEE  2344
                +PEK++S Q E +P+  +  ++ P+P K +I     P  E+
Sbjct  674   AHLVPEKVASLQGEERPRFLKQQSSGPLPNKSNIHPTSVPDLEQ  717



>ref|XP_010270286.1| PREDICTED: ubinuclein-1-like isoform X1 [Nelumbo nucifera]
Length=808

 Score =   530 bits (1366),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 373/811 (46%), Positives = 482/811 (59%), Gaps = 114/811 (14%)
 Frame = +2

Query  197   SSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpap  376
             SS   P  G  S+S  A+   + FTVELRPGETTIVSWKKL+KEA               
Sbjct  15    SSSFAPETGGASSSTYASKNGRWFTVELRPGETTIVSWKKLIKEAN--------------  60

Query  377   rasaaaaELQPLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGK  550
                  A++  P    P    P      +P QP E E+KDAPPGNR +AVIEKIERLYVGK
Sbjct  61    ----KASQSTPASEAPSGAHPALESRLAPGQPAEGESKDAPPGNRFSAVIEKIERLYVGK  116

Query  551   QSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTS  727
             +S D+E+LD VPD+D+YDTEDSFIDDTELD+YFQVD S+ KH+GFFVNRGKLERI EP +
Sbjct  117   ESSDEEELDGVPDDDQYDTEDSFIDDTELDEYFQVDKSSTKHNGFFVNRGKLERINEPVA  176

Query  728   QQNQLPNKRRKKDQTKCQSGSD----------DGCN-PNKPAKVG----KKAGKSVPLAA  862
               +  P KRR+KD  K +   D          DG + P+K AK+G    K A ++ PL  
Sbjct  177   SPDHQPKKRRRKDLAKSRIEKDGENVPNKHTKDGDHIPSKNAKLGNVRMKAAARTAPLGG  236

Query  863   G-TSSPSYGVVMPTLYRENANVHNQ-----------------------------------  934
               +SSPS  +   + Y E+  V NQ                                   
Sbjct  237   TKSSSPSQSLAAISEYYEDEKVQNQLNAPVGLSKKKSTDSSTKPDNPSSAKILNKDASVF  296

Query  935   --EVNFDMQKAEVLHSKNVVDKLKESSETSNQ----RSNERISVPQEKSSGRSANISNGL  1096
                 + + Q+   +  + +  KLK SSE+S+       ++  S   E  S R  N  N L
Sbjct  297   PEAKDIERQRTGTVQHRELGSKLKVSSESSDALLHLYRDKNTSSQIEPQSNRQLNDMNEL  356

Query  1097  DQS--FQQGEKSVIYDQRLDASAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDL  1252
             + S   +Q EK+    Q  D ++   K   QT +      ++GS+VR K TMLE+AIR+L
Sbjct  357   ELSTKVRQKEKNC-SSQLPDLNSSVIKYPVQTAKTSSMHVKEGSTVRPKGTMLERAIREL  415

Query  1253  EKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMS  1432
             EK VAESRPP  EVQD D SSQA+KRRLP E+KQKLAKVAR AQ+S GK+S+ELINRLMS
Sbjct  416   EKMVAESRPPIMEVQDADASSQAVKRRLPREVKQKLAKVARLAQSSQGKISEELINRLMS  475

Query  1433  IVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQP  1612
             I+GHLVQL+TLKRNLK M+ +GL+AKQ KD+R QQIK+E+ EMIK +   +KSKA E + 
Sbjct  476   ILGHLVQLKTLKRNLKEMVELGLTAKQAKDDRFQQIKKEIVEMIKVQALSLKSKASEPRD  535

Query  1613  GTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAY  1792
             G SDDFQ     E++  K KYCMD+A+E+++CDLYDL+VEG++ED GPQ+RKLY ELA  
Sbjct  536   GASDDFQEPLGSEEKGVKGKYCMDDAMEDKLCDLYDLFVEGMDEDKGPQIRKLYVELAEL  595

Query  1793  WPNGFMDNHGIKRAICRAKDRRKTLYNRHK------------------NQEKMRRNKISA  1918
             WPNG MDNHGIK A+CRAK+R++ +Y++HK                  +QEK+RR K+S+
Sbjct  596   WPNGSMDNHGIKSAVCRAKERKRAMYSKHKIPFPLHVLQTMYVQPIKEDQEKIRRKKLSS  655

Query  1919  Q-KEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAA----INMVGRIPVP  2083
               + EE    ET+T  QP  +QE+   D   H  T+ N+  S+  A    I+  GR+   
Sbjct  656   TPRTEEIVHGETSTIAQPRFLQERLVYDPSSHVLTSPNRMTSNMTAASQHISAPGRVLNS  715

Query  2084  SPGGTSLDR-PKPEKVK-GTGNSTDRHITTDA-LTKKKMKRKPEPELGEGQYLPEKLSSK  2254
             S  G +LDR PK EKVK  +G   D    TD  L KKK+KRKPE   GE  Y  +KLS +
Sbjct  716   STNGLNLDRPPKQEKVKDSSGTFLDEVRGTDGKLVKKKLKRKPESIFGEVHYHADKLSIQ  775

Query  2255  QAEYKPQEPIAAA-PVPKPSIQLNEPPSFEE  2344
             + + K + P  A   + KPS+Q    PS E+
Sbjct  776   KVKEKHKFPKQAGNQLQKPSVQSTGLPSSEQ  806



>ref|XP_007137474.1| hypothetical protein PHAVU_009G129800g [Phaseolus vulgaris]
 gb|ESW09468.1| hypothetical protein PHAVU_009G129800g [Phaseolus vulgaris]
Length=718

 Score =   527 bits (1358),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 355/763 (47%), Positives = 473/763 (62%), Gaps = 108/763 (14%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S+S+   G RQ FTVELRPGETTIVSWKKL+K++                        
Sbjct  6     RASSSFVKKGDRQMFTVELRPGETTIVSWKKLMKDSN-----------------------  42

Query  404   QPLILPPHNDSPGP-GFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedldd  580
             +P+     N +P     +P +PV+ E  D    NR +AVIEKIERLY+GK S DDEDL D
Sbjct  43    KPI---GSNSAPQQVAIAPGEPVDGEENDPSQPNRFSAVIEKIERLYMGKDSSDDEDLLD  99

Query  581   vpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRR  757
             VPD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EP +  NQ P KRR
Sbjct  100   VPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPPALPNQQPKKRR  159

Query  758   KKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPL-AAGTSSPSYGVVMPTLYRENANVHN  931
             +KD  K    ++DG   NK  KVG+ A GK+  L A    + S  +V    + E+  + N
Sbjct  160   RKDVLKNAGENNDGHGSNKNVKVGRPASGKAASLQAKNMLNSSENLVAHDEHHEDLKLSN  219

Query  932   QE-------------------------------------VNFDMQKAEVLHSKNVVDKLK  1000
             +                                       + D QK     SKN+ DK K
Sbjct  220   RSDVSGIISKKKTVDSKLTLDPSISLKAPNDDVPGVTDAKDADKQKIGAFQSKNISDKCK  279

Query  1001  ESS---ETSNQRSNERISVPQEKSS-GRSANISNGLDQSFQQGEKSVIYDQRLDASAPEG  1168
             + +   + S+Q+ NE+ +    KS  G+  N  + L+   +  EKS +  +  D +  EG
Sbjct  280   DGTGLFDASHQKYNEKSAYAHSKSQPGKPPNSIDDLENIIRTKEKSGMC-ELPDLNLSEG  338

Query  1169  KRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKR  1330
             K +TQ ++      ++GSSVR K +MLEKA+R+LE+ VAESRPP  + QD      A+KR
Sbjct  339   KSATQAIKSENMQKKEGSSVRPKTSMLEKALRELERMVAESRPPAVDNQD------AVKR  392

Query  1331  RLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             RLP +IK KLAKVAR A A+HGK+SKELINRLMSI+GHL+QLRTLKRNLKIMI+MGLSAK
Sbjct  393   RLPRDIKLKLAKVARLA-ATHGKVSKELINRLMSILGHLIQLRTLKRNLKIMISMGLSAK  451

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNA  1690
             QE+DNR QQIK+EV +MIK + P ++SK  +Q+   S DFQ    + K   K+K+ MD A
Sbjct  452   QEEDNRFQQIKKEVVDMIKMQPPTLESK--QQKGEASGDFQEFGPDGKAITKKKFAMDAA  509

Query  1691  LENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY  1870
             LE++ICDLYDL+V+GL+E+AGPQ+RKLY ELA  WP+G+MDNHGIKR ICRAK+RR+ LY
Sbjct  510   LEDKICDLYDLFVDGLDENAGPQIRKLYYELAELWPSGYMDNHGIKRGICRAKERRRALY  569

Query  1871  NRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTA  2050
             N+HK+QEK++R K+   K+EE  R +T +      ++E+SA +     S++ +K +S+T+
Sbjct  570   NKHKDQEKIKRKKLLVPKQEENVRFDTNSITSQQILRERSAPE-----SSSGSKQVSNTS  624

Query  2051  AINMVGRIPVPSPGGTSLDRPKPEKVKGTGNST--DRHITTDALTKKKMKRKPEPELGEG  2224
                  GR+P P  G       K EK KG+ +S+  D  I   ALT KK+KRKPE EL E 
Sbjct  625   P---TGRVPSPING------IKQEKAKGSSSSSLDDARIAEGALT-KKVKRKPELEL-EA  673

Query  2225  QYLPEKLSSKQAEYKPQ--EPIAAAPVP-KPSIQLNEPPSFEE  2344
               +PEK++S Q E +P+  +  ++ P+P K +I     P  E+
Sbjct  674   HLVPEKVASLQGEERPRFLKQQSSGPLPNKSNIHPTSVPDLEQ  716



>ref|XP_003545655.1| PREDICTED: uncharacterized protein LOC100799794 isoform X1 [Glycine 
max]
Length=755

 Score =   528 bits (1360),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 355/777 (46%), Positives = 468/777 (60%), Gaps = 82/777 (11%)
 Frame = +2

Query  173   MKPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsng  352
             M P +  G S       R  +S+   G RQ FTVELRPGETTIVSWKKL+K+A  + +  
Sbjct  6     MAPLVGGGDSSS--ATARAQSSFVKKGDRQMFTVELRPGETTIVSWKKLMKDANKVNNGS  63

Query  353   ngapgpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIE  532
               AP                  P  N +     +P QP E E + AP  NR +AVIEKIE
Sbjct  64    ASAPEHRA--------------PNANPALESRIAPGQPKEIEEEGAPQTNRFSAVIEKIE  109

Query  533   RLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER  712
             RLY+GK S D+ED  DVPD+     + SFIDD ELD+YF+VDNSAIKHDGFFVNRGKLER
Sbjct  110   RLYMGKDSSDEEDALDVPDDQYDTED-SFIDDAELDEYFEVDNSAIKHDGFFVNRGKLER  168

Query  713   I-EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPL-AAGTSSPSY  883
             I EP     Q   KRR+KD  K    + D    NK  KVGK A GK+  L    T S S+
Sbjct  169   INEPPVLPIQQAKKRRRKDIPKNPGENIDSHVSNKHVKVGKTATGKTASLPVKNTISSSH  228

Query  884   GVVMPTLYRENANVHNQ-----------------------------------EVNFDMQK  958
              + +P  + E+    NQ                                     + + +K
Sbjct  229   NLGVPGEHYEDMKFRNQLDVSGISSKRKTTDTRPMSDPPVCSKVSTDDAPAAAEDAEKKK  288

Query  959   AEVLHSKNVVDKLKESS---ETSNQRSNERISVPQEKSS-GRSANISNGLDQSFQQGEKS  1126
               VL SKN  DK K++S   +TS+Q+ +E+ +    KS  G++++  + L+++ +  +K+
Sbjct  289   TRVLQSKNTSDKYKDASGLLDTSHQKYHEKSASAHSKSHSGKTSSSVDNLEKTGRLKDKN  348

Query  1127  VI-----YDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAE  1291
              I      +  +  SA +  +S   +++DGS+ R KIT LEKAIR+LEK VAESRPP  E
Sbjct  349   GIRELPDLNLSVGKSAIQAPKSENVLKKDGSTARPKITTLEKAIRELEKIVAESRPPTME  408

Query  1292  VQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKR  1471
              Q+ D + Q +KRRLP EIK KLAKVAR AQAS GK+SKEL+NRLMSI+GHL+QLRTLKR
Sbjct  409   NQEPDTTPQGVKRRLPREIKLKLAKVARLAQASQGKVSKELLNRLMSILGHLIQLRTLKR  468

Query  1472  NLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEE  1651
             NLKIMI+MGLSAKQEKD R QQ K EV EMIK + P M+SK +++Q G S + Q +  + 
Sbjct  469   NLKIMISMGLSAKQEKDVRFQQKKNEVIEMIKMQAPTMESK-LQKQAGVSGE-QELGPDG  526

Query  1652  KEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKR  1831
             K    R + MD ALE++ICDLYDL+V+GL+E+AGPQ+RKLYAELA  WPNG+MDNHGIKR
Sbjct  527   KPITTRNFSMDTALEDKICDLYDLFVDGLDENAGPQIRKLYAELAELWPNGYMDNHGIKR  586

Query  1832  AICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETT--TRDQPVQIQEKSAVDAR  2005
             AICR+K+RR+ LYNRHK+QEK++R K+ A ++EE  + + +  T  QP  ++E+ A D+ 
Sbjct  587   AICRSKERRRALYNRHKDQEKIKRKKLLAPRQEEDVQFDPSPITSQQP--MRERLATDSS  644

Query  2006  DHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKG--TGNSTDRHITTDALT  2179
              H  T+ NK +S+T       R+  PS  G     PK E+ KG  +G+  D       L 
Sbjct  645   SHTHTSVNKTVSNTIT---AARVHNPSENG-----PKQERAKGSSSGSLDDVKGADGVLI  696

Query  2180  KKKMKRKPEPELGEGQYLPEK-LSSKQAEYKPQEPIAAAPV-PKPSIQLNEPPSFEE  2344
             KKK+KRKP+  L    + PEK  +S Q E KP+    +A V PK ++Q    P  E+
Sbjct  697   KKKVKRKPDQGLEGTHFRPEKSAASLQGEEKPRSLKQSAGVPPKSNLQPTSLPGLEQ  753



>ref|XP_010269066.1| PREDICTED: ubinuclein-1-like isoform X2 [Nelumbo nucifera]
Length=788

 Score =   529 bits (1363),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 370/774 (48%), Positives = 460/774 (59%), Gaps = 106/774 (14%)
 Frame = +2

Query  266   FTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDSPGP  445
             FTVELRPGETTIVSWKKL+KEA                        QP +         P
Sbjct  38    FTVELRPGETTIVSWKKLIKEANKAN--------------------QPPLASEAPSGAHP  77

Query  446   GF----SPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydted  613
                   +P QPVE E KDAPP NR +AVIEKIERLY+GK S D+E+LD VPD+D+YDTED
Sbjct  78    ALESRIAPGQPVESELKDAPPANRFSAVIEKIERLYMGKHSSDEEELDGVPDDDQYDTED  137

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKCQSGS  790
             SFIDDTELD+YFQVD SA KH GFFVNRGKLERI EP +  +  P KRR+KD  K + G 
Sbjct  138   SFIDDTELDEYFQVDKSATKHIGFFVNRGKLERINEPVASPDYQPKKRRRKDPAKSR-GE  196

Query  791   DDGCN------------PNKPAKVG----KKAGKSVPLAAGTSSPSYGVVMPTL--YREN  916
              DG +            P+K AKVG    K A ++ PL  GT S      + T+  Y E+
Sbjct  197   KDGEHVSNRNAKDSEHLPSKHAKVGNVRMKAAARTAPLV-GTKSYGSSQSLATISEYYED  255

Query  917   ANVHNQ-------------------------------------EVNFDMQKAEVLHSKNV  985
               V NQ                                       N + QK+ ++  + V
Sbjct  256   EKVQNQLNSLGPSKKKSTDSNTKLENPNSSKTSNRDASMFPIEAKNIEKQKSGIMQPREV  315

Query  986   VDKLKESSETSNQ----RSNERISVPQEKSSGRSANISNGLDQS--FQQGEKSVIYDQRL  1147
              +KLK  S  S+       ++  S   E   GR  N    ++ S   +Q EK+   +Q  
Sbjct  316   GNKLKVPSVPSDAVHQIYRDKGASTQIEPQPGRQLNDMTEIELSTKVRQKEKNS-SNQLP  374

Query  1148  DASAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDN  1309
             D ++   K   QT +      R+GSSVR K TMLE+AIR+LEK VA SRPP  EVQDGD 
Sbjct  375   DLNSSGIKYPVQTAKIPSMHAREGSSVRPKGTMLERAIRELEKIVAVSRPPIMEVQDGDV  434

Query  1310  SSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMI  1489
             SSQAIKRRLP E+KQKLAKVAR A +S GK+S ELINRLMSI+GHLVQL+TLKRNLK M+
Sbjct  435   SSQAIKRRLPREVKQKLAKVARLA-SSQGKISDELINRLMSILGHLVQLKTLKRNLKEMV  493

Query  1490  NMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKR  1669
              +GLSAKQEKD+  QQIK+EV EMIK +   +KSK  EQ+ G S DFQ +   E++  K 
Sbjct  494   ELGLSAKQEKDDHFQQIKKEVVEMIKMQASSLKSKVPEQRDGASVDFQEVLDSEEKGVKG  553

Query  1670  KYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAK  1849
             KY MD+A+E++ICDLYDLYVEG++ED GPQ+RKLY ELA  WPNG MDNHGIK A+CR+K
Sbjct  554   KYSMDDAMEDKICDLYDLYVEGMDEDKGPQIRKLYVELAELWPNGSMDNHGIKTAVCRSK  613

Query  1850  DRRKTLYNRHKNQEKMRRNKIS-AQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTAT  2026
             +R++ + ++HKNQ K+RR K+S A + EEG   E  T      IQE+   D   H  T  
Sbjct  614   ERKRAMLSKHKNQ-KIRRKKLSTAPRAEEGICGEAITTAHARLIQERLVTDMNCHVLTPP  672

Query  2027  NKPISSTAA----INMVGRIPVPSPGGTSLDR-PKPEKVKG-TGNSTDRHITTD-ALTKK  2185
             N+  S+ A     I+   R+P  S  G +LDR PK EKVKG TG   +    TD +L KK
Sbjct  673   NRMTSNMAVASQHISTSVRMPNSSTNGFNLDRMPKQEKVKGSTGTFLNEVQRTDGSLVKK  732

Query  2186  KMKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             K+KRKPE  LGE  +  +KLS +Q + K + P     +P KPSIQ    PS E+
Sbjct  733   KLKRKPESVLGEIHFHSDKLSLQQEKEKHKYPKLTGSLPHKPSIQSTGLPSSEQ  786



>ref|XP_010270288.1| PREDICTED: ubinuclein-1-like isoform X3 [Nelumbo nucifera]
Length=807

 Score =   530 bits (1364),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 373/810 (46%), Positives = 481/810 (59%), Gaps = 113/810 (14%)
 Frame = +2

Query  197   SSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpap  376
             SS   P  G  S+S  A+   + FTVELRPGETTIVSWKKL+KEA               
Sbjct  15    SSSFAPETGGASSSTYASKNGRWFTVELRPGETTIVSWKKLIKEAN--------------  60

Query  377   rasaaaaELQPLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGK  550
                  A++  P    P    P      +P QP E E+KDAPPGNR +AVIEKIERLYVGK
Sbjct  61    ----KASQSTPASEAPSGAHPALESRLAPGQPAEGESKDAPPGNRFSAVIEKIERLYVGK  116

Query  551   QSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTS  727
             +S D+E+LD VPD+D+YDTEDSFIDDTELD+YFQVD S+ KH+GFFVNRGKLERI EP +
Sbjct  117   ESSDEEELDGVPDDDQYDTEDSFIDDTELDEYFQVDKSSTKHNGFFVNRGKLERINEPVA  176

Query  728   QQNQLPNKRRKKDQTKCQSGSD----------DGCN-PNKPAKVG----KKAGKSVPLAA  862
               +  P KRR+KD  K +   D          DG + P+K AK+G    K A ++ PL  
Sbjct  177   SPDHQPKKRRRKDLAKSRIEKDGENVPNKHTKDGDHIPSKNAKLGNVRMKAAARTAPLGG  236

Query  863   G-TSSPSYGVVMPTLYRENANVHNQ-----------------------------------  934
               +SSPS  +   + Y E+  V NQ                                   
Sbjct  237   TKSSSPSQSLAAISEYYEDEKVQNQLNAPVGLSKKKSTDSSTKPDNPSSAKILNKDASVF  296

Query  935   --EVNFDMQKAEVLHSKNVVDKLKESSETSNQ----RSNERISVPQEKSSGRSANISNGL  1096
                 + + Q+   +  + +  KLK SSE+S+       ++  S   E  S R  N  N L
Sbjct  297   PEAKDIERQRTGTVQHRELGSKLKVSSESSDALLHLYRDKNTSSQIEPQSNRQLNDMNEL  356

Query  1097  DQS--FQQGEKSVIYDQRLDASAPEGKRSTQTVR-----RDGSSVRSKITMLEKAIRDLE  1255
             + S   +Q EK+    Q  D ++   K   QT       ++GS+VR K TMLE+AIR+LE
Sbjct  357   ELSTKVRQKEKNC-SSQLPDLNSSVIKYPVQTATSSMHVKEGSTVRPKGTMLERAIRELE  415

Query  1256  KFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSI  1435
             K VAESRPP  EVQD D SSQA+KRRLP E+KQKLAKVAR AQ+S GK+S+ELINRLMSI
Sbjct  416   KMVAESRPPIMEVQDADASSQAVKRRLPREVKQKLAKVARLAQSSQGKISEELINRLMSI  475

Query  1436  VGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPG  1615
             +GHLVQL+TLKRNLK M+ +GL+AKQ KD+R QQIK+E+ EMIK +   +KSKA E + G
Sbjct  476   LGHLVQLKTLKRNLKEMVELGLTAKQAKDDRFQQIKKEIVEMIKVQALSLKSKASEPRDG  535

Query  1616  TSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYW  1795
              SDDFQ     E++  K KYCMD+A+E+++CDLYDL+VEG++ED GPQ+RKLY ELA  W
Sbjct  536   ASDDFQEPLGSEEKGVKGKYCMDDAMEDKLCDLYDLFVEGMDEDKGPQIRKLYVELAELW  595

Query  1796  PNGFMDNHGIKRAICRAKDRRKTLYNRHK------------------NQEKMRRNKISAQ  1921
             PNG MDNHGIK A+CRAK+R++ +Y++HK                  +QEK+RR K+S+ 
Sbjct  596   PNGSMDNHGIKSAVCRAKERKRAMYSKHKIPFPLHVLQTMYVQPIKEDQEKIRRKKLSST  655

Query  1922  -KEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAA----INMVGRIPVPS  2086
              + EE    ET+T  QP  +QE+   D   H  T+ N+  S+  A    I+  GR+   S
Sbjct  656   PRTEEIVHGETSTIAQPRFLQERLVYDPSSHVLTSPNRMTSNMTAASQHISAPGRVLNSS  715

Query  2087  PGGTSLDR-PKPEKVK-GTGNSTDRHITTDA-LTKKKMKRKPEPELGEGQYLPEKLSSKQ  2257
               G +LDR PK EKVK  +G   D    TD  L KKK+KRKPE   GE  Y  +KLS ++
Sbjct  716   TNGLNLDRPPKQEKVKDSSGTFLDEVRGTDGKLVKKKLKRKPESIFGEVHYHADKLSIQK  775

Query  2258  AEYKPQEPIAAA-PVPKPSIQLNEPPSFEE  2344
              + K + P  A   + KPS+Q    PS E+
Sbjct  776   VKEKHKFPKQAGNQLQKPSVQSTGLPSSEQ  805



>ref|XP_006596223.1| PREDICTED: uncharacterized protein LOC100799794 isoform X2 [Glycine 
max]
 gb|KHN38980.1| hypothetical protein glysoja_035108 [Glycine soja]
Length=758

 Score =   527 bits (1357),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 357/780 (46%), Positives = 468/780 (60%), Gaps = 85/780 (11%)
 Frame = +2

Query  173   MKPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsng  352
             M P +  G S       R  +S+   G RQ FTVELRPGETTIVSWKKL+K+A  + +  
Sbjct  6     MAPLVGGGDSSS--ATARAQSSFVKKGDRQMFTVELRPGETTIVSWKKLMKDANKVNNGS  63

Query  353   ngapgpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIE  532
               AP                  P  N +     +P QP E E + AP  NR +AVIEKIE
Sbjct  64    ASAPEHRA--------------PNANPALESRIAPGQPKEIEEEGAPQTNRFSAVIEKIE  109

Query  533   RLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER  712
             RLY+GK S D+ED  DVPD+     + SFIDD ELD+YF+VDNSAIKHDGFFVNRGKLER
Sbjct  110   RLYMGKDSSDEEDALDVPDDQYDTED-SFIDDAELDEYFEVDNSAIKHDGFFVNRGKLER  168

Query  713   I-EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPL-AAGTSSPSY  883
             I EP     Q   KRR+KD  K    + D    NK  KVGK A GK+  L    T S S+
Sbjct  169   INEPPVLPIQQAKKRRRKDIPKNPGENIDSHVSNKHVKVGKTATGKTASLPVKNTISSSH  228

Query  884   GVVMPTLYRENANVHNQ-----------------------------------EVNFDMQK  958
              + +P  + E+    NQ                                     + + +K
Sbjct  229   NLGVPGEHYEDMKFRNQLDVSGISSKRKTTDTRPMSDPPVCSKVSTDDAPAAAEDAEKKK  288

Query  959   AEVLHSKNVVDKLKESS---ETSNQRSNERISVPQEKSS-GRSANISNGLDQSFQQGEKS  1126
               VL SKN  DK K++S   +TS+Q+ +E+ +    KS  G++++  + L+++ +  +K+
Sbjct  289   TRVLQSKNTSDKYKDASGLLDTSHQKYHEKSASAHSKSHSGKTSSSVDNLEKTGRLKDKN  348

Query  1127  VIY---DQRLDAS-----APEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPP  1282
              I    D  L        AP  ++S   +++DGS+ R KIT LEKAIR+LEK VAESRPP
Sbjct  349   GIRELPDLNLSVGKSAIQAPLMQKSENVLKKDGSTARPKITTLEKAIRELEKIVAESRPP  408

Query  1283  NAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRT  1462
               E Q+ D + Q +KRRLP EIK KLAKVAR AQAS GK+SKEL+NRLMSI+GHL+QLRT
Sbjct  409   TMENQEPDTTPQGVKRRLPREIKLKLAKVARLAQASQGKVSKELLNRLMSILGHLIQLRT  468

Query  1463  LKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIA  1642
             LKRNLKIMI+MGLSAKQEKD R QQ K EV EMIK + P M+SK +++Q G S + Q + 
Sbjct  469   LKRNLKIMISMGLSAKQEKDVRFQQKKNEVIEMIKMQAPTMESK-LQKQAGVSGE-QELG  526

Query  1643  TEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHG  1822
              + K    R + MD ALE++ICDLYDL+V+GL+E+AGPQ+RKLYAELA  WPNG+MDNHG
Sbjct  527   PDGKPITTRNFSMDTALEDKICDLYDLFVDGLDENAGPQIRKLYAELAELWPNGYMDNHG  586

Query  1823  IKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETT--TRDQPVQIQEKSAV  1996
             IKRAICR+K+RR+ LYNRHK+QEK++R K+ A ++EE  + + +  T  QP  ++E+ A 
Sbjct  587   IKRAICRSKERRRALYNRHKDQEKIKRKKLLAPRQEEDVQFDPSPITSQQP--MRERLAT  644

Query  1997  DARDHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKG--TGNSTDRHITTD  2170
             D+  H  T+ NK +S+T       R+  PS  G     PK E+ KG  +G+  D      
Sbjct  645   DSSSHTHTSVNKTVSNTIT---AARVHNPSENG-----PKQERAKGSSSGSLDDVKGADG  696

Query  2171  ALTKKKMKRKPEPELGEGQYLPEK-LSSKQAEYKPQEPIAAAPV-PKPSIQLNEPPSFEE  2344
              L KKK+KRKP+  L    + PEK  +S Q E KP+    +A V PK ++Q    P  E+
Sbjct  697   VLIKKKVKRKPDQGLEGTHFRPEKSAASLQGEEKPRSLKQSAGVPPKSNLQPTSLPGLEQ  756



>gb|KHN05178.1| hypothetical protein glysoja_028076 [Glycine soja]
Length=753

 Score =   524 bits (1350),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 354/776 (46%), Positives = 465/776 (60%), Gaps = 82/776 (11%)
 Frame = +2

Query  173   MKPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsng  352
             M P +  G S       R  +S+   G RQ FTVELRPGETTIVSWKKL+K+A  + +  
Sbjct  6     MAPLVGGGDSSS--ATARAQSSFVKKGDRQMFTVELRPGETTIVSWKKLMKDANKVNNGS  63

Query  353   ngapgpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIE  532
               AP                  P  N +     +P QP+E E + AP  NR +AVIEKIE
Sbjct  64    ASAPEHRA--------------PNANPALESRIAPGQPMEIEEQGAPQTNRFSAVIEKIE  109

Query  533   RLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER  712
             RLY+GK S D+ED  DVPD+     + SFIDD ELD+YF+VDNS+IKHDGFFVNRGKLER
Sbjct  110   RLYMGKDSSDEEDALDVPDDQYDTDD-SFIDDAELDEYFEVDNSSIKHDGFFVNRGKLER  168

Query  713   I-EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKK-AGKSVPL-AAGTSSPSY  883
             I EP     Q   KRR+KD  K      D    NK  KVGK  AGK+  L    T S S+
Sbjct  169   INEPPVLPIQQAKKRRRKDVPKNPGEHIDSHVSNKHVKVGKTAAGKTASLPVKNTISSSH  228

Query  884   GVVMPTLYRENANVHNQ----------------------------------EVNFDMQKA  961
              + +P  + E+    NQ                                    + + QK 
Sbjct  229   NLGVPGEHYEDMTFQNQLDVSGISLKRKTADTRPMLDPPVCSKVSTNAPAAAEDAEKQKT  288

Query  962   EVLHSKNVVDKLKESS---ETSNQRSNERISVPQEKSSGRSANIS-NGLDQSFQQGEKSV  1129
              VL SKN  DK K++S   +TS Q+ +E+ +  + KS     +IS + L+++ +  +K+ 
Sbjct  289   RVLQSKNTSDKYKDASGLLDTSRQKYHEKSASAKSKSQPGKISISVDNLEKAGRSKDKND  348

Query  1130  IY-----DQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEV  1294
             I+     +  +  SA +  +S   +++DGSS R K T LEKAIR+LEK VAESRPP  E 
Sbjct  349   IHELPDLNLYVGKSAIQAPKSENVLKKDGSSARPKTTTLEKAIRELEKIVAESRPPTMEN  408

Query  1295  QDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRN  1474
             Q+ D + Q +KRRLP EIK KLAKVAR AQAS GK+SKEL+NRLMSI+GHL+QLRTLKRN
Sbjct  409   QEVDTTPQGVKRRLPREIKLKLAKVARLAQASQGKVSKELLNRLMSILGHLIQLRTLKRN  468

Query  1475  LKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEK  1654
             LKIMI+MGLSAKQEKD R Q IK+EV EMIK + P ++SK ++QQ   S + Q +  + K
Sbjct  469   LKIMISMGLSAKQEKDVRFQLIKKEVIEMIKMQAPTIESK-LQQQAAASGE-QELGPDGK  526

Query  1655  EAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRA  1834
                K+ + MD ALE++ICDLYDL+V+GL+E++GPQ+RKLYAELA  WPNG+MDNHGIKRA
Sbjct  527   PITKKNFSMDTALEDKICDLYDLFVDGLDENSGPQIRKLYAELAELWPNGYMDNHGIKRA  586

Query  1835  ICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETT--TRDQPVQIQEKSAVDARD  2008
             ICR+K+RR+ LY+RHK+QEK++R K+ A + EE  +V+ +  T  QP  ++E+ A D+  
Sbjct  587   ICRSKERRRALYSRHKDQEKIKRKKLLAPRPEENVQVDPSPITLQQP--LRERLATDSSG  644

Query  2009  HGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKG-TGNSTDRHITTDA-LTK  2182
             H   + NK +S+T       R+  P  G      PK EK KG +G S D     D  L K
Sbjct  645   HPHASVNKTVSNTVT---TARVHNPVNG------PKQEKAKGSSGGSLDDVKGADGVLIK  695

Query  2183  KKMKRKPEPELGEGQYLPEKL-SSKQAEYKPQEPIAAAPV-PKPSIQLNEPPSFEE  2344
             KK+KRK E  L    + PEK+ +S Q E K +    +A V PK ++Q    P  E+
Sbjct  696   KKVKRKLEQGLEGTHFRPEKIGASLQGEEKTRSLKQSAGVPPKSNLQPTSLPGLEQ  751



>ref|XP_010270287.1| PREDICTED: ubinuclein-1-like isoform X2 [Nelumbo nucifera]
Length=807

 Score =   524 bits (1349),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 372/811 (46%), Positives = 481/811 (59%), Gaps = 115/811 (14%)
 Frame = +2

Query  197   SSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpap  376
             SS   P  G  S+S  A+   + FTVELRPGETTIVSWKKL+KEA               
Sbjct  15    SSSFAPETGGASSSTYASKNGRWFTVELRPGETTIVSWKKLIKEAN--------------  60

Query  377   rasaaaaELQPLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGK  550
                  A++  P    P    P      +P QP E E+KDAPPGNR +AVIEKIERLYVGK
Sbjct  61    ----KASQSTPASEAPSGAHPALESRLAPGQPAEGESKDAPPGNRFSAVIEKIERLYVGK  116

Query  551   QSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTS  727
             +S D+E+LD VPD+D+YDTEDSFIDDTELD+YFQVD S+ KH+GFFVNRGKLERI EP +
Sbjct  117   ESSDEEELDGVPDDDQYDTEDSFIDDTELDEYFQVDKSSTKHNGFFVNRGKLERINEPVA  176

Query  728   QQNQLPNKRRKKDQTKCQSGSD----------DGCN-PNKPAKVG----KKAGKSVPLAA  862
               +  P KRR+KD  K +   D          DG + P+K AK+G    K A ++ PL  
Sbjct  177   SPDHQPKKRRRKDLAKSRIEKDGENVPNKHTKDGDHIPSKNAKLGNVRMKAAARTAPLGG  236

Query  863   G-TSSPSYGVVMPTLYRENANVHNQ-----------------------------------  934
               +SSPS  +   + Y E+  V NQ                                   
Sbjct  237   TKSSSPSQSLAAISEYYEDEKVQNQLNAPVGLSKKKSTDSSTKPDNPSSAKILNKDASVF  296

Query  935   --EVNFDMQKAEVLHSKNVVDKLKESSETSNQ----RSNERISVPQEKSSGRSANISNGL  1096
                 + + Q+   +  + +  KLK SSE+S+       ++  S   E  S R  N  N L
Sbjct  297   PEAKDIERQRTGTVQHRELGSKLKVSSESSDALLHLYRDKNTSSQIEPQSNRQLNDMNEL  356

Query  1097  DQS--FQQGEKSVIYDQRLDASAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDL  1252
             + S   +Q EK+    Q  D ++   K   QT +      ++GS+VR K TMLE+AIR+L
Sbjct  357   ELSTKVRQKEKNC-SSQLPDLNSSVIKYPVQTAKTSSMHVKEGSTVRPKGTMLERAIREL  415

Query  1253  EKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMS  1432
             EK VAESRPP  EVQD D SSQA+KRRLP E+KQKLAKVAR A +S GK+S+ELINRLMS
Sbjct  416   EKMVAESRPPIMEVQDADASSQAVKRRLPREVKQKLAKVARLA-SSQGKISEELINRLMS  474

Query  1433  IVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQP  1612
             I+GHLVQL+TLKRNLK M+ +GL+AKQ KD+R QQIK+E+ EMIK +   +KSKA E + 
Sbjct  475   ILGHLVQLKTLKRNLKEMVELGLTAKQAKDDRFQQIKKEIVEMIKVQALSLKSKASEPRD  534

Query  1613  GTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAY  1792
             G SDDFQ     E++  K KYCMD+A+E+++CDLYDL+VEG++ED GPQ+RKLY ELA  
Sbjct  535   GASDDFQEPLGSEEKGVKGKYCMDDAMEDKLCDLYDLFVEGMDEDKGPQIRKLYVELAEL  594

Query  1793  WPNGFMDNHGIKRAICRAKDRRKTLYNRHK------------------NQEKMRRNKISA  1918
             WPNG MDNHGIK A+CRAK+R++ +Y++HK                  +QEK+RR K+S+
Sbjct  595   WPNGSMDNHGIKSAVCRAKERKRAMYSKHKIPFPLHVLQTMYVQPIKEDQEKIRRKKLSS  654

Query  1919  Q-KEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAA----INMVGRIPVP  2083
               + EE    ET+T  QP  +QE+   D   H  T+ N+  S+  A    I+  GR+   
Sbjct  655   TPRTEEIVHGETSTIAQPRFLQERLVYDPSSHVLTSPNRMTSNMTAASQHISAPGRVLNS  714

Query  2084  SPGGTSLDR-PKPEKVK-GTGNSTDRHITTDA-LTKKKMKRKPEPELGEGQYLPEKLSSK  2254
             S  G +LDR PK EKVK  +G   D    TD  L KKK+KRKPE   GE  Y  +KLS +
Sbjct  715   STNGLNLDRPPKQEKVKDSSGTFLDEVRGTDGKLVKKKLKRKPESIFGEVHYHADKLSIQ  774

Query  2255  QAEYKPQEPIAAA-PVPKPSIQLNEPPSFEE  2344
             + + K + P  A   + KPS+Q    PS E+
Sbjct  775   KVKEKHKFPKQAGNQLQKPSVQSTGLPSSEQ  805



>ref|XP_006596224.1| PREDICTED: uncharacterized protein LOC100799794 isoform X3 [Glycine 
max]
Length=757

 Score =   520 bits (1340),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 356/780 (46%), Positives = 467/780 (60%), Gaps = 86/780 (11%)
 Frame = +2

Query  173   MKPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsng  352
             M P +  G S       R  +S+   G RQ FTVELRPGETTIVSWKKL+K+A  + +  
Sbjct  6     MAPLVGGGDSSS--ATARAQSSFVKKGDRQMFTVELRPGETTIVSWKKLMKDANKVNNGS  63

Query  353   ngapgpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIE  532
               AP                  P  N +     +P QP E E + AP  NR +AVIEKIE
Sbjct  64    ASAPEHRA--------------PNANPALESRIAPGQPKEIEEEGAPQTNRFSAVIEKIE  109

Query  533   RLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER  712
             RLY+GK S D+ED  DVPD+     + SFIDD ELD+YF+VDNSAIKHDGFFVNRGKLER
Sbjct  110   RLYMGKDSSDEEDALDVPDDQYDTED-SFIDDAELDEYFEVDNSAIKHDGFFVNRGKLER  168

Query  713   I-EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPL-AAGTSSPSY  883
             I EP     Q   KRR+KD  K    + D    NK  KVGK A GK+  L    T S S+
Sbjct  169   INEPPVLPIQQAKKRRRKDIPKNPGENIDSHVSNKHVKVGKTATGKTASLPVKNTISSSH  228

Query  884   GVVMPTLYRENANVHNQ-----------------------------------EVNFDMQK  958
              + +P  + E+    NQ                                     + + +K
Sbjct  229   NLGVPGEHYEDMKFRNQLDVSGISSKRKTTDTRPMSDPPVCSKVSTDDAPAAAEDAEKKK  288

Query  959   AEVLHSKNVVDKLKESS---ETSNQRSNERISVPQEKSS-GRSANISNGLDQSFQQGEKS  1126
               VL SKN  DK K++S   +TS+Q+ +E+ +    KS  G++++  + L+++ +  +K+
Sbjct  289   TRVLQSKNTSDKYKDASGLLDTSHQKYHEKSASAHSKSHSGKTSSSVDNLEKTGRLKDKN  348

Query  1127  VIY---DQRLDAS-----APEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPP  1282
              I    D  L        AP  ++S   +++DGS+ R KIT LEKAIR+LEK VAESRPP
Sbjct  349   GIRELPDLNLSVGKSAIQAPLMQKSENVLKKDGSTARPKITTLEKAIRELEKIVAESRPP  408

Query  1283  NAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRT  1462
               E Q+ D + Q +KRRLP EIK KLAKVAR A AS GK+SKEL+NRLMSI+GHL+QLRT
Sbjct  409   TMENQEPDTTPQGVKRRLPREIKLKLAKVARLA-ASQGKVSKELLNRLMSILGHLIQLRT  467

Query  1463  LKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIA  1642
             LKRNLKIMI+MGLSAKQEKD R QQ K EV EMIK + P M+SK +++Q G S + Q + 
Sbjct  468   LKRNLKIMISMGLSAKQEKDVRFQQKKNEVIEMIKMQAPTMESK-LQKQAGVSGE-QELG  525

Query  1643  TEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHG  1822
              + K    R + MD ALE++ICDLYDL+V+GL+E+AGPQ+RKLYAELA  WPNG+MDNHG
Sbjct  526   PDGKPITTRNFSMDTALEDKICDLYDLFVDGLDENAGPQIRKLYAELAELWPNGYMDNHG  585

Query  1823  IKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETT--TRDQPVQIQEKSAV  1996
             IKRAICR+K+RR+ LYNRHK+QEK++R K+ A ++EE  + + +  T  QP  ++E+ A 
Sbjct  586   IKRAICRSKERRRALYNRHKDQEKIKRKKLLAPRQEEDVQFDPSPITSQQP--MRERLAT  643

Query  1997  DARDHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKG--TGNSTDRHITTD  2170
             D+  H  T+ NK +S+T       R+  PS  G     PK E+ KG  +G+  D      
Sbjct  644   DSSSHTHTSVNKTVSNTIT---AARVHNPSENG-----PKQERAKGSSSGSLDDVKGADG  695

Query  2171  ALTKKKMKRKPEPELGEGQYLPEK-LSSKQAEYKPQEPIAAAPV-PKPSIQLNEPPSFEE  2344
              L KKK+KRKP+  L    + PEK  +S Q E KP+    +A V PK ++Q    P  E+
Sbjct  696   VLIKKKVKRKPDQGLEGTHFRPEKSAASLQGEEKPRSLKQSAGVPPKSNLQPTSLPGLEQ  755



>ref|XP_006593820.1| PREDICTED: uncharacterized protein LOC100795185 isoform X3 [Glycine 
max]
Length=752

 Score =   518 bits (1334),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 348/750 (46%), Positives = 456/750 (61%), Gaps = 80/750 (11%)
 Frame = +2

Query  251   GGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHN  430
             G RQ FTVELRPGETTIVSWKKL+K+A  + +    AP                  P  N
Sbjct  29    GDRQMFTVELRPGETTIVSWKKLMKDANKVNNGSASAPEHRA--------------PNAN  74

Query  431   DSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydte  610
              +     +P QP+E E + AP  NR +AVIEKIERLY+GK S D+ED  DVPD+     +
Sbjct  75    PALESRIAPGQPMEIEEQGAPQTNRFSAVIEKIERLYMGKDSSDEEDALDVPDDQYDTDD  134

Query  611   dSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKCQSG  787
              SFIDD ELD+YF+VDNS+IKHDGFFVNRGKLERI EP     Q   KRR+KD  K    
Sbjct  135   -SFIDDAELDEYFEVDNSSIKHDGFFVNRGKLERINEPPVLPIQQAKKRRRKDVPKNPGE  193

Query  788   SDDGCNPNKPAKVGKK-AGKSVPL-AAGTSSPSYGVVMPTLYRENANVHNQ---------  934
               D    NK  KVGK  AGK+  L    T S S+ + +P  + E+    NQ         
Sbjct  194   HIDSHVSNKHVKVGKTAAGKTASLPVKNTISSSHNLGVPGEHYEDMTFQNQLDVSGISLK  253

Query  935   -------------------------EVNFDMQKAEVLHSKNVVDKLKESS---ETSNQRS  1030
                                        + + QK  VL SKN  DK K++S   +TS Q+ 
Sbjct  254   RKTADTRPMLDPPVCSKVSTNAPAAAEDAEKQKTRVLQSKNTSDKYKDASGLLDTSRQKY  313

Query  1031  NERISVPQEKSSGRSANIS-NGLDQSFQQGEKSVIYD-----QRLDASAPEGKRSTQTVR  1192
             +E+ +  + KS     +IS + L+++ +  +K+ I++       +  SA +  +S   ++
Sbjct  314   HEKSASAKSKSQPGKISISVDNLEKAGRSKDKNDIHELPDLNLYVGKSAIQAPKSENVLK  373

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVA  1372
             +DGSS R K T LEKAIR+LEK VAESRPP  E Q+ D + Q +KRRLP EIK KLAKVA
Sbjct  374   KDGSSARPKTTTLEKAIRELEKIVAESRPPTMENQEVDTTPQGVKRRLPREIKLKLAKVA  433

Query  1373  RYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREV  1552
             R AQAS GK+SKEL+NRLMSI+GHL+QLRTLKRNLKIMI+MGLSAKQEKD R Q IK+EV
Sbjct  434   RLAQASQGKVSKELLNRLMSILGHLIQLRTLKRNLKIMISMGLSAKQEKDVRFQLIKKEV  493

Query  1553  AEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVE  1732
              EMIK + P ++SK ++QQ   S + Q +  + K   K+ + MD ALE++ICDLYDL+V+
Sbjct  494   IEMIKMQAPTIESK-LQQQAAASGE-QELGPDGKPITKKNFSMDTALEDKICDLYDLFVD  551

Query  1733  GLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKI  1912
             GL+E++GPQ+RKLYAELA  WPNG+MDNHGIKRAICR+K+RR+ LY+RHK+QEK++R K+
Sbjct  552   GLDENSGPQIRKLYAELAELWPNGYMDNHGIKRAICRSKERRRALYSRHKDQEKIKRKKL  611

Query  1913  SAQKEEEGYRVETT--TRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPS  2086
              A + EE  +V+ +  T  QP  ++E+ A D+  H   + NK +S+T       R+  P 
Sbjct  612   LAPRPEENVQVDPSPITLQQP--LRERLATDSSGHPHASVNKTVSNTVT---TARVHNPV  666

Query  2087  PGGTSLDRPKPEKVKG-TGNSTDRHITTDA-LTKKKMKRKPEPELGEGQYLPEKL-SSKQ  2257
              G      PK EK KG +G S D     D  L KKK+KRK E  L    + PEK+ +S Q
Sbjct  667   NG------PKQEKAKGSSGGSLDDVKGADGVLIKKKVKRKLEQGLEGTHFRPEKIGASLQ  720

Query  2258  AEYKPQEPIAAAPV-PKPSIQLNEPPSFEE  2344
              E K +    +A V PK ++Q    P  E+
Sbjct  721   GEEKTRSLKQSAGVPPKSNLQPTSLPGLEQ  750



>gb|KEH35346.1| wound-responsive family protein [Medicago truncatula]
Length=725

 Score =   517 bits (1331),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 346/749 (46%), Positives = 466/749 (62%), Gaps = 79/749 (11%)
 Frame = +2

Query  233   TSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPL  412
             +S+   GGRQ FTVELRPGETTIVSWKKLLK+AT               +++ + + +P 
Sbjct  9     SSFVKKGGRQMFTVELRPGETTIVSWKKLLKDAT-----------KPNGSASTSQQSRP-  56

Query  413   ILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpde  592
                     P PG    QPVE E  D    +R +AVIEKIERLY+G  S DDEDL DVPD+
Sbjct  57    -------EPFPG----QPVEVEENDPAQPHRFSAVIEKIERLYMGNGSSDDEDLPDVPDD  105

Query  593   deydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQ  769
             D+YDTEDSFIDD ELD+YFQVDNS +KHDGFFVNRGKLER  EP    NQ P KRRKKD 
Sbjct  106   DQYDTEDSFIDDAELDEYFQVDNSKVKHDGFFVNRGKLERTDEPPVLPNQQPKKRRKKDT  165

Query  770   TKCQSGSDDGCNPNKPAKVGK-KAGKSVPL-AAGTSSPSYGVVMPTLYRENANVHNQ-EV  940
              K    +++    NK  KVGK ++GK+  + A    + S  + +P  + EN    NQ ++
Sbjct  166   VKNPDENNNVLGSNKHVKVGKVESGKTTSIQAKNVCNSSQNLAVPGEHYENLKPQNQLDI  225

Query  941   NFDMQKAEVLHSKNVVDK---LKESSE-----TSNQR-SNERISVPQEKSSGRSANIS--  1087
                  K +   +K +      LK SS+     TS  + ++++I   Q K++  S + +  
Sbjct  226   YGSSSKKKTADTKPISVSSVSLKTSSDDFPAATSEAKDADKKIGAFQSKNTSGSFDATHQ  285

Query  1088  ----------------------NGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR---  1192
                                   +GL+   +  EK+    Q  D +   GKR+T+  +   
Sbjct  286   KYHEKGAHAQSKSQPVKPSKSIDGLENISRSKEKNGRRHQLPDLNLSVGKRTTKATKSEY  345

Query  1193  ---RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLA  1363
                +DGSSVR K +MLEKA+ +LEK VAESRPP AE  + DN+SQA+KRRLP EIK KLA
Sbjct  346   MHKKDGSSVRPKSSMLEKALGELEKMVAESRPPAAENPEADNTSQAVKRRLPREIKLKLA  405

Query  1364  KVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIK  1543
             KVAR A ASHGK+SKELINRLMSI+GHL+QLRTLKRNLK MI+MGLSAKQ+ D+R Q+IK
Sbjct  406   KVARLA-ASHGKVSKELINRLMSILGHLMQLRTLKRNLKTMISMGLSAKQDDDDRFQRIK  464

Query  1544  REVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDL  1723
             +EV +MIK + P ++SK  +Q+ G S D Q    + K   KR + MD ALE++ICDLYD+
Sbjct  465   KEVVDMIKIQAPTLESKQ-QQKAGASGDVQEFGPDGKPITKRNFSMDAALEDKICDLYDI  523

Query  1724  YVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRR  1903
             +V+GL+E+AGPQ+RKLYAELA  WP G+MDNHGIKR ICRAK+RR+  ++++K+QEK++R
Sbjct  524   FVDGLDENAGPQIRKLYAELAELWPTGYMDNHGIKRGICRAKERRRASHSKNKDQEKIKR  583

Query  1904  NKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVP  2083
              K+ A ++E+  ++++ +       QEK A ++  H ST+TNK +S+T+      R+P P
Sbjct  584   KKLLASRQEDSVQLDSGSISSQQNQQEKLAPESTSHASTSTNKSVSTTST---AVRVPSP  640

Query  2084  SPGGTSLDRPKPEKVKGTGNST-DRHITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQA  2260
             + G       K EK KG+ +S+ D     D +  KK KRKPE EL      PEKL   Q 
Sbjct  641   TNG------VKQEKAKGSSSSSMDDVRVADGVLTKKAKRKPELELEGANCGPEKLVPLQE  694

Query  2261  EYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             E +P+    ++ +P K ++Q   PP  E+
Sbjct  695   EERPRSQKQSSGLPTKSNLQPTSPPGLEQ  723



>ref|XP_008466757.1| PREDICTED: ubinuclein-1-like isoform X2 [Cucumis melo]
Length=762

 Score =   518 bits (1334),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 336/688 (49%), Positives = 429/688 (62%), Gaps = 68/688 (10%)
 Frame = +2

Query  449   FSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedSFIDD  628
               P QP+E E KD    NR NAVIEKIERLY+GK S D+EDL    D+ + +   SFIDD
Sbjct  85    IDPGQPIEDEVKDPTAPNRFNAVIEKIERLYMGKDSSDEEDLIPDDDQYDTED--SFIDD  142

Query  629   TELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNP  808
             TELD+YF+VD+SAIKHDGFFVNRGKLERIEP+ Q NQ   KRR+KD  K    + DG + 
Sbjct  143   TELDEYFEVDDSAIKHDGFFVNRGKLERIEPSGQPNQQLKKRRRKDLEKGHPENHDGRSS  202

Query  809   NKPAKVGKKA-GKSVPLAAGT-SSPSYGVVMPTLYRENANVHNQEV--------------  940
             NK  KVGK   GKS  + A + S+ S  + +   + E+  + N  +              
Sbjct  203   NKHTKVGKTTTGKSALMVAKSFSNLSQNMAITHEHLEDGKLQNPLIPGHSSKKKSGDTKM  262

Query  941   -----------------------NFDMQKAEVLHSKNVVDKLKES---SETSNQRSNERI  1042
                                    + D  K  V   KN   K KES   S++  Q   E++
Sbjct  263   ILDPSPSSKVYNGDISTSVAEAKDADSSKPGVFPPKNPGTKSKESCGPSDSLQQNILEKV  322

Query  1043  S-VPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR------RDG  1201
             +  P +   GR    ++ +D S Q  EK  I  +  D + P  K S QT +      +DG
Sbjct  323   AHAPSKPQPGRPC--TDEIDSSIQMKEKHGIR-ELPDINLPAAKYSMQTAKTPYVHKKDG  379

Query  1202  SSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYA  1381
             SSVR K ++LEKAIR+LEK VAESRPP  E  + DNSSQAIKRRLP EIK KLAKVAR A
Sbjct  380   SSVRPKSSLLEKAIRELEKMVAESRPPLTENPEADNSSQAIKRRLPREIKLKLAKVARLA  439

Query  1382  QASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEM  1561
              AS+GKLSK LINRLMS +GH +QLRTLKRNLKIM+NMG+S KQEKD+R QQIK+EV EM
Sbjct  440   -ASNGKLSKGLINRLMSSLGHFIQLRTLKRNLKIMVNMGISVKQEKDDRFQQIKKEVIEM  498

Query  1562  IKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLE  1741
             IK R   ++SKAIEQQ G   D + + +EEK   ++K+ MD +LE++ICDLYDL+V+GL+
Sbjct  499   IKIRPLSLESKAIEQQGGAPQDIRELVSEEKGVPRKKFAMDPSLEDKICDLYDLFVDGLD  558

Query  1742  EDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQ  1921
             EDAGPQ+RKLYAELA  WPNGFMDNHGIKRAICRAK+RR+ L+ RHK+QEK++R KI   
Sbjct  559   EDAGPQIRKLYAELAELWPNGFMDNHGIKRAICRAKERRRALHGRHKDQEKIKRKKILPP  618

Query  1922  KEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPGGT-  2098
             + +E  R E  T  QP   +E+ A ++   G   T  P++  A++ MV    + SP  + 
Sbjct  619   RVDETVRNEVGTVAQPQYARERLASES---GPQPT--PVTKAASVLMVAAAQLQSPSMSV  673

Query  2099  -SLDRPKPEKVKGTGNST--DRHITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAEYK  2269
              +LDR K EK+K + +S+  D  I   ALTKKK KRK E EL E    PEK S++  + K
Sbjct  674   GNLDRLKSEKMKVSSSSSHEDTRIVDGALTKKKTKRKAEVELEETHNRPEKASTQHGDEK  733

Query  2270  PQ---EPIAAAPVPKPSIQLNEPPSFEE  2344
              +   +P A+ P PKP+IQ   P S E+
Sbjct  734   HKSTNKPTASHP-PKPNIQSAAPSSMEQ  760



>gb|KHG04330.1| Histone promoter control 2 [Gossypium arboreum]
Length=746

 Score =   517 bits (1331),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 356/749 (48%), Positives = 461/749 (62%), Gaps = 85/749 (11%)
 Frame = +2

Query  206   GEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpapras  385
             GEP  G V+     AG RQ FTVELRPGETT VSW+KL+K+A         +   A   +
Sbjct  10    GEPS-GVVAPKVMKAGDRQVFTVELRPGETTYVSWRKLVKDAN---RARGSSAASASVVA  65

Query  386   aaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSddd  565
             A A EL P   P       PG    Q   KE KD P  NR +AVIEKIERLY+GK S D+
Sbjct  66    APAPELPPNAHPNLQSRIAPG----QTAVKEEKDEPAPNRFSAVIEKIERLYMGKDSSDE  121

Query  566   edlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQL  742
             E+LD+ PD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLE+I EP    NQ 
Sbjct  122   EELDETPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLEKINEPPVMPNQQ  181

Query  743   PNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYG---------VVM  895
             P KRR+K+  K  S SDDG   NK AK  K       + AGT+ PS G           +
Sbjct  182   PKKRRRKEAAKPPSESDDGHVSNKHAKAAK-------MVAGTAEPSLGKNNSSSQNFTAV  234

Query  896   PTLYRE-------------------------NANVHNQEVNFDMQ------------KAE  964
                YR+                         +++ + ++ N D              K  
Sbjct  235   DEQYRDGKVLNQLPVSGVSSKKKSSATRLALDSSSYMKDPNSDTSAPLADVKDIENLKMG  294

Query  965   VLHSKNVV-DKLKE---SSETSNQRSNERISVPQEKSS-GRSANISNGLDQSFQQGEKSV  1129
              L SK VV +KLK+   SS+  +Q+ +++  + Q KS  G+ +   + L+QS +  E + 
Sbjct  295   FLQSKGVVSNKLKDATGSSDVLHQKYHDKSDLAQSKSQHGKLSGNVDKLEQSIRLRENNG  354

Query  1130  IYDQRLDASAPEGKRSTQT------VRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAE  1291
             I+ +  D +  +G  +  T      +++DGS++R K ++LEKAIR+LEK VAESRPP+ E
Sbjct  355   IH-ELPDINVSDGIHAMHTAKSPHMLKKDGSTLRPKSSVLEKAIRELEKIVAESRPPSME  413

Query  1292  VQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKR  1471
              Q+ D SSQ IKRRLP EIK KLAKVAR A AS GK+SKEL+NRLMSI+GHL+QLRTLKR
Sbjct  414   NQEADTSSQGIKRRLPREIKLKLAKVARLA-ASQGKVSKELLNRLMSILGHLIQLRTLKR  472

Query  1472  NLKIMINMGLS--AKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIAT  1645
             NLKIMI+MG+S  AKQEKD R QQIK+E  EMIK R+P  ++K +E Q   SDDFQ I +
Sbjct  473   NLKIMISMGVSPTAKQEKDARFQQIKKEAIEMIKTRIPSFETKILEPQARASDDFQEIGS  532

Query  1646  EEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGI  1825
             EE+  F+RK+ MD  +EN+IC+LYDLYV+GL+EDAGPQ+RK Y ELA  WP+G M+NH I
Sbjct  533   EER-TFRRKFNMDAPMENKICELYDLYVDGLDEDAGPQIRKFYVELAQLWPDGMMNNHEI  591

Query  1826  KRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDAR  2005
             K AICRAK+RR+  YNR K+QEKMRR K+     EE  RV++ +  Q   I+E+S  D+ 
Sbjct  592   KHAICRAKERRRARYNRRKDQEKMRREKMLTLGPEESVRVDSVSSAQSQHIRERSGSDS-  650

Query  2006  DHGSTATNKPISSTAAINMVGRIPVPSP-GGTSLDRPKPEKVKGTGNST---DRHITTDA  2173
               G+ A     +ST+       +PV SP   +S DR K +K+KG  +S    +  +   +
Sbjct  651   --GTQALLSTNTSTSHTTAAAAVPVLSPTNDSSFDRVKQDKLKGISSSAMDDEMKVAVAS  708

Query  2174  LTKKKMKRKPEPELGEGQYLPEKLSSKQA  2260
             L KKK+KRKPE +L E    PEKL  +Q 
Sbjct  709   LPKKKVKRKPEMQLDESHMRPEKLPLQQG  737



>ref|XP_006593818.1| PREDICTED: uncharacterized protein LOC100795185 isoform X1 [Glycine 
max]
Length=755

 Score =   517 bits (1331),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 349/753 (46%), Positives = 455/753 (60%), Gaps = 83/753 (11%)
 Frame = +2

Query  251   GGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHN  430
             G RQ FTVELRPGETTIVSWKKL+K+A  + +    AP                  P  N
Sbjct  29    GDRQMFTVELRPGETTIVSWKKLMKDANKVNNGSASAPEHRA--------------PNAN  74

Query  431   DSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydte  610
              +     +P QP+E E + AP  NR +AVIEKIERLY+GK S D+ED  DVPD+     +
Sbjct  75    PALESRIAPGQPMEIEEQGAPQTNRFSAVIEKIERLYMGKDSSDEEDALDVPDDQYDTDD  134

Query  611   dSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKCQSG  787
              SFIDD ELD+YF+VDNS+IKHDGFFVNRGKLERI EP     Q   KRR+KD  K    
Sbjct  135   -SFIDDAELDEYFEVDNSSIKHDGFFVNRGKLERINEPPVLPIQQAKKRRRKDVPKNPGE  193

Query  788   SDDGCNPNKPAKVGKK-AGKSVPL-AAGTSSPSYGVVMPTLYRENANVHNQ---------  934
               D    NK  KVGK  AGK+  L    T S S+ + +P  + E+    NQ         
Sbjct  194   HIDSHVSNKHVKVGKTAAGKTASLPVKNTISSSHNLGVPGEHYEDMTFQNQLDVSGISLK  253

Query  935   -------------------------EVNFDMQKAEVLHSKNVVDKLKESS---ETSNQRS  1030
                                        + + QK  VL SKN  DK K++S   +TS Q+ 
Sbjct  254   RKTADTRPMLDPPVCSKVSTNAPAAAEDAEKQKTRVLQSKNTSDKYKDASGLLDTSRQKY  313

Query  1031  NERISVPQEKSSGRSANIS-NGLDQSFQQGEKSVI--------YDQRLDASAPEGKRSTQ  1183
             +E+ +  + KS     +IS + L+++ +  +K+ I        Y  +    AP  ++S  
Sbjct  314   HEKSASAKSKSQPGKISISVDNLEKAGRSKDKNDIHELPDLNLYVGKSAIQAPLMQKSEN  373

Query  1184  TVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLA  1363
              +++DGSS R K T LEKAIR+LEK VAESRPP  E Q+ D + Q +KRRLP EIK KLA
Sbjct  374   VLKKDGSSARPKTTTLEKAIRELEKIVAESRPPTMENQEVDTTPQGVKRRLPREIKLKLA  433

Query  1364  KVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIK  1543
             KVAR AQAS GK+SKEL+NRLMSI+GHL+QLRTLKRNLKIMI+MGLSAKQEKD R Q IK
Sbjct  434   KVARLAQASQGKVSKELLNRLMSILGHLIQLRTLKRNLKIMISMGLSAKQEKDVRFQLIK  493

Query  1544  REVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDL  1723
             +EV EMIK + P ++SK ++QQ   S + Q +  + K   K+ + MD ALE++ICDLYDL
Sbjct  494   KEVIEMIKMQAPTIESK-LQQQAAASGE-QELGPDGKPITKKNFSMDTALEDKICDLYDL  551

Query  1724  YVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRR  1903
             +V+GL+E++GPQ+RKLYAELA  WPNG+MDNHGIKRAICR+K+RR+ LY+RHK+QEK++R
Sbjct  552   FVDGLDENSGPQIRKLYAELAELWPNGYMDNHGIKRAICRSKERRRALYSRHKDQEKIKR  611

Query  1904  NKISAQKEEEGYRVETT--TRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIP  2077
              K+ A + EE  +V+ +  T  QP  ++E+ A D+  H   + NK +S+T       R+ 
Sbjct  612   KKLLAPRPEENVQVDPSPITLQQP--LRERLATDSSGHPHASVNKTVSNTVT---TARVH  666

Query  2078  VPSPGGTSLDRPKPEKVKG-TGNSTDRHITTDA-LTKKKMKRKPEPELGEGQYLPEKL-S  2248
              P  G      PK EK KG +G S D     D  L KKK+KRK E  L    + PEK+ +
Sbjct  667   NPVNG------PKQEKAKGSSGGSLDDVKGADGVLIKKKVKRKLEQGLEGTHFRPEKIGA  720

Query  2249  SKQAEYKPQEPIAAAPV-PKPSIQLNEPPSFEE  2344
             S Q E K +    +A V PK ++Q    P  E+
Sbjct  721   SLQGEEKTRSLKQSAGVPPKSNLQPTSLPGLEQ  753



>ref|XP_007161456.1| hypothetical protein PHAVU_001G070500g [Phaseolus vulgaris]
 gb|ESW33450.1| hypothetical protein PHAVU_001G070500g [Phaseolus vulgaris]
Length=744

 Score =   516 bits (1329),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 344/763 (45%), Positives = 457/763 (60%), Gaps = 86/763 (11%)
 Frame = +2

Query  188   DEGSSGGEPGV--GRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngnga  361
             D  S GG   +   R  +S+   G RQ FTVELRPGETTIVSWKKL+K+A  + + G   
Sbjct  4     DTASLGGGDSLSAARAPSSFVKKGDRQMFTVELRPGETTIVSWKKLMKDANKVNNKG---  60

Query  362   pgpaprasaaaaELQPLILPPHNDSPGPGF----SPEQPVEKEAKDAPPGNRLNAVIEKI  529
                            P+  P H  +  P      +P QP E E + AP  NR +AVIEKI
Sbjct  61    ---------------PVSAPEHLPNAHPALESRIAPGQPKETEEQGAPQPNRFSAVIEKI  105

Query  530   ERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLE  709
             ERLY+GK S D+EDL D PD+     + SFIDD ELD+YF+VDNSAIKHDGFFVNRGKLE
Sbjct  106   ERLYMGKDSSDEEDLLDAPDDQYDTED-SFIDDAELDEYFEVDNSAIKHDGFFVNRGKLE  164

Query  710   RI-EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPL-AAGTSSPS  880
             RI EP     Q   KRR+KD +K    + DG   NK  KVGK A GK+V L A    S S
Sbjct  165   RINEPPVLPIQQAKKRRRKDISKNPEENIDGHLSNKHVKVGKTAAGKTVSLPAKNMLSSS  224

Query  881   YGVVM--------------------------------PTLYRENANVHNQEVNFDMQKAE  964
             +  V+                                P   + + N        D QK  
Sbjct  225   HNFVVEHYEDKKLQKQLDVSGINLKKKTADTRPMSDPPVCLKVSNNDPTAAEGADKQKTG  284

Query  965   VLHSKNVVDKLKESS---ETSNQRSNERISVPQEKSS-GRSANISNGLDQSFQQGEKSVI  1132
             VL SKN  DK K++S   +TS+ +  E+      KS  G+S+++ N L+ + +  +K+ I
Sbjct  285   VLQSKNTSDKFKDASGLLDTSHHKYYEKNQSAHSKSQPGKSSSLDN-LENTGRSKDKNGI  343

Query  1133  Y---DQRLDAS--APEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQ  1297
             +   D  L     A    +S   +++DGSS R KIT LEKAIRDLEK V ESRPP  E Q
Sbjct  344   HELPDLNLSVGKIAIRAPKSEHVLKKDGSSARPKITALEKAIRDLEKIVTESRPPTMENQ  403

Query  1298  DGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNL  1477
             +GDN+ QA+KRRLP +IK KLAKVAR AQAS GK+SK+LINRLMSI+GHL+QLRTLKRNL
Sbjct  404   EGDNTPQAVKRRLPRDIKLKLAKVARLAQASQGKVSKDLINRLMSILGHLIQLRTLKRNL  463

Query  1478  KIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKE  1657
             KIMI+MGLSAK+EKD+R QQIK+EV EMIK + P M+SK ++QQ G S + + +  + K 
Sbjct  464   KIMISMGLSAKKEKDDRFQQIKKEVVEMIKMQAPSMESK-LQQQAGASGE-EELGPDGKA  521

Query  1658  AFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAI  1837
               KR + MD ALE+RICDLYD++V+GL+E+AGPQ+RKLY ELA  WP G+MDNHGIKRAI
Sbjct  522   ITKRIFSMDTALEDRICDLYDIFVDGLDENAGPQIRKLYYELAELWPTGYMDNHGIKRAI  581

Query  1838  CRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEG-YRVETTTRDQPVQIQEKSAVDARDHG  2014
             CR+K+RR+ L+ +HK++E++++   + +++E   +     T  QP  ++E+ A D+    
Sbjct  582   CRSKERRRALHIKHKDREEIKKKLFAVRQDENAQFDANPITWQQP--MRERLATDSSSLN  639

Query  2015  STATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKG--TGNSTDRHITTDALTKKK  2188
               + NK +S+TAA     R+  PS  G+     K  K KG  +G+  D   T   + +K+
Sbjct  640   HDSVNKALSNTAA----PRVYNPSLNGS-----KQGKAKGSSSGSLNDVRGTDRIVVRKR  690

Query  2189  MKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVPKPSIQ  2317
             +KR PE  L    + PEK +  + E       +A  +PK ++Q
Sbjct  691   VKRMPEQGLEGTHFRPEKTAFSRGEKPMSLKQSAGVLPKSNLQ  733



>ref|XP_004502535.1| PREDICTED: uncharacterized protein LOC101501927 [Cicer arietinum]
Length=720

 Score =   513 bits (1322),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 351/754 (47%), Positives = 458/754 (61%), Gaps = 88/754 (12%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S+S+   G RQ FTVELRPGETTIVSWKKLLK+A                        
Sbjct  6     RASSSFVKKGDRQTFTVELRPGETTIVSWKKLLKDANK----------------------  43

Query  404   QPLILPPHNDSPGPG----FSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSddded  571
                    HN S         +P Q VE E +D    +R +AVIEKIERLY+GK S DDED
Sbjct  44    -------HNGSASTSQHSPIAPGQHVEIEEQDPAQPHRFSAVIEKIERLYMGKDSSDDED  96

Query  572   lddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER-IEPTSQQNQLPN  748
             L DVPD+D+YDTEDSFIDD ELD+YFQVDNS +KHDGFFVNRGKLER  EP    NQ P 
Sbjct  97    LLDVPDDDQYDTEDSFIDDAELDEYFQVDNSTVKHDGFFVNRGKLERNDEPPVLPNQQPR  156

Query  749   KRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPL-AAGTSSPSYGVVMPTLYRENAN  922
             KRR+KD  K    ++D    NK  K GK A GK+  + A    + S  +V+P  + E+  
Sbjct  157   KRRRKDILKNPGQNNDDHGSNKHVKAGKAASGKTASIQAKNMCNSSQNLVIPDEHYEDLK  216

Query  923   VHNQ------------------------------EVNFDMQKAEVLHSKNV----VDKLK  1000
               NQ                              +V   M +A+    K +         
Sbjct  217   PQNQLDIYGISSKKKIADIKPIPVSSVSLKTSSYDVPTAMPEAKDADKKKIGPFQSKSTS  276

Query  1001  ESSETSNQRSNERISVPQEKSS-GRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRS  1177
              S + S+Q+ +E+ +  Q KS  GR +   + L+   +  EK+ +  +  D +   GK S
Sbjct  277   GSFDASHQKYHEKGAYVQSKSQPGRPSRSIDDLENISRSKEKNGMR-ELPDLNVALGKIS  335

Query  1178  TQT---VRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEI  1348
             T++    ++DGSSVR K +MLEKA+R+LEK VAESRPP  E  + DN+SQA+KRRLP EI
Sbjct  336   TKSEYIHKKDGSSVRPKSSMLEKALRELEKMVAESRPPAVENPEADNTSQAVKRRLPREI  395

Query  1349  KQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNR  1528
             K KLAKVAR A ASHGK+SKELINRLMSI+GHL+QLRTLKRNLKIMI+MGLSAKQE+D+R
Sbjct  396   KLKLAKVARLA-ASHGKVSKELINRLMSILGHLMQLRTLKRNLKIMISMGLSAKQEEDDR  454

Query  1529  VQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRIC  1708
              Q+IK+EV +MIK + P ++SK  +Q  G S D Q    + K   KR + MD ALE++IC
Sbjct  455   FQRIKKEVVDMIKMQAPALESKQ-QQTAGASRDVQEFGPDGKAITKRNFSMDAALEDKIC  513

Query  1709  DLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQ  1888
             DLYD++V+GL+E+AGPQ+RKLYAELA  WP G+MDNHGIKR ICRAK+RR+ LYN++K++
Sbjct  514   DLYDIFVDGLDENAGPQIRKLYAELAELWPTGYMDNHGIKRGICRAKERRRALYNKNKDR  573

Query  1889  EKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVG  2068
             EK++R K+ A K+E+G R++  +       QEK A ++  H  T+ NKP S     NM  
Sbjct  574   EKIKRKKLLASKQEDGVRLDAGSIPSQQNPQEKLAPESSSHAFTSMNKPAS-----NMST  628

Query  2069  RIPVPSPGGTSLDRPKPEKVKGTGNST-DRHITTDALTKKKMKRKPEPELGEGQYLPEKL  2245
              + VPSP    ++  K EK KG+ +S+ D     D +  KK+KRKPE EL      PEKL
Sbjct  629   AVRVPSP----MNGVKQEKAKGSSSSSPDDGRVADGVLTKKVKRKPELELEGANCGPEKL  684

Query  2246  SSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
              S Q E + +    ++ +P K ++Q    P  E+
Sbjct  685   DSLQGEERSRSQKQSSGLPTKSNLQPTTLPGLEQ  718



>ref|XP_008466756.1| PREDICTED: ubinuclein-1-like isoform X1 [Cucumis melo]
Length=763

 Score =   513 bits (1322),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 336/689 (49%), Positives = 429/689 (62%), Gaps = 69/689 (10%)
 Frame = +2

Query  449   FSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedSFIDD  628
               P QP+E E KD    NR NAVIEKIERLY+GK S D+EDL    D+ + +   SFIDD
Sbjct  85    IDPGQPIEDEVKDPTAPNRFNAVIEKIERLYMGKDSSDEEDLIPDDDQYDTED--SFIDD  142

Query  629   TELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKCQSGSDDGCN  805
             TELD+YF+VD+SAIKHDGFFVNRGKLERI EP+ Q NQ   KRR+KD  K    + DG +
Sbjct  143   TELDEYFEVDDSAIKHDGFFVNRGKLERISEPSGQPNQQLKKRRRKDLEKGHPENHDGRS  202

Query  806   PNKPAKVGKKA-GKSVPLAAGT-SSPSYGVVMPTLYRENANVHNQEV-------------  940
              NK  KVGK   GKS  + A + S+ S  + +   + E+  + N  +             
Sbjct  203   SNKHTKVGKTTTGKSALMVAKSFSNLSQNMAITHEHLEDGKLQNPLIPGHSSKKKSGDTK  262

Query  941   ------------------------NFDMQKAEVLHSKNVVDKLKES---SETSNQRSNER  1039
                                     + D  K  V   KN   K KES   S++  Q   E+
Sbjct  263   MILDPSPSSKVYNGDISTSVAEAKDADSSKPGVFPPKNPGTKSKESCGPSDSLQQNILEK  322

Query  1040  IS-VPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR------RD  1198
             ++  P +   GR    ++ +D S Q  EK  I  +  D + P  K S QT +      +D
Sbjct  323   VAHAPSKPQPGRPC--TDEIDSSIQMKEKHGIR-ELPDINLPAAKYSMQTAKTPYVHKKD  379

Query  1199  GSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARY  1378
             GSSVR K ++LEKAIR+LEK VAESRPP  E  + DNSSQAIKRRLP EIK KLAKVAR 
Sbjct  380   GSSVRPKSSLLEKAIRELEKMVAESRPPLTENPEADNSSQAIKRRLPREIKLKLAKVARL  439

Query  1379  AQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAE  1558
             A AS+GKLSK LINRLMS +GH +QLRTLKRNLKIM+NMG+S KQEKD+R QQIK+EV E
Sbjct  440   A-ASNGKLSKGLINRLMSSLGHFIQLRTLKRNLKIMVNMGISVKQEKDDRFQQIKKEVIE  498

Query  1559  MIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGL  1738
             MIK R   ++SKAIEQQ G   D + + +EEK   ++K+ MD +LE++ICDLYDL+V+GL
Sbjct  499   MIKIRPLSLESKAIEQQGGAPQDIRELVSEEKGVPRKKFAMDPSLEDKICDLYDLFVDGL  558

Query  1739  EEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISA  1918
             +EDAGPQ+RKLYAELA  WPNGFMDNHGIKRAICRAK+RR+ L+ RHK+QEK++R KI  
Sbjct  559   DEDAGPQIRKLYAELAELWPNGFMDNHGIKRAICRAKERRRALHGRHKDQEKIKRKKILP  618

Query  1919  QKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPGGT  2098
              + +E  R E  T  QP   +E+ A ++   G   T  P++  A++ MV    + SP  +
Sbjct  619   PRVDETVRNEVGTVAQPQYARERLASES---GPQPT--PVTKAASVLMVAAAQLQSPSMS  673

Query  2099  --SLDRPKPEKVKGTGNST--DRHITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAEY  2266
               +LDR K EK+K + +S+  D  I   ALTKKK KRK E EL E    PEK S++  + 
Sbjct  674   VGNLDRLKSEKMKVSSSSSHEDTRIVDGALTKKKTKRKAEVELEETHNRPEKASTQHGDE  733

Query  2267  KPQ---EPIAAAPVPKPSIQLNEPPSFEE  2344
             K +   +P A+ P PKP+IQ   P S E+
Sbjct  734   KHKSTNKPTASHP-PKPNIQSAAPSSMEQ  761



>ref|XP_006386353.1| hypothetical protein POPTR_0002s07900g [Populus trichocarpa]
 gb|ERP64150.1| hypothetical protein POPTR_0002s07900g [Populus trichocarpa]
Length=618

 Score =   506 bits (1304),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 317/604 (52%), Positives = 391/604 (65%), Gaps = 66/604 (11%)
 Frame = +2

Query  227   VSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQ  406
             V+ SY   G RQ FTVELRPGETT VSWKKL+K+A  + +    A    P  +A    L+
Sbjct  21    VTPSYVKLGDRQIFTVELRPGETTFVSWKKLMKDANKVNNRSAPAAPDPPPVNAHP-NLE  79

Query  407   PLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvp  586
               I PP            Q  E E KD PP NR +AVIEKIERLY GK S D+EDL D P
Sbjct  80    SRIAPP------------QVTENEVKDDPPPNRFSAVIEKIERLYTGKDSSDEEDLMDAP  127

Query  587   dedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKK  763
             D+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRG+LERI EP    N+ P KRR+K
Sbjct  128   DDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGELERINEPPVVPNEKPKKRRRK  187

Query  764   DQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSP--SYGVVMPTLYRENANVHNQE  937
             D  K  + SDDG   NK AK+GK A + +    G +S   S  + M +   EN    NQ 
Sbjct  188   DLLKAPNDSDDGHMSNKLAKLGKSAAEKMAPPPGKNSLNLSQNLTMISEQYENVKFQNQS  247

Query  938   --------------------------VNFDMQ------------KAEVLHSKNVVDKLKE  1003
                                       +N D              K   L  KN+  K K+
Sbjct  248   NSPGISSKKKPAETKMKLDPSLSVKVLNGDAYASLEETTDNEKPKTGCLLPKNLTSKPKD  307

Query  1004  SS---ETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIY---DQRLDAS--  1156
             +S   E+SNQ+ +E+ +  Q KS S ++ +  + L+ S +  EK+ +    D  L+ S  
Sbjct  308   ASGFSESSNQKYHEKSAYVQPKSQSAKTVDHCDDLEPSVRLIEKNGVRELPDLNLNISDS  367

Query  1157  --APEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKR  1330
                 +  R++   R+DGSSVR K +MLEKAIR+LEK VAESRPP  E QD D S+QAIKR
Sbjct  368   KIYTQAARTSHVHRKDGSSVRPKSSMLEKAIRELEKMVAESRPPAVENQDTDASAQAIKR  427

Query  1331  RLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             RLP EIK KLAKVAR A AS GKLSKEL+NRLMSI+GHL+QLRTLKRNLKIMIN GLSAK
Sbjct  428   RLPTEIKLKLAKVARLA-ASQGKLSKELLNRLMSILGHLIQLRTLKRNLKIMINTGLSAK  486

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNA  1690
             QEK +R QQIK+EVAEMI  R+P ++S A+ QQ G SDDFQ + ++E+   K+K+ MD  
Sbjct  487   QEKADRFQQIKKEVAEMIMTRIPSVESNALVQQAGASDDFQEMVSDERGGLKKKFSMDAV  546

Query  1691  LENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY  1870
             LE++ICDLYDL+VEGL+ED+GPQVRKLY ELA +WP+G MDNHGIKRAICRAK+RR+ +Y
Sbjct  547   LEDKICDLYDLFVEGLDEDSGPQVRKLYVELAQFWPSGLMDNHGIKRAICRAKERRRVMY  606

Query  1871  NRHK  1882
              R+K
Sbjct  607   IRNK  610



>ref|XP_011027457.1| PREDICTED: uncharacterized protein LOC105127753 isoform X3 [Populus 
euphratica]
Length=618

 Score =   506 bits (1303),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 317/604 (52%), Positives = 391/604 (65%), Gaps = 66/604 (11%)
 Frame = +2

Query  227   VSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQ  406
             V+ SY   G RQ FTVELRPGETT VSWKKL+K+A  + S    A    P  +A    L+
Sbjct  21    VTPSYVKLGDRQIFTVELRPGETTFVSWKKLMKDANKVNSRSAPAAPDPPPVNAHP-NLE  79

Query  407   PLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvp  586
               I PP            Q +E E KD PP NR +AVIEKIERLY GK S D+EDL D P
Sbjct  80    SRIAPP------------QVIENEVKDDPPPNRFSAVIEKIERLYTGKDSSDEEDLMDAP  127

Query  587   dedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKK  763
             D+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRG+LERI EP    N+ P KRR+K
Sbjct  128   DDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGELERINEPPVVPNEKPKKRRRK  187

Query  764   DQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSS--PSYGVVMPTLYRENANVHNQ-  934
             D  K  + SDDG   NK  K+GK A + + L  G +S   S  + M +   EN    NQ 
Sbjct  188   DLLKAPNDSDDGHMSNKLVKLGKSAAEKMALPPGKNSLNISQNLTMISEQYENVKFQNQS  247

Query  935   -----------------------------------EVNFDMQKAE--VLHSKNVVDKLKE  1003
                                                E   D++K +   L  KN+  K K 
Sbjct  248   NSPGISSKKKPAETKMKLDPSLSVKVLNGDAYASLEETKDIEKPKTGCLPPKNLTSKPKN  307

Query  1004  S---SETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIY---DQRLDAS--  1156
             +   SE+SNQ+  E+ +  Q KS S ++ N  + L+ S +  EK+ +    D  L+ S  
Sbjct  308   ASGFSESSNQKYQEKSAYVQPKSQSAKTVNHGDDLEPSVRLKEKNGVRELPDLNLNISDS  367

Query  1157  --APEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKR  1330
                 +  R++   R+DGSSVR K +MLEKAIR+LEK VAESRPP  E Q+ D S+QAIKR
Sbjct  368   KIYTQAARTSHVHRKDGSSVRPKSSMLEKAIRELEKMVAESRPPAVENQETDASAQAIKR  427

Query  1331  RLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             RLP EIK KLAKVAR A AS GKLSKEL+NRLMSI+GHL+QLRTLKRNLKIMIN GLSAK
Sbjct  428   RLPTEIKLKLAKVARLA-ASQGKLSKELLNRLMSILGHLIQLRTLKRNLKIMINTGLSAK  486

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNA  1690
             QEKD+R QQIK+EVAEMI  R+P ++S A+ QQ G SDDFQ + ++E+   K+K+ MD  
Sbjct  487   QEKDDRFQQIKKEVAEMIMTRIPSVESNALVQQAGASDDFQEMVSDERGGLKKKFSMDAV  546

Query  1691  LENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY  1870
             LE++ICDLYDL+VEGL+ED+G QVRKLY ELA  WP+G MDNHGIKRAICRAK+RR+ ++
Sbjct  547   LEDKICDLYDLFVEGLDEDSGQQVRKLYVELAQLWPSGLMDNHGIKRAICRAKERRRVMH  606

Query  1871  NRHK  1882
              R+K
Sbjct  607   IRNK  610



>ref|XP_006593819.1| PREDICTED: uncharacterized protein LOC100795185 isoform X2 [Glycine 
max]
Length=754

 Score =   511 bits (1315),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 348/753 (46%), Positives = 454/753 (60%), Gaps = 84/753 (11%)
 Frame = +2

Query  251   GGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHN  430
             G RQ FTVELRPGETTIVSWKKL+K+A  + +    AP                  P  N
Sbjct  29    GDRQMFTVELRPGETTIVSWKKLMKDANKVNNGSASAPEHRA--------------PNAN  74

Query  431   DSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydte  610
              +     +P QP+E E + AP  NR +AVIEKIERLY+GK S D+ED  DVPD+     +
Sbjct  75    PALESRIAPGQPMEIEEQGAPQTNRFSAVIEKIERLYMGKDSSDEEDALDVPDDQYDTDD  134

Query  611   dSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKCQSG  787
              SFIDD ELD+YF+VDNS+IKHDGFFVNRGKLERI EP     Q   KRR+KD  K    
Sbjct  135   -SFIDDAELDEYFEVDNSSIKHDGFFVNRGKLERINEPPVLPIQQAKKRRRKDVPKNPGE  193

Query  788   SDDGCNPNKPAKVGKK-AGKSVPL-AAGTSSPSYGVVMPTLYRENANVHNQ---------  934
               D    NK  KVGK  AGK+  L    T S S+ + +P  + E+    NQ         
Sbjct  194   HIDSHVSNKHVKVGKTAAGKTASLPVKNTISSSHNLGVPGEHYEDMTFQNQLDVSGISLK  253

Query  935   -------------------------EVNFDMQKAEVLHSKNVVDKLKESS---ETSNQRS  1030
                                        + + QK  VL SKN  DK K++S   +TS Q+ 
Sbjct  254   RKTADTRPMLDPPVCSKVSTNAPAAAEDAEKQKTRVLQSKNTSDKYKDASGLLDTSRQKY  313

Query  1031  NERISVPQEKSSGRSANIS-NGLDQSFQQGEKSVI--------YDQRLDASAPEGKRSTQ  1183
             +E+ +  + KS     +IS + L+++ +  +K+ I        Y  +    AP  ++S  
Sbjct  314   HEKSASAKSKSQPGKISISVDNLEKAGRSKDKNDIHELPDLNLYVGKSAIQAPLMQKSEN  373

Query  1184  TVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLA  1363
              +++DGSS R K T LEKAIR+LEK VAESRPP  E Q+ D + Q +KRRLP EIK KLA
Sbjct  374   VLKKDGSSARPKTTTLEKAIRELEKIVAESRPPTMENQEVDTTPQGVKRRLPREIKLKLA  433

Query  1364  KVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIK  1543
             KVAR A AS GK+SKEL+NRLMSI+GHL+QLRTLKRNLKIMI+MGLSAKQEKD R Q IK
Sbjct  434   KVARLA-ASQGKVSKELLNRLMSILGHLIQLRTLKRNLKIMISMGLSAKQEKDVRFQLIK  492

Query  1544  REVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDL  1723
             +EV EMIK + P ++SK ++QQ   S + Q +  + K   K+ + MD ALE++ICDLYDL
Sbjct  493   KEVIEMIKMQAPTIESK-LQQQAAASGE-QELGPDGKPITKKNFSMDTALEDKICDLYDL  550

Query  1724  YVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRR  1903
             +V+GL+E++GPQ+RKLYAELA  WPNG+MDNHGIKRAICR+K+RR+ LY+RHK+QEK++R
Sbjct  551   FVDGLDENSGPQIRKLYAELAELWPNGYMDNHGIKRAICRSKERRRALYSRHKDQEKIKR  610

Query  1904  NKISAQKEEEGYRVETT--TRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIP  2077
              K+ A + EE  +V+ +  T  QP  ++E+ A D+  H   + NK +S+T       R+ 
Sbjct  611   KKLLAPRPEENVQVDPSPITLQQP--LRERLATDSSGHPHASVNKTVSNTVT---TARVH  665

Query  2078  VPSPGGTSLDRPKPEKVKG-TGNSTDRHITTDA-LTKKKMKRKPEPELGEGQYLPEKL-S  2248
              P  G      PK EK KG +G S D     D  L KKK+KRK E  L    + PEK+ +
Sbjct  666   NPVNG------PKQEKAKGSSGGSLDDVKGADGVLIKKKVKRKLEQGLEGTHFRPEKIGA  719

Query  2249  SKQAEYKPQEPIAAAPV-PKPSIQLNEPPSFEE  2344
             S Q E K +    +A V PK ++Q    P  E+
Sbjct  720   SLQGEEKTRSLKQSAGVPPKSNLQPTSLPGLEQ  752



>ref|XP_011027456.1| PREDICTED: uncharacterized protein LOC105127753 isoform X2 [Populus 
euphratica]
Length=627

 Score =   506 bits (1302),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 317/604 (52%), Positives = 391/604 (65%), Gaps = 66/604 (11%)
 Frame = +2

Query  227   VSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQ  406
             V+ SY   G RQ FTVELRPGETT VSWKKL+K+A  + S    A    P  +A    L+
Sbjct  21    VTPSYVKLGDRQIFTVELRPGETTFVSWKKLMKDANKVNSRSAPAAPDPPPVNAHP-NLE  79

Query  407   PLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvp  586
               I PP            Q +E E KD PP NR +AVIEKIERLY GK S D+EDL D P
Sbjct  80    SRIAPP------------QVIENEVKDDPPPNRFSAVIEKIERLYTGKDSSDEEDLMDAP  127

Query  587   dedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKK  763
             D+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRG+LERI EP    N+ P KRR+K
Sbjct  128   DDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGELERINEPPVVPNEKPKKRRRK  187

Query  764   DQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSS--PSYGVVMPTLYRENANVHNQ-  934
             D  K  + SDDG   NK  K+GK A + + L  G +S   S  + M +   EN    NQ 
Sbjct  188   DLLKAPNDSDDGHMSNKLVKLGKSAAEKMALPPGKNSLNISQNLTMISEQYENVKFQNQS  247

Query  935   -----------------------------------EVNFDMQKAE--VLHSKNVVDKLKE  1003
                                                E   D++K +   L  KN+  K K 
Sbjct  248   NSPGISSKKKPAETKMKLDPSLSVKVLNGDAYASLEETKDIEKPKTGCLPPKNLTSKPKN  307

Query  1004  S---SETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIY---DQRLDAS--  1156
             +   SE+SNQ+  E+ +  Q KS S ++ N  + L+ S +  EK+ +    D  L+ S  
Sbjct  308   ASGFSESSNQKYQEKSAYVQPKSQSAKTVNHGDDLEPSVRLKEKNGVRELPDLNLNISDS  367

Query  1157  --APEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKR  1330
                 +  R++   R+DGSSVR K +MLEKAIR+LEK VAESRPP  E Q+ D S+QAIKR
Sbjct  368   KIYTQAARTSHVHRKDGSSVRPKSSMLEKAIRELEKMVAESRPPAVENQETDASAQAIKR  427

Query  1331  RLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             RLP EIK KLAKVAR A AS GKLSKEL+NRLMSI+GHL+QLRTLKRNLKIMIN GLSAK
Sbjct  428   RLPTEIKLKLAKVARLA-ASQGKLSKELLNRLMSILGHLIQLRTLKRNLKIMINTGLSAK  486

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNA  1690
             QEKD+R QQIK+EVAEMI  R+P ++S A+ QQ G SDDFQ + ++E+   K+K+ MD  
Sbjct  487   QEKDDRFQQIKKEVAEMIMTRIPSVESNALVQQAGASDDFQEMVSDERGGLKKKFSMDAV  546

Query  1691  LENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY  1870
             LE++ICDLYDL+VEGL+ED+G QVRKLY ELA  WP+G MDNHGIKRAICRAK+RR+ ++
Sbjct  547   LEDKICDLYDLFVEGLDEDSGQQVRKLYVELAQLWPSGLMDNHGIKRAICRAKERRRVMH  606

Query  1871  NRHK  1882
              R+K
Sbjct  607   IRNK  610



>ref|XP_006434286.1| hypothetical protein CICLE_v10000343mg [Citrus clementina]
 gb|ESR47526.1| hypothetical protein CICLE_v10000343mg [Citrus clementina]
Length=590

 Score =   495 bits (1275),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 305/591 (52%), Positives = 388/591 (66%), Gaps = 59/591 (10%)
 Frame = +2

Query  734   NQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGV-------  889
             NQ P KRR+KD  K  + +DDG  PNK AK+ K A  KS PL  G + P+  +       
Sbjct  3     NQQPKKRRRKDLPKAHNQNDDGRVPNKHAKLTKAATSKSAPL-VGKNIPTQNLGSKSGAH  61

Query  890   ---VMP--------------------TLYRENANVHNQEVNFDMQKAE--------VLHS  976
                V P                    TL   +  V N + +  + +A+         L S
Sbjct  62    CDEVRPQNQLNASGISPKKKSSDHKTTLDPSSIKVLNGDASVSLAEAKDADRLKTGNLQS  121

Query  977   KNVVDKLKE---SSETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEKSVIYDQR  1144
             K+V +KLK+    S+ S+Q+ +++ +  Q K  SG+     +GL+ S +Q EK+  + + 
Sbjct  122   KSVSNKLKDISGPSDASHQKYHDQNAHIQSKFQSGKLLQNIDGLEPSARQREKNGSH-EL  180

Query  1145  LDASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD  1306
             LD +  EGK   QT       R+DGSSVR K +MLEKAIR+LEK VAESRPP  E Q+ D
Sbjct  181   LDINVSEGKHPLQTTKASHMHRKDGSSVRPKGSMLEKAIRELEKMVAESRPPAIENQEAD  240

Query  1307  NSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIM  1486
             NSSQA+KRRLP EIK KLAKVAR AQAS GK+SKELINRLMSI+GHL+QLRTLKRNLKIM
Sbjct  241   NSSQAVKRRLPREIKLKLAKVARLAQASQGKISKELINRLMSILGHLIQLRTLKRNLKIM  300

Query  1487  INMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFK  1666
             I+MGLSAKQEKDNR QQIK+EV EMIK+RVP ++SKA EQQ G SDDFQ I +EEK   K
Sbjct  301   ISMGLSAKQEKDNRFQQIKKEVVEMIKERVPSLESKAFEQQAGASDDFQEIGSEEKGVLK  360

Query  1667  RKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRA  1846
             RKY MD+ALE++ICDLYDLYV+GL+EDAGPQ+RKLY ELA  WP GFMDNHGIKRAICRA
Sbjct  361   RKYRMDSALEDKICDLYDLYVDGLDEDAGPQIRKLYLELAELWPKGFMDNHGIKRAICRA  420

Query  1847  KDRRKTLYNRHKNQEKMRRNKISAQK-EEEGYRVETTTRDQPVQIQEKSAVDARDHGSTA  2023
             K+R++ LY+RHK+QEK++R K+ A K EEE  RVE ++  Q   ++E+S  D+  H    
Sbjct  421   KERKRELYSRHKDQEKIKRKKMLATKIEEETVRVEASSTTQSQFMKERSVTDSGGHNLAL  480

Query  2024  TNKPISSTAAINMVGRIPVPSP-GGTSLDRPKPEKVKG-TGNSTDRHITTD-ALTKKKMK  2194
              NKPI +TAA     +IP PS    +SLDR K EK+KG T NS D     D A+TKKK+K
Sbjct  481   ANKPICNTAA---AMKIPNPSANAASSLDRLKHEKLKGITINSMDEPKMVDGAITKKKVK  537

Query  2195  RKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             RKPE E+    + PEKL+ +  E + +    +  +P K ++QLN P +FE+
Sbjct  538   RKPEQEVDGTYFHPEKLAGQSNEERHKSHKQSEILPQKLNLQLNSPSNFEQ  588



>gb|EYU23863.1| hypothetical protein MIMGU_mgv1a003415mg [Erythranthe guttata]
Length=586

 Score =   491 bits (1264),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 301/569 (53%), Positives = 370/569 (65%), Gaps = 35/569 (6%)
 Frame = +2

Query  239   YEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLIL  418
             +E++G R RFTVELRPGETTIVSWKKLL+EA   +S    +       +      QP   
Sbjct  22    FESSGDRVRFTVELRPGETTIVSWKKLLREANSSKSRPGTSVSDPSAEAQFQPVSQPARS  81

Query  419   PPHNDSPGPGFSPEQPVEKEAKD--APPG-NRLNAVIEKIERLYVGKQSdddedlddvp-  586
             PP    P    S +Q +E E+KD  A  G NRL+ VIE+IER+Y G  S D+ED+     
Sbjct  82    PPLEAPP----SSKQHLENESKDSQAQAGPNRLSNVIERIERMYAGNGSGDEEDVVLDNV  137

Query  587   -dedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKK  763
              D+DEYDTEDSFIDD ELDDYFQ+DNS+IKHDGFFVNRGKLE IEPT   NQ P KRR++
Sbjct  138   PDDDEYDTEDSFIDDAELDDYFQIDNSSIKHDGFFVNRGKLEGIEPTIPTNQQPKKRRRE  197

Query  764   DQTKCQSGSDDGCNPNKPAKVGKKAGKSVPL---AAGTSSPSYGVVMPTLYRE-------  913
             D TK   GSDDG NPNK  K+G K  K+      +   +SP +   +    +        
Sbjct  198   DLTKGHGGSDDGHNPNKNVKIGNKVRKTSSSQRNSGSQASPMHTAEVSIKNKTAESQTTR  257

Query  914   ------NANVHNQEVNFDMQKAEVLHSKNVVDKLKESS--ETSNQRSNERISVPQEKSSG  1069
                   N +   Q +  D Q++ VL  K+ V KLKE+    TS QRSN + S   +   G
Sbjct  258   NPSGLLNGDAVRQNMATDQQRSVVLSLKSHVSKLKETELQNTSTQRSNNKNSDASKSRFG  317

Query  1070  RSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTV------RRDGSSVRSKITML  1231
             +  N  +GLDQS QQ  K  +  +R D + P    ST +       R++ +SVRSK T L
Sbjct  318   KQKNNVDGLDQSIQQKGKGGLI-ERFDLNVPAMGDSTSSTKAALMQRKEAASVRSKSTTL  376

Query  1232  EKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKE  1411
             EKAIR+LEK V+E RPP+ EV+D DNSSQA+KRRLPP IKQKL KV R AQ S+GK+ KE
Sbjct  377   EKAIRELEKIVSEFRPPSTEVKDPDNSSQAVKRRLPPVIKQKLGKVGRLAQISYGKIPKE  436

Query  1412  LINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKS  1591
             +IN LMSIVGHL+Q+RTLKRNL +  + GLSAKQEKD+ ++++K EVAEM+K R+  +KS
Sbjct  437   VINHLMSIVGHLMQIRTLKRNLNVTSDTGLSAKQEKDDIIKKMKLEVAEMVKLRIVSIKS  496

Query  1592  KAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKL  1771
             K +EQQ   SDDFQ    EEKEA KRKY MD+ LEN+ICDLYDLYVE  E ++GP VR L
Sbjct  497   K-VEQQAANSDDFQEAGPEEKEALKRKYIMDDLLENKICDLYDLYVERSETNSGPSVRSL  555

Query  1772  YAELAAYWPNGFMDNHGIKRAICRAKDRR  1858
             Y EL   WPNG MD  GIKRAI RAKDRR
Sbjct  556   YEELVMLWPNGSMDIDGIKRAIYRAKDRR  584



>ref|XP_011027455.1| PREDICTED: uncharacterized protein LOC105127753 isoform X1 [Populus 
euphratica]
Length=639

 Score =   491 bits (1264),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 303/630 (48%), Positives = 392/630 (62%), Gaps = 59/630 (9%)
 Frame = +2

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKCQSGS  790
             SFIDD ELD+YF+VDNSAIKHDGFFVNRG+LERI EP    N+ P KRR+KD  K  + S
Sbjct  14    SFIDDAELDEYFEVDNSAIKHDGFFVNRGELERINEPPVVPNEKPKKRRRKDLLKAPNDS  73

Query  791   DDGCNPNKPAKVGKKAGKSVPLAAGTSSP--SYGVVMPTLYRENANVHNQ----------  934
             DDG   NK  K+GK A + + L  G +S   S  + M +   EN    NQ          
Sbjct  74    DDGHMSNKLVKLGKSAAEKMALPPGKNSLNISQNLTMISEQYENVKFQNQSNSPGISSKK  133

Query  935   --------------------------EVNFDMQKAEV--LHSKNVVDKLKESS---ETSN  1021
                                       E   D++K +   L  KN+  K K +S   E+SN
Sbjct  134   KPAETKMKLDPSLSVKVLNGDAYASLEETKDIEKPKTGCLPPKNLTSKPKNASGFSESSN  193

Query  1022  QRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIY---DQRLDAS----APEGKRS  1177
             Q+  E+ +  Q KS S ++ N  + L+ S +  EK+ +    D  L+ S      +  R+
Sbjct  194   QKYQEKSAYVQPKSQSAKTVNHGDDLEPSVRLKEKNGVRELPDLNLNISDSKIYTQAART  253

Query  1178  TQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQK  1357
             +   R+DGSSVR K +MLEKAIR+LEK VAESRPP  E Q+ D S+QAIKRRLP EIK K
Sbjct  254   SHVHRKDGSSVRPKSSMLEKAIRELEKMVAESRPPAVENQETDASAQAIKRRLPTEIKLK  313

Query  1358  LAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQ  1537
             LAKVAR A AS GKLSKEL+NRLMSI+GHL+QLRTLKRNLKIMIN GLSAKQEKD+R QQ
Sbjct  314   LAKVARLA-ASQGKLSKELLNRLMSILGHLIQLRTLKRNLKIMINTGLSAKQEKDDRFQQ  372

Query  1538  IKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLY  1717
             IK+EVAEMI  R+P ++S A+ QQ G SDDFQ + ++E+   K+K+ MD  LE++ICDLY
Sbjct  373   IKKEVAEMIMTRIPSVESNALVQQAGASDDFQEMVSDERGGLKKKFSMDAVLEDKICDLY  432

Query  1718  DLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKM  1897
             DL+VEGL+ED+G QVRKLY ELA  WP+G MDNHGIKRAICRAK+RR+ ++ R+K+Q+K+
Sbjct  433   DLFVEGLDEDSGQQVRKLYVELAQLWPSGLMDNHGIKRAICRAKERRRVMHIRNKDQDKI  492

Query  1898  RRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIP  2077
             +  K+   K+EEG R+E+ T  QP  +QE+ A D          KP  ++  I    + P
Sbjct  493   KSKKMLTPKQEEGVRIESGTVAQP-HVQERLATDMVGPVLALARKPAPNS--IAAAAQFP  549

Query  2078  VPSPGGTSLDRPKPEKVKG-TGNSTD-RHITTDALTKKKMKRKPEPELGEGQYLPEKLSS  2251
              PS  G  LD+ K EK KG + NS D   +  D    KK+KRKPE EL       EKL  
Sbjct  550   SPSANGLELDKLKQEKPKGSSSNSMDGAKMGVDGALPKKVKRKPEQELDGTHPRSEKLHP  609

Query  2252  KQAEYKPQEPIAAAPVP-KPSIQLNEPPSF  2338
             + +  + +    A+ +P K ++Q + PPSF
Sbjct  610   RSSGERQKSLKHASGLPQKLNLQSSAPPSF  639



>gb|KDO80486.1| hypothetical protein CISIN_1g003939mg [Citrus sinensis]
Length=590

 Score =   487 bits (1253),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 302/591 (51%), Positives = 385/591 (65%), Gaps = 59/591 (10%)
 Frame = +2

Query  734   NQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGV-------  889
             NQ P KRR+KD  K  + +DDG  PNK AK+ K A  KS PL  G + P+  +       
Sbjct  3     NQQPKKRRRKDLPKAHNQNDDGRVPNKHAKLTKAATSKSAPL-VGKNIPTQNLGSKSGAH  61

Query  890   ---VMP--------------------TLYRENANVHNQEVNFDMQKAE--------VLHS  976
                V P                    TL   +  V N + +  + +A+         L S
Sbjct  62    CDEVRPQNQLNASGISPKKKSSDHKTTLDPSSIKVLNGDASVSLAEAKDADRLKTGNLQS  121

Query  977   KNVVDKLKE---SSETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEKSVIYDQR  1144
             K+V +KLK+    S+ S+Q+ +++ +  Q K  SG+     + L+ S +Q EK+  + + 
Sbjct  122   KSVSNKLKDISGPSDASHQKYHDQNAHIQSKFQSGKLLQNIDDLEPSARQREKNGSH-EL  180

Query  1145  LDASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD  1306
             LD +  EGK   QT       R+DGSSVR K +MLEKAIR+LEK VAESRPP  E Q+ D
Sbjct  181   LDINVSEGKHPLQTTKASHMHRKDGSSVRPKGSMLEKAIRELEKMVAESRPPAIENQEAD  240

Query  1307  NSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIM  1486
             NSSQA+KRRLP EIK KLAKVAR AQAS GK+SKELINRLMSI+GHL+QLRTLKRNLKIM
Sbjct  241   NSSQAVKRRLPREIKLKLAKVARLAQASQGKISKELINRLMSILGHLIQLRTLKRNLKIM  300

Query  1487  INMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFK  1666
             I+MGLSAKQEKDNR QQIK+EV EMIK+RVP ++SKA EQQ G SDDFQ I +EEK   K
Sbjct  301   ISMGLSAKQEKDNRFQQIKKEVVEMIKERVPSLESKAYEQQAGASDDFQEIGSEEKGVLK  360

Query  1667  RKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRA  1846
             RKY MD+ALE++ICDLYDLYV+GL+EDAGPQ+RKLY ELA  WP GFMDNHGIKRAICRA
Sbjct  361   RKYRMDSALEDKICDLYDLYVDGLDEDAGPQIRKLYLELAELWPKGFMDNHGIKRAICRA  420

Query  1847  KDRRKTLYNRHKNQEKMRRNKISAQK-EEEGYRVETTTRDQPVQIQEKSAVDARDHGSTA  2023
             K+R++ LY+RHK+QEK++R K+ A K EEE  RVE ++  Q   ++E+   D+  H    
Sbjct  421   KERKRELYSRHKDQEKIKRKKMLATKIEEETVRVEASSTTQSQFMKERLVTDSGGHNLAL  480

Query  2024  TNKPISSTAAINMVGRIPVPSP-GGTSLDRPKPEKVKG-TGNSTDRHITTD-ALTKKKMK  2194
              NKPI +T A     +IP PS    +SLDR K EK+KG T NS D     D A+TKKK+K
Sbjct  481   ANKPICNTTA---AMKIPNPSANAASSLDRLKHEKLKGITINSMDEPKMVDGAITKKKVK  537

Query  2195  RKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             RKPE E+    + PEKL+ +  E + +    +  +P K ++QLN P +FE+
Sbjct  538   RKPEQEVDGTYFHPEKLAGQSNEERHKSHKQSEILPQKLNLQLNTPSNFEQ  588



>ref|XP_006596225.1| PREDICTED: uncharacterized protein LOC100799794 isoform X4 [Glycine 
max]
Length=684

 Score =   485 bits (1249),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 323/684 (47%), Positives = 425/684 (62%), Gaps = 69/684 (10%)
 Frame = +2

Query  461   QPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELD  640
             QP E E + AP  NR +AVIEKIERLY+GK S D+ED  DVPD+     + SFIDD ELD
Sbjct  12    QPKEIEEEGAPQTNRFSAVIEKIERLYMGKDSSDEEDALDVPDDQYDTED-SFIDDAELD  70

Query  641   DYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKP  817
             +YF+VDNSAIKHDGFFVNRGKLERI EP     Q   KRR+KD  K    + D    NK 
Sbjct  71    EYFEVDNSAIKHDGFFVNRGKLERINEPPVLPIQQAKKRRRKDIPKNPGENIDSHVSNKH  130

Query  818   AKVGKKA-GKSVPL-AAGTSSPSYGVVMPTLYRENANVHNQ-------------------  934
              KVGK A GK+  L    T S S+ + +P  + E+    NQ                   
Sbjct  131   VKVGKTATGKTASLPVKNTISSSHNLGVPGEHYEDMKFRNQLDVSGISSKRKTTDTRPMS  190

Query  935   ----------------EVNFDMQKAEVLHSKNVVDKLKESS---ETSNQRSNERISVPQE  1057
                               + + +K  VL SKN  DK K++S   +TS+Q+ +E+ +    
Sbjct  191   DPPVCSKVSTDDAPAAAEDAEKKKTRVLQSKNTSDKYKDASGLLDTSHQKYHEKSASAHS  250

Query  1058  KSS-GRSANISNGLDQSFQQGEKSVIY---DQRLDAS-----APEGKRSTQTVRRDGSSV  1210
             KS  G++++  + L+++ +  +K+ I    D  L        AP  ++S   +++DGS+ 
Sbjct  251   KSHSGKTSSSVDNLEKTGRLKDKNGIRELPDLNLSVGKSAIQAPLMQKSENVLKKDGSTA  310

Query  1211  RSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQAS  1390
             R KIT LEKAIR+LEK VAESRPP  E Q+ D + Q +KRRLP EIK KLAKVAR AQAS
Sbjct  311   RPKITTLEKAIRELEKIVAESRPPTMENQEPDTTPQGVKRRLPREIKLKLAKVARLAQAS  370

Query  1391  HGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKD  1570
              GK+SKEL+NRLMSI+GHL+QLRTLKRNLKIMI+MGLSAKQEKD R QQ K EV EMIK 
Sbjct  371   QGKVSKELLNRLMSILGHLIQLRTLKRNLKIMISMGLSAKQEKDVRFQQKKNEVIEMIKM  430

Query  1571  RVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDA  1750
             + P M+SK +++Q G S + Q +  + K    R + MD ALE++ICDLYDL+V+GL+E+A
Sbjct  431   QAPTMESK-LQKQAGVSGE-QELGPDGKPITTRNFSMDTALEDKICDLYDLFVDGLDENA  488

Query  1751  GPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEE  1930
             GPQ+RKLYAELA  WPNG+MDNHGIKRAICR+K+RR+ LYNRHK+QEK++R K+ A ++E
Sbjct  489   GPQIRKLYAELAELWPNGYMDNHGIKRAICRSKERRRALYNRHKDQEKIKRKKLLAPRQE  548

Query  1931  EGYRVETT--TRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPGGTSL  2104
             E  + + +  T  QP  ++E+ A D+  H  T+ NK +S+T       R+  PS  G   
Sbjct  549   EDVQFDPSPITSQQP--MRERLATDSSSHTHTSVNKTVSNTIT---AARVHNPSENG---  600

Query  2105  DRPKPEKVKG--TGNSTDRHITTDALTKKKMKRKPEPELGEGQYLPEK-LSSKQAEYKPQ  2275
               PK E+ KG  +G+  D       L KKK+KRKP+  L    + PEK  +S Q E KP+
Sbjct  601   --PKQERAKGSSSGSLDDVKGADGVLIKKKVKRKPDQGLEGTHFRPEKSAASLQGEEKPR  658

Query  2276  EPIAAAPV-PKPSIQLNEPPSFEE  2344
                 +A V PK ++Q    P  E+
Sbjct  659   SLKQSAGVPPKSNLQPTSLPGLEQ  682



>ref|XP_010087179.1| hypothetical protein L484_003819 [Morus notabilis]
 gb|EXB28436.1| hypothetical protein L484_003819 [Morus notabilis]
Length=588

 Score =   474 bits (1221),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 292/598 (49%), Positives = 381/598 (64%), Gaps = 66/598 (11%)
 Frame = +2

Query  710   RIEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSV--PLAAGTSSPSY  883
             R E T   NQ P KRR+KD  K    ++D   PNK  K+GK +   +    A   S+ + 
Sbjct  2     RSETTVLPNQQPKKRRRKDLAKGNGENNDDRLPNKHTKLGKTSAAKITSAFAKNLSTSTE  61

Query  884   GVVMPTLYRENANVHNQ------------------------------------EV-NFDM  952
              V +   + E+    NQ                                    EV + D 
Sbjct  62    TVAVSGEHSEDLKFENQLNASTFFPKKKSSESKTALDPSFLKVSNGDTSVALAEVKDIDK  121

Query  953   QKAEVLHSKNVVDKLKE---SSETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGE  1120
             QKA    SK+   K K+   SS+  +Q+ +++ +  Q +  SG+     + LD S +  E
Sbjct  122   QKA----SKDPSSKFKDVAVSSDALHQKYHDKSAYAQSRPQSGKLLGSVDELDSSVRLKE  177

Query  1121  KSVIYDQRLDASAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPP  1282
             K+ I +Q  D +A EGK ST + +      +DGSS+R K +MLEKAIR+LEK VAESRPP
Sbjct  178   KNGIREQP-DVNAFEGKYSTTSTKTSHMHKKDGSSIRPKSSMLEKAIRELEKMVAESRPP  236

Query  1283  NAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRT  1462
               E Q+ DNSSQ IKRRLP EIK KLAKVAR A ASHGK+SKEL+ RLMSI+GHL+QLRT
Sbjct  237   AVESQEVDNSSQTIKRRLPREIKMKLAKVARLA-ASHGKVSKELLARLMSILGHLIQLRT  295

Query  1463  LKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIA  1642
             LKRNLKIMIN GLSAKQEKD+R QQIK+EV +MIK R P M+ KA+E Q G SD+FQ IA
Sbjct  296   LKRNLKIMINTGLSAKQEKDDRFQQIKKEVIDMIKTRAPSMELKALELQAGASDNFQEIA  355

Query  1643  TEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHG  1822
             T EKEA KRK+ MD ALE++ICDLYDLYV+GL+EDAGPQ+RKLYAELA  WPNGFMDNHG
Sbjct  356   TGEKEASKRKFSMDAALEDKICDLYDLYVDGLDEDAGPQIRKLYAELAELWPNGFMDNHG  415

Query  1823  IKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDA  2002
             IKRAICR K+RR+ LY+R+K QEK++R K+ A + EEG RVE ++  Q   ++E+   ++
Sbjct  416   IKRAICRTKERRRALYSRNKEQEKIKRKKMLALRLEEGIRVEASSMMQAQYMRERLVTES  475

Query  2003  RDHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNST--DRHITTDAL  2176
               HG+   NKP+S+T A     R+P P     S D+PK EK+KG+ +++  D  +    L
Sbjct  476   SSHGT--ANKPVSATTA---AARMPSP-LNVPSFDKPKQEKLKGSSSNSLDDARVGDGTL  529

Query  2177  TKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIA-AAPVP-KPSIQLNEPPSFEE  2344
             TKKK+KRKPE E  E ++ PEKL+S+Q E + Q+P+  AA +P KP++Q    PS E+
Sbjct  530   TKKKVKRKPETESDETRFRPEKLTSQQGEER-QKPLKQAASLPHKPNLQSTVLPSVEQ  586



>ref|XP_006593821.1| PREDICTED: uncharacterized protein LOC100795185 isoform X4 [Glycine 
max]
Length=740

 Score =   479 bits (1232),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 335/753 (44%), Positives = 440/753 (58%), Gaps = 98/753 (13%)
 Frame = +2

Query  251   GGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHN  430
             G RQ FTVELRPGETTIVSWKKL+K+A  + +    AP                  P  N
Sbjct  29    GDRQMFTVELRPGETTIVSWKKLMKDANKVNNGSASAPEHRA--------------PNAN  74

Query  431   DSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydte  610
              +     +P QP+E E + AP  NR +AVIEKIERLY+GK S D+ED  DVPD+     +
Sbjct  75    PALESRIAPGQPMEIEEQGAPQTNRFSAVIEKIERLYMGKDSSDEEDALDVPDDQYDTDD  134

Query  611   dSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKCQSG  787
              SFIDD ELD+YF+VDNS+IKHDGFFVNRGKLERI EP     Q   KRR+KD  K    
Sbjct  135   -SFIDDAELDEYFEVDNSSIKHDGFFVNRGKLERINEPPVLPIQQAKKRRRKDVPKNPGE  193

Query  788   SDDGCNPNKPAKVGKK-AGKSVPL-AAGTSSPSYGVVMPTLYRENANVHNQ---------  934
               D    NK  KVGK  AGK+  L    T S S+ + +P  + E+    NQ         
Sbjct  194   HIDSHVSNKHVKVGKTAAGKTASLPVKNTISSSHNLGVPGEHYEDMTFQNQLDVSGISLK  253

Query  935   -------------------------EVNFDMQKAEVLHSKNVVDKLKESS---ETSNQRS  1030
                                        + + QK  VL SKN  DK K++S   +TS Q+ 
Sbjct  254   RKTADTRPMLDPPVCSKVSTNAPAAAEDAEKQKTRVLQSKNTSDKYKDASGLLDTSRQKY  313

Query  1031  NERISVPQEKSSGRSANIS-NGLDQSFQQGEKSVI--------YDQRLDASAPEGKRSTQ  1183
             +E+ +  + KS     +IS + L+++ +  +K+ I        Y  +    AP  ++S  
Sbjct  314   HEKSASAKSKSQPGKISISVDNLEKAGRSKDKNDIHELPDLNLYVGKSAIQAPLMQKSEN  373

Query  1184  TVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLA  1363
              +++DGSS R K T LEKAIR+LEK VAESRPP  E Q+ D + Q +KRRLP EIK KLA
Sbjct  374   VLKKDGSSARPKTTTLEKAIRELEKIVAESRPPTMENQEVDTTPQGVKRRLPREIKLKLA  433

Query  1364  KVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIK  1543
             KVAR AQAS GK+SKEL+NRLMSI+GHL+QLRTLK               EKD R Q IK
Sbjct  434   KVARLAQASQGKVSKELLNRLMSILGHLIQLRTLK---------------EKDVRFQLIK  478

Query  1544  REVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDL  1723
             +EV EMIK + P ++SK ++QQ   S + Q +  + K   K+ + MD ALE++ICDLYDL
Sbjct  479   KEVIEMIKMQAPTIESK-LQQQAAASGE-QELGPDGKPITKKNFSMDTALEDKICDLYDL  536

Query  1724  YVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRR  1903
             +V+GL+E++GPQ+RKLYAELA  WPNG+MDNHGIKRAICR+K+RR+ LY+RHK+QEK++R
Sbjct  537   FVDGLDENSGPQIRKLYAELAELWPNGYMDNHGIKRAICRSKERRRALYSRHKDQEKIKR  596

Query  1904  NKISAQKEEEGYRVETT--TRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIP  2077
              K+ A + EE  +V+ +  T  QP  ++E+ A D+  H   + NK +S+T       R+ 
Sbjct  597   KKLLAPRPEENVQVDPSPITLQQP--LRERLATDSSGHPHASVNKTVSNTVT---TARVH  651

Query  2078  VPSPGGTSLDRPKPEKVKG-TGNSTDRHITTDA-LTKKKMKRKPEPELGEGQYLPEKL-S  2248
              P  G      PK EK KG +G S D     D  L KKK+KRK E  L    + PEK+ +
Sbjct  652   NPVNG------PKQEKAKGSSGGSLDDVKGADGVLIKKKVKRKLEQGLEGTHFRPEKIGA  705

Query  2249  SKQAEYKPQEPIAAAPV-PKPSIQLNEPPSFEE  2344
             S Q E K +    +A V PK ++Q    P  E+
Sbjct  706   SLQGEEKTRSLKQSAGVPPKSNLQPTSLPGLEQ  738



>ref|XP_008466759.1| PREDICTED: uncharacterized protein LOC103504093 isoform X4 [Cucumis 
melo]
Length=650

 Score =   470 bits (1210),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 300/625 (48%), Positives = 387/625 (62%), Gaps = 66/625 (11%)
 Frame = +2

Query  638   DDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKP  817
             D+YF+VD+SAIKHDGFFVNRGKLERIEP+ Q NQ   KRR+KD  K    + DG + NK 
Sbjct  34    DEYFEVDDSAIKHDGFFVNRGKLERIEPSGQPNQQLKKRRRKDLEKGHPENHDGRSSNKH  93

Query  818   AKVGKKA-GKSVPLAAGT-SSPSYGVVMPTLYRENANVHNQEV-----------------  940
              KVGK   GKS  + A + S+ S  + +   + E+  + N  +                 
Sbjct  94    TKVGKTTTGKSALMVAKSFSNLSQNMAITHEHLEDGKLQNPLIPGHSSKKKSGDTKMILD  153

Query  941   --------------------NFDMQKAEVLHSKNVVDKLKES---SETSNQRSNERIS-V  1048
                                 + D  K  V   KN   K KES   S++  Q   E+++  
Sbjct  154   PSPSSKVYNGDISTSVAEAKDADSSKPGVFPPKNPGTKSKESCGPSDSLQQNILEKVAHA  213

Query  1049  PQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR------RDGSSV  1210
             P +   GR    ++ +D S Q  EK  I +   D + P  K S QT +      +DGSSV
Sbjct  214   PSKPQPGRPC--TDEIDSSIQMKEKHGIRELP-DINLPAAKYSMQTAKTPYVHKKDGSSV  270

Query  1211  RSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQAS  1390
             R K ++LEKAIR+LEK VAESRPP  E  + DNSSQAIKRRLP EIK KLAKVAR A AS
Sbjct  271   RPKSSLLEKAIRELEKMVAESRPPLTENPEADNSSQAIKRRLPREIKLKLAKVARLA-AS  329

Query  1391  HGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKD  1570
             +GKLSK LINRLMS +GH +QLRTLKRNLKIM+NMG+S KQEKD+R QQIK+EV EMIK 
Sbjct  330   NGKLSKGLINRLMSSLGHFIQLRTLKRNLKIMVNMGISVKQEKDDRFQQIKKEVIEMIKI  389

Query  1571  RVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDA  1750
             R   ++SKAIEQQ G   D + + +EEK   ++K+ MD +LE++ICDLYDL+V+GL+EDA
Sbjct  390   RPLSLESKAIEQQGGAPQDIRELVSEEKGVPRKKFAMDPSLEDKICDLYDLFVDGLDEDA  449

Query  1751  GPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEE  1930
             GPQ+RKLYAELA  WPNGFMDNHGIKRAICRAK+RR+ L+ RHK+QEK++R KI   + +
Sbjct  450   GPQIRKLYAELAELWPNGFMDNHGIKRAICRAKERRRALHGRHKDQEKIKRKKILPPRVD  509

Query  1931  EGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPGGT--SL  2104
             E  R E  T  QP   +E+ A ++   G   T  P++  A++ MV    + SP  +  +L
Sbjct  510   ETVRNEVGTVAQPQYARERLASES---GPQPT--PVTKAASVLMVAAAQLQSPSMSVGNL  564

Query  2105  DRPKPEKVKGTGNST--DRHITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQ-  2275
             DR K EK+K + +S+  D  I   ALTKKK KRK E EL E    PEK S++  + K + 
Sbjct  565   DRLKSEKMKVSSSSSHEDTRIVDGALTKKKTKRKAEVELEETHNRPEKASTQHGDEKHKS  624

Query  2276  --EPIAAAPVPKPSIQLNEPPSFEE  2344
               +P A+ P PKP+IQ   P S E+
Sbjct  625   TNKPTASHP-PKPNIQSAAPSSMEQ  648



>gb|KEH40497.1| wound-responsive family protein [Medicago truncatula]
Length=823

 Score =   475 bits (1223),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 350/834 (42%), Positives = 465/834 (56%), Gaps = 139/834 (17%)
 Frame = +2

Query  194   GSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpa  373
              ++GG+    R  +++   G R RFTVELR GETTIVSWKKLLK+A  +    + A    
Sbjct  10    AAAGGDSS--RPPSTFVKIGDRTRFTVELREGETTIVSWKKLLKDANKVNDGSSSAAIEQ  67

Query  374   prasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQ  553
                           +P  N +        Q   KE +DAP  NR +AVIEKIERLY+G  
Sbjct  68    --------------VPKANHALEARIGSGQTENKE-EDAPQTNRFSAVIEKIERLYMGND  112

Query  554   SdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQ  730
             S D+EDL  VPD+     + SFIDD ELD+YF+VDNSAIKHDGFFVNRGKLER+ EP++ 
Sbjct  113   SSDEEDLPVVPDDQYDTED-SFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERLNEPSAL  171

Query  731   QNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPL-AAGTSSPSYGVVMP--  898
              NQ   K+R+KD +K    + DG  PNK  KVGK A GK+  L    T   S  + +P  
Sbjct  172   PNQPEKKKRRKDISKNPGENVDGHVPNKRVKVGKTAAGKTASLPVKNTVDSSQNLAVPGE  231

Query  899   ----------------TLYRENANVH------------NQEV------------------  940
                             TL ++ A+              N +V                  
Sbjct  232   HDEDLKSQNQFEISGITLKKKTADTRPISDPSLCLKASNNDVPSVVVCLKASDNDVPSVV  291

Query  941   ---NFDMQKAEVLHSKNVVDKLKESS---ETSNQRSNERISVPQEKSS-GRSANISNGLD  1099
                + D QK  VL SK  VDK K++S   +T++Q+  E+      K   GR+ + ++ L+
Sbjct  292   EAKDADKQKTGVLQSKTRVDKNKDASGVHDTADQKYQEKSVYAHSKPQPGRTPSRADCLE  351

Query  1100  QSFQQGEKSVIYDQRLDASAPEGK------RSTQTVRRDGSSVRSKITMLEKAIRDLEKF  1261
              +    +K+ I D+  D +  EGK      +S   +++D S++R K T+LEKA++DLEK 
Sbjct  352   NTGGSTDKNGI-DELPDLNLSEGKSVMQAPKSKNMLKKDCSALRPKSTILEKAVQDLEKT  410

Query  1262  VAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVG  1441
             VAESRPP  E Q+ D++SQAIKRRLP EIK KLAKVAR A AS GK+S+ELINRLMSI+G
Sbjct  411   VAESRPPIMEKQEVDSTSQAIKRRLPREIKLKLAKVARLA-ASQGKVSQELINRLMSILG  469

Query  1442  HLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTS  1621
             HL+QLRTLKRNLKIMINMGLSAK+EKD+R QQ K+EV EMIK + P + S+   QQ G S
Sbjct  470   HLIQLRTLKRNLKIMINMGLSAKKEKDDRFQQKKKEVIEMIKMQAPSIDSEQ-RQQAGVS  528

Query  1622  DDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPN  1801
              D Q + ++ K   KR + MD ALE++ICDLYDL+V+GL+E AGP +RKLYAELAA WPN
Sbjct  529   GD-QELGSDGKAISKRNFSMDTALEDKICDLYDLFVDGLDETAGPIIRKLYAELAALWPN  587

Query  1802  GFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTR-------  1960
             G MDNHGIK AI RAK+RR+ L+NR+K+QEK++R K+ A + EE   ++T+++       
Sbjct  588   GCMDNHGIKGAIVRAKERRRALHNRNKDQEKIKRKKLLAPRREENVELDTSSQQKMRERL  647

Query  1961  --DQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPG--------------  2092
               +  +Q     AV          + P++ T      GR   P  G              
Sbjct  648   APESSIQTSLNKAVSKTVTDVRVLSPPVNVTKTEKAKGRSSSPVNGPNKEKAKGRSSSPV  707

Query  2093  ---------GTS-----------------LDRPKPEKVKGTGNST--DRHITTDALTKKK  2188
                      G+S                 +  PK EK KG+ + +  D  +    LTKK 
Sbjct  708   NGSNKEKAKGSSNPVNGPNKEKTKGSSNPVSGPKKEKAKGSSSCSPDDARVKDGVLTKKV  767

Query  2189  M-KRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVP-KPSIQLNEPPSFEE  2344
             M KRK E EL      P+KL+S + E +PQ    +A VP K +IQ    P  E+
Sbjct  768   MKKRKTESELEGTHCRPQKLASLKVEDRPQSVKQSAVVPSKSNIQSTSLPGVEQ  821



>ref|XP_010677635.1| PREDICTED: ubinuclein-2 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=773

 Score =   473 bits (1217),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 343/789 (43%), Positives = 449/789 (57%), Gaps = 94/789 (12%)
 Frame = +2

Query  191   EGSSGGEPGVGRVSTS---YEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQ--sngn  355
             EG   GEP       +   +   G R RFTVELRPGETTIVSWKKL+K+A   +  +  +
Sbjct  3     EGVISGEPSSSGSRGTTSSFVKIGDRMRFTVELRPGETTIVSWKKLMKDAAKAEGVARSS  62

Query  356   gapgpaprasaaaaELQPLILPPHNDSPGPGF----SPEQPVEKEAKDAPPGNRLNAVIE  523
              A      A+AA A +     P    S  P      +P Q    E  DAP  NR NAVIE
Sbjct  63    AAVASVDVAAAAGATVAAAAAPQPPSSAHPALESRLAPGQSAGNELNDAPAPNRFNAVIE  122

Query  524   KIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGK  703
             KIERLY GK S D+EDLDD+PD+D+YDTEDSFIDD ELD+YF+VD S  KHDG+FVNRG 
Sbjct  123   KIERLYTGKNSSDEEDLDDIPDDDQYDTEDSFIDDAELDEYFEVDKSKTKHDGYFVNRGM  182

Query  704   LERIEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKK-AGKSVPLAAG----T  868
             LE++EP    NQ P KRR+K+  K     +D     K  KV KK AGKS     G    +
Sbjct  183   LEKVEPLEAANQQPKKRRRKEVPKAPGDDNDDQRAIKHMKVRKKGAGKSASADKGALPTS  242

Query  869   SSPSY------------------------GVVMPTLYRENANVHNQEVNFDMQKAEVLHS  976
              SPS                            + T   + ++   + +N D QK  +  +
Sbjct  243   QSPSLKSSEDLKSQNHQKIIADSRPSLDPSPSLKTSLGDTSSALAENIN-DKQKTGIFLA  301

Query  977   KNVVDKLKESSETSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDAS  1156
             K+   KLKE+SE   +           K+     N S  L+   Q  + S +  +++D +
Sbjct  302   KSPSSKLKEASENGAKLEY------MHKTQSLKPNHSKELESVAQHKDNSGMR-EKIDLN  354

Query  1157  APEGKRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQ  1318
              P+ K++ Q V+      +DGS+ + K   LEK+IR+LEK VAESRPP     D D+S Q
Sbjct  355   LPDTKQTIQPVKNSALHKKDGSNAKPKANSLEKSIRELEKMVAESRPP---APDADSSGQ  411

Query  1319  AIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMG  1498
             +IKRRLP EIKQKLAKVAR + AS+GK+ KEL+ RLM I+GH VQLRTLKR+LKIM+   
Sbjct  412   SIKRRLPREIKQKLAKVARLSHASNGKVPKELLARLMGILGHFVQLRTLKRHLKIMMTSS  471

Query  1499  LSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYC  1678
             LSAKQEKD++ QQ K+EV EMIK R+P + SKA EQQ G S +FQ     +K A K + C
Sbjct  472   LSAKQEKDDKFQQAKKEVIEMIKMRIPSLMSKAAEQQSGGSGEFQECGHLDK-AVKGQLC  530

Query  1679  MDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRR  1858
             MD  LE++ICDLYD++++GL+EDA PQVRKLYAELA  WP G MDNHGIKRAICRAK+R+
Sbjct  531   MDTTLEDKICDLYDIFIDGLDEDATPQVRKLYAELAELWPKGVMDNHGIKRAICRAKERK  590

Query  1859  KTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPI  2038
             + L  ++K+QEK+RR K+ A   EE  RVE+++  Q       S VDAR      ++  +
Sbjct  591   RALNEKNKDQEKVRRKKVPATNAEETVRVESSSDIQ------SSYVDAR----LVSDPSV  640

Query  2039  SSTAAIN-----------------------MVGRIPVPSPGGTSLDRPKPEKVKGTGNST  2149
             +S A  N                       +   + +PS    +++R KPEK+K T NS+
Sbjct  641   ASVAQQNKFSTMTSTTPATTTTTSTAINTSIASSVSMPSTHLPNIERLKPEKMKVTQNSS  700

Query  2150  DRHI-TTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVPKPSIQLNE  2326
                +   D   KKK+K++ E  +GE    PEKLSS   E K ++    A   +  IQ N 
Sbjct  701   LIDVRIVDMGVKKKVKKRAENLMGELPLRPEKLSSHHVEDKQKQHKHVATAGQ--IQQNA  758

Query  2327  P--PSFEEL  2347
             P   SF E 
Sbjct  759   PHKSSFNEF  767



>ref|XP_008466758.1| PREDICTED: uncharacterized protein LOC103504093 isoform X3 [Cucumis 
melo]
Length=651

 Score =   465 bits (1197),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 300/626 (48%), Positives = 387/626 (62%), Gaps = 67/626 (11%)
 Frame = +2

Query  638   DDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNK  814
             D+YF+VD+SAIKHDGFFVNRGKLERI EP+ Q NQ   KRR+KD  K    + DG + NK
Sbjct  34    DEYFEVDDSAIKHDGFFVNRGKLERISEPSGQPNQQLKKRRRKDLEKGHPENHDGRSSNK  93

Query  815   PAKVGKKA-GKSVPLAAGT-SSPSYGVVMPTLYRENANVHNQEV----------------  940
               KVGK   GKS  + A + S+ S  + +   + E+  + N  +                
Sbjct  94    HTKVGKTTTGKSALMVAKSFSNLSQNMAITHEHLEDGKLQNPLIPGHSSKKKSGDTKMIL  153

Query  941   ---------------------NFDMQKAEVLHSKNVVDKLKES---SETSNQRSNERIS-  1045
                                  + D  K  V   KN   K KES   S++  Q   E+++ 
Sbjct  154   DPSPSSKVYNGDISTSVAEAKDADSSKPGVFPPKNPGTKSKESCGPSDSLQQNILEKVAH  213

Query  1046  VPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR------RDGSS  1207
              P +   GR    ++ +D S Q  EK  I +   D + P  K S QT +      +DGSS
Sbjct  214   APSKPQPGRPC--TDEIDSSIQMKEKHGIRELP-DINLPAAKYSMQTAKTPYVHKKDGSS  270

Query  1208  VRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQA  1387
             VR K ++LEKAIR+LEK VAESRPP  E  + DNSSQAIKRRLP EIK KLAKVAR A A
Sbjct  271   VRPKSSLLEKAIRELEKMVAESRPPLTENPEADNSSQAIKRRLPREIKLKLAKVARLA-A  329

Query  1388  SHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIK  1567
             S+GKLSK LINRLMS +GH +QLRTLKRNLKIM+NMG+S KQEKD+R QQIK+EV EMIK
Sbjct  330   SNGKLSKGLINRLMSSLGHFIQLRTLKRNLKIMVNMGISVKQEKDDRFQQIKKEVIEMIK  389

Query  1568  DRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEED  1747
              R   ++SKAIEQQ G   D + + +EEK   ++K+ MD +LE++ICDLYDL+V+GL+ED
Sbjct  390   IRPLSLESKAIEQQGGAPQDIRELVSEEKGVPRKKFAMDPSLEDKICDLYDLFVDGLDED  449

Query  1748  AGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKE  1927
             AGPQ+RKLYAELA  WPNGFMDNHGIKRAICRAK+RR+ L+ RHK+QEK++R KI   + 
Sbjct  450   AGPQIRKLYAELAELWPNGFMDNHGIKRAICRAKERRRALHGRHKDQEKIKRKKILPPRV  509

Query  1928  EEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPGGT--S  2101
             +E  R E  T  QP   +E+ A ++   G   T  P++  A++ MV    + SP  +  +
Sbjct  510   DETVRNEVGTVAQPQYARERLASES---GPQPT--PVTKAASVLMVAAAQLQSPSMSVGN  564

Query  2102  LDRPKPEKVKGTGNST--DRHITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQ  2275
             LDR K EK+K + +S+  D  I   ALTKKK KRK E EL E    PEK S++  + K +
Sbjct  565   LDRLKSEKMKVSSSSSHEDTRIVDGALTKKKTKRKAEVELEETHNRPEKASTQHGDEKHK  624

Query  2276  ---EPIAAAPVPKPSIQLNEPPSFEE  2344
                +P A+ P PKP+IQ   P S E+
Sbjct  625   STNKPTASHP-PKPNIQSAAPSSMEQ  649



>ref|XP_010677628.1| PREDICTED: ubinuclein-2 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=774

 Score =   468 bits (1205),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 343/790 (43%), Positives = 449/790 (57%), Gaps = 95/790 (12%)
 Frame = +2

Query  191   EGSSGGEPGVGRVSTS---YEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQ--sngn  355
             EG   GEP       +   +   G R RFTVELRPGETTIVSWKKL+K+A   +  +  +
Sbjct  3     EGVISGEPSSSGSRGTTSSFVKIGDRMRFTVELRPGETTIVSWKKLMKDAAKAEGVARSS  62

Query  356   gapgpaprasaaaaELQPLILPPHNDSPGPGF----SPEQPVEKEAKDAPPGNRLNAVIE  523
              A      A+AA A +     P    S  P      +P Q    E  DAP  NR NAVIE
Sbjct  63    AAVASVDVAAAAGATVAAAAAPQPPSSAHPALESRLAPGQSAGNELNDAPAPNRFNAVIE  122

Query  524   KIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGK  703
             KIERLY GK S D+EDLDD+PD+D+YDTEDSFIDD ELD+YF+VD S  KHDG+FVNRG 
Sbjct  123   KIERLYTGKNSSDEEDLDDIPDDDQYDTEDSFIDDAELDEYFEVDKSKTKHDGYFVNRGM  182

Query  704   LERI-EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKK-AGKSVPLAAG----  865
             LE++ EP    NQ P KRR+K+  K     +D     K  KV KK AGKS     G    
Sbjct  183   LEKVSEPLEAANQQPKKRRRKEVPKAPGDDNDDQRAIKHMKVRKKGAGKSASADKGALPT  242

Query  866   TSSPSY------------------------GVVMPTLYRENANVHNQEVNFDMQKAEVLH  973
             + SPS                            + T   + ++   + +N D QK  +  
Sbjct  243   SQSPSLKSSEDLKSQNHQKIIADSRPSLDPSPSLKTSLGDTSSALAENIN-DKQKTGIFL  301

Query  974   SKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDA  1153
             +K+   KLKE+SE   +           K+     N S  L+   Q  + S +  +++D 
Sbjct  302   AKSPSSKLKEASENGAKLEY------MHKTQSLKPNHSKELESVAQHKDNSGMR-EKIDL  354

Query  1154  SAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSS  1315
             + P+ K++ Q V+      +DGS+ + K   LEK+IR+LEK VAESRPP     D D+S 
Sbjct  355   NLPDTKQTIQPVKNSALHKKDGSNAKPKANSLEKSIRELEKMVAESRPP---APDADSSG  411

Query  1316  QAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINM  1495
             Q+IKRRLP EIKQKLAKVAR + AS+GK+ KEL+ RLM I+GH VQLRTLKR+LKIM+  
Sbjct  412   QSIKRRLPREIKQKLAKVARLSHASNGKVPKELLARLMGILGHFVQLRTLKRHLKIMMTS  471

Query  1496  GLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKY  1675
              LSAKQEKD++ QQ K+EV EMIK R+P + SKA EQQ G S +FQ     +K A K + 
Sbjct  472   SLSAKQEKDDKFQQAKKEVIEMIKMRIPSLMSKAAEQQSGGSGEFQECGHLDK-AVKGQL  530

Query  1676  CMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDR  1855
             CMD  LE++ICDLYD++++GL+EDA PQVRKLYAELA  WP G MDNHGIKRAICRAK+R
Sbjct  531   CMDTTLEDKICDLYDIFIDGLDEDATPQVRKLYAELAELWPKGVMDNHGIKRAICRAKER  590

Query  1856  RKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKP  2035
             ++ L  ++K+QEK+RR K+ A   EE  RVE+++  Q       S VDAR      ++  
Sbjct  591   KRALNEKNKDQEKVRRKKVPATNAEETVRVESSSDIQ------SSYVDAR----LVSDPS  640

Query  2036  ISSTAAIN-----------------------MVGRIPVPSPGGTSLDRPKPEKVKGTGNS  2146
             ++S A  N                       +   + +PS    +++R KPEK+K T NS
Sbjct  641   VASVAQQNKFSTMTSTTPATTTTTSTAINTSIASSVSMPSTHLPNIERLKPEKMKVTQNS  700

Query  2147  TDRHI-TTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAPVPKPSIQLN  2323
             +   +   D   KKK+K++ E  +GE    PEKLSS   E K ++    A   +  IQ N
Sbjct  701   SLIDVRIVDMGVKKKVKKRAENLMGELPLRPEKLSSHHVEDKQKQHKHVATAGQ--IQQN  758

Query  2324  EP--PSFEEL  2347
              P   SF E 
Sbjct  759   APHKSSFNEF  768



>ref|XP_004498357.1| PREDICTED: uncharacterized protein LOC101491241 isoform X1 [Cicer 
arietinum]
Length=746

 Score =   464 bits (1193),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 324/684 (47%), Positives = 417/684 (61%), Gaps = 75/684 (11%)
 Frame = +2

Query  416   LPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpded  595
             LP  N +     +P Q   KE +DAP  NR +AVIEKIERLY+G  S D+EDL D+PD+ 
Sbjct  66    LPKLNPALEARIAPGQAEIKE-QDAPQTNRFSAVIEKIERLYMGNDSSDEEDLPDIPDDQ  124

Query  596   eydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI---EPTSQQNQLPNKRRKKD  766
                 + SFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI   EP    NQ   KRR+KD
Sbjct  125   YDTED-SFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERIARNEPPVSPNQPTKKRRRKD  183

Query  767   QTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGT-SSPSYGVVMPTLYRENANVHNQ--  934
               K    + DG   NK AKVGK A GK+  L     S+ S  + +P  + E+    NQ  
Sbjct  184   IPKNSGENVDGHVSNKHAKVGKTAAGKTASLPVNNKSNSSKKLAVPGEHHEDLKSQNQLE  243

Query  935   --EVNF---------------------------------DMQKAEVLHSKNVVDKLKESS  1009
                +N                                  D QK  VL SKN  DK K++S
Sbjct  244   ISGINLKKKTADIRPISDSFLCLKVSNNDVPSVVETKDADKQKTGVLQSKNTKDKYKDAS  303

Query  1010  ---ETSNQRSNER-ISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRS  1177
                +TS Q+  E+ + V  +  SGR+ +  + L  + +  +K+  + +  D +  EGK  
Sbjct  304   AVLDTSQQKFQEKSVYVHSKSQSGRNPSSVDDLKNTGRSKDKNGTH-ELPDLNLSEGKSV  362

Query  1178  TQT------VRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLP  1339
              QT      +++D SSV SK TMLEKAIRDLEK VA SRPP  + Q+ DN+SQ IKRRLP
Sbjct  363   MQTPKSKNLLKKDCSSVASKSTMLEKAIRDLEKTVAVSRPPTMDNQEVDNTSQTIKRRLP  422

Query  1340  PEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEK  1519
              EIK KLAKVAR AQAS GK+S ELINRLMS +GHL+QLRTLKRNLK+MINMGLSAK+EK
Sbjct  423   REIKLKLAKVARLAQASQGKVSTELINRLMSSLGHLIQLRTLKRNLKVMINMGLSAKKEK  482

Query  1520  DNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALEN  1699
             D+R QQIK++V EMIK   P M+S   E+Q G S D Q +  + K   KR + MD ALE 
Sbjct  483   DDRFQQIKKDVVEMIKIEAPSMES---EEQAGASGD-QELGPDGKAISKRTFSMDTALEE  538

Query  1700  RICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRH  1879
             +ICDLYDL+V+GL+E AGPQ+RKLYAELA  WP G MDNHGIKRAICRAK+RR+ L+NR+
Sbjct  539   KICDLYDLFVDGLDETAGPQIRKLYAELAELWPKGNMDNHGIKRAICRAKERRRALHNRN  598

Query  1880  KNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAIN  2059
             K+QEK++R K+   K EE  + + +++     +Q++ A ++  H S   NK +S+T A  
Sbjct  599   KDQEKIKRKKLLTPKHEENVQFDASSQQ---NVQKRLAPESSSHPS--LNKAVSNTVADV  653

Query  2060  MVGRIPVPSPGGTSLDRPKPEKVKGTGNST--DRHITTDALT-KKKMKRKPEPELGEGQY  2230
              V   PV        +  K EKVKG+ + +  D  +   AL  KK+ KRK E EL   ++
Sbjct  654   RVLHPPV--------NGSKKEKVKGSSSCSPADVRVADGALIKKKEKKRKTEHELEGTRF  705

Query  2231  LPEKLSSKQAEYKPQEPIAAAPVP  2302
              PEKL+S Q +  P+    +  VP
Sbjct  706   RPEKLASLQEKESPRSLKQSPGVP  729



>ref|XP_006596226.1| PREDICTED: uncharacterized protein LOC100799794 isoform X5 [Glycine 
max]
Length=646

 Score =   459 bits (1181),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 295/633 (47%), Positives = 391/633 (62%), Gaps = 68/633 (11%)
 Frame = +2

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKCQSGS  790
             SFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI EP     Q   KRR+KD  K    +
Sbjct  24    SFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERINEPPVLPIQQAKKRRRKDIPKNPGEN  83

Query  791   DDGCNPNKPAKVGKKA-GKSVPL-AAGTSSPSYGVVMPTLYRENANVHNQ----------  934
              D    NK  KVGK A GK+  L    T S S+ + +P  + E+    NQ          
Sbjct  84    IDSHVSNKHVKVGKTATGKTASLPVKNTISSSHNLGVPGEHYEDMKFRNQLDVSGISSKR  143

Query  935   -------------------------EVNFDMQKAEVLHSKNVVDKLKESS---ETSNQRS  1030
                                        + + +K  VL SKN  DK K++S   +TS+Q+ 
Sbjct  144   KTTDTRPMSDPPVCSKVSTDDAPAAAEDAEKKKTRVLQSKNTSDKYKDASGLLDTSHQKY  203

Query  1031  NERISVPQEKSS-GRSANISNGLDQSFQQGEKSVIY---DQRLDAS-----APEGKRSTQ  1183
             +E+ +    KS  G++++  + L+++ +  +K+ I    D  L        AP  ++S  
Sbjct  204   HEKSASAHSKSHSGKTSSSVDNLEKTGRLKDKNGIRELPDLNLSVGKSAIQAPLMQKSEN  263

Query  1184  TVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLA  1363
              +++DGS+ R KIT LEKAIR+LEK VAESRPP  E Q+ D + Q +KRRLP EIK KLA
Sbjct  264   VLKKDGSTARPKITTLEKAIRELEKIVAESRPPTMENQEPDTTPQGVKRRLPREIKLKLA  323

Query  1364  KVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIK  1543
             KVAR AQAS GK+SKEL+NRLMSI+GHL+QLRTLKRNLKIMI+MGLSAKQEKD R QQ K
Sbjct  324   KVARLAQASQGKVSKELLNRLMSILGHLIQLRTLKRNLKIMISMGLSAKQEKDVRFQQKK  383

Query  1544  REVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDL  1723
              EV EMIK + P M+SK +++Q G S + Q +  + K    R + MD ALE++ICDLYDL
Sbjct  384   NEVIEMIKMQAPTMESK-LQKQAGVSGE-QELGPDGKPITTRNFSMDTALEDKICDLYDL  441

Query  1724  YVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRR  1903
             +V+GL+E+AGPQ+RKLYAELA  WPNG+MDNHGIKRAICR+K+RR+ LYNRHK+QEK++R
Sbjct  442   FVDGLDENAGPQIRKLYAELAELWPNGYMDNHGIKRAICRSKERRRALYNRHKDQEKIKR  501

Query  1904  NKISAQKEEEGYRVETT--TRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIP  2077
              K+ A ++EE  + + +  T  QP  ++E+ A D+  H  T+ NK +S+T       R+ 
Sbjct  502   KKLLAPRQEEDVQFDPSPITSQQP--MRERLATDSSSHTHTSVNKTVSNTIT---AARVH  556

Query  2078  VPSPGGTSLDRPKPEKVKG--TGNSTDRHITTDALTKKKMKRKPEPELGEGQYLPEK-LS  2248
              PS  G     PK E+ KG  +G+  D       L KKK+KRKP+  L    + PEK  +
Sbjct  557   NPSENG-----PKQERAKGSSSGSLDDVKGADGVLIKKKVKRKPDQGLEGTHFRPEKSAA  611

Query  2249  SKQAEYKPQEPIAAAPV-PKPSIQLNEPPSFEE  2344
             S Q E KP+    +A V PK ++Q    P  E+
Sbjct  612   SLQGEEKPRSLKQSAGVPPKSNLQPTSLPGLEQ  644



>ref|XP_011102229.1| PREDICTED: uncharacterized protein LOC105180235 isoform X4 [Sesamum 
indicum]
Length=621

 Score =   454 bits (1169),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 274/590 (46%), Positives = 369/590 (63%), Gaps = 49/590 (8%)
 Frame = +2

Query  716   EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTS-SPSYGVV  892
             EPT   NQ P KRR+KD TK Q G DDG NPNK  K+G K  K++      S + S+ V 
Sbjct  36    EPTISTNQQPKKRRRKDVTKGQVGMDDGHNPNKHVKIGNKGRKALSSNERNSMNQSHIVA  95

Query  893   MPTLYREN----------ANVH-----------------------NQEVNFDMQKAEVLH  973
             +P+++R +          A V                         Q+ + D Q+  V+ 
Sbjct  96    LPSVHRSDLLFEASPTDAAEVSLKKKTVDTQIMVDPLGLSSVDGIRQDKDADQQRTRVIS  155

Query  974   SKNVVDKLKESSE----TSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQ  1141
             S+N  +  KESSE    T  QR N++ S   +  SG+  +  +GLDQ+ Q+ EK  +  +
Sbjct  156   SQNHNNHRKESSELQDDTLAQRPNDKSSHVSKSHSGKQLSNVDGLDQAIQRKEKGGLV-E  214

Query  1142  RLDASAPEGKRSTQTV-----RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD  1306
             R D + P  + S  T      R++GS  R KI ML+KAIR+LEK VAESRPP+ EVQD D
Sbjct  215   RFDLNIPASRDSQITKVPLMPRKEGSHFRQKIAMLDKAIRELEKIVAESRPPSTEVQDPD  274

Query  1307  NSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIM  1486
             NSSQA+KRRLPPEIKQKLAKVAR AQAS+GK+ K++I+RLMSI+GHL+QLRTLKRNLK+M
Sbjct  275   NSSQAVKRRLPPEIKQKLAKVARLAQASYGKIPKDVISRLMSILGHLMQLRTLKRNLKVM  334

Query  1487  INMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFK  1666
              N+GLSAKQEKD+R+Q+IK+E+AEM+K R+P + SK +E Q   SD+FQ    + K+ F+
Sbjct  335   ANLGLSAKQEKDDRLQKIKQEIAEMVKQRIPYINSK-VEHQTTNSDNFQEAGAQGKDTFR  393

Query  1667  RKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRA  1846
             +KY MD+ LEN+ICDLYDLYVE LEED GP VR+LY ELAA WP+G MD  GIKRAI ++
Sbjct  394   QKYSMDDVLENKICDLYDLYVEKLEEDLGPPVRRLYEELAALWPSGVMDTDGIKRAIYKS  453

Query  1847  KDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTAT  2026
             KDRR+ L  R K+QEKM++ K+ A K E   R E  + +  + + EK    + D     T
Sbjct  454   KDRRRALSGRRKDQEKMKK-KMLAPKTENTTRGEAVSVNPALPVHEKLLAGSCDQALPLT  512

Query  2027  NKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTDRH-ITTDALTKKKMKRKP  2203
             +KP+ S AA++   R+PVP     ++D+ K E++KG+ +S     ++TD L KKK+KRKP
Sbjct  513   SKPVLS-AAVSPAARMPVPLANSQNVDKLKHERLKGSSSSNPVDAVSTDVLPKKKVKRKP  571

Query  2204  EPELGEGQYLPEKLSSKQAEYKP-QEPIAAAPVPKPSIQLNEPPSFEELT  2350
               E+ E QY  +KL   Q E +       A P+PK  +Q   P   E L+
Sbjct  572   NSEIVEAQYRLDKLEVSQVEERHRHHKHMAVPLPKSDLQPAAPSGSENLS  621



>ref|XP_004498358.1| PREDICTED: uncharacterized protein LOC101491241 isoform X2 [Cicer 
arietinum]
Length=745

 Score =   457 bits (1175),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 323/684 (47%), Positives = 416/684 (61%), Gaps = 76/684 (11%)
 Frame = +2

Query  416   LPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpded  595
             LP  N +     +P Q   KE +DAP  NR +AVIEKIERLY+G  S D+EDL D+PD+ 
Sbjct  66    LPKLNPALEARIAPGQAEIKE-QDAPQTNRFSAVIEKIERLYMGNDSSDEEDLPDIPDDQ  124

Query  596   eydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI---EPTSQQNQLPNKRRKKD  766
                 + SFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI   EP    NQ   KRR+KD
Sbjct  125   YDTED-SFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERIARNEPPVSPNQPTKKRRRKD  183

Query  767   QTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGT-SSPSYGVVMPTLYRENANVHNQ--  934
               K    + DG   NK AKVGK A GK+  L     S+ S  + +P  + E+    NQ  
Sbjct  184   IPKNSGENVDGHVSNKHAKVGKTAAGKTASLPVNNKSNSSKKLAVPGEHHEDLKSQNQLE  243

Query  935   --EVNF---------------------------------DMQKAEVLHSKNVVDKLKESS  1009
                +N                                  D QK  VL SKN  DK K++S
Sbjct  244   ISGINLKKKTADIRPISDSFLCLKVSNNDVPSVVETKDADKQKTGVLQSKNTKDKYKDAS  303

Query  1010  ---ETSNQRSNER-ISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRS  1177
                +TS Q+  E+ + V  +  SGR+ +  + L  + +  +K+  + +  D +  EGK  
Sbjct  304   AVLDTSQQKFQEKSVYVHSKSQSGRNPSSVDDLKNTGRSKDKNGTH-ELPDLNLSEGKSV  362

Query  1178  TQT------VRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLP  1339
              QT      +++D SSV SK TMLEKAIRDLEK VA SRPP  + Q+ DN+SQ IKRRLP
Sbjct  363   MQTPKSKNLLKKDCSSVASKSTMLEKAIRDLEKTVAVSRPPTMDNQEVDNTSQTIKRRLP  422

Query  1340  PEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEK  1519
              EIK KLAKVAR A AS GK+S ELINRLMS +GHL+QLRTLKRNLK+MINMGLSAK+EK
Sbjct  423   REIKLKLAKVARLA-ASQGKVSTELINRLMSSLGHLIQLRTLKRNLKVMINMGLSAKKEK  481

Query  1520  DNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALEN  1699
             D+R QQIK++V EMIK   P M+S   E+Q G S D Q +  + K   KR + MD ALE 
Sbjct  482   DDRFQQIKKDVVEMIKIEAPSMES---EEQAGASGD-QELGPDGKAISKRTFSMDTALEE  537

Query  1700  RICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRH  1879
             +ICDLYDL+V+GL+E AGPQ+RKLYAELA  WP G MDNHGIKRAICRAK+RR+ L+NR+
Sbjct  538   KICDLYDLFVDGLDETAGPQIRKLYAELAELWPKGNMDNHGIKRAICRAKERRRALHNRN  597

Query  1880  KNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAIN  2059
             K+QEK++R K+   K EE  + + +++     +Q++ A ++  H S   NK +S+T A  
Sbjct  598   KDQEKIKRKKLLTPKHEENVQFDASSQQ---NVQKRLAPESSSHPS--LNKAVSNTVADV  652

Query  2060  MVGRIPVPSPGGTSLDRPKPEKVKGTGNST--DRHITTDALT-KKKMKRKPEPELGEGQY  2230
              V   PV        +  K EKVKG+ + +  D  +   AL  KK+ KRK E EL   ++
Sbjct  653   RVLHPPV--------NGSKKEKVKGSSSCSPADVRVADGALIKKKEKKRKTEHELEGTRF  704

Query  2231  LPEKLSSKQAEYKPQEPIAAAPVP  2302
              PEKL+S Q +  P+    +  VP
Sbjct  705   RPEKLASLQEKESPRSLKQSPGVP  728



>ref|XP_011027458.1| PREDICTED: uncharacterized protein LOC105127753 isoform X4 [Populus 
euphratica]
 ref|XP_011027459.1| PREDICTED: uncharacterized protein LOC105127753 isoform X4 [Populus 
euphratica]
 ref|XP_011027460.1| PREDICTED: uncharacterized protein LOC105127753 isoform X4 [Populus 
euphratica]
Length=603

 Score =   449 bits (1155),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 294/570 (52%), Positives = 362/570 (64%), Gaps = 66/570 (12%)
 Frame = +2

Query  227   VSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQ  406
             V+ SY   G RQ FTVELRPGETT VSWKKL+K+A  + S    A    P  +A    L+
Sbjct  21    VTPSYVKLGDRQIFTVELRPGETTFVSWKKLMKDANKVNSRSAPAAPDPPPVNAHP-NLE  79

Query  407   PLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvp  586
               I PP            Q +E E KD PP NR +AVIEKIERLY GK S D+EDL D P
Sbjct  80    SRIAPP------------QVIENEVKDDPPPNRFSAVIEKIERLYTGKDSSDEEDLMDAP  127

Query  587   dedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKK  763
             D+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRG+LERI EP    N+ P KRR+K
Sbjct  128   DDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGELERINEPPVVPNEKPKKRRRK  187

Query  764   DQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSS--PSYGVVMPTLYRENANVHNQ-  934
             D  K  + SDDG   NK  K+GK A + + L  G +S   S  + M +   EN    NQ 
Sbjct  188   DLLKAPNDSDDGHMSNKLVKLGKSAAEKMALPPGKNSLNISQNLTMISEQYENVKFQNQS  247

Query  935   -----------------------------------EVNFDMQKAE--VLHSKNVVDKLKE  1003
                                                E   D++K +   L  KN+  K K 
Sbjct  248   NSPGISSKKKPAETKMKLDPSLSVKVLNGDAYASLEETKDIEKPKTGCLPPKNLTSKPKN  307

Query  1004  S---SETSNQRSNERISVPQEKS-SGRSANISNGLDQSFQQGEKSVIY---DQRLDAS--  1156
             +   SE+SNQ+  E+ +  Q KS S ++ N  + L+ S +  EK+ +    D  L+ S  
Sbjct  308   ASGFSESSNQKYQEKSAYVQPKSQSAKTVNHGDDLEPSVRLKEKNGVRELPDLNLNISDS  367

Query  1157  --APEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKR  1330
                 +  R++   R+DGSSVR K +MLEKAIR+LEK VAESRPP  E Q+ D S+QAIKR
Sbjct  368   KIYTQAARTSHVHRKDGSSVRPKSSMLEKAIRELEKMVAESRPPAVENQETDASAQAIKR  427

Query  1331  RLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             RLP EIK KLAKVAR A AS GKLSKEL+NRLMSI+GHL+QLRTLKRNLKIMIN GLSAK
Sbjct  428   RLPTEIKLKLAKVARLA-ASQGKLSKELLNRLMSILGHLIQLRTLKRNLKIMINTGLSAK  486

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNA  1690
             QEKD+R QQIK+EVAEMI  R+P ++S A+ QQ G SDDFQ + ++E+   K+K+ MD  
Sbjct  487   QEKDDRFQQIKKEVAEMIMTRIPSVESNALVQQAGASDDFQEMVSDERGGLKKKFSMDAV  546

Query  1691  LENRICDLYDLYVEGLEEDAGPQVRKLYAE  1780
             LE++ICDLYDL+VEGL+ED+G QVRKLY E
Sbjct  547   LEDKICDLYDLFVEGLDEDSGQQVRKLYVE  576



>ref|XP_006390101.1| hypothetical protein EUTSA_v10018217mg [Eutrema salsugineum]
 gb|ESQ27387.1| hypothetical protein EUTSA_v10018217mg [Eutrema salsugineum]
Length=686

 Score =   448 bits (1153),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 303/608 (50%), Positives = 385/608 (63%), Gaps = 65/608 (11%)
 Frame = +2

Query  176   KPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngn  355
             K   D  S+ GE    R+S     AG R+   VELR GETT VSWKKL+KEA+       
Sbjct  5     KATTDGVSTPGESS--RISPKLLTAGDRKLLKVELRQGETTYVSWKKLMKEAS---KGNA  59

Query  356   gapgpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIER  535
                        A   L+  +      +PGP      P E E  D P  NR NAVIEKIER
Sbjct  60    SFSSAPDPPPNANPNLESRL------APGP------PAEGENVDQPHSNRFNAVIEKIER  107

Query  536   LYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI  715
             LY+G+ S D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLERI
Sbjct  108   LYMGRDSSDGEELDGAPDDDEYDTEDSFIDDVELDEYFEVDNSAIKHDGFFVNRGKLERI  167

Query  716   EP--TSQQNQLPNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPS-  880
             EP  T+  NQ P KR++K+  K C    D      K AK+ K A GK    A+G SS + 
Sbjct  168   EPSTTTTTNQQPKKRQRKESAKPCGDVVDVS---RKQAKMAKTAGGKDQSAASGPSSKNK  224

Query  881   -------YGVVMP--------TLYRENA----NVHNQEVNFDMQKAEVLHSKNVVDKLKE  1003
                       + P         L  EN      V++Q  N    KA+ + S   +  LK 
Sbjct  225   FNDSKTVQDSISPLKAQSGNDCLLLENVKHSDKVNHQPRNASSPKAKAVGSSGAL-HLKC  283

Query  1004  SSETSNQRSNERISVPQEKSSGRSANISNGLDQS--FQQGEKSVIYDQRLDASAPEGKRS  1177
             S+++++Q+SN   S+P     G+S    N L +S   +Q E + ++D  LD +A   ++S
Sbjct  284   SNKSAHQQSN---SLP-----GKSR--PNVLAKSTVVRQKENNGMHD--LD-NATVSRQS  330

Query  1178  TQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQ  1354
              QT ++ GS+ R K + L+KAIR+LEK VAESRPP A E QD D +SQA+KRRLP ++K 
Sbjct  331   IQTTKKGGSNARPKTSTLDKAIRELEKVVAESRPPAATENQDADTASQAVKRRLPRDVKL  390

Query  1355  KLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQ  1534
             KLAKVAR A AS G +S ELINRLMSIVGHL+Q+R+LKRNLKIMI+ G +A +EKD R Q
Sbjct  391   KLAKVARIA-ASQGTVSGELINRLMSIVGHLIQVRSLKRNLKIMIDSGDTANREKDTRFQ  449

Query  1535  QIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDL  1714
             +IK EV EMIK +VPLM+S+A  Q+ GTSDDFQ + + EK   K+K+ MD ALE+++CDL
Sbjct  450   RIKNEVIEMIKIKVPLMESQATNQEAGTSDDFQDVGSVEKPPMKKKFVMDAALEDKLCDL  509

Query  1715  YDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY---NRHKN  1885
             YD++V+GL+EDAGPQ+RKLYA LA  WPN  MDNH IKRAICRAK+RR+ LY    +  +
Sbjct  510   YDIFVDGLDEDAGPQIRKLYASLAELWPNKLMDNHEIKRAICRAKERRRALYGNLGKEMD  569

Query  1886  QEKMRRNK  1909
             Q KM + K
Sbjct  570   QAKMTKRK  577



>ref|XP_006306914.1| hypothetical protein CARUB_v10008479mg [Capsella rubella]
 gb|EOA39812.1| hypothetical protein CARUB_v10008479mg [Capsella rubella]
Length=690

 Score =   444 bits (1142),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 285/584 (49%), Positives = 375/584 (64%), Gaps = 40/584 (7%)
 Frame = +2

Query  203   GGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpapra  382
             GGE    R S +   AG R+   VELRPG+TT VSWKKL+++A+ +  +    P P P A
Sbjct  13    GGESL--RASPNVLTAGDRKLLKVELRPGDTTYVSWKKLMRDASKVNGSSASVPDPPPNA  70

Query  383   saaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdd  562
             +     L+  I        GPG    QP E E  D P  NR NAVIEKIERLY G  S D
Sbjct  71    NP---NLESRI--------GPG----QPAEIETNDQPHSNRFNAVIEKIERLYKGNDSSD  115

Query  563   dedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQL  742
              E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGF+VNRGKLERIEP++  NQ 
Sbjct  116   GEELDGAPDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFYVNRGKLERIEPSTTSNQQ  175

Query  743   PNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTS-SPSYGVVMPTLYRE--  913
             P KRR+KD TK    + D  + +    +  +  K   +A+G+S    Y V   T      
Sbjct  176   PKKRRRKDSTKISGDAVDVSDKHTKLSITARQ-KDQSIASGSSLKRKYNVARKTQESSLP  234

Query  914   -NANVHNQEVNFDMQK----AEVLHSKNVVDKLKESSETS---NQRSNERISVPQEKSSG  1069
               A   N  ++ D  K    A  L  K+   K KE+  +S    + SN+ +    +   G
Sbjct  235   FGAQDANTSLSLDNVKHPDRANYLSKKDTTHKSKETGSSSALQQKYSNKGLHQQSKSLPG  294

Query  1070  RSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKAIRD  1249
             +     +      +Q E + +++    A+A   ++S+Q  ++DGS+V+SK ++LEKAIR+
Sbjct  295   KFLPNVSAEATIVRQKENNGVHEL---ANAMGSRQSSQASKKDGSNVKSKTSILEKAIRE  351

Query  1250  LEKFVAESRPPN-AEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRL  1426
             LEK VAESRPP   E Q+ D SSQA+KRRLP ++K KLAKVAR A AS GK S EL+NRL
Sbjct  352   LEKVVAESRPPAITENQEADTSSQAVKRRLPRDVKLKLAKVARIA-ASQGKFSAELVNRL  410

Query  1427  MSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQ  1606
             MSIVGHL+QLR+LKRNLKIMI+MG SA +EKDNR Q+I  EV +MI+ +V LM+S+    
Sbjct  411   MSIVGHLIQLRSLKRNLKIMIDMGDSANREKDNRFQRINNEVLDMIRTKVSLMESQTTRP  470

Query  1607  QPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELA  1786
             + GTSDDFQ   + EK + K K+ MD ALE+++CDLYD+++EGL+ED GPQ+RKLY  LA
Sbjct  471   ETGTSDDFQD--SVEKPSLK-KFVMDAALEDKLCDLYDIFIEGLDEDQGPQIRKLYVNLA  527

Query  1787  AYWPNGFMDNHGIKRAICRAKDRRKTLY---NRHKNQEKMRRNK  1909
               WPN  MDNHGIKRAICRAK+R+K LY    +  +Q KM++++
Sbjct  528   ELWPNRLMDNHGIKRAICRAKERQKALYGNLGKEMDQTKMKKSR  571



>gb|KFK44264.1| hypothetical protein AALP_AA1G235600 [Arabis alpina]
Length=668

 Score =   443 bits (1139),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 321/730 (44%), Positives = 427/730 (58%), Gaps = 81/730 (11%)
 Frame = +2

Query  185   IDEGSSGGEPGVG-RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngnga  361
             + E S G   G   R S     AG R+   VELRPG+TT VSWKKL++EA+ +     G+
Sbjct  4     VKETSGGFTSGESLRDSPKVLTAGDRKLLKVELRPGDTTYVSWKKLMREASKVNGLLLGS  63

Query  362   pgpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLY  541
                 P  +    E +         +PGP      P E E  D P  NR NAVIEKIERLY
Sbjct  64    VPDPPPNANPNLESRL--------APGP------PAEIETNDQPHSNRFNAVIEKIERLY  109

Query  542   VGKQSdddedlddv-pdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIE  718
              GK S D E+LD    D+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGF+VNRGKLER+E
Sbjct  110   KGKDSSDGEELDGAPDDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFYVNRGKLERME  169

Query  719   PTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPS--YGVV  892
             P++  NQ P KRR+KD     S  D     +K  K+   A +     AG SS    Y V 
Sbjct  170   PSTTSNQQPKKRRRKDS--VNSFGDAVDVSSKQTKLSLTARRKDQSTAGGSSLKRKYNVA  227

Query  893   MPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGR  1072
               T            + F  Q A    S +VV    ++S+ +N +S    S  Q     +
Sbjct  228   RKT--------QESPLPFGSQNANASLSLDVV----KNSDKANHQSKNTTSHKQ-----K  270

Query  1073  SANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKAIRDL  1252
              A  S+ L    ++   +++      A+A   ++ +Q  R+DGS+V+SKI+ LEKAIR+L
Sbjct  271   EAGYSSALVVRKKENNGTLVL-----ANATGSRQLSQATRKDGSNVKSKISTLEKAIREL  325

Query  1253  EKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLM  1429
             EK VAESRPP A E Q+ D SSQA+KRRLP E+K  LAKVA  AQAS GK+S+ELI RLM
Sbjct  326   EKVVAESRPPAATENQEADISSQAVKRRLPREVKSNLAKVATIAQASQGKISEELIKRLM  385

Query  1430  SIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQ  1609
             SIVGHL+QLR+LKRNLKIMI+MG SA +EKDNR Q+I  EV EMIK +V LM+S+A +Q+
Sbjct  386   SIVGHLIQLRSLKRNLKIMIDMGDSANREKDNRFQRINNEVLEMIKSKVSLMESQATKQE  445

Query  1610  PGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAA  1789
              G+SDDFQ  A   +    +K+ MD ALE+++CDLYD++V+GL+ED GP++RKLY  LA 
Sbjct  446   VGSSDDFQDSA---QNPSLKKFVMDAALEDKLCDLYDIFVDGLDEDPGPEIRKLYVNLAE  502

Query  1790  YWPNGFMDNHGIKRAICRAKDRRKTLY---NRHKNQEKM-RRNKISAQKEEEGYRVETTT  1957
              WPN  MD +GIKRAICRAK+R++  Y    +  +Q KM +R K    + +   +  T +
Sbjct  503   LWPNRLMDKNGIKRAICRAKERQRASYGNLGKEMDQTKMKKRRKQLVPRTDWTAQPNTGS  562

Query  1958  RDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRP--KPEKVK  2131
               Q  Q  EK  VDA      AT+  + ST  I             +S DR   + EK+K
Sbjct  563   VVQKQQSGEKMTVDA-----NATSTSLISTQTI-----------ADSSRDRSNQQHEKLK  606

Query  2132  GTGNSTDRHITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAP----V  2299
             G+ +S +      A   + +K+K EP + E Q +   L+ K+ E+ PQ  + AAP    +
Sbjct  607   GSSSSCN-----PAEVTRVVKKKVEPVMAEKQVV---LALKRQEH-PQTRVIAAPQNLDI  657

Query  2300  PKPSIQLNEP  2329
              +  + LN P
Sbjct  658   AETPLDLNLP  667



>ref|XP_010911241.1| PREDICTED: LOW QUALITY PROTEIN: ubinuclein-1 [Elaeis guineensis]
Length=795

 Score =   442 bits (1138),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 332/767 (43%), Positives = 432/767 (56%), Gaps = 109/767 (14%)
 Frame = +2

Query  251   GGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHN  430
             G RQRFTVELRPGETTIVSWK+LL+E+       +                     PP  
Sbjct  51    GQRQRFTVELRPGETTIVSWKRLLRESGKGGGGDS--------------------FPPSG  90

Query  431   DSP--GP--GFSPEQPVEKEAKDAPPG-NRLNAVIEKIERLYVGKQSdddedlddvpded  595
               P  GP  G + E PVE E KDA P  NR +AVIEKIERLY+GKQS D+EDLDD PD+D
Sbjct  91    ADPALGPHAGVAAE-PVENELKDAVPAPNRFSAVIEKIERLYMGKQSSDEEDLDDTPDDD  149

Query  596   eydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTK  775
             +YDTEDSFIDDTELD+YFQVD    KHDG+FVN+GKLE +EP +  N  P KRR+KD TK
Sbjct  150   QYDTEDSFIDDTELDEYFQVDKLRTKHDGYFVNKGKLEHVEPMASPNVAPKKRRRKDSTK  209

Query  776   CQSGSDDGCNPNKPAKVG----KKAGKSVPLAAGTSSPSYGVVMPTLYRENANVHNQEVN  943
                G D    PN+   +G    K A +S PLA G    S   V+   Y EN    N+ ++
Sbjct  210   VH-GEDHDHVPNESINMGNMRIKAAARSAPLA-GKKLSSSAKVLALPYVENYYEENKLID  267

Query  944   FDMQKAEVLHSKNVVDKLKESSETSNQRSNERIS---------------VPQEKSSGRSA  1078
               +      + K   D    S     +  N+ IS               +P +  + +S 
Sbjct  268   DKLNAPTGAYKKRFADLTINSENPPVKLLNKDISSLPLESKDFDKHKAVMPSKDLTHKSR  327

Query  1079  NISNGLDQSFQQGEKSVIYDQ------RL------DASA---------------------  1159
                N  D  +Q  +   +  Q      RL      + SA                     
Sbjct  328   GTGNSFDPMYQTSQDKGVSSQVEFQSRRLPNGENEEVSAKLRRKEKYGTGEFPDMNSSGS  387

Query  1160  --PEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRR  1333
               P   + T T  ++GS+VR K T LE+AIRDLEK VAESRPP+  VQ+ D SSQ +KRR
Sbjct  388   VYPMPAQPTFTRVKEGSTVRPKGTTLERAIRDLEKIVAESRPPSIYVQEMDPSSQGVKRR  447

Query  1334  LPPEIKQKLAKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             LP E+KQKLAKVAR + AS GK+S+ ELI+RLM I+GHLVQ +TLKRN+K M+ +GLSAK
Sbjct  448   LPQEVKQKLAKVARLS-ASQGKVSEDELIDRLMGILGHLVQRKTLKRNMKEMVELGLSAK  506

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIATEEKEAFKRKYCMDN  1687
             Q+K +R QQIK+EV EMI+ RV  + S+  E Q G++DDFQ +I  +E+ A K KY MD 
Sbjct  507   QQKADRFQQIKKEVHEMIRSRVSNLNSRVAESQDGSADDFQEAINNDERRALKGKYSMDA  566

Query  1688  ALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
             ALE++ICDLYDLYVEG++ED GPQ RKLY ELA  WP+G+MDN GIK +I R+K+R++  
Sbjct  567   ALEDKICDLYDLYVEGMDEDKGPQSRKLYVELAELWPHGYMDNVGIKDSIYRSKERKRAF  626

Query  1868  Y--NRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQI---QEKSAVDARDHGSTATNK  2032
             Y  N+ +++E+++R K++A       RVE T      Q    QE+   D       + +K
Sbjct  627   YRQNKVRDEERIKRRKLAA-----AVRVEETNPGPAAQARAGQERPVTDPTGPFLVSLDK  681

Query  2033  PISST--AAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHITTDA----LTKKKMK  2194
               S+   A++      P+ S  G       P+K KG G S    I  D     +  KK K
Sbjct  682   LASNQLPASLGRTDPTPLSSDYGQQHVLKNPDKAKGGGMSV---IPDDGNKAAVDVKKKK  738

Query  2195  RKPEPELGEGQYLPEKLSSKQAE--YKPQEPIAAAPV---PKPSIQL  2320
             RK E +LGE    P K+ S+  +  +K ++PI    V   PKPSI L
Sbjct  739   RKLESDLGEIHVHPLKVPSQHTKERHKSEKPIDDPNVSQQPKPSIPL  785



>ref|XP_010537364.1| PREDICTED: ubinuclein-1-like isoform X4 [Tarenaya hassleriana]
Length=671

 Score =   438 bits (1126),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 283/592 (48%), Positives = 363/592 (61%), Gaps = 50/592 (8%)
 Frame = +2

Query  194   GSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpa  373
             GS+ GE    R S      G R+ F VE+RPGETT VSWKK +KEA  +  +    P   
Sbjct  10    GSTHGESN--RASQKVVTVGDRKLFYVEVRPGETTYVSWKKFMKEACKVNGSSTSVPE--  65

Query  374   prasaaaaELQPLILPPHNDSPG-PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGK  550
                            PP + +P      P  P E E  D P  NR +AVIEKIERLY+GK
Sbjct  66    ---------------PPPSANPNLECLVPGHPAENEKVDQP--NRFSAVIEKIERLYMGK  108

Query  551   QSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQ  730
              S D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGFFVNRGKLERIEP++ 
Sbjct  109   DSSDGEELDSSPDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFFVNRGKLERIEPSAT  168

Query  731   QNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGVVMPTLY  907
              NQ   KRR+K+  K   G  D   PNK AKV K A GK     +G SS           
Sbjct  169   SNQQLKKRRRKESAKPGGGVTDV--PNKQAKVAKMARGKDRSKHSGQSSKKRSNDPKAAQ  226

Query  908   RENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANIS  1087
                ++   Q VN  +   +  +S     +LK ++    +      + PQ+  S  +   S
Sbjct  227   DSFSSFRVQSVNASLPLEDTKYSDKTNHELKNAASRKAKEVGSSDAFPQKCRSKIAHQQS  286

Query  1088  NGL----------DQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR------RDGSSVRSK  1219
             N +          + +  + EK+ ++D    A+A   + S Q  R      +D S+VR K
Sbjct  287   NAMPVKSPHNHVAEAACTKKEKNDMHDL---ANATGSRHSIQKARPFSAQKKDSSNVRPK  343

Query  1220  ITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGK  1399
              ++L+KAIR+LEK VA+SRP N   Q+ D +SQ +KRRLP E+K KL KVAR   A  GK
Sbjct  344   TSLLDKAIRELEKVVADSRPEN---QEADTTSQGVKRRLPKEVKAKLDKVARIV-AKEGK  399

Query  1400  LSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVP  1579
             LS ELINRLMSIVGHL+QLR+LKRNLKIMI+  LS  +++D+R Q IK+EVAEMIK +VP
Sbjct  400   LSAELINRLMSIVGHLIQLRSLKRNLKIMIDESLSFNRKRDDRFQGIKKEVAEMIKTQVP  459

Query  1580  LMKSKAIEQQP-GTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGP  1756
             LM+S+  EQQ  GTS DF   A  EK   K+K+ MD  LE++ICDLYD++V+GL+EDAGP
Sbjct  460   LMESQTDEQQAAGTSSDFHDDAAVEKAPLKKKFVMDARLEDKICDLYDIFVDGLDEDAGP  519

Query  1757  QVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKI  1912
             Q+RKLY ELA  WP+  MDNHGIKRAICRAK+RR+  YN  +N +KM++  +
Sbjct  520   QIRKLYVELAELWPDRLMDNHGIKRAICRAKERRRASYN-MENMKKMKQQSV  570



>ref|XP_009414608.1| PREDICTED: ubinuclein-1-like [Musa acuminata subsp. malaccensis]
Length=807

 Score =   441 bits (1134),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 314/762 (41%), Positives = 441/762 (58%), Gaps = 96/762 (13%)
 Frame = +2

Query  248   AGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPH  427
              G R RF+VEL+PGETTIVSWK+LLKE+                   A+   +PL +   
Sbjct  67    GGQRVRFSVELKPGETTIVSWKRLLKESN----------KGGGSLPIASVAERPLAVQVG  116

Query  428   NDSPGPGFSPEQPVEKEAKDA-PPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeyd  604
                P        P E E KDA PP NR +AVIEKIERLY+GKQS D+E+LDD+PD+D+YD
Sbjct  117   TGGP--------PAENELKDAVPPPNRFSAVIEKIERLYMGKQSSDEEELDDIPDDDQYD  168

Query  605   tedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQS  784
             TEDSFIDD ELD+YFQVD  + KH+G+FVN+GKLE+IEP+S   + P +RR++D TK   
Sbjct  169   TEDSFIDDAELDEYFQVDKMSTKHNGYFVNKGKLEQIEPSSSPKEAPKRRRRRDSTKLHG  228

Query  785   GSDDGCNPNKPAKVG----KKAGKSVPLAAGTSSPS-----YG--------------VVM  895
                    P  PAKVG    K A ++ P+     SP+     YG                 
Sbjct  229   DGSHVLVPGGPAKVGSMRIKDAARNAPVMGRKPSPAKVYAPYGEHYSEEGRSLKYKSKTT  288

Query  896   PTLY-RENAN------------VHNQEV--------NFDMQKAEVLHSKNVVDK--LKES  1006
              T+Y R++A+            V N++V        +FD  K+ VL S++   +  +  S
Sbjct  289   TTVYKRKSADFTIKSEEQSTMRVPNKDVLPLPLELKDFDKHKSGVLASEDTTHRASVSHS  348

Query  1007  SETSNQRSNERISV---PQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRS  1177
              +   Q S  ++ V   P++     +  +S  + +  + G  +        +  P     
Sbjct  349   FDPLYQASRSKVQVEFQPKKLLKSETGEVSAKIRRKEKYGSSNFPAMNSSMSVYPMHAVQ  408

Query  1178  TQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQK  1357
               T  ++ SS+R K T LE+AIRDLEK VAE RPP+ +V + D + Q IKRRLP E+KQK
Sbjct  409   PSTRVKESSSMRPKGTTLERAIRDLEKIVAECRPPSLDVHEVDPAFQGIKRRLPQEVKQK  468

Query  1358  LAKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQ  1534
             LAKVAR + AS GK+S+ ELI+RLM I+GHLVQ +TLK+N++ M+ +GLSAKQ+K +R Q
Sbjct  469   LAKVARLS-ASQGKISEDELIDRLMGILGHLVQRKTLKKNMREMVELGLSAKQQKADRFQ  527

Query  1535  QIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDL  1714
             QIKREV EMI+ RV  +KSK  E+Q G++DDFQ I  +E+   K +Y MD ALE++ICDL
Sbjct  528   QIKREVNEMIRARVSQLKSKLAEKQDGSADDFQEINNDERRTLKGRYSMDAALEDKICDL  587

Query  1715  YDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK--NQ  1888
             YDLYVEG++ED GPQ RKLY ELA  WP+G+MDN GIK AI R+K+R+++LY +HK  ++
Sbjct  588   YDLYVEGMDEDKGPQSRKLYVELAELWPSGYMDNVGIKDAIYRSKERKRSLYRQHKVHDE  647

Query  1889  EKMRRNKISAQKEEEGYRVETTT--------RDQPVQIQEKSAVDARDHGSTATNKPISS  2044
             E+++R K+++ K     R++ T         +++PV + E +A          +N+P  S
Sbjct  648   ERIKRKKLASTK-----RIDETNPAAQLRAGQEKPVPVVEATARFLAPLDKLISNQPAGS  702

Query  2045  TAAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHITTDAL--TKKKMKRKPEPELG  2218
             T   +M    P  S   T  +   P+KV+    ST+    + A    KKK+KRK E EL 
Sbjct  703   TGR-SMDSVQPADSSQHTLKN---PDKVRVANMSTNPEDASKAFVDVKKKLKRKAESELS  758

Query  2219  EGQYLPEKLSSKQAEYKPQEP-----IAAAPVPKPSIQLNEP  2329
             +     +K+ S+    K + P        +  PKPS++L  P
Sbjct  759   DTHIHSQKVPSQHITEKQKSPRIMDDTNMSYQPKPSLELPGP  800



>ref|XP_008353916.1| PREDICTED: uncharacterized protein LOC103417515 [Malus domestica]
Length=371

 Score =   426 bits (1094),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 227/378 (60%), Positives = 282/378 (75%), Gaps = 14/378 (4%)
 Frame = +2

Query  1226  MLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLS  1405
             MLEKAIR+LEK VAESRPP A+ Q+GDNSSQAIKRRLP E+K KLAKVAR AQASHGK++
Sbjct  1     MLEKAIRELEKMVAESRPPAADNQEGDNSSQAIKRRLPRELKMKLAKVARLAQASHGKIT  60

Query  1406  KELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLM  1585
             KEL+NRLMSI+GHL+QLRTLKRNLK+MI+MG+SAK+EKD R Q +K+EV +MIK + P +
Sbjct  61    KELLNRLMSILGHLIQLRTLKRNLKVMISMGISAKKEKDERFQHVKKEVIDMIKIKAPSL  120

Query  1586  KSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVR  1765
             +SKA+EQ  G SDDFQ  A+  KE  KRK+ MD ALE++ICDLYDLYV+GL+EDAGPQ+R
Sbjct  121   ESKALEQHAGASDDFQETASGTKELSKRKFSMDAALEDKICDLYDLYVDGLDEDAGPQIR  180

Query  1766  KLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRV  1945
             KLYAELAA WPNGFMDNHGIKRAICR+K+RR+  Y+R+K QEK+RR K+   + EE  RV
Sbjct  181   KLYAELAALWPNGFMDNHGIKRAICRSKERRRERYSRNKEQEKIRRKKMLTPRTEETIRV  240

Query  1946  ETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSP-GGTSLDRPKPE  2122
             E +   Q + +QE+ A +   +  + TNKPIS T A      + VP P  G S DR K E
Sbjct  241   ERSITQQ-LLMQERMATE--QNSQSPTNKPISGTTAA-----LGVPGPINGPSFDRLKQE  292

Query  2123  KVKGTGNST--DRHITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAE--YKPQEPIAA  2290
             K+KG+ +S+  D  +   ALTKKK KRKPE EL E +  PEKL S+  E  +K  +P AA
Sbjct  293   KLKGSSSSSADDTRVGDGALTKKKTKRKPEQELDESRIRPEKLPSQSGEERHKSLKP-AA  351

Query  2291  APVPKPSIQLNEPPSFEE  2344
              P  K ++Q    PS E+
Sbjct  352   GPPHKSNLQSTVVPSVEQ  369



>gb|KFK44263.1| hypothetical protein AALP_AA1G235600 [Arabis alpina]
Length=667

 Score =   436 bits (1121),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 320/730 (44%), Positives = 426/730 (58%), Gaps = 82/730 (11%)
 Frame = +2

Query  185   IDEGSSGGEPGVG-RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngnga  361
             + E S G   G   R S     AG R+   VELRPG+TT VSWKKL++EA+ +     G+
Sbjct  4     VKETSGGFTSGESLRDSPKVLTAGDRKLLKVELRPGDTTYVSWKKLMREASKVNGLLLGS  63

Query  362   pgpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLY  541
                 P  +    E +         +PGP      P E E  D P  NR NAVIEKIERLY
Sbjct  64    VPDPPPNANPNLESRL--------APGP------PAEIETNDQPHSNRFNAVIEKIERLY  109

Query  542   VGKQSdddedlddv-pdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIE  718
              GK S D E+LD    D+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGF+VNRGKLER+E
Sbjct  110   KGKDSSDGEELDGAPDDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFYVNRGKLERME  169

Query  719   PTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPS--YGVV  892
             P++  NQ P KRR+KD     S  D     +K  K+   A +     AG SS    Y V 
Sbjct  170   PSTTSNQQPKKRRRKDS--VNSFGDAVDVSSKQTKLSLTARRKDQSTAGGSSLKRKYNVA  227

Query  893   MPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGR  1072
               T            + F  Q A    S +VV    ++S+ +N +S    S  Q     +
Sbjct  228   RKT--------QESPLPFGSQNANASLSLDVV----KNSDKANHQSKNTTSHKQ-----K  270

Query  1073  SANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKAIRDL  1252
              A  S+ L    ++   +++      A+A   ++ +Q  R+DGS+V+SKI+ LEKAIR+L
Sbjct  271   EAGYSSALVVRKKENNGTLVL-----ANATGSRQLSQATRKDGSNVKSKISTLEKAIREL  325

Query  1253  EKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLM  1429
             EK VAESRPP A E Q+ D SSQA+KRRLP E+K  LAKVA  A AS GK+S+ELI RLM
Sbjct  326   EKVVAESRPPAATENQEADISSQAVKRRLPREVKSNLAKVATIA-ASQGKISEELIKRLM  384

Query  1430  SIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQ  1609
             SIVGHL+QLR+LKRNLKIMI+MG SA +EKDNR Q+I  EV EMIK +V LM+S+A +Q+
Sbjct  385   SIVGHLIQLRSLKRNLKIMIDMGDSANREKDNRFQRINNEVLEMIKSKVSLMESQATKQE  444

Query  1610  PGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAA  1789
              G+SDDFQ  A   +    +K+ MD ALE+++CDLYD++V+GL+ED GP++RKLY  LA 
Sbjct  445   VGSSDDFQDSA---QNPSLKKFVMDAALEDKLCDLYDIFVDGLDEDPGPEIRKLYVNLAE  501

Query  1790  YWPNGFMDNHGIKRAICRAKDRRKTLY---NRHKNQEKM-RRNKISAQKEEEGYRVETTT  1957
              WPN  MD +GIKRAICRAK+R++  Y    +  +Q KM +R K    + +   +  T +
Sbjct  502   LWPNRLMDKNGIKRAICRAKERQRASYGNLGKEMDQTKMKKRRKQLVPRTDWTAQPNTGS  561

Query  1958  RDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRP--KPEKVK  2131
               Q  Q  EK  VDA      AT+  + ST  I             +S DR   + EK+K
Sbjct  562   VVQKQQSGEKMTVDA-----NATSTSLISTQTI-----------ADSSRDRSNQQHEKLK  605

Query  2132  GTGNSTDRHITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAP----V  2299
             G+ +S +      A   + +K+K EP + E Q +   L+ K+ E+ PQ  + AAP    +
Sbjct  606   GSSSSCN-----PAEVTRVVKKKVEPVMAEKQVV---LALKRQEH-PQTRVIAAPQNLDI  656

Query  2300  PKPSIQLNEP  2329
              +  + LN P
Sbjct  657   AETPLDLNLP  666



>emb|CDX88358.1| BnaC06g38020D [Brassica napus]
Length=678

 Score =   435 bits (1119),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 285/604 (47%), Positives = 372/604 (62%), Gaps = 64/604 (11%)
 Frame = +2

Query  176   KPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngn  355
             K   D GS+ GE    + S     AG R+   VELR GETT VSWKKL+KEA+       
Sbjct  5     KAATDGGSASGESS--KPSAKLLTAGDRKLLKVELRQGETTYVSWKKLMKEAS-------  55

Query  356   gapgpaprasaaaaELQPLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKI  529
                          + +  +  PP N +P      +P  PVE E  D P  NR NAVIEKI
Sbjct  56    ---------KGNCSLVSAIDAPPPNANPNLESRIAPGVPVEGETVDQPHSNRFNAVIEKI  106

Query  530   ERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLE  709
             ERLY+G+ S D E+LD  PD+DEYDTEDSFIDD ELD+YF+VD+SAIKHDGFFVN+G+LE
Sbjct  107   ERLYMGRDSSDGEELDGAPDDDEYDTEDSFIDDVELDEYFEVDDSAIKHDGFFVNKGELE  166

Query  710   RIEP--TSQQNQLPNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPS  880
             RI P  T+  N+ P KR++K+  K C    D     +K AK+ K  G     AA   SP 
Sbjct  167   RIAPSTTTTSNKQPKKRKRKESAKPCGDVVDVS---SKQAKIAKTVGGKDQSAASGLSPK  223

Query  881   YGVVMPTLYRENAN-VHNQEVNFDMQKAEVLHS-------KNVVDKLKESSETS------  1018
                  P   +++ + +  Q  N  +    V HS       +N      +++E+S      
Sbjct  224   KKSNDPKTVQDSVSPLKVQSGNDSLSLENVKHSDKANHQPRNTTSPKSKAAESSVALHLK  283

Query  1019  -----NQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQ  1183
                  +Q+SN   SVP     G+S  I        +Q E + ++DQ    +A   ++S Q
Sbjct  284   CSKSAHQQSN---SVP-----GKSRPIVLEKSTVARQKENNGMHDQD---NATVSRQSNQ  332

Query  1184  TVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQKL  1360
               ++ GS+V+ K + LEKA R+LEK VAESRPP A + QD D SSQ +KRRLP +IK KL
Sbjct  333   ITKKGGSNVKPKTSTLEKAFRELEKVVAESRPPAATDNQDADTSSQVVKRRLPGDIKLKL  392

Query  1361  AKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQI  1540
             AKVAR AQASHG LS ELINRLMSIVGHL+Q+R+LKRNLKIMI+ G SAK+E D R Q I
Sbjct  393   AKVARIAQASHGNLSGELINRLMSIVGHLIQVRSLKRNLKIMIDSGDSAKRENDTRFQSI  452

Query  1541  KREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYD  1720
             K EV E +K +VPLM+ +A   + GTSDDF++       + K+K+ MD ALE+++CDLYD
Sbjct  453   KNEVIETLKTQVPLMEPQATNHEAGTSDDFEN----PPPSTKKKFVMDEALEDKLCDLYD  508

Query  1721  LYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY---NRHKNQE  1891
             ++V+GL+ED+GPQ+RKLYA LA  WPN  MDNHGIKRAICRAK+RR+ L+    +  +Q 
Sbjct  509   IFVDGLDEDSGPQIRKLYANLAELWPNRLMDNHGIKRAICRAKERRRALHANLGKEMDQG  568

Query  1892  KMRR  1903
             KM++
Sbjct  569   KMKK  572



>ref|XP_010537362.1| PREDICTED: ubinuclein-1-like isoform X2 [Tarenaya hassleriana]
Length=681

 Score =   435 bits (1118),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 285/591 (48%), Positives = 366/591 (62%), Gaps = 38/591 (6%)
 Frame = +2

Query  194   GSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpa  373
             GS+ GE    R S      G R+ F VE+RPGETT VSWKK +KEA  +  +    P P 
Sbjct  10    GSTHGESN--RASQKVVTVGDRKLFYVEVRPGETTYVSWKKFMKEACKVNGSSTSVPEPP  67

Query  374   prasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQ  553
             P A+     L P++        G       P E E  D P  NR +AVIEKIERLY+GK 
Sbjct  68    PSANPNLECLVPVLRSAAITILG------HPAENEKVDQP--NRFSAVIEKIERLYMGKD  119

Query  554   SdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQ  733
             S D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGFFVNRGKLERIEP++  
Sbjct  120   SSDGEELDSSPDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFFVNRGKLERIEPSATS  179

Query  734   NQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGVVMPTLYR  910
             NQ   KRR+K+  K   G  D   PNK AKV K A GK     +G SS            
Sbjct  180   NQQLKKRRRKESAKPGGGVTDV--PNKQAKVAKMARGKDRSKHSGQSSKKRSNDPKAAQD  237

Query  911   ENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANISN  1090
               ++   Q VN  +   +  +S     +LK ++    +      + PQ+  S  +   SN
Sbjct  238   SFSSFRVQSVNASLPLEDTKYSDKTNHELKNAASRKAKEVGSSDAFPQKCRSKIAHQQSN  297

Query  1091  GL----------DQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR------RDGSSVRSKI  1222
              +          + +  + EK+ ++D    A+A   + S Q  R      +D S+VR K 
Sbjct  298   AMPVKSPHNHVAEAACTKKEKNDMHDL---ANATGSRHSIQKARPFSAQKKDSSNVRPKT  354

Query  1223  TMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKL  1402
             ++L+KAIR+LEK VA+SRP N   Q+ D +SQ +KRRLP E+K KL KVAR   A  GKL
Sbjct  355   SLLDKAIRELEKVVADSRPEN---QEADTTSQGVKRRLPKEVKAKLDKVARIV-AKEGKL  410

Query  1403  SKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPL  1582
             S ELINRLMSIVGHL+QLR+LKRNLKIMI+  LS  +++D+R Q IK+EVAEMIK +VPL
Sbjct  411   SAELINRLMSIVGHLIQLRSLKRNLKIMIDESLSFNRKRDDRFQGIKKEVAEMIKTQVPL  470

Query  1583  MKSKAIEQQP-GTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQ  1759
             M+S+  EQQ  GTS DF   A  EK   K+K+ MD  LE++ICDLYD++V+GL+EDAGPQ
Sbjct  471   MESQTDEQQAAGTSSDFHDDAAVEKAPLKKKFVMDARLEDKICDLYDIFVDGLDEDAGPQ  530

Query  1760  VRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKI  1912
             +RKLY ELA  WP+  MDNHGIKRAICRAK+RR+  YN  +N +KM++  +
Sbjct  531   IRKLYVELAELWPDRLMDNHGIKRAICRAKERRRASYN-MENMKKMKQQSV  580



>ref|XP_010537363.1| PREDICTED: ubinuclein-1-like isoform X3 [Tarenaya hassleriana]
Length=672

 Score =   433 bits (1114),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 283/593 (48%), Positives = 363/593 (61%), Gaps = 51/593 (9%)
 Frame = +2

Query  194   GSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpa  373
             GS+ GE    R S      G R+ F VE+RPGETT VSWKK +KEA  +  +    P   
Sbjct  10    GSTHGESN--RASQKVVTVGDRKLFYVEVRPGETTYVSWKKFMKEACKVNGSSTSVPE--  65

Query  374   prasaaaaELQPLILPPHNDSPG-PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGK  550
                            PP + +P      P  P E E  D P  NR +AVIEKIERLY+GK
Sbjct  66    ---------------PPPSANPNLECLVPGHPAENEKVDQP--NRFSAVIEKIERLYMGK  108

Query  551   QSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTS  727
              S D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGFFVNRGKLERI EP++
Sbjct  109   DSSDGEELDSSPDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFFVNRGKLERISEPSA  168

Query  728   QQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGVVMPTL  904
               NQ   KRR+K+  K   G  D   PNK AKV K A GK     +G SS          
Sbjct  169   TSNQQLKKRRRKESAKPGGGVTDV--PNKQAKVAKMARGKDRSKHSGQSSKKRSNDPKAA  226

Query  905   YRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANI  1084
                 ++   Q VN  +   +  +S     +LK ++    +      + PQ+  S  +   
Sbjct  227   QDSFSSFRVQSVNASLPLEDTKYSDKTNHELKNAASRKAKEVGSSDAFPQKCRSKIAHQQ  286

Query  1085  SNGL----------DQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR------RDGSSVRS  1216
             SN +          + +  + EK+ ++D    A+A   + S Q  R      +D S+VR 
Sbjct  287   SNAMPVKSPHNHVAEAACTKKEKNDMHDL---ANATGSRHSIQKARPFSAQKKDSSNVRP  343

Query  1217  KITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHG  1396
             K ++L+KAIR+LEK VA+SRP N   Q+ D +SQ +KRRLP E+K KL KVAR   A  G
Sbjct  344   KTSLLDKAIRELEKVVADSRPEN---QEADTTSQGVKRRLPKEVKAKLDKVARIV-AKEG  399

Query  1397  KLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRV  1576
             KLS ELINRLMSIVGHL+QLR+LKRNLKIMI+  LS  +++D+R Q IK+EVAEMIK +V
Sbjct  400   KLSAELINRLMSIVGHLIQLRSLKRNLKIMIDESLSFNRKRDDRFQGIKKEVAEMIKTQV  459

Query  1577  PLMKSKAIEQQP-GTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAG  1753
             PLM+S+  EQQ  GTS DF   A  EK   K+K+ MD  LE++ICDLYD++V+GL+EDAG
Sbjct  460   PLMESQTDEQQAAGTSSDFHDDAAVEKAPLKKKFVMDARLEDKICDLYDIFVDGLDEDAG  519

Query  1754  PQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKI  1912
             PQ+RKLY ELA  WP+  MDNHGIKRAICRAK+RR+  YN  +N +KM++  +
Sbjct  520   PQIRKLYVELAELWPDRLMDNHGIKRAICRAKERRRASYN-MENMKKMKQQSV  571



>ref|XP_008805860.1| PREDICTED: ubinuclein-1-like isoform X1 [Phoenix dactylifera]
Length=782

 Score =   437 bits (1123),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 324/765 (42%), Positives = 438/765 (57%), Gaps = 112/765 (15%)
 Frame = +2

Query  242   EAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILP  421
             E+A  R RFTVELRPGETTIVSWK+L+++++  ++                     +  P
Sbjct  48    ESASQRLRFTVELRPGETTIVSWKRLVRDSSKGRN---------------------VFPP  86

Query  422   PHNDSPGPGFSP---EQPVEKEAKDA-PPGNRLNAVIEKIERLYVGKQSdddedlddvpd  589
             P    P  G         VE E KDA  P NR +AVIEKIERLY+GKQS D+EDLD+ PD
Sbjct  87    PSGAEPAFGTHAGPAAATVEDELKDAVAPPNRFSAVIEKIERLYMGKQSSDEEDLDEAPD  146

Query  590   edeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQ  769
             +D+YDTEDSFIDD ELD+YFQVD    K+DG+FVN+GKLE +EP +  N  P KRR+KD 
Sbjct  147   DDQYDTEDSFIDDAELDEYFQVDKLRTKYDGYFVNKGKLEHVEPMASFNVAPKKRRRKDS  206

Query  770   TKCQSGSDDGCNPNKPAKVG----KKAGKSVPLAAGTSSPSYGVV-MP------------  898
             TK     D    PN+  K+G    K A ++ PL     S +  V+ +P            
Sbjct  207   TKVYRKRDHQHGPNESVKMGNMRIKAAARNAPLVGKKLSSTADVLALPYFEHYYEESKPV  266

Query  899   ------------------TLYREN---ANVHNQEV--------NFDMQKAEVLHSKNVVD  991
                               TL+ EN     V N++V        +FD  KA V+ S ++V 
Sbjct  267   KKILNAPAGAYKKRSSDLTLHLENPPSVKVPNKDVPSLPLESKDFDKHKAVVIPSDDLVH  326

Query  992   KLKESSETSN---QRSNERISVPQEKSSGRSANISNG----LDQSFQQGEKSVIYDQRLD  1150
             K + +  + +   Q S ++    Q +   R   + NG    L    ++ EK    +  + 
Sbjct  327   KSRGTGNSLDPMYQASQDKGVSSQVEFQSR--RLLNGEIEELSAKIRRKEKHGTCEFPMQ  384

Query  1151  ASAPEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKR  1330
             A  P  +R      ++GS+VR K T LE+AIRDLEK VA SRPP+ +VQ+ D SSQ +KR
Sbjct  385   AVQPTFRRV-----KEGSTVRPKGTTLERAIRDLEKIVAVSRPPSIDVQEMDPSSQGVKR  439

Query  1331  RLPPEIKQKLAKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSA  1507
             RLP ++KQKLAKVAR + AS GK+S+ +LI+RLM I+GHLVQ +TLKRN+K M+ +GLSA
Sbjct  440   RLPQDVKQKLAKVARLS-ASQGKVSEDDLIDRLMGILGHLVQRKTLKRNMKEMVELGLSA  498

Query  1508  KQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQS-IATEEKEAFKRKYCMD  1684
             KQ+K +R QQ+K+EV EMI+ RV  MKSK       ++DDFQ  I  +E+ A K KY MD
Sbjct  499   KQQKADRFQQVKKEVHEMIRARVSNMKSKD-----ASADDFQEVINNDERRALKGKYSMD  553

Query  1685  NALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKT  1864
             +ALE++ICDLYDLYVEG++ED GPQ RKLY ELA  WP+G+MDN GIK AI R+K+R++ 
Sbjct  554   SALEDKICDLYDLYVEGMDEDKGPQSRKLYVELAELWPHGYMDNVGIKDAIYRSKERKRV  613

Query  1865  LYNRHK--NQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPI  2038
             LY  HK  ++E+++R K++A       RVET    Q    QE+   D+      +  K +
Sbjct  614   LYRPHKVRDEERIKRKKLAA-----AVRVETNPAAQVWAGQERPVTDSIGAVLISPGKLV  668

Query  2039  SSTAAINMVGRIPVPSP----GGTSLDRPKPEKVKGTGNSTDRHITTDALT--KKKMKRK  2200
             S+     ++GRI  P+P     G       P+KV+G   S      + A+   KKKMKRK
Sbjct  669   SNQPPA-LLGRITDPTPPSSDSGQQHGLKNPDKVRGGSMSMILEDGSKAVVDMKKKMKRK  727

Query  2201  PEPELGEGQYLPEKLSSKQAE--YKPQEPIAAAPV---PKPSIQL  2320
              E ELG     P K+ S+  +  +K Q+      V   PKP I L
Sbjct  728   SESELGYIHVHPRKVPSQHTKESHKSQKLTDDTNVSQQPKPVIPL  772



>ref|XP_009106395.1| PREDICTED: uncharacterized protein LOC103832183 isoform X1 [Brassica 
rapa]
Length=679

 Score =   430 bits (1106),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 286/609 (47%), Positives = 372/609 (61%), Gaps = 73/609 (12%)
 Frame = +2

Query  176   KPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngn  355
             K   D GS+ GE    + S     AG R+   VELR GETT VSWKKL+KEA+       
Sbjct  5     KAATDGGSASGESS--KPSAKLLTAGDRRLLKVELRQGETTYVSWKKLMKEAS-------  55

Query  356   gapgpaprasaaaaELQPLI-LPPHNDSP------GPGFSPEQPVEKEAKDAPPGNRLNA  514
                            L  +I  PP N +P       PG   +QPVE E  D P  NR NA
Sbjct  56    ----------KGNCSLVSVIDAPPPNANPNLESRIAPG---QQPVEGETVDQPHSNRFNA  102

Query  515   VIEKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVN  694
             VIEKIERLY+G+ S D E+LD  PD+DEYDTEDSFIDD ELD+YF+VD+SAIKHDGFFVN
Sbjct  103   VIEKIERLYMGRDSSDGEELDGAPDDDEYDTEDSFIDDVELDEYFEVDDSAIKHDGFFVN  162

Query  695   RGKLERIEP--TSQQNQLPNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKK-AGKSVPLAA  862
             +G+LERI P  T+  N+ P KR++K+  K C    D     +K AK+ K   GK    A+
Sbjct  163   KGELERIAPSTTTTSNKQPKKRKRKESAKPCGDVVDVS---SKQAKIAKTVGGKDQSAAS  219

Query  863   GTSSPSYGVVMPTLYRENANVHNQEVNFDMQKAEVLHS-------KNVVDKLKES-----  1006
             G           T+    + +  Q  N  +    V HS       +N      ++     
Sbjct  220   GLCPKKKSNDTKTVQDSVSPLKVQSGNDSLSLENVKHSDKANPQPRNTTSPKSKAAGSSG  279

Query  1007  ------SETSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEG  1168
                   S++++Q+SN   SVP     G+S  I        +Q E + ++DQ    +A   
Sbjct  280   ALHLKCSKSAHQQSN---SVP-----GKSRPIVLEKSTVARQKENNGMHDQD---NATVS  328

Query  1169  KRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPE  1345
             ++S Q  ++ GS+V+ K + LEKA R+LEK VAESRPP A + QD D SSQ +KRRLP +
Sbjct  329   RQSNQITKKGGSNVKPKTSTLEKAFRELEKVVAESRPPTATDNQDADTSSQVVKRRLPGD  388

Query  1346  IKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDN  1525
             +K KLAKVAR AQAS G LS ELINRLMSIVGHL+Q+R+LKRNLKIMI+ G SAK+E D 
Sbjct  389   VKLKLAKVARIAQASQGNLSGELINRLMSIVGHLIQVRSLKRNLKIMIDSGDSAKRENDT  448

Query  1526  RVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRI  1705
             R Q IK EV E +K +VPLM+ +A  Q+ GTSDDF++       + K+K+ MD ALE+++
Sbjct  449   RFQSIKNEVIETLKTQVPLMEPQATNQEAGTSDDFEN----PPPSTKKKFVMDEALEDKL  504

Query  1706  CDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY---NR  1876
             CDLYD++V+GL+ED+GPQ+RKLYA LA  WPN  MDNHGIKRAICRAK+RR+ L+    +
Sbjct  505   CDLYDIFVDGLDEDSGPQIRKLYANLAELWPNRLMDNHGIKRAICRAKERRRALHANLGK  564

Query  1877  HKNQEKMRR  1903
               +Q KM++
Sbjct  565   EMDQGKMKK  573



>ref|XP_010537361.1| PREDICTED: ubinuclein-1-like isoform X1 [Tarenaya hassleriana]
Length=682

 Score =   430 bits (1105),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 285/592 (48%), Positives = 366/592 (62%), Gaps = 39/592 (7%)
 Frame = +2

Query  194   GSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpa  373
             GS+ GE    R S      G R+ F VE+RPGETT VSWKK +KEA  +  +    P P 
Sbjct  10    GSTHGESN--RASQKVVTVGDRKLFYVEVRPGETTYVSWKKFMKEACKVNGSSTSVPEPP  67

Query  374   prasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQ  553
             P A+     L P++        G       P E E  D P  NR +AVIEKIERLY+GK 
Sbjct  68    PSANPNLECLVPVLRSAAITILG------HPAENEKVDQP--NRFSAVIEKIERLYMGKD  119

Query  554   SdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQ  730
             S D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGFFVNRGKLERI EP++ 
Sbjct  120   SSDGEELDSSPDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFFVNRGKLERISEPSAT  179

Query  731   QNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGVVMPTLY  907
              NQ   KRR+K+  K   G  D   PNK AKV K A GK     +G SS           
Sbjct  180   SNQQLKKRRRKESAKPGGGVTDV--PNKQAKVAKMARGKDRSKHSGQSSKKRSNDPKAAQ  237

Query  908   RENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANIS  1087
                ++   Q VN  +   +  +S     +LK ++    +      + PQ+  S  +   S
Sbjct  238   DSFSSFRVQSVNASLPLEDTKYSDKTNHELKNAASRKAKEVGSSDAFPQKCRSKIAHQQS  297

Query  1088  NGL----------DQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR------RDGSSVRSK  1219
             N +          + +  + EK+ ++D    A+A   + S Q  R      +D S+VR K
Sbjct  298   NAMPVKSPHNHVAEAACTKKEKNDMHDL---ANATGSRHSIQKARPFSAQKKDSSNVRPK  354

Query  1220  ITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGK  1399
              ++L+KAIR+LEK VA+SRP N   Q+ D +SQ +KRRLP E+K KL KVAR   A  GK
Sbjct  355   TSLLDKAIRELEKVVADSRPEN---QEADTTSQGVKRRLPKEVKAKLDKVARIV-AKEGK  410

Query  1400  LSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVP  1579
             LS ELINRLMSIVGHL+QLR+LKRNLKIMI+  LS  +++D+R Q IK+EVAEMIK +VP
Sbjct  411   LSAELINRLMSIVGHLIQLRSLKRNLKIMIDESLSFNRKRDDRFQGIKKEVAEMIKTQVP  470

Query  1580  LMKSKAIEQQP-GTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGP  1756
             LM+S+  EQQ  GTS DF   A  EK   K+K+ MD  LE++ICDLYD++V+GL+EDAGP
Sbjct  471   LMESQTDEQQAAGTSSDFHDDAAVEKAPLKKKFVMDARLEDKICDLYDIFVDGLDEDAGP  530

Query  1757  QVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKI  1912
             Q+RKLY ELA  WP+  MDNHGIKRAICRAK+RR+  YN  +N +KM++  +
Sbjct  531   QIRKLYVELAELWPDRLMDNHGIKRAICRAKERRRASYN-MENMKKMKQQSV  581



>emb|CDX87526.1| BnaA07g33470D [Brassica napus]
Length=678

 Score =   429 bits (1103),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 284/605 (47%), Positives = 370/605 (61%), Gaps = 66/605 (11%)
 Frame = +2

Query  176   KPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngn  355
             K   D GS+ GE    + S     AG R+   VELR GETT VSWKKL+KEA+       
Sbjct  5     KAATDGGSASGESS--KPSAKLLTAGDRRLLKVELRQGETTYVSWKKLMKEAS-------  55

Query  356   gapgpaprasaaaaELQPLI-LPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEK  526
                            L  +I  PP N +P      +P  PVE E  D P  NR NAVIEK
Sbjct  56    ----------KGNCSLVSVIDAPPPNANPNLESRIAPGVPVEGETVDQPHSNRFNAVIEK  105

Query  527   IERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKL  706
             IERLY+G+ S D E+LD  PD+DEYDTEDSFIDD ELD+YF+VD+SAIKHDGFFVN+G+L
Sbjct  106   IERLYMGRDSSDGEELDGAPDDDEYDTEDSFIDDVELDEYFEVDDSAIKHDGFFVNKGEL  165

Query  707   ERIEP--TSQQNQLPNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKK-AGKSVPLAAGTSS  874
             ERI P  T+  N+ P KR++K+  K C    D     +K AK+ K   GK    A+G   
Sbjct  166   ERIAPSTTTTSNKQPKKRKRKESAKPCGDVVDVS---SKQAKIAKTVGGKDQSAASGLCP  222

Query  875   PSYGVVMPTLYRENANVHNQEVNFDMQKAEVLHS-------KNVVDKLKES---------  1006
                     T+    + +  Q  N  +    V HS       +N      ++         
Sbjct  223   KKKSNDTKTVQDSVSPLKVQSGNDSLSLENVKHSDKANPQPRNTTSPKSKAAGSSGALHL  282

Query  1007  --SETSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRST  1180
               S++++Q+SN   SVP     G+S  I        +Q E + ++DQ    +A   ++S 
Sbjct  283   KCSKSAHQQSN---SVP-----GKSRPIVLEKSTVARQKENNGMHDQD---NATVSRQSN  331

Query  1181  QTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQK  1357
             Q  ++ GS+V+ K + LEKA R+LEK VAESRPP A + QD D SSQ +KRRLP ++K K
Sbjct  332   QITKKGGSNVKPKTSTLEKAFRELEKVVAESRPPTATDNQDADTSSQVVKRRLPGDVKLK  391

Query  1358  LAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQ  1537
             LAKVAR AQAS G LS ELINRLMSIVGHL+Q+R+LKRNLKIMI+ G SAK+E D R Q 
Sbjct  392   LAKVARIAQASQGNLSGELINRLMSIVGHLIQVRSLKRNLKIMIDSGDSAKRENDTRFQS  451

Query  1538  IKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLY  1717
             IK EV E +K +VPLM+ +A  Q+ GTSDDF++       + K+K+ MD ALE+++CDLY
Sbjct  452   IKNEVIETLKTQVPLMEPQATNQEAGTSDDFEN----PPPSTKKKFVMDEALEDKLCDLY  507

Query  1718  DLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY---NRHKNQ  1888
             D++V+GL+ED+GPQ+RKLYA LA  WPN  MDNHGIKRAICRAK+RR+ L+    +  +Q
Sbjct  508   DIFVDGLDEDSGPQIRKLYANLAELWPNRLMDNHGIKRAICRAKERRRALHANLGKEMDQ  567

Query  1889  EKMRR  1903
              KM++
Sbjct  568   GKMKK  572



>ref|XP_010905321.1| PREDICTED: LOW QUALITY PROTEIN: ubinuclein-1-like [Elaeis guineensis]
Length=791

 Score =   431 bits (1107),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 323/763 (42%), Positives = 432/763 (57%), Gaps = 109/763 (14%)
 Frame = +2

Query  257   RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDS  436
             R RF VELRPGETTIVSWK+LL+++   ++                        PP    
Sbjct  53    RLRFAVELRPGETTIVSWKRLLRDSGKGRNA----------------------FPPSGAE  90

Query  437   PGPGFSP---EQPVEKEAKDA-PPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeyd  604
             P  G        PVE E KDA PP NR +AVIEKIERLY+GK S D+EDLD+ PD+D+YD
Sbjct  91    PAFGTHAGPATAPVENELKDAVPPPNRFSAVIEKIERLYMGKHSSDEEDLDEAPDDDQYD  150

Query  605   tedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQS  784
             TEDSFIDD ELD+YFQVD    K+DG+FVN+GKLE +EP +  N  P KRR+KD TK   
Sbjct  151   TEDSFIDDAELDEYFQVDKLRTKYDGYFVNKGKLEHVEPMASSNVAPKKRRRKDSTKVHG  210

Query  785   GSDDGCNPNKPAKVG----KKAGKSVPLAAG-TSSPSYGVVMP-----------------  898
               D    PN+  K+G    K A ++ PL     SSP+  + +P                 
Sbjct  211   KRDHQHGPNESVKMGNMRIKAAARNAPLVGKKLSSPAEVLALPYFEHYYEESKPVKNKLN  270

Query  899   -------------TLYREN---ANVHNQEV--------NFDMQKAEVLHSKNVVDKLKES  1006
                          T++ EN     V N++V        +FD   A V+   ++  K + +
Sbjct  271   APAGSYRKRSSDLTVHLENPPSVKVPNKDVPSLPLESKDFDKHNAGVMPPNDLAHKSRGT  330

Query  1007  SETSN---QRSNER-ISVPQEKSSGRSANISNG-LDQSFQQGEK---SVIYDQRLDASAP  1162
             S + +   Q + ++ +S   E  S R  N  N  L    ++ EK   +   D     S  
Sbjct  331   SNSFDPMYQATQDKGVSSQVEFQSRRLLNGENEELSVKIRRKEKYGTAEFPDTNSSGSIY  390

Query  1163  EGKRSTQTVRR--DGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRL  1336
               +    T RR  +GS+VR K T LE+AIRDLEK VAESRPP+ +VQ+ D SSQ +KRRL
Sbjct  391   PMQAEQPTFRRMKEGSTVRPKGTTLERAIRDLEKIVAESRPPSIDVQEMDPSSQGVKRRL  450

Query  1337  PPEIKQKLAKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQ  1513
             P E+KQKLAKVAR + AS GK+S+ +LI+RLM I+GHLVQ +TLKRN+K M+ +GLSAKQ
Sbjct  451   PQEVKQKLAKVARLS-ASQGKVSEDDLIDRLMGILGHLVQRKTLKRNMKEMVELGLSAKQ  509

Query  1514  EKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQS-IATEEKEAFKRKYCMDNA  1690
             +K +R QQIK+EV EMI+ RV  MKSK       ++DDFQ  I+  E+ A K KY MD A
Sbjct  510   QKADRFQQIKKEVHEMIRARVLNMKSKD-----ASADDFQEVISNVERRALKGKYSMDAA  564

Query  1691  LENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY  1870
             LE++ICDLYDLYVEG++ED GPQ RKLY ELA  WP+G+MDN GIK AI R+K+R++ LY
Sbjct  565   LEDKICDLYDLYVEGMDEDKGPQSRKLYVELAELWPHGYMDNVGIKDAIYRSKERKRGLY  624

Query  1871  NRHK--NQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISS  2044
               HK  ++E+++R K++A       RVET    Q    QE+   D+      + +K +S+
Sbjct  625   RPHKVRDEERIKRKKLAA-----AVRVETNPAGQVWAGQERPVTDSTGPVLISPDKLVSN  679

Query  2045  TAAINMVGRI--PVP--SPGGTSLDRPKPEKVKGTGNSTDRHITTDALT--KKKMKRKPE  2206
                  ++GRI  P+P  S  G       P+K +G          + A+   KK+MKRK E
Sbjct  680   QPPA-LLGRITDPIPPSSDSGQQHGLKNPDKARGGSMGMIPEDGSKAVVDMKKRMKRKSE  738

Query  2207  PELGEGQYLPEKL-----SSKQAEYKPQEPIAAAPVPKPSIQL  2320
              ELG+    P K+       +Q   K  +    +  PKP+I L
Sbjct  739   SELGDIHVHPLKVPLQHAKERQKSQKLTDDTNVSQQPKPTIPL  781



>gb|KFK42129.1| hypothetical protein AALP_AA2G214600 [Arabis alpina]
Length=694

 Score =   427 bits (1097),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 276/585 (47%), Positives = 363/585 (62%), Gaps = 56/585 (10%)
 Frame = +2

Query  182   PIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT-GLQsngng  358
             PID GS+ GE    ++S     +G R+   V+L   ETTIVSWKKL+KEA+ G+ S+   
Sbjct  7     PIDVGSNSGESA--KLSPKLLFSGDRKLLKVKLLEEETTIVSWKKLMKEASKGIVSSSVA  64

Query  359   apgpaprasaaaaELQPLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIE  532
                                 PP N +P      +P  P E E  D P  NR NAVIEKIE
Sbjct  65    HE------------------PPPNANPNLESRIAPGPPAEGEVADQPHSNRFNAVIEKIE  106

Query  533   RLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER  712
             RLY+GK S D E+LD  PD+DEYDTEDSFIDD ELD YF+VDNSAIKHDGFFVNRGKLER
Sbjct  107   RLYMGKDSSDGEELDGAPDDDEYDTEDSFIDDVELDAYFEVDNSAIKHDGFFVNRGKLER  166

Query  713   IEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGV  889
             IEP++  NQ P KR++K+  K    + D     K +K+ K A GK   +A+G SS     
Sbjct  167   IEPSTTSNQQPKKRKRKESAKPNGDAVDVS--RKQSKMVKTAGGKDQSVASGPSSKK---  221

Query  890   VMPTLYRENANVHNQEVN--FDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKS  1063
                TL    A   ++ V   F + K +  +    ++  K + + ++Q  N   + P+ K 
Sbjct  222   ---TLSDAKAVEDSKAVQDPFPLSKVQNGNDSLFLENAKHTDKANDQPRN--ATSPKSKG  276

Query  1064  SGRSANIS-NGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQT--------------VRRD  1198
             +G SAN++    ++   Q   S+    R + SA    +ST                 ++ 
Sbjct  277   AGSSANLNPKCSNKGAHQQSNSMPGKSRPNVSA----KSTDVRHKENNGMHDLDNATKKG  332

Query  1199  GSSVRSKITMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVAR  1375
             GS+VR K + L+KAIR+LEK VAESRPP A E QD D +SQA+KRRLP ++K KLAKVAR
Sbjct  333   GSNVRPKTSSLDKAIRELEKVVAESRPPTATENQDADIASQAVKRRLPTDVKLKLAKVAR  392

Query  1376  YAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVA  1555
              A A  G +S ELI RLMSIVGHL+Q+R+LKR+LK MI+ G SA +EKD R Q IK EV 
Sbjct  393   IAPARQGNISGELIKRLMSIVGHLIQVRSLKRHLKTMIDSGDSANREKDTRFQLIKNEVI  452

Query  1556  EMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEG  1735
             EM+K +VPL++S+A  Q+ GTSDDFQ + + EK   K+K+ +D  LE+++CDLYD+Y++G
Sbjct  453   EMLKTQVPLVESQATNQEAGTSDDFQDVGSFEKAVLKKKFVIDAVLEDKLCDLYDIYIDG  512

Query  1736  LEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY  1870
             L+ED GPQ+RKLYA LA  WPN  MD + IK AICRAK+RR+ L+
Sbjct  513   LDEDVGPQIRKLYASLAELWPNKVMDKNQIKHAICRAKERRRALH  557



>ref|XP_010537365.1| PREDICTED: ubinuclein-1-like isoform X5 [Tarenaya hassleriana]
Length=571

 Score =   422 bits (1086),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 280/576 (49%), Positives = 356/576 (62%), Gaps = 38/576 (7%)
 Frame = +2

Query  194   GSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpa  373
             GS+ GE    R S      G R+ F VE+RPGETT VSWKK +KEA  +  +    P P 
Sbjct  10    GSTHGESN--RASQKVVTVGDRKLFYVEVRPGETTYVSWKKFMKEACKVNGSSTSVPEPP  67

Query  374   prasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQ  553
             P A+     L P++        G       P E E  D P  NR +AVIEKIERLY+GK 
Sbjct  68    PSANPNLECLVPVLRSAAITILG------HPAENEKVDQP--NRFSAVIEKIERLYMGKD  119

Query  554   SdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQ  730
             S D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGFFVNRGKLERI EP++ 
Sbjct  120   SSDGEELDSSPDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFFVNRGKLERISEPSAT  179

Query  731   QNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGVVMPTLY  907
              NQ   KRR+K+  K   G  D   PNK AKV K A GK     +G SS           
Sbjct  180   SNQQLKKRRRKESAKPGGGVTDV--PNKQAKVAKMARGKDRSKHSGQSSKKRSNDPKAAQ  237

Query  908   RENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANIS  1087
                ++   Q VN  +   +  +S     +LK ++    +      + PQ+  S  +   S
Sbjct  238   DSFSSFRVQSVNASLPLEDTKYSDKTNHELKNAASRKAKEVGSSDAFPQKCRSKIAHQQS  297

Query  1088  NGL----------DQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR------RDGSSVRSK  1219
             N +          + +  + EK+ ++D    A+A   + S Q  R      +D S+VR K
Sbjct  298   NAMPVKSPHNHVAEAACTKKEKNDMHDL---ANATGSRHSIQKARPFSAQKKDSSNVRPK  354

Query  1220  ITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGK  1399
              ++L+KAIR+LEK VA+SRP N   Q+ D +SQ +KRRLP E+K KL KVAR   A  GK
Sbjct  355   TSLLDKAIRELEKVVADSRPEN---QEADTTSQGVKRRLPKEVKAKLDKVARIV-AKEGK  410

Query  1400  LSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVP  1579
             LS ELINRLMSIVGHL+QLR+LKRNLKIMI+  LS  +++D+R Q IK+EVAEMIK +VP
Sbjct  411   LSAELINRLMSIVGHLIQLRSLKRNLKIMIDESLSFNRKRDDRFQGIKKEVAEMIKTQVP  470

Query  1580  LMKSKAIEQQP-GTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGP  1756
             LM+S+  EQQ  GTS DF   A  EK   K+K+ MD  LE++ICDLYD++V+GL+EDAGP
Sbjct  471   LMESQTDEQQAAGTSSDFHDDAAVEKAPLKKKFVMDARLEDKICDLYDIFVDGLDEDAGP  530

Query  1757  QVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKT  1864
             Q+RKLY ELA  WP+  MDNHGIKRAICRAK+RR+ 
Sbjct  531   QIRKLYVELAELWPDRLMDNHGIKRAICRAKERRRA  566



>ref|XP_009106396.1| PREDICTED: uncharacterized protein LOC103832183 isoform X2 [Brassica 
rapa]
Length=678

 Score =   426 bits (1096),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 282/609 (46%), Positives = 365/609 (60%), Gaps = 74/609 (12%)
 Frame = +2

Query  176   KPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngn  355
             K   D GS+ GE    + S     AG R+   VELR GETT VSWKKL+KEA+       
Sbjct  5     KAATDGGSASGESS--KPSAKLLTAGDRRLLKVELRQGETTYVSWKKLMKEAS-------  55

Query  356   gapgpaprasaaaaELQPLI-LPPHNDSP------GPGFSPEQPVEKEAKDAPPGNRLNA  514
                            L  +I  PP N +P       PG   +QPVE E  D P  NR NA
Sbjct  56    ----------KGNCSLVSVIDAPPPNANPNLESRIAPG---QQPVEGETVDQPHSNRFNA  102

Query  515   VIEKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVN  694
             VIEKIERLY+G+ S D E+LD  PD+DEYDTEDSFIDD ELD+YF+VD+SAIKHDGFFVN
Sbjct  103   VIEKIERLYMGRDSSDGEELDGAPDDDEYDTEDSFIDDVELDEYFEVDDSAIKHDGFFVN  162

Query  695   RGKLERIEP--TSQQNQLPNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKKAGKSVPLAAG  865
             +G+LERI P  T+  N+ P KR++K+  K C    D     +K AK+ K  G        
Sbjct  163   KGELERIAPSTTTTSNKQPKKRKRKESAKPCGDVVDVS---SKQAKIAKTVG------GK  213

Query  866   TSSPSYGVVMPTLYRENANVHNQEVNFDMQKA-EVLHSKNVVDKLKESSETSNQRSNERI  1042
               S + G+       +   V +      +Q   + L  +NV    K S + + Q  N   
Sbjct  214   DQSAASGLCPKKKSNDTKTVQDSVSPLKVQSGNDSLSLENV----KHSDKANPQPRN--T  267

Query  1043  SVPQEKSSGRSANISNGLDQSFQQG-------------EKSVIYDQR-----LDASAPEG  1168
             + P+ K++G S  +     +S  Q              EKS +  Q+      D      
Sbjct  268   TSPKSKAAGSSGALHLKCSKSAHQQSNSVPGKSRPIVLEKSTVARQKENNGMHDQDNATV  327

Query  1169  KRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPE  1345
              R +  + + GS+V+ K + LEKA R+LEK VAESRPP A + QD D SSQ +KRRLP +
Sbjct  328   SRQSNQITKGGSNVKPKTSTLEKAFRELEKVVAESRPPTATDNQDADTSSQVVKRRLPGD  387

Query  1346  IKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDN  1525
             +K KLAKVAR AQAS G LS ELINRLMSIVGHL+Q+R+LKRNLKIMI+ G SAK+E D 
Sbjct  388   VKLKLAKVARIAQASQGNLSGELINRLMSIVGHLIQVRSLKRNLKIMIDSGDSAKRENDT  447

Query  1526  RVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRI  1705
             R Q IK EV E +K +VPLM+ +A  Q+ GTSDDF++       + K+K+ MD ALE+++
Sbjct  448   RFQSIKNEVIETLKTQVPLMEPQATNQEAGTSDDFEN----PPPSTKKKFVMDEALEDKL  503

Query  1706  CDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY---NR  1876
             CDLYD++V+GL+ED+GPQ+RKLYA LA  WPN  MDNHGIKRAICRAK+RR+ L+    +
Sbjct  504   CDLYDIFVDGLDEDSGPQIRKLYANLAELWPNRLMDNHGIKRAICRAKERRRALHANLGK  563

Query  1877  HKNQEKMRR  1903
               +Q KM++
Sbjct  564   EMDQGKMKK  572



>ref|XP_010539681.1| PREDICTED: ubinuclein-1-like isoform X3 [Tarenaya hassleriana]
 ref|XP_010539682.1| PREDICTED: ubinuclein-1-like isoform X4 [Tarenaya hassleriana]
Length=686

 Score =   426 bits (1095),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 290/651 (45%), Positives = 380/651 (58%), Gaps = 83/651 (13%)
 Frame = +2

Query  194   GSSGGEPG--VGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapg  367
             G+SGG       R S     AG RQ   VELRPGETT VSWKKL+KEA+ +       P 
Sbjct  6     GTSGGFTAGESSRASPKLVTAGDRQLLIVELRPGETTYVSWKKLMKEASKVNGTSASVPD  65

Query  368   paprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVG  547
             P P A+     L+  +   H            P E E  D P  NR +AVIEKIERLY+G
Sbjct  66    PPPNANP---NLETRLAQGH------------PAEGEKADQP--NRFSAVIEKIERLYMG  108

Query  548   KQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTS  727
             K S  +E      D++    + SFIDD EL++YF+VDNSA+KHDGFFVNRGKLERIEP++
Sbjct  109   KDSSGEELDSSPDDDEYDTED-SFIDDAELNEYFEVDNSAVKHDGFFVNRGKLERIEPST  167

Query  728   QQN-QLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAG--------------KSVPLAA  862
               N QL  ++RK+    C   SD     NK  KV K AG              KS    A
Sbjct  168   TSNLQLKKRQRKESAKPC---SDVADVLNKQVKVAKMAGEKDQSNASRQSSKKKSTDAKA  224

Query  863   GTSSPSYG-----VVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQR  1027
               +  S        V  +L  E+A  + ++ N  ++ A    +K+V       S+   Q+
Sbjct  225   AQAQDSLSSFRGPAVNASLSLEDAKYY-EKANHQLKNAASHKAKDV-----GPSDALLQK  278

Query  1028  SNERISVPQEKSSGRSANISNGL-DQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR----  1192
              N + S  Q+ SS    ++ N L   +  + EK+ +++Q   A+A   ++  Q  +    
Sbjct  279   YNNK-SAHQQSSSVPGNSLQNVLAGAAVTKKEKNGMHEQ---ANATGSRQLMQKAKPFSA  334

Query  1193  --RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAK  1366
               +D S+VR K + LEKAIR+LEK VAESRP   E Q+ D SSQ +KRRLP E+K KL K
Sbjct  335   QKKDSSNVRPKTSSLEKAIRELEKVVAESRP---ECQEADTSSQGVKRRLPREVKVKLGK  391

Query  1367  VARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKR  1546
             VAR A A  GK+S ELINRLMSIVGHL+QLR+LKR+LKIMI+  +SA +E+D++ Q+IK+
Sbjct  392   VARIA-AKEGKVSAELINRLMSIVGHLIQLRSLKRHLKIMIDGSMSANRERDDKFQRIKK  450

Query  1547  EVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLY  1726
             EV EMIK +VPLM+S+A EQQ G SDDFQ     EK   K+ + MD ALE++ICDLYD++
Sbjct  451   EVIEMIKTQVPLMESQATEQQAGKSDDFQDAGFIEKAPQKKNFVMDAALEDKICDLYDIF  510

Query  1727  VEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRN  1906
             V+GL+ED GPQ+RKLY ELA  WPN  MDNHGIKRAICRAK+RR+  Y +   +  M++ 
Sbjct  511   VDGLDEDVGPQIRKLYVELAELWPNRLMDNHGIKRAICRAKERRRAAYEKIVTEANMKKR  570

Query  1907  KISAQKEEEGYRVETTTRDQPVQIQ-----EKSAVDARDHGSTATNKPISS  2044
             K          ++ T   D    +Q     EK++VD     ST TN P SS
Sbjct  571   K----------QLGTVRPDPAAVVQQKHGGEKTSVDP----STTTNVPDSS  607



>ref|XP_010496324.1| PREDICTED: uncharacterized protein LOC104773417 isoform X3 [Camelina 
sativa]
Length=698

 Score =   425 bits (1093),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 289/599 (48%), Positives = 375/599 (63%), Gaps = 65/599 (11%)
 Frame = +2

Query  197   SSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpap  376
             S GGE    R S     AG R+   VELRPG+TT VSWKKL+++A  +  +    P P P
Sbjct  11    SIGGESL--RASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDANKVNGSSASVPDPPP  68

Query  377   rasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQS  556
              A+     L+  I PP            QP E E  D P  NR NAVIEKIERLY G  S
Sbjct  69    NANP---NLESRIAPPG-----------QPAEIETNDQPHSNRFNAVIEKIERLYKGNDS  114

Query  557   dddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQN  736
              D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGF+VNRGKLERIEP++  N
Sbjct  115   SDGEELDGAPDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFYVNRGKLERIEPSTTSN  174

Query  737   QLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSP-SYGVVMPTLYR  910
             Q P KRR+KD  K    + D  +  K  K+   A GK    A+G+S    Y V   T   
Sbjct  175   QQPKKRRRKDPAKPFGDAVDVSD--KHTKLSLTARGKDQSTASGSSXKRKYNVARKT---  229

Query  911   ENANVHNQE--VNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANI  1084
                    QE  + F  Q A    S   +D +K S   ++Q  N++ + P+ K +G S+ +
Sbjct  230   -------QEPPLPFGAQDANTSLS---LDDVKHSDRANHQ--NKKDTCPKSKETGSSSAL  277

Query  1085  -----SNGLDQSFQQ---------GEKSVIYDQRLDASAPE-----GKRSTQTVRRDGSS  1207
                  + GL Q  +            ++ I  Q+ +    E      ++S+Q  +RDGS+
Sbjct  278   HQKYSNKGLHQQSKSLPGKSLPNVSAEATIVRQKENNGMHELANAKSRQSSQASKRDGSN  337

Query  1208  VRSKITMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQ  1384
             V+SKI++LEKAIR+LEK VAESRPP   E Q+ D SS A+KRRLP ++K KLAKVAR A 
Sbjct  338   VKSKISILEKAIRELEKVVAESRPPAINENQEADTSSLAVKRRLPRDVKLKLAKVARIA-  396

Query  1385  ASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMI  1564
             AS GK + EL+NRLMSIVGHL+QLR+LKRNLKIMI+MG SA +EKD R QQI  EV +MI
Sbjct  397   ASQGKYTAELVNRLMSIVGHLIQLRSLKRNLKIMIDMGDSANREKDTRFQQINNEVLDMI  456

Query  1565  KDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGL-E  1741
             K +V LM+++  + + GTSDDFQ     EK + K K+ +D ALE+++C LYD+++EGL E
Sbjct  457   KAKVSLMETQETKPEGGTSDDFQDPV--EKPSLK-KFVIDAALEDKLCHLYDIFIEGLDE  513

Query  1742  EDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY---NRHKNQEKMRRNK  1909
             ED GP +RKLYA LA  WPN  MDNHGIKRAICRAK+R+K L+    +  +Q KM++++
Sbjct  514   EDQGPPIRKLYANLAELWPNRLMDNHGIKRAICRAKERQKALFGNLGKEMDQTKMKKSR  572



>ref|NP_173580.2| wound-responsive family protein [Arabidopsis thaliana]
 gb|AAL90916.1| At1g21610/F24J8_11 [Arabidopsis thaliana]
 gb|AAM78043.1| At1g21610/F24J8_11 [Arabidopsis thaliana]
 gb|AEE30124.1| wound-responsive family protein [Arabidopsis thaliana]
Length=684

 Score =   424 bits (1089),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 311/740 (42%), Positives = 426/740 (58%), Gaps = 94/740 (13%)
 Frame = +2

Query  194   GSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEA---TGLQsngngap  364
             GS GGE  + R S     AG R+   VELRPG+TT VSWKKL+++A    GL      + 
Sbjct  10    GSIGGE--LLRASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDAGKVNGL------SA  61

Query  365   gpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYV  544
                     A   L+  I P H            PVE E  + P  NR NAVIEKIERLY 
Sbjct  62    SVPDPPPNANPNLEFRIAPGH------------PVEIETNEQPHSNRFNAVIEKIERLYK  109

Query  545   GKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPT  724
             G  S D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNS +KHDGF+VNRGKLER+EP+
Sbjct  110   GNDSSDGEELDGAPDDDEYDTEDSFIDDAELDEYFEVDNSTVKHDGFYVNRGKLERMEPS  169

Query  725   SQQNQLPNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKKAGKSV----------PLAAGTS  871
             +  NQ P KRR+KD  K C+   D      K +   +K  +S           PL +G  
Sbjct  170   TTSNQQPKKRRRKDSAKPCRDAVDVSDKHTKLSITARKKDQSTAPGSWKTQESPLPSGAQ  229

Query  872   SPSYGVVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERI---  1042
               +  V +  +   +   H Q  N    K+    S + + + K S+++ +Q+S   +   
Sbjct  230   DANTSVPLDDVKHSDRANH-QSRNDTSHKSRETGSSSALHQ-KYSNKSLHQQSTSLLGKS  287

Query  1043  --SVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRS  1216
               +V  E +  R    +NG+ Q                A+    ++S+Q  ++DGS+V+S
Sbjct  288   PPNVFAEVTVVRQKE-NNGMHQL---------------ANVTGSRQSSQASKKDGSNVKS  331

Query  1217  KITMLEKAIRDLEKFVAESRPPN-AEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASH  1393
             K ++LEKAIR+LEK V ESRPP   E Q+ D SSQA+KRRLP ++K KLAKVAR AQAS 
Sbjct  332   KTSILEKAIRELEKVVVESRPPAITENQEADTSSQAVKRRLPRDVKLKLAKVARIAQASQ  391

Query  1394  GKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDR  1573
             GK S ELINRLMSIVGHL+QLR+LKRNLKIMI+MG SA +EKD R +QI  EV +MIK +
Sbjct  392   GKHSTELINRLMSIVGHLIQLRSLKRNLKIMIDMGDSATREKDTRFKQINNEVLDMIKAK  451

Query  1574  VPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAG  1753
             V LM+S+AI+ +  TSDDFQ   + EK + K K+ MD ALE+++CDLYD++++GL+ED G
Sbjct  452   VSLMESQAIKPEGATSDDFQD--SVEKPSLK-KFVMDAALEDKLCDLYDIFIDGLDEDQG  508

Query  1754  PQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEE  1933
             PQ +KLY  LA  WPN  MD  GIK AI RAK+RRK LY     +  M + K+    ++ 
Sbjct  509   PQTKKLYVNLAELWPNRLMDYRGIKHAIFRAKERRKALYGNLAKE--MDQTKMKKSMKQL  566

Query  1934  GYRVETTTR-DQPVQIQEKSAVDAR---DHGSTATNKPISSTAAINMVGRIPVPSPGGTS  2101
               R + T + +  + +Q + + + +   D  +T+T+   S T    MV R          
Sbjct  567   VPRTDCTAQPNTELVVQRQHSGEKKLIVDPNATSTSVVTSQT----MVDRS---------  613

Query  2102  LDRPKPEKVKGTGNSTDRHITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEP  2281
              ++ +PEK+KG  +S +    T     + +KRK E  + E Q +   L+ K+ E+ PQ  
Sbjct  614   -NQQQPEKLKGISSSCNPTEET-----RVVKRKNEAVMAEKQVV---LALKKPEH-PQTR  663

Query  2282  IAAAP----VPKPSIQLNEP  2329
             +  AP    +P+ +  LN P
Sbjct  664   VIPAPQNLNIPRTTPDLNLP  683



>ref|NP_001185055.1| wound-responsive family protein [Arabidopsis thaliana]
 gb|AEE30126.1| wound-responsive family protein [Arabidopsis thaliana]
Length=685

 Score =   423 bits (1088),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 311/740 (42%), Positives = 428/740 (58%), Gaps = 93/740 (13%)
 Frame = +2

Query  194   GSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEA---TGLQsngngap  364
             GS GGE  + R S     AG R+   VELRPG+TT VSWKKL+++A    GL      + 
Sbjct  10    GSIGGE--LLRASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDAGKVNGL------SA  61

Query  365   gpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYV  544
                     A   L+  I P H            PVE E  + P  NR NAVIEKIERLY 
Sbjct  62    SVPDPPPNANPNLEFRIAPGH------------PVEIETNEQPHSNRFNAVIEKIERLYK  109

Query  545   GKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPT  724
             G  S D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNS +KHDGF+VNRGKLER+EP+
Sbjct  110   GNDSSDGEELDGAPDDDEYDTEDSFIDDAELDEYFEVDNSTVKHDGFYVNRGKLERMEPS  169

Query  725   SQQNQLPNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKKAGKSV----------PLAAGTS  871
             +  NQ P KRR+KD  K C+   D      K +   +K  +S           PL +G  
Sbjct  170   TTSNQQPKKRRRKDSAKPCRDAVDVSDKHTKLSITARKKDQSTAPGSWKTQESPLPSGAQ  229

Query  872   SPSYGVVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERI---  1042
               +  V +  +   +   H Q  N    K+    S + + + K S+++ +Q+S   +   
Sbjct  230   DANTSVPLDDVKHSDRANH-QSRNDTSHKSRETGSSSALHQ-KYSNKSLHQQSTSLLGKS  287

Query  1043  --SVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRS  1216
               +V  E +  R    +NG+ Q                A+    ++S+Q  ++DGS+V+S
Sbjct  288   PPNVFAEVTVVRQKE-NNGMHQL---------------ANVTGSRQSSQASKKDGSNVKS  331

Query  1217  KITMLEKAIRDLEKFVAESRPPN-AEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASH  1393
             K ++LEKAIR+LEK V ESRPP   E Q+ D SSQA+KRRLP ++K KLAKVAR AQAS 
Sbjct  332   KTSILEKAIRELEKVVVESRPPAITENQEADTSSQAVKRRLPRDVKLKLAKVARIAQASQ  391

Query  1394  GKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDR  1573
             GK S ELINRLMSIVGHL+QLR+LKRNLKIMI+MG SA +EKD R +QI  EV +MIK +
Sbjct  392   GKHSTELINRLMSIVGHLIQLRSLKRNLKIMIDMGDSATREKDTRFKQINNEVLDMIKAK  451

Query  1574  VPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAG  1753
             V LM+S+AI+ +  TSDDFQ   + EK + K K+ MD ALE+++CDLYD++++GL+ED G
Sbjct  452   VSLMESQAIKPEGATSDDFQD--SVEKPSLK-KFVMDAALEDKLCDLYDIFIDGLDEDQG  508

Query  1754  PQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEE  1933
             PQ +KLY  LA  WPN  MD  GIK AI RAK+RRK LY  +  +E + + K+    ++ 
Sbjct  509   PQTKKLYVNLAELWPNRLMDYRGIKHAIFRAKERRKALYG-NLAKEMVDQTKMKKSMKQL  567

Query  1934  GYRVETTTR-DQPVQIQEKSAVDAR---DHGSTATNKPISSTAAINMVGRIPVPSPGGTS  2101
               R + T + +  + +Q + + + +   D  +T+T+   S T    MV R          
Sbjct  568   VPRTDCTAQPNTELVVQRQHSGEKKLIVDPNATSTSVVTSQT----MVDRS---------  614

Query  2102  LDRPKPEKVKGTGNSTDRHITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEP  2281
              ++ +PEK+KG  +S +    T     + +KRK E  + E Q +   L+ K+ E+ PQ  
Sbjct  615   -NQQQPEKLKGISSSCNPTEET-----RVVKRKNEAVMAEKQVV---LALKKPEH-PQTR  664

Query  2282  IAAAP----VPKPSIQLNEP  2329
             +  AP    +P+ +  LN P
Sbjct  665   VIPAPQNLNIPRTTPDLNLP  684



>ref|XP_002890446.1| wound-responsive family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66705.1| wound-responsive family protein [Arabidopsis lyrata subsp. lyrata]
Length=687

 Score =   423 bits (1088),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 279/583 (48%), Positives = 357/583 (61%), Gaps = 55/583 (9%)
 Frame = +2

Query  185   IDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngap  364
             I  GS GGE  +G  S     AG R+   VELRPG+TT VSWKKL+++   +      + 
Sbjct  7     ISGGSIGGE-SLG-ASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDVGKVN---GSSA  61

Query  365   gpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYV  544
                     A   L+  I P H            P E E  + P  N  NAVIEKIERLY 
Sbjct  62    SVPDPPPNANPNLESRIAPGH------------PAEIETNEQPHSNHFNAVIEKIERLYK  109

Query  545   GKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPT  724
             G  S D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNS +KHDGF+V RGKLER+EP+
Sbjct  110   GNDSSDGEELDGAPDDDEYDTEDSFIDDAELDEYFEVDNSTVKHDGFYVYRGKLERMEPS  169

Query  725   SQQNQLPNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPT  901
             +  +Q P KRR+KD TK C    D      K +   ++  +S   A+G+S       +  
Sbjct  170   TTSDQQPKKRRRKDSTKPCGDAVDVSDKHTKLSITARRKDQST--ASGSS-------LKR  220

Query  902   LYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSAN  1081
              Y          + F  Q A    S   +D +K S   ++Q  N+     +E  S  SA 
Sbjct  221   KYNVARKTQESPLPFGAQAANTSVS---LDDVKHSDRANHQSKNDTSHKSRETGSS-SAL  276

Query  1082  ISNGLDQSFQQGEKSV-------------IYDQRLD------ASAPEGKRSTQTVRRDGS  1204
                  ++S  Q  KS+             +  Q+ +      A+A   ++S+Q  ++DGS
Sbjct  277   HPKYSNKSLHQQSKSLPGKSPTNVFAEATVVLQKENNGMHQLANAMGSRQSSQASKKDGS  336

Query  1205  SVRSKITMLEKAIRDLEKFVAESRPPN-AEVQDGDNSSQAIKRRLPPEIKQKLAKVARYA  1381
             +V+SK ++LEKAIR+LEK VAESRPP   E Q+ D SSQA+KRRLP ++K KLAKVAR A
Sbjct  337   NVKSKTSILEKAIRELEKVVAESRPPAITENQEADTSSQAVKRRLPRDVKLKLAKVARIA  396

Query  1382  QASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEM  1561
             QAS GK S ELINRLMSIVGHL+QLR+LKRNLKIMI+MG SA +EKD R QQI  EV +M
Sbjct  397   QASQGKHSTELINRLMSIVGHLIQLRSLKRNLKIMIDMGDSATREKDTRFQQINNEVLDM  456

Query  1562  IKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGL-  1738
             IK +V LM+S+AI+ + GTSDDFQ   + EK + K K+ MD ALE+++CDLYD++++GL 
Sbjct  457   IKAKVSLMESQAIKPEGGTSDDFQD--SVEKPSLK-KFVMDAALEDKLCDLYDIFIDGLD  513

Query  1739  EEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
             +ED GPQ RKLY  LA  WPN  MDNHGIKRAICRAK+RRK L
Sbjct  514   DEDQGPQKRKLYVNLAELWPNRLMDNHGIKRAICRAKERRKAL  556



>ref|XP_010496325.1| PREDICTED: uncharacterized protein LOC104773417 isoform X4 [Camelina 
sativa]
Length=698

 Score =   424 bits (1089),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 287/597 (48%), Positives = 373/597 (62%), Gaps = 61/597 (10%)
 Frame = +2

Query  197   SSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpap  376
             S GGE    R S     AG R+   VELRPG+TT VSWKKL+++A  +  +    P P P
Sbjct  11    SIGGESL--RASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDANKVNGSSASVPDPPP  68

Query  377   rasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQS  556
              A+     L+  I PP            QP E E  D P  NR NAVIEKIERLY G  S
Sbjct  69    NANP---NLESRIAPPG-----------QPAEIETNDQPHSNRFNAVIEKIERLYKGNDS  114

Query  557   dddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQN  736
              D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGF+VNRGKLERIEP++  N
Sbjct  115   SDGEELDGAPDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFYVNRGKLERIEPSTTSN  174

Query  737   QLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTS-SPSYGVVMPTLYR  910
             Q P KRR+KD  K    + D  +  K  K+   A GK    A+G+S    Y V   T   
Sbjct  175   QQPKKRRRKDPAKPFGDAVDVSD--KHTKLSLTARGKDQSTASGSSLKRKYNVARKTQV-  231

Query  911   ENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANI--  1084
                      + F  Q A    S   +D +K S   ++Q  N++ + P+ K +G S+ +  
Sbjct  232   -------PPLPFGAQDANTSLS---LDDVKHSDRANHQ--NKKDTCPKSKETGSSSALHQ  279

Query  1085  ---SNGLDQSFQQ---------GEKSVIYDQRLDASAPE-----GKRSTQTVRRDGSSVR  1213
                + GL Q  +            ++ I  Q+ +    E      ++S+Q  +RDGS+V+
Sbjct  280   KYSNKGLHQQSKSLPGKSLPNVSAEATIVRQKENNGMHELANAKSRQSSQASKRDGSNVK  339

Query  1214  SKITMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQAS  1390
             SKI++LEKAIR+LEK VAESRPP   E Q+ D SS A+KRRLP ++K KLAKVAR A AS
Sbjct  340   SKISILEKAIRELEKVVAESRPPAINENQEADTSSLAVKRRLPRDVKLKLAKVARIA-AS  398

Query  1391  HGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKD  1570
              GK + EL+NRLMSIVGHL+QLR+LKRNLKIMI+MG SA +EKD R QQI  EV +MIK 
Sbjct  399   QGKYTAELVNRLMSIVGHLIQLRSLKRNLKIMIDMGDSANREKDTRFQQINNEVLDMIKA  458

Query  1571  RVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGL-EED  1747
             +V LM+++  + + GTSDDFQ     EK + K K+ +D ALE+++C LYD+++EGL EED
Sbjct  459   KVSLMETQETKPEGGTSDDFQDPV--EKPSLK-KFVIDAALEDKLCHLYDIFIEGLDEED  515

Query  1748  AGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY---NRHKNQEKMRRNK  1909
              GP +RKLYA LA  WPN  MDNHGIKRAICRAK+R+K L+    +  +Q KM++++
Sbjct  516   QGPPIRKLYANLAELWPNRLMDNHGIKRAICRAKERQKALFGNLGKEMDQTKMKKSR  572



>ref|XP_010539679.1| PREDICTED: ubinuclein-1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010539680.1| PREDICTED: ubinuclein-1-like isoform X2 [Tarenaya hassleriana]
Length=687

 Score =   421 bits (1083),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 290/652 (44%), Positives = 380/652 (58%), Gaps = 84/652 (13%)
 Frame = +2

Query  194   GSSGGEPG--VGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapg  367
             G+SGG       R S     AG RQ   VELRPGETT VSWKKL+KEA+ +       P 
Sbjct  6     GTSGGFTAGESSRASPKLVTAGDRQLLIVELRPGETTYVSWKKLMKEASKVNGTSASVPD  65

Query  368   paprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVG  547
             P P A+     L+  +   H            P E E  D P  NR +AVIEKIERLY+G
Sbjct  66    PPPNANP---NLETRLAQGH------------PAEGEKADQP--NRFSAVIEKIERLYMG  108

Query  548   KQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPT  724
             K S  +E      D++    + SFIDD EL++YF+VDNSA+KHDGFFVNRGKLERI EP+
Sbjct  109   KDSSGEELDSSPDDDEYDTED-SFIDDAELNEYFEVDNSAVKHDGFFVNRGKLERISEPS  167

Query  725   SQQN-QLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAG--------------KSVPLA  859
             +  N QL  ++RK+    C   SD     NK  KV K AG              KS    
Sbjct  168   TTSNLQLKKRQRKESAKPC---SDVADVLNKQVKVAKMAGEKDQSNASRQSSKKKSTDAK  224

Query  860   AGTSSPSYG-----VVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQ  1024
             A  +  S        V  +L  E+A  + ++ N  ++ A    +K+V       S+   Q
Sbjct  225   AAQAQDSLSSFRGPAVNASLSLEDAKYY-EKANHQLKNAASHKAKDV-----GPSDALLQ  278

Query  1025  RSNERISVPQEKSSGRSANISNGL-DQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR---  1192
             + N + S  Q+ SS    ++ N L   +  + EK+ +++Q   A+A   ++  Q  +   
Sbjct  279   KYNNK-SAHQQSSSVPGNSLQNVLAGAAVTKKEKNGMHEQ---ANATGSRQLMQKAKPFS  334

Query  1193  ---RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLA  1363
                +D S+VR K + LEKAIR+LEK VAESRP   E Q+ D SSQ +KRRLP E+K KL 
Sbjct  335   AQKKDSSNVRPKTSSLEKAIRELEKVVAESRP---ECQEADTSSQGVKRRLPREVKVKLG  391

Query  1364  KVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIK  1543
             KVAR A A  GK+S ELINRLMSIVGHL+QLR+LKR+LKIMI+  +SA +E+D++ Q+IK
Sbjct  392   KVARIA-AKEGKVSAELINRLMSIVGHLIQLRSLKRHLKIMIDGSMSANRERDDKFQRIK  450

Query  1544  REVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDL  1723
             +EV EMIK +VPLM+S+A EQQ G SDDFQ     EK   K+ + MD ALE++ICDLYD+
Sbjct  451   KEVIEMIKTQVPLMESQATEQQAGKSDDFQDAGFIEKAPQKKNFVMDAALEDKICDLYDI  510

Query  1724  YVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRR  1903
             +V+GL+ED GPQ+RKLY ELA  WPN  MDNHGIKRAICRAK+RR+  Y +   +  M++
Sbjct  511   FVDGLDEDVGPQIRKLYVELAELWPNRLMDNHGIKRAICRAKERRRAAYEKIVTEANMKK  570

Query  1904  NKISAQKEEEGYRVETTTRDQPVQIQ-----EKSAVDARDHGSTATNKPISS  2044
              K          ++ T   D    +Q     EK++VD     ST TN P SS
Sbjct  571   RK----------QLGTVRPDPAAVVQQKHGGEKTSVDP----STTTNVPDSS  608



>ref|XP_010496322.1| PREDICTED: uncharacterized protein LOC104773417 isoform X1 [Camelina 
sativa]
Length=699

 Score =   421 bits (1082),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 289/600 (48%), Positives = 375/600 (63%), Gaps = 66/600 (11%)
 Frame = +2

Query  197   SSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpap  376
             S GGE    R S     AG R+   VELRPG+TT VSWKKL+++A  +  +    P P P
Sbjct  11    SIGGESL--RASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDANKVNGSSASVPDPPP  68

Query  377   rasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQS  556
              A+     L+  I PP            QP E E  D P  NR NAVIEKIERLY G  S
Sbjct  69    NANP---NLESRIAPPG-----------QPAEIETNDQPHSNRFNAVIEKIERLYKGNDS  114

Query  557   dddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQN  736
              D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGF+VNRGKLERIEP++  N
Sbjct  115   SDGEELDGAPDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFYVNRGKLERIEPSTTSN  174

Query  737   QLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSP-SYGVVMPTLYR  910
             Q P KRR+KD  K    + D  +  K  K+   A GK    A+G+S    Y V   T   
Sbjct  175   QQPKKRRRKDPAKPFGDAVDVSD--KHTKLSLTARGKDQSTASGSSXKRKYNVARKT---  229

Query  911   ENANVHNQE--VNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANI  1084
                    QE  + F  Q A    S   +D +K S   ++Q  N++ + P+ K +G S+ +
Sbjct  230   -------QEPPLPFGAQDANTSLS---LDDVKHSDRANHQ--NKKDTCPKSKETGSSSAL  277

Query  1085  -----SNGLDQSFQQ---------GEKSVIYDQRLDASAPE-----GKRSTQTVRRDGSS  1207
                  + GL Q  +            ++ I  Q+ +    E      ++S+Q  +RDGS+
Sbjct  278   HQKYSNKGLHQQSKSLPGKSLPNVSAEATIVRQKENNGMHELANAKSRQSSQASKRDGSN  337

Query  1208  VRSKITMLEKAIRDLEKFVAES-RPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYA  1381
             V+SKI++LEKAIR+LEK VAES RPP   E Q+ D SS A+KRRLP ++K KLAKVAR A
Sbjct  338   VKSKISILEKAIRELEKVVAESARPPAINENQEADTSSLAVKRRLPRDVKLKLAKVARIA  397

Query  1382  QASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEM  1561
              AS GK + EL+NRLMSIVGHL+QLR+LKRNLKIMI+MG SA +EKD R QQI  EV +M
Sbjct  398   -ASQGKYTAELVNRLMSIVGHLIQLRSLKRNLKIMIDMGDSANREKDTRFQQINNEVLDM  456

Query  1562  IKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGL-  1738
             IK +V LM+++  + + GTSDDFQ     EK + K K+ +D ALE+++C LYD+++EGL 
Sbjct  457   IKAKVSLMETQETKPEGGTSDDFQDPV--EKPSLK-KFVIDAALEDKLCHLYDIFIEGLD  513

Query  1739  EEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY---NRHKNQEKMRRNK  1909
             EED GP +RKLYA LA  WPN  MDNHGIKRAICRAK+R+K L+    +  +Q KM++++
Sbjct  514   EEDQGPPIRKLYANLAELWPNRLMDNHGIKRAICRAKERQKALFGNLGKEMDQTKMKKSR  573



>ref|XP_009104627.1| PREDICTED: uncharacterized protein LOC103830572 isoform X1 [Brassica 
rapa]
Length=659

 Score =   419 bits (1078),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 271/595 (46%), Positives = 357/595 (60%), Gaps = 71/595 (12%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S    AA  R+   VELR GETT VSWKKL+KEA+ +  +                  
Sbjct  14    RTSPKLLAAADRKLLKVELRRGETTYVSWKKLMKEASKVHGSST----------------  57

Query  404   QPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddv  583
              P  +P  N +     +P  P E E  D P  NR NAVIEKIERLY+G+ S D E+LD  
Sbjct  58    -PDPVPNANPNLDAHLAPGAPAEGEMVDQPHSNRFNAVIEKIERLYMGRDSSDGEELDGA  116

Query  584   pdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTS--QQNQLPNKRR  757
             PD+DEYDTEDSFIDD ELD+YF+VD++ IKHDGFFVN+GKLE+IEP++    NQ P KR+
Sbjct  117   PDDDEYDTEDSFIDDVELDEYFEVDDAKIKHDGFFVNKGKLEQIEPSTATMSNQKPKKRQ  176

Query  758   KKD--------------QTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVM  895
             +K+              Q K   G D         K      K+V  +     P  G  +
Sbjct  177   RKESAKPSGDVVDVSRKQAKTDGGKDQSAASGPSLKKKISDSKTVQDSVSPLKPQSGNDL  236

Query  896   PTL-YRENANVHNQEVNFDMQKAE---VLHSKNVVDKLKESSETSNQRSNERISVPQEKS  1063
               + + + AN+    ++   + AE    LH       +K S++ ++Q SN  +       
Sbjct  237   ENVKHSDKANLLRNALSPRSKAAESSGALH-------MKHSNKGAHQLSNSPLP------  283

Query  1064  SGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKAI  1243
                      G  +     + +V+  +    +A   ++S Q  R+ GS+ R K + LEKA 
Sbjct  284   ---------GKPRPDVLAKSTVVRQKENTDNATVSRQSIQ--RKGGSNARPKTSTLEKAF  332

Query  1244  RDLEKFVAESRPPNA--EVQDGD-NSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKEL  1414
             R+LEK VAESRPP A  E QD D +SSQA+KRRLP ++K KLAKVAR AQAS G +S EL
Sbjct  333   RELEKVVAESRPPAAATENQDADTSSSQAVKRRLPGDVKSKLAKVARIAQASQGNVSGEL  392

Query  1415  INRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSK  1594
             INRLMSIVGHL+Q+R+LKRNLKIMI+ G SA +EKDN+ Q+IK EV EM+K +VPL++S+
Sbjct  393   INRLMSIVGHLIQVRSLKRNLKIMIDSGDSANREKDNKFQRIKNEVVEMLKTQVPLIESQ  452

Query  1595  AIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLY  1774
             A  Q+ GTSDDFQ +        K+K+ MD A+E+++CDLYD++V+GL+ED+GP +RKLY
Sbjct  453   ATNQEAGTSDDFQDVGP----PAKKKFVMDAAMEDKLCDLYDIFVDGLDEDSGPHIRKLY  508

Query  1775  AELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRH---KNQEKMRRNKISAQKEE  1930
             A LA  WPN  MDNHGIKRAICRAK+RR+ LY  H     Q KM + K +  K E
Sbjct  509   ANLAELWPNRLMDNHGIKRAICRAKERRRALYENHGKEMGQGKMTKRKQTLPKPE  563



>emb|CDX79196.1| BnaC06g21070D [Brassica napus]
Length=664

 Score =   419 bits (1076),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 273/565 (48%), Positives = 354/565 (63%), Gaps = 43/565 (8%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S    AA  R+   VELR GETT VSWKKL+KEA+    +   A  P           
Sbjct  14    RTSPKLLAAADRKLLKVELRRGETTYVSWKKLMKEASKAHGSSVSASDP-----------  62

Query  404   QPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddv  583
                 +P  N +     +P  P E E  D P  NR NAVIEKIERLY+G+ S D E+LD  
Sbjct  63    ----VPNANPNLEAHLAPGPPAEGEMVDQPHSNRFNAVIEKIERLYMGRDSSDGEELDGA  118

Query  584   pdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTS--QQNQLPNKRR  757
             PD+DEYDTEDSFIDD ELD+YF+VD++ IKHDGFFVN+GKLE+IEP++    NQ P KR+
Sbjct  119   PDDDEYDTEDSFIDDVELDEYFEVDDAKIKHDGFFVNKGKLEQIEPSTATMSNQKPKKRQ  178

Query  758   KKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENANVHNQE  937
             +K+  K      D     K AK+ K  G  V  +A  S PS    +     ++  V +  
Sbjct  179   RKESAKPPGDVVDVSR--KQAKIAKTDGGRVDQSAA-SGPS----LKKKISDSKTVQDSV  231

Query  938   VNFDMQKAEVLHSKNVVDK--LKESSETSNQRSNERISVPQEKSSGRSAN-ISNGLDQSF  1108
                  Q    L +    DK  L  ++ +   ++ E       K S + A+ +SN L    
Sbjct  232   SPLKPQSGNDLENVKHSDKANLLRNALSPRSKAAESSGALHMKHSNKGAHQLSNSL--PG  289

Query  1109  QQG----EKSVIYDQRLDA-SAPEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAES  1273
             + G     KS +  Q+ +  +A   ++S Q  R+ GS+ R K + LEKA R+LEK VAES
Sbjct  290   KSGPDVLAKSTVVRQKENTDNAILSRQSIQ--RKGGSNARPKTSTLEKAFRELEKVVAES  347

Query  1274  RPPNA--EVQDGD-NSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGH  1444
             RPP A  E QD D +SSQA+KRRLP ++K KLAKVAR AQAS G +S ELINRLMSIVGH
Sbjct  348   RPPAAATENQDADTSSSQAVKRRLPGDVKSKLAKVARIAQASQGNVSGELINRLMSIVGH  407

Query  1445  LVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSD  1624
             L+Q+R+LKRNLKIMI+ G SA +EKDN+ Q+IK EV EM+K +VPL++S+A  Q+ GTSD
Sbjct  408   LIQVRSLKRNLKIMIDSGDSANREKDNKFQRIKNEVVEMLKTQVPLIESQATNQEAGTSD  467

Query  1625  DFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNG  1804
             DFQ +        K+K+ MD A+E+++CDLYD++V+GL+ED+GP +RKLYA LA  WPN 
Sbjct  468   DFQDVGP----PTKKKFVMDAAMEDKLCDLYDIFVDGLDEDSGPHIRKLYANLAELWPNR  523

Query  1805  FMDNHGIKRAICRAKDRRKTLYNRH  1879
              MDNHGIKRAICRAK+RR+ LY  H
Sbjct  524   LMDNHGIKRAICRAKERRRALYENH  548



>ref|XP_010496326.1| PREDICTED: uncharacterized protein LOC104773417 isoform X5 [Camelina 
sativa]
Length=697

 Score =   419 bits (1078),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 288/600 (48%), Positives = 374/600 (62%), Gaps = 68/600 (11%)
 Frame = +2

Query  197   SSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpap  376
             S GGE    R S     AG R+   VELRPG+TT VSWKKL+++A  +  +    P P P
Sbjct  11    SIGGESL--RASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDANKVNGSSASVPDPPP  68

Query  377   rasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQS  556
              A+     L+  I PP             P E E  D P  NR NAVIEKIERLY G  S
Sbjct  69    NANP---NLESRIAPP-------------PAEIETNDQPHSNRFNAVIEKIERLYKGNDS  112

Query  557   dddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQN  736
              D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGF+VNRGKLERIEP++  N
Sbjct  113   SDGEELDGAPDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFYVNRGKLERIEPSTTSN  172

Query  737   QLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSP-SYGVVMPTLYR  910
             Q P KRR+KD  K    + D  +  K  K+   A GK    A+G+S    Y V   T   
Sbjct  173   QQPKKRRRKDPAKPFGDAVDVSD--KHTKLSLTARGKDQSTASGSSXKRKYNVARKT---  227

Query  911   ENANVHNQE--VNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANI  1084
                    QE  + F  Q A    S   +D +K S   ++Q  N++ + P+ K +G S+ +
Sbjct  228   -------QEPPLPFGAQDANTSLS---LDDVKHSDRANHQ--NKKDTCPKSKETGSSSAL  275

Query  1085  -----SNGLDQSFQQ---------GEKSVIYDQRLDASAPE-----GKRSTQTVRRDGSS  1207
                  + GL Q  +            ++ I  Q+ +    E      ++S+Q  +RDGS+
Sbjct  276   HQKYSNKGLHQQSKSLPGKSLPNVSAEATIVRQKENNGMHELANAKSRQSSQASKRDGSN  335

Query  1208  VRSKITMLEKAIRDLEKFVAES-RPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYA  1381
             V+SKI++LEKAIR+LEK VAES RPP   E Q+ D SS A+KRRLP ++K KLAKVAR A
Sbjct  336   VKSKISILEKAIRELEKVVAESARPPAINENQEADTSSLAVKRRLPRDVKLKLAKVARIA  395

Query  1382  QASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEM  1561
              AS GK + EL+NRLMSIVGHL+QLR+LKRNLKIMI+MG SA +EKD R QQI  EV +M
Sbjct  396   -ASQGKYTAELVNRLMSIVGHLIQLRSLKRNLKIMIDMGDSANREKDTRFQQINNEVLDM  454

Query  1562  IKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGL-  1738
             IK +V LM+++  + + GTSDDFQ     EK + K K+ +D ALE+++C LYD+++EGL 
Sbjct  455   IKAKVSLMETQETKPEGGTSDDFQDPV--EKPSLK-KFVIDAALEDKLCHLYDIFIEGLD  511

Query  1739  EEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY---NRHKNQEKMRRNK  1909
             EED GP +RKLYA LA  WPN  MDNHGIKRAICRAK+R+K L+    +  +Q KM++++
Sbjct  512   EEDQGPPIRKLYANLAELWPNRLMDNHGIKRAICRAKERQKALFGNLGKEMDQTKMKKSR  571



>ref|XP_010496323.1| PREDICTED: uncharacterized protein LOC104773417 isoform X2 [Camelina 
sativa]
Length=699

 Score =   419 bits (1077),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 287/598 (48%), Positives = 373/598 (62%), Gaps = 62/598 (10%)
 Frame = +2

Query  197   SSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpap  376
             S GGE    R S     AG R+   VELRPG+TT VSWKKL+++A  +  +    P P P
Sbjct  11    SIGGESL--RASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDANKVNGSSASVPDPPP  68

Query  377   rasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQS  556
              A+     L+  I PP            QP E E  D P  NR NAVIEKIERLY G  S
Sbjct  69    NANP---NLESRIAPPG-----------QPAEIETNDQPHSNRFNAVIEKIERLYKGNDS  114

Query  557   dddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQN  736
              D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGF+VNRGKLERIEP++  N
Sbjct  115   SDGEELDGAPDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFYVNRGKLERIEPSTTSN  174

Query  737   QLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTS-SPSYGVVMPTLYR  910
             Q P KRR+KD  K    + D  +  K  K+   A GK    A+G+S    Y V   T   
Sbjct  175   QQPKKRRRKDPAKPFGDAVDVSD--KHTKLSLTARGKDQSTASGSSLKRKYNVARKTQV-  231

Query  911   ENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANI--  1084
                      + F  Q A    S   +D +K S   ++Q  N++ + P+ K +G S+ +  
Sbjct  232   -------PPLPFGAQDANTSLS---LDDVKHSDRANHQ--NKKDTCPKSKETGSSSALHQ  279

Query  1085  ---SNGLDQSFQQ---------GEKSVIYDQRLDASAPE-----GKRSTQTVRRDGSSVR  1213
                + GL Q  +            ++ I  Q+ +    E      ++S+Q  +RDGS+V+
Sbjct  280   KYSNKGLHQQSKSLPGKSLPNVSAEATIVRQKENNGMHELANAKSRQSSQASKRDGSNVK  339

Query  1214  SKITMLEKAIRDLEKFVAES-RPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQA  1387
             SKI++LEKAIR+LEK VAES RPP   E Q+ D SS A+KRRLP ++K KLAKVAR A A
Sbjct  340   SKISILEKAIRELEKVVAESARPPAINENQEADTSSLAVKRRLPRDVKLKLAKVARIA-A  398

Query  1388  SHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIK  1567
             S GK + EL+NRLMSIVGHL+QLR+LKRNLKIMI+MG SA +EKD R QQI  EV +MIK
Sbjct  399   SQGKYTAELVNRLMSIVGHLIQLRSLKRNLKIMIDMGDSANREKDTRFQQINNEVLDMIK  458

Query  1568  DRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGL-EE  1744
              +V LM+++  + + GTSDDFQ     EK + K K+ +D ALE+++C LYD+++EGL EE
Sbjct  459   AKVSLMETQETKPEGGTSDDFQDPV--EKPSLK-KFVIDAALEDKLCHLYDIFIEGLDEE  515

Query  1745  DAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY---NRHKNQEKMRRNK  1909
             D GP +RKLYA LA  WPN  MDNHGIKRAICRAK+R+K L+    +  +Q KM++++
Sbjct  516   DQGPPIRKLYANLAELWPNRLMDNHGIKRAICRAKERQKALFGNLGKEMDQTKMKKSR  573



>gb|KFK42128.1| hypothetical protein AALP_AA2G214600 [Arabis alpina]
Length=703

 Score =   419 bits (1077),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 276/594 (46%), Positives = 363/594 (61%), Gaps = 65/594 (11%)
 Frame = +2

Query  182   PIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT-GLQsngng  358
             PID GS+ GE    ++S     +G R+   V+L   ETTIVSWKKL+KEA+ G+ S+   
Sbjct  7     PIDVGSNSGESA--KLSPKLLFSGDRKLLKVKLLEEETTIVSWKKLMKEASKGIVSSSVA  64

Query  359   apgpaprasaaaaELQPLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIE  532
                                 PP N +P      +P  P E E  D P  NR NAVIEKIE
Sbjct  65    HE------------------PPPNANPNLESRIAPGPPAEGEVADQPHSNRFNAVIEKIE  106

Query  533   RLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER  712
             RLY+GK S D E+LD  PD+DEYDTEDSFIDD ELD YF+VDNSAIKHDGFFVNRGKLER
Sbjct  107   RLYMGKDSSDGEELDGAPDDDEYDTEDSFIDDVELDAYFEVDNSAIKHDGFFVNRGKLER  166

Query  713   I---------EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAA  862
             I         EP++  NQ P KR++K+  K    + D     K +K+ K A GK   +A+
Sbjct  167   IVNGQESQDNEPSTTSNQQPKKRKRKESAKPNGDAVDVS--RKQSKMVKTAGGKDQSVAS  224

Query  863   GTSSPSYGVVMPTLYRENANVHNQEVN--FDMQKAEVLHSKNVVDKLKESSETSNQRSNE  1036
             G SS        TL    A   ++ V   F + K +  +    ++  K + + ++Q  N 
Sbjct  225   GPSSKK------TLSDAKAVEDSKAVQDPFPLSKVQNGNDSLFLENAKHTDKANDQPRN-  277

Query  1037  RISVPQEKSSGRSANIS-NGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQT---------  1186
               + P+ K +G SAN++    ++   Q   S+    R + SA    +ST           
Sbjct  278   -ATSPKSKGAGSSANLNPKCSNKGAHQQSNSMPGKSRPNVSA----KSTDVRHKENNGMH  332

Query  1187  -----VRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEI  1348
                   ++ GS+VR K + L+KAIR+LEK VAESRPP A E QD D +SQA+KRRLP ++
Sbjct  333   DLDNATKKGGSNVRPKTSSLDKAIRELEKVVAESRPPTATENQDADIASQAVKRRLPTDV  392

Query  1349  KQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNR  1528
             K KLAKVAR A A  G +S ELI RLMSIVGHL+Q+R+LKR+LK MI+ G SA +EKD R
Sbjct  393   KLKLAKVARIAPARQGNISGELIKRLMSIVGHLIQVRSLKRHLKTMIDSGDSANREKDTR  452

Query  1529  VQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRIC  1708
              Q IK EV EM+K +VPL++S+A  Q+ GTSDDFQ + + EK   K+K+ +D  LE+++C
Sbjct  453   FQLIKNEVIEMLKTQVPLVESQATNQEAGTSDDFQDVGSFEKAVLKKKFVIDAVLEDKLC  512

Query  1709  DLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY  1870
             DLYD+Y++GL+ED GPQ+RKLYA LA  WPN  MD + IK AICRAK+RR+ L+
Sbjct  513   DLYDIYIDGLDEDVGPQIRKLYASLAELWPNKVMDKNQIKHAICRAKERRRALH  566



>ref|NP_973880.1| wound-responsive family protein [Arabidopsis thaliana]
 gb|AEE30125.1| wound-responsive family protein [Arabidopsis thaliana]
Length=683

 Score =   417 bits (1072),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 310/740 (42%), Positives = 425/740 (57%), Gaps = 95/740 (13%)
 Frame = +2

Query  194   GSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEA---TGLQsngngap  364
             GS GGE  + R S     AG R+   VELRPG+TT VSWKKL+++A    GL      + 
Sbjct  10    GSIGGE--LLRASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDAGKVNGL------SA  61

Query  365   gpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYV  544
                     A   L+  I P H            PVE E  + P  NR NAVIEKIERLY 
Sbjct  62    SVPDPPPNANPNLEFRIAPGH------------PVEIETNEQPHSNRFNAVIEKIERLYK  109

Query  545   GKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPT  724
             G  S D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNS +KHDGF+VNRGKLER+EP+
Sbjct  110   GNDSSDGEELDGAPDDDEYDTEDSFIDDAELDEYFEVDNSTVKHDGFYVNRGKLERMEPS  169

Query  725   SQQNQLPNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKKAGKSV----------PLAAGTS  871
             +  NQ P KRR+KD  K C+   D      K +   +K  +S           PL +G  
Sbjct  170   TTSNQQPKKRRRKDSAKPCRDAVDVSDKHTKLSITARKKDQSTAPGSWKTQESPLPSGAQ  229

Query  872   SPSYGVVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERI---  1042
               +  V +  +   +   H Q  N    K+    S + + + K S+++ +Q+S   +   
Sbjct  230   DANTSVPLDDVKHSDRANH-QSRNDTSHKSRETGSSSALHQ-KYSNKSLHQQSTSLLGKS  287

Query  1043  --SVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRS  1216
               +V  E +  R    +NG+ Q                A+    ++S+Q  ++DGS+V+S
Sbjct  288   PPNVFAEVTVVRQKE-NNGMHQL---------------ANVTGSRQSSQASKKDGSNVKS  331

Query  1217  KITMLEKAIRDLEKFVAESRPPN-AEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASH  1393
             K ++LEKAIR+LEK V ESRPP   E Q+ D SSQA+KRRLP ++K KLAKVAR A AS 
Sbjct  332   KTSILEKAIRELEKVVVESRPPAITENQEADTSSQAVKRRLPRDVKLKLAKVARIA-ASQ  390

Query  1394  GKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDR  1573
             GK S ELINRLMSIVGHL+QLR+LKRNLKIMI+MG SA +EKD R +QI  EV +MIK +
Sbjct  391   GKHSTELINRLMSIVGHLIQLRSLKRNLKIMIDMGDSATREKDTRFKQINNEVLDMIKAK  450

Query  1574  VPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAG  1753
             V LM+S+AI+ +  TSDDFQ   + EK + K K+ MD ALE+++CDLYD++++GL+ED G
Sbjct  451   VSLMESQAIKPEGATSDDFQD--SVEKPSLK-KFVMDAALEDKLCDLYDIFIDGLDEDQG  507

Query  1754  PQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEE  1933
             PQ +KLY  LA  WPN  MD  GIK AI RAK+RRK LY     +  M + K+    ++ 
Sbjct  508   PQTKKLYVNLAELWPNRLMDYRGIKHAIFRAKERRKALYGNLAKE--MDQTKMKKSMKQL  565

Query  1934  GYRVETTTR-DQPVQIQEKSAVDAR---DHGSTATNKPISSTAAINMVGRIPVPSPGGTS  2101
               R + T + +  + +Q + + + +   D  +T+T+   S T    MV R          
Sbjct  566   VPRTDCTAQPNTELVVQRQHSGEKKLIVDPNATSTSVVTSQT----MVDRS---------  612

Query  2102  LDRPKPEKVKGTGNSTDRHITTDALTKKKMKRKPEPELGEGQYLPEKLSSKQAEYKPQEP  2281
              ++ +PEK+KG  +S +    T     + +KRK E  + E Q +   L+ K+ E+ PQ  
Sbjct  613   -NQQQPEKLKGISSSCNPTEET-----RVVKRKNEAVMAEKQVV---LALKKPEH-PQTR  662

Query  2282  IAAAP----VPKPSIQLNEP  2329
             +  AP    +P+ +  LN P
Sbjct  663   VIPAPQNLNIPRTTPDLNLP  682



>ref|XP_009104628.1| PREDICTED: uncharacterized protein LOC103830572 isoform X2 [Brassica 
rapa]
Length=658

 Score =   413 bits (1061),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 270/595 (45%), Positives = 356/595 (60%), Gaps = 72/595 (12%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S    AA  R+   VELR GETT VSWKKL+KEA+ +  +                  
Sbjct  14    RTSPKLLAAADRKLLKVELRRGETTYVSWKKLMKEASKVHGSST----------------  57

Query  404   QPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddv  583
              P  +P  N +     +P  P E E  D P  NR NAVIEKIERLY+G+ S D E+LD  
Sbjct  58    -PDPVPNANPNLDAHLAPGAPAEGEMVDQPHSNRFNAVIEKIERLYMGRDSSDGEELDGA  116

Query  584   pdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTS--QQNQLPNKRR  757
             PD+DEYDTEDSFIDD ELD+YF+VD++ IKHDGFFVN+GKLE+IEP++    NQ P KR+
Sbjct  117   PDDDEYDTEDSFIDDVELDEYFEVDDAKIKHDGFFVNKGKLEQIEPSTATMSNQKPKKRQ  176

Query  758   KKD--------------QTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVM  895
             +K+              Q K   G D         K      K+V  +     P  G  +
Sbjct  177   RKESAKPSGDVVDVSRKQAKTDGGKDQSAASGPSLKKKISDSKTVQDSVSPLKPQSGNDL  236

Query  896   PTL-YRENANVHNQEVNFDMQKAE---VLHSKNVVDKLKESSETSNQRSNERISVPQEKS  1063
               + + + AN+    ++   + AE    LH       +K S++ ++Q SN  +       
Sbjct  237   ENVKHSDKANLLRNALSPRSKAAESSGALH-------MKHSNKGAHQLSNSPLP------  283

Query  1064  SGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKAI  1243
                      G  +     + +V+  +    +A   ++S Q  R+ GS+ R K + LEKA 
Sbjct  284   ---------GKPRPDVLAKSTVVRQKENTDNATVSRQSIQ--RKGGSNARPKTSTLEKAF  332

Query  1244  RDLEKFVAESRPPNA--EVQDGD-NSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKEL  1414
             R+LEK VAESRPP A  E QD D +SSQA+KRRLP ++K KLAKVAR A AS G +S EL
Sbjct  333   RELEKVVAESRPPAAATENQDADTSSSQAVKRRLPGDVKSKLAKVARIA-ASQGNVSGEL  391

Query  1415  INRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSK  1594
             INRLMSIVGHL+Q+R+LKRNLKIMI+ G SA +EKDN+ Q+IK EV EM+K +VPL++S+
Sbjct  392   INRLMSIVGHLIQVRSLKRNLKIMIDSGDSANREKDNKFQRIKNEVVEMLKTQVPLIESQ  451

Query  1595  AIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLY  1774
             A  Q+ GTSDDFQ +        K+K+ MD A+E+++CDLYD++V+GL+ED+GP +RKLY
Sbjct  452   ATNQEAGTSDDFQDVGP----PAKKKFVMDAAMEDKLCDLYDIFVDGLDEDSGPHIRKLY  507

Query  1775  AELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRH---KNQEKMRRNKISAQKEE  1930
             A LA  WPN  MDNHGIKRAICRAK+RR+ LY  H     Q KM + K +  K E
Sbjct  508   ANLAELWPNRLMDNHGIKRAICRAKERRRALYENHGKEMGQGKMTKRKQTLPKPE  562



>ref|XP_009128218.1| PREDICTED: uncharacterized protein LOC103853066 isoform X1 [Brassica 
rapa]
Length=659

 Score =   409 bits (1052),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 275/576 (48%), Positives = 352/576 (61%), Gaps = 70/576 (12%)
 Frame = +2

Query  248   AGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPH  427
             AG R+   VELR GETT VSWKKL+KEA+  +  G+   G               + PP 
Sbjct  30    AGDRKLLKVELREGETTYVSWKKLMKEASNSRGIGSSDSG---------------LDPPP  74

Query  428   NDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedey  601
             N +P      +P  P E E  D P  NR NAVIEKIERLY+G+ S D E+LD  PD+DEY
Sbjct  75    NSNPNLQSRIAPGPPAEGETADQPHSNRFNAVIEKIERLYMGRDSSDGEELDGAPDDDEY  134

Query  602   dtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEP---TSQQNQLPNKRRKKDQT  772
             DTEDSFIDD ELD+YF+VD++ +KHDGFFVN GKLE IEP   T+  NQ P KR++K+  
Sbjct  135   DTEDSFIDDVELDEYFEVDDAEVKHDGFFVNSGKLELIEPSTTTAIPNQKPKKRQRKELA  194

Query  773   K-CQSGSDDGCNPNKPAKVGKKAGKSVPLAAGT-------SSPSYGVVMPTL--YRENAN  922
             K C   +D      K AK+ K AG  V  AA +       S+ S  V    L   + +A 
Sbjct  195   KPCGDVADAS---RKKAKIAKTAGGKVDQAAASGPSPQKKSNDSKTVQDSVLENVKHSAK  251

Query  923   VHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANISNGLDQ  1102
              + Q  N    K++   S   +  LK S++ + Q+SN +                NGL +
Sbjct  252   ANLQPRNSTSPKSKAFESSGPL-LLKCSNKGTPQQSNSQ---------------PNGLAK  295

Query  1103  SF--QQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKIT-MLEKAIRDLEKFVAES  1273
             S   ++ E +  +D               T R   ++VR K +  LEKA ++LEK VAES
Sbjct  296   STVTRRSENNGTHD-----------LGNATKRGGSNTVRPKTSSTLEKAFKELEKVVAES  344

Query  1274  RPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLV  1450
             RPP A E QD D SSQA+KRRLP  +K KLAKVAR  QAS G +S ELINRLMSIVGHL+
Sbjct  345   RPPAATENQDADTSSQAVKRRLPSNVKLKLAKVARLGQASQGSVSGELINRLMSIVGHLI  404

Query  1451  QLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDF  1630
             Q+R+LKRNLKIMI+   +A +EKD R Q IK EV EM+K +VPLM+S+A  Q+ GTSDDF
Sbjct  405   QVRSLKRNLKIMIDSEDTANREKDTRFQLIKNEVIEMLKTQVPLMESQATNQEAGTSDDF  464

Query  1631  QSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFM  1810
             Q +   EK   K+K+ MD  LE+++CDLYD++V+GL+EDAGPQ+RKLYA LA  WP   M
Sbjct  465   QDV---EKPPTKKKFVMDAGLEDKLCDLYDIFVDGLDEDAGPQIRKLYANLAELWPKRLM  521

Query  1811  DNHGIKRAICRAKDRRKTL---YNRHKNQEKMRRNK  1909
             DNHGIKRAICRAK+RR+       +  +QEK+ + K
Sbjct  522   DNHGIKRAICRAKERRRASNGDLGKEMDQEKITKRK  557



>ref|XP_007019215.1| Wound-responsive family protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY16440.1| Wound-responsive family protein, putative isoform 2 [Theobroma 
cacao]
Length=528

 Score =   405 bits (1040),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 272/509 (53%), Positives = 341/509 (67%), Gaps = 34/509 (7%)
 Frame = +2

Query  248   AGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPH  427
             AG RQ FTVELRPGETT VSWKKL+K+A     +   A   A   SA          PP 
Sbjct  30    AGDRQVFTVELRPGETTYVSWKKLVKDANRGNGSSAAAAMVAVATSAPE--------PPP  81

Query  428   NDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedey  601
             N  P      +P Q  EKE KD PP NR +AVIEKIERLY+GK S D+E+LD+ PD+D+Y
Sbjct  82    NAHPNLQSRIAPGQAAEKETKDEPPPNRFSAVIEKIERLYMGKDSSDEEELDETPDDDQY  141

Query  602   dtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKC  778
             DTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLER+ EP    NQ P KRR+KD  K 
Sbjct  142   DTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERVNEPLVILNQQPKKRRRKDAAKP  201

Query  779   QSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGVVMPTLYRENANV--HNQEVNFD  949
                SDDG   NK  K  K   G++ P + G ++ ++   +  L  +  +V   NQ    D
Sbjct  202   AGESDDGRVSNKHVKAAKMTPGRAEP-SLGRNNSNHSQNLTALNEQYGDVKAQNQLSVSD  260

Query  950   MQKAE-----VLHSKNVV-DKLKESS---ETSNQRSNERISVPQEKS-SGRSANISNGLD  1099
             ++  E     VL SKNVV +KLK++S   +  +Q+ +++ +  Q KS  G+     + L+
Sbjct  261   VKDTEKSKMGVLQSKNVVSNKLKDASGSYDVLHQKYHDKNAYLQSKSPHGKPIGNVDELE  320

Query  1100  QSFQQGEKSVIYDQRLDASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKF  1261
              S +  EK+ I + + D +  +GK +  T       +RDGS++R K +MLEKAIR+LEK 
Sbjct  321   LSVRLREKNGIRELQ-DTNVSDGKYAMHTAKSSHMQKRDGSTLRPKSSMLEKAIRELEKM  379

Query  1262  VAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVG  1441
             VAESRPP  E QD DNSSQ IKRRLP EIK KLAKVAR A AS GK+SKEL+NRLMSI+G
Sbjct  380   VAESRPPAMENQDADNSSQGIKRRLPREIKFKLAKVARLA-ASQGKVSKELLNRLMSILG  438

Query  1442  HLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTS  1621
             HL+QLRTLKRNLKIMI+ GLSAKQEKD+R QQ+K+EV EMIK RVP ++ KA+EQQ G S
Sbjct  439   HLIQLRTLKRNLKIMISTGLSAKQEKDDRFQQVKKEVVEMIKTRVPSLEPKALEQQAGAS  498

Query  1622  DDFQSIATEEKEAFKRKYCMDNALENRIC  1708
             D FQ + TEE+ A KRK+ MD +LE++I 
Sbjct  499   DGFQEVGTEER-ALKRKFSMDTSLEDKIW  526



>ref|XP_009128219.1| PREDICTED: uncharacterized protein LOC103853066 isoform X2 [Brassica 
rapa]
Length=658

 Score =   409 bits (1050),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 274/575 (48%), Positives = 350/575 (61%), Gaps = 69/575 (12%)
 Frame = +2

Query  248   AGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPH  427
             AG R+   VELR GETT VSWKKL+KEA+  +  G+   G               + PP 
Sbjct  30    AGDRKLLKVELREGETTYVSWKKLMKEASNSRGIGSSDSG---------------LDPPP  74

Query  428   NDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedey  601
             N +P      +P  P E E  D P  NR NAVIEKIERLY+G+ S D E+LD  PD+DEY
Sbjct  75    NSNPNLQSRIAPGPPAEGETADQPHSNRFNAVIEKIERLYMGRDSSDGEELDGAPDDDEY  134

Query  602   dtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQ---NQLPNKRRKKDQT  772
             DTEDSFIDD ELD+YF+VD++ +KHDGFFVN GKLE IEP++     NQ P KR++K+  
Sbjct  135   DTEDSFIDDVELDEYFEVDDAEVKHDGFFVNSGKLELIEPSTTTAIPNQKPKKRQRKELA  194

Query  773   K-CQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSP------SYGVVMPTL--YRENANV  925
             K C   +D      K AK+ K AG     AA   SP      S  V    L   + +A  
Sbjct  195   KPCGDVADAS---RKKAKIAKTAGGKDQAAASGPSPQKKSNDSKTVQDSVLENVKHSAKA  251

Query  926   HNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANISNGLDQS  1105
             + Q  N    K++   S   +  LK S++ + Q+SN +                NGL +S
Sbjct  252   NLQPRNSTSPKSKAFESSGPL-LLKCSNKGTPQQSNSQ---------------PNGLAKS  295

Query  1106  F--QQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKIT-MLEKAIRDLEKFVAESR  1276
                ++ E +  +D               T R   ++VR K +  LEKA ++LEK VAESR
Sbjct  296   TVTRRSENNGTHD-----------LGNATKRGGSNTVRPKTSSTLEKAFKELEKVVAESR  344

Query  1277  PPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQ  1453
             PP A E QD D SSQA+KRRLP  +K KLAKVAR  QAS G +S ELINRLMSIVGHL+Q
Sbjct  345   PPAATENQDADTSSQAVKRRLPSNVKLKLAKVARLGQASQGSVSGELINRLMSIVGHLIQ  404

Query  1454  LRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQ  1633
             +R+LKRNLKIMI+   +A +EKD R Q IK EV EM+K +VPLM+S+A  Q+ GTSDDFQ
Sbjct  405   VRSLKRNLKIMIDSEDTANREKDTRFQLIKNEVIEMLKTQVPLMESQATNQEAGTSDDFQ  464

Query  1634  SIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMD  1813
              +   EK   K+K+ MD  LE+++CDLYD++V+GL+EDAGPQ+RKLYA LA  WP   MD
Sbjct  465   DV---EKPPTKKKFVMDAGLEDKLCDLYDIFVDGLDEDAGPQIRKLYANLAELWPKRLMD  521

Query  1814  NHGIKRAICRAKDRRKTL---YNRHKNQEKMRRNK  1909
             NHGIKRAICRAK+RR+       +  +QEK+ + K
Sbjct  522   NHGIKRAICRAKERRRASNGDLGKEMDQEKITKRK  556



>emb|CDX68061.1| BnaA07g21010D [Brassica napus]
Length=658

 Score =   408 bits (1049),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 270/596 (45%), Positives = 357/596 (60%), Gaps = 74/596 (12%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S    AA  R+   VELR GETT VSWKKL+KEA+ +  +                  
Sbjct  14    RTSPKLLAAADRKLLKVELRRGETTYVSWKKLMKEASKVHGSSA----------------  57

Query  404   QPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddv  583
              P  +P  N +     +P  P E E  D P  NR NAVIEKIERLY+G+ S D E+LD  
Sbjct  58    -PDPVPNANPNLEAHLAPGAPAEGEMVDQPHSNRFNAVIEKIERLYMGRDSSDGEELDGA  116

Query  584   pdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTS--QQNQLPNKRR  757
             PD+DEYDTEDSFIDD ELD+YF+VD++ IKHDGFFVN+GKLE+IEP++    NQ P KR+
Sbjct  117   PDDDEYDTEDSFIDDVELDEYFEVDDAKIKHDGFFVNKGKLEQIEPSTATMSNQKPKKRQ  176

Query  758   KKD--------------QTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVM  895
             +K+              Q K   G D         K      K+V  +     P  G  +
Sbjct  177   RKESAKPSGDVVDVSRKQAKTDGGKDQSAASGPSLKKKISDSKTVQDSVSPLKPQSGNDL  236

Query  896   PTL-YRENANVHNQEVNFDMQKAE---VLHSKNVVDKLKESSETSNQRSNERISVPQEKS  1063
               + + + AN+    ++   + AE    LH       +K S++ ++Q     +S+     
Sbjct  237   ENVKHSDKANLLRNALSPRSKAAESSGALH-------MKHSNKGAHQ-----LSISPLPG  284

Query  1064  SGRSANISNGLDQSFQQGEKSVIYDQRLDA-SAPEGKRSTQTVRRDGSSVRSKITMLEKA  1240
               R   ++           KS +  Q+ +  +A   ++S Q  R+ GS+ R K + LEKA
Sbjct  285   KSRPDVLA-----------KSTVVRQKENTDNATVSRQSIQ--RKGGSNARPKTSTLEKA  331

Query  1241  IRDLEKFVAESRPPNA--EVQDGD-NSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKE  1411
              R+LEK VAESRPP    E QD D +SSQA+KRRLP ++K KLAKVAR A AS G +S E
Sbjct  332   FRELEKVVAESRPPAVATENQDADTSSSQAVKRRLPGDVKSKLAKVARIA-ASQGNVSGE  390

Query  1412  LINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKS  1591
             LINRLMSIVGHL+Q+R+LKRNLKIMI+ G SA +EKDN+ Q+IK EV EM+K +VPL++S
Sbjct  391   LINRLMSIVGHLIQVRSLKRNLKIMIDSGDSANREKDNKFQRIKNEVVEMLKTQVPLIES  450

Query  1592  KAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKL  1771
             +A  Q+ GTSDDFQ +        K+K+ MD A+E+++CDLYD++V+GL+ED+GP +RKL
Sbjct  451   QATNQEAGTSDDFQDVGP----PAKKKFVMDAAMEDKLCDLYDIFVDGLDEDSGPHIRKL  506

Query  1772  YAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRH---KNQEKMRRNKISAQKEE  1930
             YA LA  WPN  MDNHGIKRAICRAK+RR+ LY  H     Q KM + K +  K E
Sbjct  507   YANLAELWPNRLMDNHGIKRAICRAKERRRALYENHGKEMGQGKMTKRKQTLPKPE  562



>ref|XP_009128220.1| PREDICTED: uncharacterized protein LOC103853066 isoform X3 [Brassica 
rapa]
Length=658

 Score =   403 bits (1036),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 274/576 (48%), Positives = 351/576 (61%), Gaps = 71/576 (12%)
 Frame = +2

Query  248   AGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPH  427
             AG R+   VELR GETT VSWKKL+KEA+  +  G+   G               + PP 
Sbjct  30    AGDRKLLKVELREGETTYVSWKKLMKEASNSRGIGSSDSG---------------LDPPP  74

Query  428   NDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedey  601
             N +P      +P  P E E  D P  NR NAVIEKIERLY+G+ S D E+LD  PD+DEY
Sbjct  75    NSNPNLQSRIAPGPPAEGETADQPHSNRFNAVIEKIERLYMGRDSSDGEELDGAPDDDEY  134

Query  602   dtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEP---TSQQNQLPNKRRKKDQT  772
             DTEDSFIDD ELD+YF+VD++ +KHDGFFVN GKLE IEP   T+  NQ P KR++K+  
Sbjct  135   DTEDSFIDDVELDEYFEVDDAEVKHDGFFVNSGKLELIEPSTTTAIPNQKPKKRQRKELA  194

Query  773   K-CQSGSDDGCNPNKPAKVGKKAGKSVPLAAGT-------SSPSYGVVMPTL--YRENAN  922
             K C   +D      K AK+ K AG  V  AA +       S+ S  V    L   + +A 
Sbjct  195   KPCGDVADAS---RKKAKIAKTAGGKVDQAAASGPSPQKKSNDSKTVQDSVLENVKHSAK  251

Query  923   VHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANISNGLDQ  1102
              + Q  N    K++   S   +  LK S++ + Q+SN +                NGL +
Sbjct  252   ANLQPRNSTSPKSKAFESSGPL-LLKCSNKGTPQQSNSQ---------------PNGLAK  295

Query  1103  SF--QQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKIT-MLEKAIRDLEKFVAES  1273
             S   ++ E +  +D               T R   ++VR K +  LEKA ++LEK VAES
Sbjct  296   STVTRRSENNGTHD-----------LGNATKRGGSNTVRPKTSSTLEKAFKELEKVVAES  344

Query  1274  RPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLV  1450
             RPP A E QD D SSQA+KRRLP  +K KLAKVAR   AS G +S ELINRLMSIVGHL+
Sbjct  345   RPPAATENQDADTSSQAVKRRLPSNVKLKLAKVARLG-ASQGSVSGELINRLMSIVGHLI  403

Query  1451  QLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDF  1630
             Q+R+LKRNLKIMI+   +A +EKD R Q IK EV EM+K +VPLM+S+A  Q+ GTSDDF
Sbjct  404   QVRSLKRNLKIMIDSEDTANREKDTRFQLIKNEVIEMLKTQVPLMESQATNQEAGTSDDF  463

Query  1631  QSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFM  1810
             Q +   EK   K+K+ MD  LE+++CDLYD++V+GL+EDAGPQ+RKLYA LA  WP   M
Sbjct  464   QDV---EKPPTKKKFVMDAGLEDKLCDLYDIFVDGLDEDAGPQIRKLYANLAELWPKRLM  520

Query  1811  DNHGIKRAICRAKDRRKTL---YNRHKNQEKMRRNK  1909
             DNHGIKRAICRAK+RR+       +  +QEK+ + K
Sbjct  521   DNHGIKRAICRAKERRRASNGDLGKEMDQEKITKRK  556



>gb|KEH35347.1| wound-responsive family protein [Medicago truncatula]
Length=547

 Score =   399 bits (1026),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 272/564 (48%), Positives = 355/564 (63%), Gaps = 68/564 (12%)
 Frame = +2

Query  233   TSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPL  412
             +S+   GGRQ FTVELRPGETTIVSWKKLLK+AT               +++ + + +P 
Sbjct  9     SSFVKKGGRQMFTVELRPGETTIVSWKKLLKDAT-----------KPNGSASTSQQSRP-  56

Query  413   ILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpde  592
                     P PG    QPVE E  D    +R +AVIEKIERLY+G  S DDEDL DVPD+
Sbjct  57    -------EPFPG----QPVEVEENDPAQPHRFSAVIEKIERLYMGNGSSDDEDLPDVPDD  105

Query  593   deydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQ  769
             D+YDTEDSFIDD ELD+YFQVDNS +KHDGFFVNRGKLER  EP    NQ P KRRKKD 
Sbjct  106   DQYDTEDSFIDDAELDEYFQVDNSKVKHDGFFVNRGKLERTDEPPVLPNQQPKKRRKKDT  165

Query  770   TKCQSGSDDGCNPNKPAKVGK-KAGKSVPL-AAGTSSPSYGVVMPTLYRENANVHNQ-EV  940
              K    +++    NK  KVGK ++GK+  + A    + S  + +P  + EN    NQ ++
Sbjct  166   VKNPDENNNVLGSNKHVKVGKVESGKTTSIQAKNVCNSSQNLAVPGEHYENLKPQNQLDI  225

Query  941   NFDMQKAEVLHSKNVVDK---LKESSE-----TSNQR-SNERISVPQEKSSGRSANIS--  1087
                  K +   +K +      LK SS+     TS  + ++++I   Q K++  S + +  
Sbjct  226   YGSSSKKKTADTKPISVSSVSLKTSSDDFPAATSEAKDADKKIGAFQSKNTSGSFDATHQ  285

Query  1088  ----------------------NGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR---  1192
                                   +GL+   +  EK+    Q  D +   GKR+T+  +   
Sbjct  286   KYHEKGAHAQSKSQPVKPSKSIDGLENISRSKEKNGRRHQLPDLNLSVGKRTTKATKSEY  345

Query  1193  ---RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLA  1363
                +DGSSVR K +MLEKA+ +LEK VAESRPP AE  + DN+SQA+KRRLP EIK KLA
Sbjct  346   MHKKDGSSVRPKSSMLEKALGELEKMVAESRPPAAENPEADNTSQAVKRRLPREIKLKLA  405

Query  1364  KVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIK  1543
             KVAR A ASHGK+SKELINRLMSI+GHL+QLRTLKRNLK MI+MGLSAKQ+ D+R Q+IK
Sbjct  406   KVARLA-ASHGKVSKELINRLMSILGHLMQLRTLKRNLKTMISMGLSAKQDDDDRFQRIK  464

Query  1544  REVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDL  1723
             +EV +MIK + P ++SK  +Q+ G S D Q    + K   KR + MD ALE++ICDLYD+
Sbjct  465   KEVVDMIKIQAPTLESKQ-QQKAGASGDVQEFGPDGKPITKRNFSMDAALEDKICDLYDI  523

Query  1724  YVEGLEEDAGPQVRKLYAELAAYW  1795
             +V+GL+E+AGPQ+RKLYAE+   +
Sbjct  524   FVDGLDENAGPQIRKLYAEVIKIF  547



>emb|CDY38353.1| BnaA02g18460D [Brassica napus]
Length=656

 Score =   398 bits (1023),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 265/568 (47%), Positives = 345/568 (61%), Gaps = 56/568 (10%)
 Frame = +2

Query  248   AGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPH  427
             AG R+   VELR GETT VSWKKL+KEA+  +  G+   G               + PP 
Sbjct  29    AGDRKLLKVELREGETTYVSWKKLMKEASNSKGIGSSDSG---------------LDPPL  73

Query  428   NDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedey  601
             N +P      +P  P E E  D P  NR NAVIEKIERLY+G+ S D E+LD  PD+DEY
Sbjct  74    NSNPNLQSRIAPGPPAEGETADQPHSNRFNAVIEKIERLYMGRDSSDGEELDGAPDDDEY  133

Query  602   dtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEP---TSQQNQLPNKRRKKDQT  772
             DTEDSFIDD ELD+YF+VD++ +KHDGFFVN GKLE +EP   T+  NQ P KR++K+  
Sbjct  134   DTEDSFIDDVELDEYFEVDDAEVKHDGFFVNSGKLELVEPSTTTTIPNQKPKKRQRKELA  193

Query  773   K-CQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENANVHNQEV-NF  946
             K C   +D      K AK+ K AG     AA   SP           ++  VH+  + N 
Sbjct  194   KPCGDVADAS---RKKAKIAKTAGGKDQAAASGPSPKKK------SNDSKTVHDSVLENV  244

Query  947   DMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANISNGLDQSF--QQGE  1120
                    L  +N      +++E++       +    + +  +S +  NGL +S   ++ E
Sbjct  245   KHSDKANLQPRNSTSPKSKAAESTGPL---LLKCSNKGTHQQSDSQPNGLAKSTVARRNE  301

Query  1121  KSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKIT-MLEKAIRDLEKFVAESRPPNA-EV  1294
              +  +D               T R   ++VR K +  LEKA ++LEK VAESRPP A E 
Sbjct  302   NNGTHD-----------LGNATKRGGSNTVRPKTSSTLEKAFKELEKVVAESRPPAATEN  350

Query  1295  QDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRN  1474
             QD D SSQA+KRRLP  +K KLAKVAR   AS G +S ELINRLMSIVGHL+Q+R+LKRN
Sbjct  351   QDADTSSQAVKRRLPSNVKLKLAKVARLG-ASQGSVSGELINRLMSIVGHLIQVRSLKRN  409

Query  1475  LKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEK  1654
             LKIMI+   +A +EKD R Q  K EV EM+K +VPLM+S+A  Q+ GTSDDFQ +   EK
Sbjct  410   LKIMIDSEDTANREKDTRFQLTKNEVIEMLKTQVPLMESQATNQEAGTSDDFQDV---EK  466

Query  1655  EAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRA  1834
                K+K+ MD ALE+++CDLYD++V+GL+EDAGPQ+RKLYA LA  WP   MDNHGIKRA
Sbjct  467   PPTKKKFVMDAALEDKLCDLYDIFVDGLDEDAGPQIRKLYANLAELWPKRLMDNHGIKRA  526

Query  1835  ICRAKDRRKTL---YNRHKNQEKMRRNK  1909
             ICR K+RR+       +  +QEK+ + K
Sbjct  527   ICRVKERRRASNGELGKEMDQEKITKRK  554



>ref|XP_011031129.1| PREDICTED: ubinuclein-1-like isoform X5 [Populus euphratica]
Length=685

 Score =   397 bits (1020),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 261/572 (46%), Positives = 363/572 (63%), Gaps = 24/572 (4%)
 Frame = +2

Query  257   RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDS  436
             RQRF +EL+PGETTIVSWKKLLK+A   ++N + +      A+A A+    ++ P   ++
Sbjct  16    RQRFYIELKPGETTIVSWKKLLKDAAANKANPSHSNNRTAAAAAGASTSSFVMEPASVET  75

Query  437   PG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydte  610
                   F+  Q  +   K+AP  +RL +VIEKIE+LYVG QS D+E+LD  PDED YDT+
Sbjct  76    AQQEAQFALGQLTKPIPKNAPSSSRLGSVIEKIEQLYVGNQSSDEEELDGAPDEDHYDTK  135

Query  611   dSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGS  790
             DSFIDDTELD YF+VD S  KH+GFFVN+GKLE +      +   +K+RK +  K +   
Sbjct  136   DSFIDDTELDGYFEVDQSTTKHNGFFVNKGKLEHMNRPISSSHFQSKKRKNNMQKAREEK  195

Query  791   DDGCNPNKPAKVGKK----AGKSVPLAAGTSSPSYGVVMPTLYRENANVHNQEVN-FDMQ  955
             D     +K AK+G+     A  ++P+     + +  + +  +   + ++ N   N  + Q
Sbjct  196   DGDRIRDKHAKLGQGRMNVATGNIPMDEPFRTNTQNLAVNEITNRDDSISNTGQNDTEKQ  255

Query  956   KAEVLHSKNVVDKLKESSETSN------QRSNE-RISVPQEKS-SGRSANISNGLDQSFQ  1111
                VL   N+   +K++SE S       Q +N    S PQ K  +  + N S+       
Sbjct  256   MNGVLQPGNLGRIVKDTSELSRVADRKYQENNAPGQSAPQSKRLASETCNASSPKVPHRN  315

Query  1112  QGEKSVIYDQRLDASAPEGKRSTQTVR-RDGSSVRSKITMLEKAIRDLEKFVAESRPPNA  1288
             +  +  + D  L     + ++ T T+  +D SS++ K +M+E+AIRDLEK VAESRP N 
Sbjct  316   KKGRHELPDLNLPHYPVQAEKKTATMHPKDVSSLQPKGSMVERAIRDLEKVVAESRPRNT  375

Query  1289  EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLK  1468
             + QD D SS +IKRRLP E+KQKLAKVAR AQ+S GK+S+ELI+ LM+I+GHL+QL TLK
Sbjct  376   DAQDADTSSMSIKRRLPFEVKQKLAKVARLAQSSQGKISEELISHLMTILGHLIQLSTLK  435

Query  1469  RNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIAT  1645
             +NL+ M+ MGL+AKQEK +R Q+IK+EV EMI+ ++   + KA+        DFQ  I  
Sbjct  436   KNLREMVEMGLTAKQEKADRFQKIKKEVMEMIELQLFKQRDKAVV-------DFQKGIIH  488

Query  1646  EEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGI  1825
              EK A  RKY MD+ +E++ICDLYDL+V+G++ED GPQ+RKLYAE+A  WPNG MDNHGI
Sbjct  489   GEKGAINRKYVMDDKMEDKICDLYDLFVQGMDEDKGPQIRKLYAEVAEMWPNGAMDNHGI  548

Query  1826  KRAICRAKDRRKTLYNRHKNQEKMRRNKISAQ  1921
             K AICRAK+RR+  YN  K QEK R  K+S Q
Sbjct  549   KIAICRAKERRRIFYNNEKVQEKARIEKLSRQ  580



>ref|XP_008805861.1| PREDICTED: ubinuclein-2-like isoform X2 [Phoenix dactylifera]
Length=754

 Score =   398 bits (1022),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 307/761 (40%), Positives = 419/761 (55%), Gaps = 132/761 (17%)
 Frame = +2

Query  242   EAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILP  421
             E+A  R RFTVELRPGETTIVSWK+L+++++                     + + +  P
Sbjct  48    ESASQRLRFTVELRPGETTIVSWKRLVRDSS---------------------KGRNVFPP  86

Query  422   PHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedey  601
             P    P  G             A P                GKQS D+EDLD+ PD+D+Y
Sbjct  87    PSGAEPAFGTH-----------AGPAA-------------AGKQSSDEEDLDEAPDDDQY  122

Query  602   dtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQ  781
             DTEDSFIDD ELD+YFQVD    K+DG+FVN+GKLE +EP +  N  P KRR+KD TK  
Sbjct  123   DTEDSFIDDAELDEYFQVDKLRTKYDGYFVNKGKLEHVEPMASFNVAPKKRRRKDSTKVY  182

Query  782   SGSDDGCNPNKPAKVG----KKAGKSVPLAAGTSSPSYGVV-MP----------------  898
                D    PN+  K+G    K A ++ PL     S +  V+ +P                
Sbjct  183   RKRDHQHGPNESVKMGNMRIKAAARNAPLVGKKLSSTADVLALPYFEHYYEESKPVKKIL  242

Query  899   --------------TLYREN---ANVHNQEV--------NFDMQKAEVLHSKNVVDKLKE  1003
                           TL+ EN     V N++V        +FD  KA V+ S ++V K + 
Sbjct  243   NAPAGAYKKRSSDLTLHLENPPSVKVPNKDVPSLPLESKDFDKHKAVVIPSDDLVHKSRG  302

Query  1004  SSETSN---QRSNERISVPQEKSSGRSANISNG----LDQSFQQGEKSVIYDQRLDASAP  1162
             +  + +   Q S ++    Q +   R   + NG    L    ++ EK    +  + A  P
Sbjct  303   TGNSLDPMYQASQDKGVSSQVEFQSR--RLLNGEIEELSAKIRRKEKHGTCEFPMQAVQP  360

Query  1163  EGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPP  1342
               +R      ++GS+VR K T LE+AIRDLEK VA SRPP+ +VQ+ D SSQ +KRRLP 
Sbjct  361   TFRRV-----KEGSTVRPKGTTLERAIRDLEKIVAVSRPPSIDVQEMDPSSQGVKRRLPQ  415

Query  1343  EIKQKLAKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEK  1519
             ++KQKLAKVAR + AS GK+S+ +LI+RLM I+GHLVQ +TLKRN+K M+ +GLSAKQ+K
Sbjct  416   DVKQKLAKVARLS-ASQGKVSEDDLIDRLMGILGHLVQRKTLKRNMKEMVELGLSAKQQK  474

Query  1520  DNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQS-IATEEKEAFKRKYCMDNALE  1696
              +R QQ+K+EV EMI+ RV  MKSK       ++DDFQ  I  +E+ A K KY MD+ALE
Sbjct  475   ADRFQQVKKEVHEMIRARVSNMKSKD-----ASADDFQEVINNDERRALKGKYSMDSALE  529

Query  1697  NRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNR  1876
             ++ICDLYDLYVEG++ED GPQ RKLY ELA  WP+G+MDN GIK AI R+K+R++ LY  
Sbjct  530   DKICDLYDLYVEGMDEDKGPQSRKLYVELAELWPHGYMDNVGIKDAIYRSKERKRVLYRP  589

Query  1877  HK--NQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTA  2050
             HK  ++E+++R K++A       RVET    Q    QE+   D+      +  K +S+  
Sbjct  590   HKVRDEERIKRKKLAA-----AVRVETNPAAQVWAGQERPVTDSIGAVLISPGKLVSNQP  644

Query  2051  AINMVGRIPVPSP----GGTSLDRPKPEKVKGTGNSTDRHITTDALT--KKKMKRKPEPE  2212
                ++GRI  P+P     G       P+KV+G   S      + A+   KKKMKRK E E
Sbjct  645   PA-LLGRITDPTPPSSDSGQQHGLKNPDKVRGGSMSMILEDGSKAVVDMKKKMKRKSESE  703

Query  2213  LGEGQYLPEKLSSKQAE--YKPQEPIAAAPV---PKPSIQL  2320
             LG     P K+ S+  +  +K Q+      V   PKP I L
Sbjct  704   LGYIHVHPRKVPSQHTKESHKSQKLTDDTNVSQQPKPVIPL  744



>ref|NP_177855.4| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE35962.1| uncharacterized protein AT1G77310 [Arabidopsis thaliana]
Length=717

 Score =   394 bits (1012),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 294/729 (40%), Positives = 408/729 (56%), Gaps = 107/729 (15%)
 Frame = +2

Query  176   KPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT----GLQ  343
             K P D+G +  E    ++S+    AG R+   VEL   ETT+VSWKKL+ EA+    GL 
Sbjct  6     KLPTDDGPTFNESC--KISSEILTAGDRKLLKVELLKEETTLVSWKKLMDEASKENGGL-  62

Query  344   sngngapgpaprasaaaaELQPLILPPH---NDSPGPGF--SPEQPVEKEAKDAPPGNRL  508
                                    +  P    N +P   F  +P    E E  + P  NRL
Sbjct  63    ----------------------FVSAPERLLNANPNLEFRLAPGAQTENEMVNQPHPNRL  100

Query  509   NAVIEKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFF  688
             N+VI KIERLY+GK   D E+LD  PD+D+YDTEDSFIDD ELD+YF+VDNS IKHDGFF
Sbjct  101   NSVIAKIERLYMGKDGSDGEELDGAPDDDDYDTEDSFIDDAELDEYFEVDNSPIKHDGFF  160

Query  689   VNRGKLERIEPTSQQNQL-PNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKKAGKSVPLAA  862
             VNRGKLERIEP++  NQ  P KRR+K+  K C    D      K AK+ K AG       
Sbjct  161   VNRGKLERIEPSATSNQQQPKKRRRKESAKPCGDVVDVS---RKRAKMAKTAG------G  211

Query  863   GTSSPSYGVVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERI  1042
                S S G     +  ++  V +   +F   KA+  +   V++ +K + + ++Q  N   
Sbjct  212   KDQSASPGPSSKKISNDSKTVQD---SFSPLKAQNGNDSLVLENVKHTDKANHQPMN--A  266

Query  1043  SVPQEKSSGRSANI-----SNGLDQSFQQ---------GEKSVIYDQRLDASAP------  1162
             + P+ K++G S  +     S  + +               KS +  Q+++   P      
Sbjct  267   TSPKSKAAGSSGPLHPKCSSKSVHEQSNSPPGKSRPNVSAKSAVVRQQVNNGMPDLDIAT  326

Query  1163  EGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLP  1339
             E K S Q  ++ GS+ R K + LEKAIR+LEK VAESRPP A E QD D SSQA+KR LP
Sbjct  327   ESKTSIQISKKSGSNGRPKYSTLEKAIRNLEKLVAESRPPAATENQDADISSQAVKRGLP  386

Query  1340  PEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEK  1519
              ++K  LAKVAR A AS G++S ELINRLM IVGHL+Q+R+LKRNLKIMI+  ++A +EK
Sbjct  387   GDVKLHLAKVARIAYASQGEISGELINRLMGIVGHLIQIRSLKRNLKIMIDSIVTANREK  446

Query  1520  DNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALEN  1699
             D R Q+IK E+ EM+K +VPL++S+   Q+ GTSDDFQ + +  K   K K+ MD ALE 
Sbjct  447   DTRFQRIKSEITEMLKTQVPLVESQETNQEAGTSDDFQDVGSLGKSPVK-KFVMDVALEE  505

Query  1700  RICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRH  1879
             ++CDLYD++VEG++E +G Q+RKLY++LA  WPN  +DNH I+RAICR K+RR+ L    
Sbjct  506   KLCDLYDVFVEGMDEHSGSQIRKLYSDLAQLWPNSLVDNHEIRRAICREKERRRALEGNI  565

Query  1880  KNQEKMRRNKISAQKE------EEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPIS  2041
               +  M + KI+ +K+       EG     T  D+   ++ K++V             + 
Sbjct  566   GKE--MDQTKITKKKQTQLVPKSEGI----TYPDKTSGVEVKASV-------------VL  606

Query  2042  STAAINMVGRIPVPSPGGTSLDRPKP--EKVKGTGNSTDRHITTDALTKKKMKRKPEPEL  2215
             +    ++V   P      +S +R K   EK+K T +     ++  A   KK++RK EP L
Sbjct  607   TATTTSLVDCQPA---ADSSFERSKQQHEKLKRTSS-----LSNPAAEGKKVRRKTEPAL  658

Query  2216  GEGQYLPEK  2242
              E     EK
Sbjct  659   EETHLPAEK  667



>gb|AAD41413.1|AC007727_2 ESTs gb|T42839 and gb|AA395192 come from this gene [Arabidopsis 
thaliana]
Length=709

 Score =   391 bits (1004),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 307/769 (40%), Positives = 425/769 (55%), Gaps = 127/769 (17%)
 Frame = +2

Query  194   GSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEA---TGLQsngngap  364
             GS GGE  + R S     AG R+   VELRPG+TT VSWKKL+++A    GL      + 
Sbjct  10    GSIGGE--LLRASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDAGKVNGL------SA  61

Query  365   gpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEK------  526
                     A   L+  I P H            PVE E  + P  NR NAVIEK      
Sbjct  62    SVPDPPPNANPNLEFRIAPGH------------PVEIETNEQPHSNRFNAVIEKIERLYK  109

Query  527   --------IERLYV------------------------GKQSdddedlddvpdedeydte  610
                     I  ++                         G  S D E+LD  PD+DEYDTE
Sbjct  110   VVICLIFHIHNIFAYHAIALLHSHISEKCMLTSENKSQGNDSSDGEELDGAPDDDEYDTE  169

Query  611   dSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTK-CQSG  787
             DSFIDD ELD+YF+VDNS +KHDGF+VNRGKLER+EP++  NQ P KRR+KD  K C+  
Sbjct  170   DSFIDDAELDEYFEVDNSTVKHDGFYVNRGKLERMEPSTTSNQQPKKRRRKDSAKPCRDA  229

Query  788   SDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTL-YRENANVHNQEVNFDMQKAE  964
              D      K +   +K  K  PL +G    +  V +  + + + AN  +Q  N    K+ 
Sbjct  230   VDVSDKHTKLSITARK--KESPLPSGAQDANTSVPLDDVKHSDRAN--HQSRNDTSHKSR  285

Query  965   VLHSKNVVDKLKESSETSNQRSNERI-----SVPQEKSSGRSANISNGLDQSFQQGEKSV  1129
                S + + + K S+++ +Q+S   +     +V  E +  R    +NG+ Q         
Sbjct  286   ETGSSSALHQ-KYSNKSLHQQSTSLLGKSPPNVFAEVTVVRQKE-NNGMHQL--------  335

Query  1130  IYDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPN-AEVQDGD  1306
                    A+    ++S+Q  ++DGS+V+SK ++LEKAIR+LEK V ESRPP   E Q+ D
Sbjct  336   -------ANVTGSRQSSQASKKDGSNVKSKTSILEKAIRELEKVVVESRPPAITENQEAD  388

Query  1307  NSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIM  1486
              SSQA+KRRLP ++K KLAKVAR A AS GK S ELINRLMSIVGHL+QLR+LKRNLKIM
Sbjct  389   TSSQAVKRRLPRDVKLKLAKVARIA-ASQGKHSTELINRLMSIVGHLIQLRSLKRNLKIM  447

Query  1487  INMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFK  1666
             I+MG SA +EKD R +QI  EV +MIK +V LM+S+AI+ +  TSDDFQ   + EK + K
Sbjct  448   IDMGDSATREKDTRFKQINNEVLDMIKAKVSLMESQAIKPEGATSDDFQD--SVEKPSLK  505

Query  1667  RKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRA  1846
              K+ MD ALE+++CDLYD++++GL+ED GPQ +KLY  LA  WPN  MD  GIK AI RA
Sbjct  506   -KFVMDAALEDKLCDLYDIFIDGLDEDQGPQTKKLYVNLAELWPNRLMDYRGIKHAIFRA  564

Query  1847  KDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTR-DQPVQIQEKSAVDAR---DHG  2014
             K+RRK LY     +  M + K+    ++   R + T + +  + +Q + + + +   D  
Sbjct  565   KERRKALYGNLAKE--MDQTKMKKSMKQLVPRTDCTAQPNTELVVQRQHSGEKKLIVDPN  622

Query  2015  STATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHITTDALTKKKMK  2194
             +T+T+   S T    MV R           ++ +PEK+KG  +S +    T     + +K
Sbjct  623   ATSTSVVTSQT----MVDRS----------NQQQPEKLKGISSSCNPTEET-----RVVK  663

Query  2195  RKPEPELGEGQYLPEKLSSKQAEYKPQEPIAAAP----VPKPSIQLNEP  2329
             RK E  + E Q +   L+ K+ E+ PQ  +  AP    +P+ +  LN P
Sbjct  664   RKNEAVMAEKQVV---LALKKPEH-PQTRVIPAPQNLNIPRTTPDLNLP  708



>ref|XP_011031130.1| PREDICTED: ubinuclein-1-like isoform X6 [Populus euphratica]
Length=657

 Score =   387 bits (995),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 257/567 (45%), Positives = 353/567 (62%), Gaps = 42/567 (7%)
 Frame = +2

Query  257   RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDS  436
             RQRF +EL+PGETTIVSWKKLLK+A   ++N + +      A+A A+    ++ P   ++
Sbjct  16    RQRFYIELKPGETTIVSWKKLLKDAAANKANPSHSNNRTAAAAAGASTSSFVMEPASVET  75

Query  437   PG--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydte  610
                   F+  Q  +   K+AP  +RL +VIEKIE+LYVG QS D+E+LD  PDED YDT+
Sbjct  76    AQQEAQFALGQLTKPIPKNAPSSSRLGSVIEKIEQLYVGNQSSDEEELDGAPDEDHYDTK  135

Query  611   dSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGS  790
             DSFIDDTELD YF+VD S  KH+GFFVN+GKLE +      +   +K+RK +  K +   
Sbjct  136   DSFIDDTELDGYFEVDQSTTKHNGFFVNKGKLEHMNRPISSSHFQSKKRKNNMQKAREEK  195

Query  791   DDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENANVHNQEVNFDMQKAEVL  970
             D     +K AK                       +    R+++  +  + + + Q   VL
Sbjct  196   DGDRIRDKHAK-----------------------LEITNRDDSISNTGQNDTEKQMNGVL  232

Query  971   HSKNVVDKLKESSETSN------QRSNE-RISVPQEKS-SGRSANISNGLDQSFQQGEKS  1126
                N+   +K++SE S       Q +N    S PQ K  +  + N S+       +  + 
Sbjct  233   QPGNLGRIVKDTSELSRVADRKYQENNAPGQSAPQSKRLASETCNASSPKVPHRNKKGRH  292

Query  1127  VIYDQRLDASAPEGKRSTQTVR-RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDG  1303
              + D  L     + ++ T T+  +D SS++ K +M+E+AIRDLEK VAESRP N + QD 
Sbjct  293   ELPDLNLPHYPVQAEKKTATMHPKDVSSLQPKGSMVERAIRDLEKVVAESRPRNTDAQDA  352

Query  1304  DNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKI  1483
             D SS +IKRRLP E+KQKLAKVAR AQ+S GK+S+ELI+ LM+I+GHL+QL TLK+NL+ 
Sbjct  353   DTSSMSIKRRLPFEVKQKLAKVARLAQSSQGKISEELISHLMTILGHLIQLSTLKKNLRE  412

Query  1484  MINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIATEEKEA  1660
             M+ MGL+AKQEK +R Q+IK+EV EMI+ ++   + KA+        DFQ  I   EK A
Sbjct  413   MVEMGLTAKQEKADRFQKIKKEVMEMIELQLFKQRDKAVV-------DFQKGIIHGEKGA  465

Query  1661  FKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAIC  1840
               RKY MD+ +E++ICDLYDL+V+G++ED GPQ+RKLYAE+A  WPNG MDNHGIK AIC
Sbjct  466   INRKYVMDDKMEDKICDLYDLFVQGMDEDKGPQIRKLYAEVAEMWPNGAMDNHGIKIAIC  525

Query  1841  RAKDRRKTLYNRHKNQEKMRRNKISAQ  1921
             RAK+RR+  YN  K QEK R  K+S Q
Sbjct  526   RAKERRRIFYNNEKVQEKARIEKLSRQ  552



>emb|CDY40880.1| BnaCnng09710D [Brassica napus]
Length=581

 Score =   383 bits (984),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 248/485 (51%), Positives = 316/485 (65%), Gaps = 47/485 (10%)
 Frame = +2

Query  464   PVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDD  643
             P E E  D P  NR NAVIEKIERLY+G+ S D E+LD  PD+DEYDTEDSFIDD ELD+
Sbjct  5     PAEGETADQPHSNRFNAVIEKIERLYMGRDSSDGEELDGAPDDDEYDTEDSFIDDVELDE  64

Query  644   YFQVDNSAIKHDGFFVNRGKLERIEPTSQQ---NQLPNKRRKKDQTK-CQSGSDDGCNPN  811
             YF+VD++ IKHDGFFVN GKLE IEP++     NQ P KR++K+  K C   +D      
Sbjct  65    YFEVDDAEIKHDGFFVNSGKLELIEPSTTTAIPNQKPKKRQRKESAKPCGDVADAS---R  121

Query  812   KPAKVGKKAGKSVPLAAGTSSPSY----------GVVMPTLYRENANVHNQEVNFDMQKA  961
             K AK+ K AG     AA   SP             V+    + + AN+  Q  N    K+
Sbjct  122   KQAKIAKTAGAKDQAAASRPSPKKKSNDSKTVQDSVLENVKHSDKANL--QPRNSTSPKS  179

Query  962   EVLHSKNVVDKLKESSETSNQRSNERISVPQ--EKSSGRSANISNGLDQSFQQGEKSVIY  1135
             +   S   +  LK S++ ++Q+S+   S P    KS+    N +NG   +   G  +V  
Sbjct  180   KAAESSGAL-LLKCSNKGTHQQSD---SQPNGLAKSTVARGNENNG---THDLGNATV--  230

Query  1136  DQRLDASAPEGKRSTQTVRRDGS-SVRSKIT-MLEKAIRDLEKFVAESRPPNA-EVQDGD  1306
                        K+S Q  +R GS +VR K +  LEKA ++LEK VAESRPP A E QD D
Sbjct  231   ----------SKQSVQITKRGGSNTVRPKTSSTLEKAFKELEKVVAESRPPAATENQDAD  280

Query  1307  NSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIM  1486
              SSQA+KRRLP  +K KLAKVAR A A+ G +S ELINRLMSIVGHL+Q+R+LKRNLKIM
Sbjct  281   TSSQAVKRRLPSNVKLKLAKVARLA-ANQGSVSGELINRLMSIVGHLIQVRSLKRNLKIM  339

Query  1487  INMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFK  1666
             I+   +A +EKD R Q IK EV+EM+K +VPLM+S+A  Q+ GTSDDFQ +   EK   K
Sbjct  340   IDSEDTANREKDTRFQLIKNEVSEMLKTQVPLMESQATNQEAGTSDDFQDV---EKPPTK  396

Query  1667  RKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRA  1846
             +++ MD ALE+++CDLYD++V+GL+EDAGPQ+RKLYA LA  WP   MDNHGIKRAICRA
Sbjct  397   KRFVMDAALEDKLCDLYDIFVDGLDEDAGPQIRKLYANLAELWPKRLMDNHGIKRAICRA  456

Query  1847  KDRRK  1861
             K+RR+
Sbjct  457   KERRR  461



>ref|XP_006300313.1| hypothetical protein CARUB_v10019893mg [Capsella rubella]
 gb|EOA33211.1| hypothetical protein CARUB_v10019893mg [Capsella rubella]
Length=690

 Score =   386 bits (992),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 282/610 (46%), Positives = 357/610 (59%), Gaps = 90/610 (15%)
 Frame = +2

Query  176   KPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT---GLQs  346
             K P D+GS+ GEP   ++S     +G R+   VEL   ET I+SWKKL+ EAT   GL  
Sbjct  5     KVPTDDGSNPGEPC--KISPEVLTSGDRKSLKVELILEETNIISWKKLMNEATKDNGL--  60

Query  347   ngngapgpaprasaaaaELQPLILPPHNDSPGPGF--SPEQPVEKEAKDAPPGNRLNAVI  520
                                 P   P  N +P   F  + + P E E  D P  +R N VI
Sbjct  61    ------------------FPPSPEPSLNANPNFEFRLARKAPTENEMADQPQSHRYNTVI  102

Query  521   EKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRG  700
             +KIERLY+GK S D E+L   PD+DEYDTEDSFIDD ELDDYF+VDNS IKHDG+FVNRG
Sbjct  103   QKIERLYMGKDSSDGEELYGAPDDDEYDTEDSFIDDAELDDYFEVDNSPIKHDGYFVNRG  162

Query  701   KLERIEPTSQQNQLPNKRRKKDQTK-CQSGSDDGCNPN-KPAKVGKKAG----KSVPLAA  862
             KLERIEP++  NQ P KR++K   K C     D  N + K AK+ K AG     + P   
Sbjct  163   KLERIEPSTTSNQQPKKRQRKKAAKPC----GDVVNVSRKQAKIAKTAGGKDQSAAPETN  218

Query  863   GTSSPSYGVVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKE------SSETSNQ  1024
             G+     G    +L  EN   H  + N   + A    SK  +D   E      SS++ +Q
Sbjct  219   GSMKAQNG--NDSLVLENVK-HTDKANHQPRNATSPKSK--IDGSSEPLYPKCSSKSPHQ  273

Query  1025  RSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGS  1204
             +SN   S P++     SA  +      FQQ E S +++  LD  A   K+S    ++ GS
Sbjct  274   QSN---SHPEKSRPNDSAKTT----LVFQQ-ENSGMHE--LDV-ATVCKKSAPITKKGGS  322

Query  1205  SVRSKITMLEKAIRDLEKFVAE----------------------------SRPPNA-EVQ  1297
             +VR   + LEKAIR+LEK VAE                            +RPP A E Q
Sbjct  323   NVRPNSSTLEKAIRELEKVVAECEFPTVCCSLHAREAQYHLVNYNIQFIAARPPAATENQ  382

Query  1298  DGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNL  1477
             D D SSQA+KRRLP ++K KLAKVAR A  S G LS ELINRLM IVGHL+Q+R+LKRNL
Sbjct  383   DVDVSSQAVKRRLPTDVKLKLAKVARIAD-SQGNLSGELINRLMGIVGHLIQIRSLKRNL  441

Query  1478  KIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKE  1657
             KIMI+ G  A +EKD R Q+IK EV EM+  +VPL +S+A  Q+ GTSDDF  + +  K 
Sbjct  442   KIMIDSGDIANREKDARFQRIKNEVIEMLNTQVPLFESQATNQEAGTSDDFPDVGSVGKP  501

Query  1658  AFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAI  1837
              FK K+ MD ALE ++CDLYD++V+GL+ED+GPQ+RKLYA LA  WPN  MDNH I+RAI
Sbjct  502   PFK-KFVMDAALEGKLCDLYDIFVQGLDEDSGPQIRKLYANLAQLWPNKLMDNHEIRRAI  560

Query  1838  CRAKDRRKTL  1867
             CR K+RR+ L
Sbjct  561   CREKERRRAL  570



>ref|XP_011031124.1| PREDICTED: uncharacterized protein LOC105130359 isoform X1 [Populus 
euphratica]
Length=720

 Score =   385 bits (990),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 259/606 (43%), Positives = 371/606 (61%), Gaps = 59/606 (10%)
 Frame = +2

Query  260   QRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDSP  439
             QRF +EL+PGETTIVSWKKLLK+A   ++N + +      A+A A+    ++ P   ++ 
Sbjct  17    QRFYIELKPGETTIVSWKKLLKDAAANKANPSHSNNRTAAAAAGASTSSFVMEPASVETA  76

Query  440   G--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydted  613
                  F+  Q  +   K+AP  +RL +VIEKIE+LYVG QS D+E+LD  PDED YDT+D
Sbjct  77    QQEAQFALGQLTKPIPKNAPSSSRLGSVIEKIEQLYVGNQSSDEEELDGAPDEDHYDTKD  136

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSD  793
             SFIDDTELD YF+VD S  KH+GFFVN+GKLE +      +   +K+RK +  K +   D
Sbjct  137   SFIDDTELDGYFEVDQSTTKHNGFFVNKGKLEHMNRPISSSHFQSKKRKNNMQKAREEKD  196

Query  794   DGCNPNKPAKVGKK----AGKSVPLAAGTSSPSYGVVMPTLYRENANVH--------NQE  937
                  +K AK+G+     A  ++P+     + +  + +   +  N  +H        +++
Sbjct  197   GDRIRDKHAKLGQGRMNVATGNIPMDEPFRTNTQNLAVNGEHHHNGKLHSLMHPIFSDKK  256

Query  938   VNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERIS-VPQEKSSGR----SANISNGLDQ  1102
             V     ++E      + ++    S T    + ++++ V Q  + GR    ++ +S   D+
Sbjct  257   VAGTDIRSEYSPYPEITNRDDSISNTGQNDTEKQMNGVLQPGNLGRIVKDTSELSRVADR  316

Query  1103  SFQQGE---KSVIYDQRL-----DASAP-----------------------EGKRSTQTV  1189
              +Q+     +S    +RL     +AS+P                       + ++ T T+
Sbjct  317   KYQENNAPGQSAPQSKRLASETCNASSPKVPHRNKKGRHELPDLNLPHYPVQAEKKTATM  376

Query  1190  R-RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAK  1366
               +D SS++ K +M+E+AIRDLEK VAESRP N + QD D SS +IKRRLP E+KQKLAK
Sbjct  377   HPKDVSSLQPKGSMVERAIRDLEKVVAESRPRNTDAQDADTSSMSIKRRLPFEVKQKLAK  436

Query  1367  VARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKR  1546
             VAR AQ+S GK+S+ELI+ LM+I+GHL+QL TLK+NL+ M+ MGL+AKQEK +R Q+IK+
Sbjct  437   VARLAQSSQGKISEELISHLMTILGHLIQLSTLKKNLREMVEMGLTAKQEKADRFQKIKK  496

Query  1547  EVAEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIATEEKEAFKRKYCMDNALENRICDLYDL  1723
             EV EMI+ ++   + KA+        DFQ  I   EK A  RKY MD+ +E++ICDLYDL
Sbjct  497   EVMEMIELQLFKQRDKAVV-------DFQKGIIHGEKGAINRKYVMDDKMEDKICDLYDL  549

Query  1724  YVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRR  1903
             +V+G++ED GPQ+RKLYAE+A  WPNG MDNHGIK AICRAK+RR+  YN  K QEK R 
Sbjct  550   FVQGMDEDKGPQIRKLYAEVAEMWPNGAMDNHGIKIAICRAKERRRIFYNNEKVQEKARI  609

Query  1904  NKISAQ  1921
              K+S Q
Sbjct  610   EKLSRQ  615



>gb|EEC71910.1| hypothetical protein OsI_04685 [Oryza sativa Indica Group]
Length=748

 Score =   386 bits (992),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 300/708 (42%), Positives = 396/708 (56%), Gaps = 94/708 (13%)
 Frame = +2

Query  257   RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDS  436
             RQ F+VELRPGETTIVSWKKLLKEA    ++   A      A++          P     
Sbjct  46    RQVFSVELRPGETTIVSWKKLLKEAGHAAASPPPAAPAVAVAASD---------PAFPAL  96

Query  437   PG-PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydted  613
             PG PG     P E + KD    NR NAVIEKIERLY+GK S D+EDLDDVPD+D+YDTED
Sbjct  97    PGQPGAV--HPPESDPKDPAQPNRFNAVIEKIERLYMGKHSSDEEDLDDVPDDDQYDTED  154

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSD  793
             SFIDD ELD+YF+VDN   KHDG+FVN+GKLE+IE  +  N  P K+R++  +      +
Sbjct  155   SFIDDAELDEYFEVDNLRTKHDGYFVNKGKLEQIEAGTSANVAP-KKRRRKDSSSGYIEN  213

Query  794   DGCNP-------NKPAKVGKKAGKSVPLAAGTSS-PSYGVVMPTLYR-----ENANVHNQ  934
             +   P       N P K   ++G  V     +S+  SYG       R       A VH +
Sbjct  214   NQVAPADYPSIGNMPGKSAARSGAHVGKKLTSSNIGSYGEYYHDDNRVVKNKTGAGVHKR  273

Query  935   E-VNFDMQKAEVLHSKNVVDKLKESSETSN-----------QRSNERISVPQEKSSGRSA  1078
             + ++F M      + K     +  +S   N            RS    +     S+ R  
Sbjct  274   KSMDFAMGSDTAAYMKISSKDMPYASSELNKAAGLQPTDYTHRSKTAEAYDYAYSAYRDR  333

Query  1079  NISNGLDQSFQQGEKSVIYDQR----------------LDASAPEGKRSTQTV----RRD  1198
             + S  LD  FQQ +++   + R                    A  G   +  V     RD
Sbjct  334   DTSMQLD--FQQ-KRAYTGENRDPSNKIHRKEKHGMGEFSGMATTGALYSGQVMPITSRD  390

Query  1199  GSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD-NSSQAIKRRLPPEIKQKLAKVAR  1375
             GS  + K T LE+AIRDL+K  AE RPP  ++ + D N   A+KRRLPPE+KQKLAKVAR
Sbjct  391   GSGTKPKGTRLERAIRDLQKIAAEYRPPAIDINEVDPNGQVAVKRRLPPEVKQKLAKVAR  450

Query  1376  YAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREV  1552
              + A+HGK+ + EL++RLM IVGHLVQ RTL+RN+K M+  GLSAKQEK ++ Q++K E+
Sbjct  451   LS-ANHGKIQEHELMDRLMGIVGHLVQRRTLRRNMKEMVESGLSAKQEKADKFQRVKMEI  509

Query  1553  AEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVE  1732
              EMIK RV   K+K  E   G++DDFQ IA +EK   K K  MD ALE+RICDLYDLYVE
Sbjct  510   NEMIKSRV-AAKAKVNEHHSGSADDFQ-IANDEKRYLKGKSVMDAALEDRICDLYDLYVE  567

Query  1733  GLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK--NQEKMRRN  1906
             G++ED GPQ RKLY ELA  WP G MDN GIK AI R+K+RR++LYN+ K  N+E+M+R 
Sbjct  568   GMDEDKGPQSRKLYVELAELWPEGSMDNVGIKDAINRSKERRRSLYNQQKVRNEERMKRK  627

Query  1907  KI-SAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVP  2083
             ++ +A K ++GY         PV +Q            +A  + ++     N V   PV 
Sbjct  628   RLAAAAKLQDGY---------PVVMQ------------SALIQQVAQPPITNPVATYPVT  666

Query  2084  SPGGTSLDRPKPEKVKGTGNSTDRHITTDALTKKKMKRKPEPELGEGQ  2227
               G  S DR +  ++  + N  D +  T  + KK  KRKPE +L + Q
Sbjct  667   DQGSKSFDRVR--EISASANPDDINRNTGEMKKK--KRKPESDLVDTQ  710



>gb|EPS68725.1| hypothetical protein M569_06041 [Genlisea aurea]
Length=675

 Score =   381 bits (979),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 271/590 (46%), Positives = 341/590 (58%), Gaps = 74/590 (13%)
 Frame = +2

Query  194   GSSGGEPGVG-RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgp  370
             G+ G + G G + +   E+ G R RF V+LR GETTI+SW+KLLKEA             
Sbjct  6     GNWGQDSGEGSKHACICESVGCRLRFRVDLRFGETTILSWRKLLKEAN------------  53

Query  371   aprasaaaaELQPLILPPHNDSPGPGFSPEQP----------------VEKEAKDAPPG-  499
                        +P    P    P P   P  P                +EKE  DA    
Sbjct  54    ---------LSEPGGSGPSGLDPSPTERPTIPQPQPISPSSAPPSRKIIEKEPMDAQAQA  104

Query  500   --NRLNAVIEKIERLYVGKQSdddedlddvp--dedeydtedSFIDDTELDDYFQVDNSA  667
               NRL++VIE+IER+Y G  S DDE        D+DEYDT DSFIDD ELDDYFQVD SA
Sbjct  105   GPNRLSSVIERIERMYAGNGSSDDEAGVLDNVPDDDEYDTNDSFIDDAELDDYFQVDKSA  164

Query  668   IKHDGFFVNRGKLERIEP--TSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAG  841
             IKHDGFFVNRGKLERIEP  +  Q+    KRR+KD TK    +D+  NP K AK+  K  
Sbjct  165   IKHDGFFVNRGKLERIEPAVSEHQDHQLKKRRRKDLTKGHGENDEKHNPKKIAKLDNKGK  224

Query  842   KSVPLAAGTSSPSYGVVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVD---KLKESSE  1012
              +  L A     S G  M    RE  +V  Q+   D  K  +L  K  +D    +  S  
Sbjct  225   TASSLLA----KSRGGNMVDTNRE--SVPFQDTVGDSSK--ILPKKRSLDPPANVDPSGV  276

Query  1013  TSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTV-  1189
                  + +R    Q+ S  RS         S +   K   + +  + S P  +RS     
Sbjct  277   WGVAGNCKRKDTHQQGSEIRS---------SLKHSSK---WKESNEHSTPWSQRSISRYI  324

Query  1190  -RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAK  1366
              RR+GSS R K  MLEKAI++LEK VAESRPP+ EV D DNS  ++K+RLPPEIKQKL K
Sbjct  325   DRREGSSARPKSMMLEKAIKELEKIVAESRPPSTEVLDPDNSG-SVKKRLPPEIKQKLGK  383

Query  1367  VARYAQAS-HGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIK  1543
             VAR AQ S  G + K+++NRLMSIVGHL+Q+RTLKRNLK+M N+GL A QEKD+R+ ++K
Sbjct  384   VARLAQQSGTGTIPKDVVNRLMSIVGHLMQVRTLKRNLKVMANVGLPANQEKDDRILKLK  443

Query  1544  REVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDL  1723
              E+AEM+K RV  ++SK IEQ+   SD  Q    EE++  +RKYCMD+ALEN+IC+LYD 
Sbjct  444   VELAEMLKLRVSSLRSK-IEQRAANSDGVQENGPEERD-LRRKYCMDDALENKICELYDF  501

Query  1724  YVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYN  1873
             Y EGLEED+ P  R+LY E+   WP   +D   IKRAI RAK+RR  L N
Sbjct  502   YAEGLEEDSRPPARRLYEEILVLWPGDLLDADAIKRAIYRAKERRGGLSN  551



>ref|XP_010471918.1| PREDICTED: uncharacterized protein LOC104751626 isoform X1 [Camelina 
sativa]
 ref|XP_010471919.1| PREDICTED: uncharacterized protein LOC104751626 isoform X1 [Camelina 
sativa]
Length=645

 Score =   379 bits (973),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 266/570 (47%), Positives = 337/570 (59%), Gaps = 57/570 (10%)
 Frame = +2

Query  188   DEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT---GLQsngng  358
             D+GS+ GEP    +S+    AG R    VELR  ET  VSWKKL+ EAT   GL  +   
Sbjct  9     DDGSNPGEPC--DISSEVLTAGDRNLLKVELRLEETNYVSWKKLMYEATKENGLFPSSPD  66

Query  359   apgpaprasaaaaELQPLILPPHNDSPGPGF--SPEQPVEKEAKDAPPGNRLNAVIEKIE  532
                                 P  N +P   F  + + P + E    P   R N VI+KIE
Sbjct  67    --------------------PSLNANPNFEFPLARKAPTDNEVAGQPQAYRFNTVIQKIE  106

Query  533   RLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER  712
             RLY+G+ S D E+L   PD+DEYDTEDSFIDD ELDDYF+VDNS IKHDGFF++RGKLER
Sbjct  107   RLYMGRDSSDGEELGGAPDDDEYDTEDSFIDDAELDDYFEVDNSPIKHDGFFISRGKLER  166

Query  713   IEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSV---PLAAGTSSPSY  883
             IEPT+   +   +RRKK    C    D      K AK  +   +S    P     S+ S 
Sbjct  167   IEPTTSNQKPKKRRRKKSAKPCGDVVDVSRKQAKMAKTAEGKDQSAVPEPSLKNISNDSK  226

Query  884   GVVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKS  1063
              V     + + AN  +Q  N    K++   S   +  +  SS+ ++Q SN   S+P    
Sbjct  227   TVPDSIPHTDEAN--HQPRNSTSPKSKAAESSAPLHPIC-SSKNAHQESN---SLP----  276

Query  1064  SGRS-ANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKA  1240
              G+S  N+S       QQ E S ++D  +              ++ GS VR K + LEKA
Sbjct  277   -GKSRPNVSAKSTVVCQQ-ENSGMHDLNI------------ATKKSGSIVRPKSSTLEKA  322

Query  1241  IRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELI  1417
             IR+LEK VAES PP A E Q  D SSQA+KRRLP ++K KLAKVAR AQ S G +S ELI
Sbjct  323   IRELEKVVAESSPPAATENQGADISSQAVKRRLPIDVKLKLAKVARIAQGSQGNVSGELI  382

Query  1418  NRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKA  1597
             NRLM+IVGHL+Q+R+LKRNLK+MI  G +A +EKD R QQIK EV EM+K R+PLM+S+A
Sbjct  383   NRLMNIVGHLIQIRSLKRNLKLMIESGDNANREKDTRFQQIKNEVIEMLKTRIPLMESQA  442

Query  1598  IEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYA  1777
               Q+ GTSDDF  + +  K   K K+ MD ALE ++CDLYD +VEGL+ED+  Q+RKLYA
Sbjct  443   NNQEAGTSDDFLDVGSVGKPPLK-KFVMDAALEGKLCDLYDNFVEGLDEDSSSQIRKLYA  501

Query  1778  ELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
              LA  WPN  MDN  IKRAICR K+RR+ L
Sbjct  502   NLAELWPNSLMDNREIKRAICREKERRRAL  531



>ref|XP_010471921.1| PREDICTED: uncharacterized protein LOC104751626 isoform X3 [Camelina 
sativa]
Length=644

 Score =   379 bits (973),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 266/569 (47%), Positives = 335/569 (59%), Gaps = 56/569 (10%)
 Frame = +2

Query  188   DEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT---GLQsngng  358
             D+GS+ GEP    +S+    AG R    VELR  ET  VSWKKL+ EAT   GL  +   
Sbjct  9     DDGSNPGEPC--DISSEVLTAGDRNLLKVELRLEETNYVSWKKLMYEATKENGLFPSSPD  66

Query  359   apgpaprasaaaaELQPLILPPHNDSPGPGFS-PEQPVEKEAKDAPPGNRLNAVIEKIER  535
                                 P  N +P   F     P + E    P   R N VI+KIER
Sbjct  67    --------------------PSLNANPNFEFPLARAPTDNEVAGQPQAYRFNTVIQKIER  106

Query  536   LYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI  715
             LY+G+ S D E+L   PD+DEYDTEDSFIDD ELDDYF+VDNS IKHDGFF++RGKLERI
Sbjct  107   LYMGRDSSDGEELGGAPDDDEYDTEDSFIDDAELDDYFEVDNSPIKHDGFFISRGKLERI  166

Query  716   EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSV---PLAAGTSSPSYG  886
             EPT+   +   +RRKK    C    D      K AK  +   +S    P     S+ S  
Sbjct  167   EPTTSNQKPKKRRRKKSAKPCGDVVDVSRKQAKMAKTAEGKDQSAVPEPSLKNISNDSKT  226

Query  887   VVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSS  1066
             V     + + AN  +Q  N    K++   S   +  +  SS+ ++Q SN   S+P     
Sbjct  227   VPDSIPHTDEAN--HQPRNSTSPKSKAAESSAPLHPIC-SSKNAHQESN---SLP-----  275

Query  1067  GRS-ANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKAI  1243
             G+S  N+S       QQ E S ++D  +              ++ GS VR K + LEKAI
Sbjct  276   GKSRPNVSAKSTVVCQQ-ENSGMHDLNI------------ATKKSGSIVRPKSSTLEKAI  322

Query  1244  RDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELIN  1420
             R+LEK VAES PP A E Q  D SSQA+KRRLP ++K KLAKVAR AQ S G +S ELIN
Sbjct  323   RELEKVVAESSPPAATENQGADISSQAVKRRLPIDVKLKLAKVARIAQGSQGNVSGELIN  382

Query  1421  RLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAI  1600
             RLM+IVGHL+Q+R+LKRNLK+MI  G +A +EKD R QQIK EV EM+K R+PLM+S+A 
Sbjct  383   RLMNIVGHLIQIRSLKRNLKLMIESGDNANREKDTRFQQIKNEVIEMLKTRIPLMESQAN  442

Query  1601  EQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAE  1780
              Q+ GTSDDF  + +  K   K K+ MD ALE ++CDLYD +VEGL+ED+  Q+RKLYA 
Sbjct  443   NQEAGTSDDFLDVGSVGKPPLK-KFVMDAALEGKLCDLYDNFVEGLDEDSSSQIRKLYAN  501

Query  1781  LAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
             LA  WPN  MDN  IKRAICR K+RR+ L
Sbjct  502   LAELWPNSLMDNREIKRAICREKERRRAL  530



>ref|XP_010428806.1| PREDICTED: uncharacterized protein LOC104713399 isoform X1 [Camelina 
sativa]
 ref|XP_010428807.1| PREDICTED: uncharacterized protein LOC104713399 isoform X1 [Camelina 
sativa]
 ref|XP_010428808.1| PREDICTED: uncharacterized protein LOC104713399 isoform X2 [Camelina 
sativa]
Length=653

 Score =   377 bits (969),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 264/570 (46%), Positives = 332/570 (58%), Gaps = 59/570 (10%)
 Frame = +2

Query  188   DEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT---GLQsngng  358
             D+GS+ GEP    +S+    AG R+   VELR  ET  VSWKKL+ EAT   GL  +   
Sbjct  9     DDGSNPGEPC--EISSEVLTAGDRRLLKVELRLEETNYVSWKKLMYEATKENGLFPSSTD  66

Query  359   apgpaprasaaaaELQPLILPPHNDSPGPGF--SPEQPVEKEAKDAPPGNRLNAVIEKIE  532
                                 P  N +P   F  + + P E E    P   R N VI+KIE
Sbjct  67    --------------------PSLNANPNFEFPLARKAPTENEMAGQPQAYRFNDVIQKIE  106

Query  533   RLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER  712
             RLY+G+ S D E+L   PD+DEYDT+DSFIDD ELDDYF+VDNS IKHDGFF++RGKLER
Sbjct  107   RLYMGRDSSDGEELGGAPDDDEYDTQDSFIDDAELDDYFEVDNSPIKHDGFFISRGKLER  166

Query  713   IEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVV  892
             IEPT+   +   +RRKK    C    D      K AK+ K AG     AA    PS   +
Sbjct  167   IEPTTSNQKPKKRRRKKSAKPCGDVVDVS---RKQAKMAKTAGGKDQSAA--PEPSLKNI  221

Query  893   MPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKE----SSETSNQRSNERISVPQEK  1060
                    ++  H  E N   + A    SK            SS+ ++Q SN   S+P++ 
Sbjct  222   SNDSKTADSIPHTDEANHQPRNATSPKSKAAESSAPLHPICSSKNAHQESN---SLPRKS  278

Query  1061  SSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKA  1240
                 SA  +        Q E S ++D  +               +  S+VR K + LEKA
Sbjct  279   RPNVSAKST-----VVCQQENSSMHDLNI------------ATTKSSSNVRPKSSTLEKA  321

Query  1241  IRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELI  1417
             IR+LEK VAES PP A E QD D SSQA+KR LP ++K KLAKVAR A  S G +S ELI
Sbjct  322   IRELEKVVAESSPPAATENQDADISSQAVKRGLPRDVKLKLAKVARIA-GSEGNVSGELI  380

Query  1418  NRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKA  1597
             NRLMSIVGHL+Q+R+LKRNLK+MI  G +A +EKD R QQIK EV EM+K R+PLM+S+A
Sbjct  381   NRLMSIVGHLIQIRSLKRNLKLMIESGDNANREKDTRFQQIKNEVIEMLKTRIPLMESQA  440

Query  1598  IEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYA  1777
               Q+ GTSDDF  + +  K + K K+ MD  LE ++CDLYD +VEGL+ED+  Q+RKLYA
Sbjct  441   NNQEAGTSDDFLDVGSVGKPSLK-KFVMDATLEGKLCDLYDNFVEGLDEDSNSQIRKLYA  499

Query  1778  ELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
              LAA WPN  MDN  IKRAICR K+RR+ L
Sbjct  500   NLAALWPNSLMDNREIKRAICREKERRRAL  529



>ref|XP_011031125.1| PREDICTED: uncharacterized protein LOC105130359 isoform X2 [Populus 
euphratica]
Length=719

 Score =   379 bits (974),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 258/606 (43%), Positives = 370/606 (61%), Gaps = 60/606 (10%)
 Frame = +2

Query  260   QRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDSP  439
             QRF +EL+PGETTIVSWKKLLK+A   ++N + +      A+A A+    ++ P   ++ 
Sbjct  17    QRFYIELKPGETTIVSWKKLLKDAAANKANPSHSNNRTAAAAAGASTSSFVMEPASVETA  76

Query  440   G--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydted  613
                  F+  Q  +   K+AP  +RL +VIEKIE+LYVG QS D+E+LD  PDED YDT+D
Sbjct  77    QQEAQFALGQLTKPIPKNAPSSSRLGSVIEKIEQLYVGNQSSDEEELDGAPDEDHYDTKD  136

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSD  793
             SFIDDTELD YF+VD S  KH+GFFVN+GKLE +      +   +K+RK +  K +   D
Sbjct  137   SFIDDTELDGYFEVDQSTTKHNGFFVNKGKLEHMNRPISSSHFQSKKRKNNMQKAREEKD  196

Query  794   DGCNPNKPAKVGKK----AGKSVPLAAGTSSPSYGVVMPTLYRENANVH--------NQE  937
                  +K AK+G+     A  ++P+     + +  + +   +  N  +H        +++
Sbjct  197   GDRIRDKHAKLGQGRMNVATGNIPMDEPFRTNTQNLAVNGEHHHNGKLHSLMHPIFSDKK  256

Query  938   VNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERIS-VPQEKSSGR----SANISNGLDQ  1102
             V     ++E      + ++    S T    + ++++ V Q  + GR    ++ +S   D+
Sbjct  257   VAGTDIRSEYSPYPEITNRDDSISNTGQNDTEKQMNGVLQPGNLGRIVKDTSELSRVADR  316

Query  1103  SFQQGE---KSVIYDQRL-----DASAP-----------------------EGKRSTQTV  1189
              +Q+     +S    +RL     +AS+P                       + ++ T T+
Sbjct  317   KYQENNAPGQSAPQSKRLASETCNASSPKVPHRNKKGRHELPDLNLPHYPVQAEKKTATM  376

Query  1190  R-RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAK  1366
               +D SS++ K +M+E+AIRDLEK VAESRP N + QD D SS +IKRRLP E+KQKLAK
Sbjct  377   HPKDVSSLQPKGSMVERAIRDLEKVVAESRPRNTDAQDADTSSMSIKRRLPFEVKQKLAK  436

Query  1367  VARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKR  1546
             VAR A +S GK+S+ELI+ LM+I+GHL+QL TLK+NL+ M+ MGL+AKQEK +R Q+IK+
Sbjct  437   VARLA-SSQGKISEELISHLMTILGHLIQLSTLKKNLREMVEMGLTAKQEKADRFQKIKK  495

Query  1547  EVAEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIATEEKEAFKRKYCMDNALENRICDLYDL  1723
             EV EMI+ ++   + KA+        DFQ  I   EK A  RKY MD+ +E++ICDLYDL
Sbjct  496   EVMEMIELQLFKQRDKAVV-------DFQKGIIHGEKGAINRKYVMDDKMEDKICDLYDL  548

Query  1724  YVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRR  1903
             +V+G++ED GPQ+RKLYAE+A  WPNG MDNHGIK AICRAK+RR+  YN  K QEK R 
Sbjct  549   FVQGMDEDKGPQIRKLYAEVAEMWPNGAMDNHGIKIAICRAKERRRIFYNNEKVQEKARI  608

Query  1904  NKISAQ  1921
              K+S Q
Sbjct  609   EKLSRQ  614



>ref|XP_011031127.1| PREDICTED: uncharacterized protein LOC105130359 isoform X3 [Populus 
euphratica]
Length=707

 Score =   379 bits (973),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 257/605 (42%), Positives = 364/605 (60%), Gaps = 70/605 (12%)
 Frame = +2

Query  260   QRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDSP  439
             QRF +EL+PGETTIVSWKKLLK+A   ++N + +      A+A A+    ++ P   ++ 
Sbjct  17    QRFYIELKPGETTIVSWKKLLKDAAANKANPSHSNNRTAAAAAGASTSSFVMEPASVETA  76

Query  440   G--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydted  613
                  F+  Q  +   K+AP  +RL +VIEKIE+LYVG QS D+E+LD  PDED YDT+D
Sbjct  77    QQEAQFALGQLTKPIPKNAPSSSRLGSVIEKIEQLYVGNQSSDEEELDGAPDEDHYDTKD  136

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSD  793
             SFIDDTELD YF+VD S  KH+GFFVN+GKLE +      +   +K+RK +  K +   D
Sbjct  137   SFIDDTELDGYFEVDQSTTKHNGFFVNKGKLEHMNRPISSSHFQSKKRKNNMQKAREEKD  196

Query  794   DGCNPNKPAKVGKK----AGKSVPLAAGTSSPSYGVVMPTLYRENANVH--------NQE  937
                  +K AK+G+     A  ++P+     + +  + +   +  N  +H        +++
Sbjct  197   GDRIRDKHAKLGQGRMNVATGNIPMDEPFRTNTQNLAVNGEHHHNGKLHSLMHPIFSDKK  256

Query  938   VNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERIS-VPQEKSSGR----SANISNGLDQ  1102
             V     ++E      + ++    S T    + ++++ V Q  + GR    ++ +S   D+
Sbjct  257   VAGTDIRSEYSPYPEITNRDDSISNTGQNDTEKQMNGVLQPGNLGRIVKDTSELSRVADR  316

Query  1103  SFQQGE---KSVIYDQRL-----DASAP-----------------------EGKRSTQTV  1189
              +Q+     +S    +RL     +AS+P                       + ++ T T+
Sbjct  317   KYQENNAPGQSAPQSKRLASETCNASSPKVPHRNKKGRHELPDLNLPHYPVQAEKKTATM  376

Query  1190  R-RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAK  1366
               +D SS++ K +M+E+AIRDLEK VAESRP N + QD D SS +IKRRLP E+KQKLAK
Sbjct  377   HPKDVSSLQPKGSMVERAIRDLEKVVAESRPRNTDAQDADTSSMSIKRRLPFEVKQKLAK  436

Query  1367  VARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKR  1546
             VAR AQ+S GK+S+ELI+ LM+I+GHL+QL TLK+NL+ M+ MGL+AKQEK +R Q+IK+
Sbjct  437   VARLAQSSQGKISEELISHLMTILGHLIQLSTLKKNLREMVEMGLTAKQEKADRFQKIKK  496

Query  1547  EVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLY  1726
             EV EM            IE Q G       I   EK A  RKY MD+ +E++ICDLYDL+
Sbjct  497   EVMEM------------IELQKG-------IIHGEKGAINRKYVMDDKMEDKICDLYDLF  537

Query  1727  VEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRN  1906
             V+G++ED GPQ+RKLYAE+A  WPNG MDNHGIK AICRAK+RR+  YN  K QEK R  
Sbjct  538   VQGMDEDKGPQIRKLYAEVAEMWPNGAMDNHGIKIAICRAKERRRIFYNNEKVQEKARIE  597

Query  1907  KISAQ  1921
             K+S Q
Sbjct  598   KLSRQ  602



>ref|XP_010537367.1| PREDICTED: uncharacterized protein LOC104812084 isoform X6 [Tarenaya 
hassleriana]
Length=567

 Score =   374 bits (959),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 220/452 (49%), Positives = 288/452 (64%), Gaps = 29/452 (6%)
 Frame = +2

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQNQLPNKRRKKDQTKCQSGS  790
             SFIDD ELD+YF+VDNSA+KHDGFFVNRGKLERI EP++  NQ   KRR+K+  K   G 
Sbjct  25    SFIDDAELDEYFEVDNSAVKHDGFFVNRGKLERISEPSATSNQQLKKRRRKESAKPGGGV  84

Query  791   DDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGVVMPTLYRENANVHNQEVNFDMQKAEV  967
              D   PNK AKV K A GK     +G SS              ++   Q VN  +   + 
Sbjct  85    TDV--PNKQAKVAKMARGKDRSKHSGQSSKKRSNDPKAAQDSFSSFRVQSVNASLPLEDT  142

Query  968   LHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANISNGL----------DQSFQQG  1117
              +S     +LK ++    +      + PQ+  S  +   SN +          + +  + 
Sbjct  143   KYSDKTNHELKNAASRKAKEVGSSDAFPQKCRSKIAHQQSNAMPVKSPHNHVAEAACTKK  202

Query  1118  EKSVIYDQRLDASAPEGKRSTQTVR------RDGSSVRSKITMLEKAIRDLEKFVAESRP  1279
             EK+ ++D    A+A   + S Q  R      +D S+VR K ++L+KAIR+LEK VA+SRP
Sbjct  203   EKNDMHDL---ANATGSRHSIQKARPFSAQKKDSSNVRPKTSLLDKAIRELEKVVADSRP  259

Query  1280  PNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLR  1459
              N   Q+ D +SQ +KRRLP E+K KL KVAR   A  GKLS ELINRLMSIVGHL+QLR
Sbjct  260   EN---QEADTTSQGVKRRLPKEVKAKLDKVARIV-AKEGKLSAELINRLMSIVGHLIQLR  315

Query  1460  TLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQP-GTSDDFQS  1636
             +LKRNLKIMI+  LS  +++D+R Q IK+EVAEMIK +VPLM+S+  EQQ  GTS DF  
Sbjct  316   SLKRNLKIMIDESLSFNRKRDDRFQGIKKEVAEMIKTQVPLMESQTDEQQAAGTSSDFHD  375

Query  1637  IATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDN  1816
              A  EK   K+K+ MD  LE++ICDLYD++V+GL+EDAGPQ+RKLY ELA  WP+  MDN
Sbjct  376   DAAVEKAPLKKKFVMDARLEDKICDLYDIFVDGLDEDAGPQIRKLYVELAELWPDRLMDN  435

Query  1817  HGIKRAICRAKDRRKTLYNRHKNQEKMRRNKI  1912
             HGIKRAICRAK+RR+  YN  +N +KM++  +
Sbjct  436   HGIKRAICRAKERRRASYN-MENMKKMKQQSV  466



>ref|XP_010416668.1| PREDICTED: uncharacterized protein LOC104702508 isoform X3 [Camelina 
sativa]
Length=654

 Score =   376 bits (965),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 271/575 (47%), Positives = 338/575 (59%), Gaps = 68/575 (12%)
 Frame = +2

Query  188   DEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapg  367
             D+GS+ GEP    +S+    AG R+   VEL   ET  VSWKKL+ EA+           
Sbjct  9     DDGSNPGEPC--EISSEVLTAGDRRLLKVELLLEETNYVSWKKLMYEASN----------  56

Query  368   paprasaaaaELQPLILPPHNDSPGPGFS---PEQPVEKEAKDAPPGNRLNAVIEKIERL  538
                        L P    P + +P P F     + P E E    P   R N VI+KIERL
Sbjct  57    --------ENGLFPSSTNP-SLNPNPNFENLLAQAPTENEMAGQPQAYRFNDVIQKIERL  107

Query  539   YVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIE  718
             Y+G+ S D E+L   PD+D+YDTEDSFIDD ELDDYF+VDNS IKHDGFF++RGKLERIE
Sbjct  108   YMGRDSSDGEELGGAPDDDDYDTEDSFIDDAELDDYFEVDNSPIKHDGFFISRGKLERIE  167

Query  719   PTSQQNQLPNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVM  895
             PT+  NQ P KRR+K   K C    D      K AK+ K AG     AA   S      +
Sbjct  168   PTT-SNQTPKKRRRKKSAKPCGDVVDVS---RKQAKMAKTAGGKDQSAAPEPS------L  217

Query  896   PTLYRENANV-----HNQEVNFDMQKAEVLHSKNVVDKLKE----SSETSNQRSNERISV  1048
               +  ++  V     H  E N   + A    SK            SS+ ++Q SN   S+
Sbjct  218   KNISNDSKTVPDSIPHTDEANHQPRNATSPKSKAAESSAPRHPICSSKNAHQESN---SL  274

Query  1049  PQEKSSGRS-ANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKIT  1225
             P     G+S  N+S       QQ E S ++D  +              ++ GS+VR K +
Sbjct  275   P-----GKSRPNVSAKSTVVCQQ-ENSGMHDLNI------------PTKKSGSNVRPKAS  316

Query  1226  MLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKL  1402
              LEKAIR+LEK VAES PP A E QD D SSQA+KRRLP ++K KLAKVAR AQ S G +
Sbjct  317   TLEKAIRELEKVVAESSPPAATENQDADISSQAVKRRLPRDVKLKLAKVARIAQGSQGDV  376

Query  1403  SKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPL  1582
             S ELINRLMSIVGHL+Q+R+LKRNLK+MI  G +A +EKD R QQIK EV EM+K R+PL
Sbjct  377   SGELINRLMSIVGHLIQIRSLKRNLKLMIESGDNANREKDTRFQQIKNEVIEMLKTRIPL  436

Query  1583  MKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQV  1762
             M+S+A  Q+ GTSDDF  + +  K   K K+ MD  LE ++CDLYD +VEGL+ED+  Q+
Sbjct  437   MESQANNQEAGTSDDFLDVGSVGKPPLK-KFVMDATLEGKLCDLYDNFVEGLDEDSSSQI  495

Query  1763  RKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
             RKLYA LA  WPN  MDN  IKRAICR K+RR+ L
Sbjct  496   RKLYANLAELWPNSLMDNREIKRAICREKERRRAL  530



>ref|XP_010416665.1| PREDICTED: uncharacterized protein LOC104702508 isoform X1 [Camelina 
sativa]
 ref|XP_010416666.1| PREDICTED: uncharacterized protein LOC104702508 isoform X1 [Camelina 
sativa]
Length=655

 Score =   375 bits (963),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 271/576 (47%), Positives = 339/576 (59%), Gaps = 69/576 (12%)
 Frame = +2

Query  188   DEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapg  367
             D+GS+ GEP    +S+    AG R+   VEL   ET  VSWKKL+ EA+           
Sbjct  9     DDGSNPGEPC--EISSEVLTAGDRRLLKVELLLEETNYVSWKKLMYEASN----------  56

Query  368   paprasaaaaELQPLILPPHNDSPGPGF----SPEQPVEKEAKDAPPGNRLNAVIEKIER  535
                        L P    P + +P P F    + + P E E    P   R N VI+KIER
Sbjct  57    --------ENGLFPSSTNP-SLNPNPNFENLLAQKAPTENEMAGQPQAYRFNDVIQKIER  107

Query  536   LYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI  715
             LY+G+ S D E+L   PD+D+YDTEDSFIDD ELDDYF+VDNS IKHDGFF++RGKLERI
Sbjct  108   LYMGRDSSDGEELGGAPDDDDYDTEDSFIDDAELDDYFEVDNSPIKHDGFFISRGKLERI  167

Query  716   EPTSQQNQLPNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVV  892
             EPT+  NQ P KRR+K   K C    D      K AK+ K AG     AA   S      
Sbjct  168   EPTT-SNQTPKKRRRKKSAKPCGDVVDVS---RKQAKMAKTAGGKDQSAAPEPS------  217

Query  893   MPTLYRENANV-----HNQEVNFDMQKAEVLHSKNVVDKLKE----SSETSNQRSNERIS  1045
             +  +  ++  V     H  E N   + A    SK            SS+ ++Q SN   S
Sbjct  218   LKNISNDSKTVPDSIPHTDEANHQPRNATSPKSKAAESSAPRHPICSSKNAHQESN---S  274

Query  1046  VPQEKSSGRS-ANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKI  1222
             +P     G+S  N+S       QQ E S ++D  +              ++ GS+VR K 
Sbjct  275   LP-----GKSRPNVSAKSTVVCQQ-ENSGMHDLNI------------PTKKSGSNVRPKA  316

Query  1223  TMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGK  1399
             + LEKAIR+LEK VAES PP A E QD D SSQA+KRRLP ++K KLAKVAR AQ S G 
Sbjct  317   STLEKAIRELEKVVAESSPPAATENQDADISSQAVKRRLPRDVKLKLAKVARIAQGSQGD  376

Query  1400  LSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVP  1579
             +S ELINRLMSIVGHL+Q+R+LKRNLK+MI  G +A +EKD R QQIK EV EM+K R+P
Sbjct  377   VSGELINRLMSIVGHLIQIRSLKRNLKLMIESGDNANREKDTRFQQIKNEVIEMLKTRIP  436

Query  1580  LMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQ  1759
             LM+S+A  Q+ GTSDDF  + +  K   K K+ MD  LE ++CDLYD +VEGL+ED+  Q
Sbjct  437   LMESQANNQEAGTSDDFLDVGSVGKPPLK-KFVMDATLEGKLCDLYDNFVEGLDEDSSSQ  495

Query  1760  VRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
             +RKLYA LA  WPN  MDN  IKRAICR K+RR+ L
Sbjct  496   IRKLYANLAELWPNSLMDNREIKRAICREKERRRAL  531



>ref|XP_010471920.1| PREDICTED: uncharacterized protein LOC104751626 isoform X2 [Camelina 
sativa]
Length=644

 Score =   372 bits (955),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 265/570 (46%), Positives = 336/570 (59%), Gaps = 58/570 (10%)
 Frame = +2

Query  188   DEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT---GLQsngng  358
             D+GS+ GEP    +S+    AG R    VELR  ET  VSWKKL+ EAT   GL  +   
Sbjct  9     DDGSNPGEPC--DISSEVLTAGDRNLLKVELRLEETNYVSWKKLMYEATKENGLFPSSPD  66

Query  359   apgpaprasaaaaELQPLILPPHNDSPGPGF--SPEQPVEKEAKDAPPGNRLNAVIEKIE  532
                                 P  N +P   F  + + P + E    P   R N VI+KIE
Sbjct  67    --------------------PSLNANPNFEFPLARKAPTDNEVAGQPQAYRFNTVIQKIE  106

Query  533   RLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER  712
             RLY+G+ S D E+L   PD+DEYDTEDSFIDD ELDDYF+VDNS IKHDGFF++RGKLER
Sbjct  107   RLYMGRDSSDGEELGGAPDDDEYDTEDSFIDDAELDDYFEVDNSPIKHDGFFISRGKLER  166

Query  713   IEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSV---PLAAGTSSPSY  883
             IEPT+   +   +RRKK    C    D      K AK  +   +S    P     S+ S 
Sbjct  167   IEPTTSNQKPKKRRRKKSAKPCGDVVDVSRKQAKMAKTAEGKDQSAVPEPSLKNISNDSK  226

Query  884   GVVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKS  1063
              V     + + AN  +Q  N    K++   S   +  +  SS+ ++Q SN   S+P    
Sbjct  227   TVPDSIPHTDEAN--HQPRNSTSPKSKAAESSAPLHPIC-SSKNAHQESN---SLP----  276

Query  1064  SGRS-ANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKA  1240
              G+S  N+S       QQ E S ++D  +              ++ GS VR K + LEKA
Sbjct  277   -GKSRPNVSAKSTVVCQQ-ENSGMHDLNI------------ATKKSGSIVRPKSSTLEKA  322

Query  1241  IRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELI  1417
             IR+LEK VAES PP A E Q  D SSQA+KRRLP ++K KLAKVAR A  S G +S ELI
Sbjct  323   IRELEKVVAESSPPAATENQGADISSQAVKRRLPIDVKLKLAKVARIA-GSQGNVSGELI  381

Query  1418  NRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKA  1597
             NRLM+IVGHL+Q+R+LKRNLK+MI  G +A +EKD R QQIK EV EM+K R+PLM+S+A
Sbjct  382   NRLMNIVGHLIQIRSLKRNLKLMIESGDNANREKDTRFQQIKNEVIEMLKTRIPLMESQA  441

Query  1598  IEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYA  1777
               Q+ GTSDDF  + +  K   K K+ MD ALE ++CDLYD +VEGL+ED+  Q+RKLYA
Sbjct  442   NNQEAGTSDDFLDVGSVGKPPLK-KFVMDAALEGKLCDLYDNFVEGLDEDSSSQIRKLYA  500

Query  1778  ELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
              LA  WPN  MDN  IKRAICR K+RR+ L
Sbjct  501   NLAELWPNSLMDNREIKRAICREKERRRAL  530



>ref|XP_006646537.1| PREDICTED: uncharacterized protein LOC102710554 [Oryza brachyantha]
Length=773

 Score =   373 bits (957),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 280/655 (43%), Positives = 369/655 (56%), Gaps = 85/655 (13%)
 Frame = +2

Query  257   RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL--QP-LILPPH  427
             RQ F+VEL+ GETTIVSWKKLL+EA    ++   A      +  A   L  QP  + PP 
Sbjct  64    RQVFSVELKSGETTIVSWKKLLREAGHAATSPPPAAPALAASEPAFPALPGQPGAVHPPE  123

Query  428   NDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydt  607
             NDS  P     QP           NR +AVIEKIERLY+GK S D+EDLDDVPD+D+YDT
Sbjct  124   NDSKDPA----QP-----------NRFSAVIEKIERLYMGKHSSDEEDLDDVPDDDQYDT  168

Query  608   edSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQ--  781
             EDSFIDD ELD+YF+VDN   KHDG+FVN+GKLE+IE  +  N  P KRR+KD +     
Sbjct  169   EDSFIDDAELDEYFEVDNLKTKHDGYFVNKGKLEQIEAGTSANAAPKKRRRKDSSSGHIE  228

Query  782   ----SGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYREN----------A  919
                 +  D     N P K   ++G  V      S+  YG      Y E+           
Sbjct  229   NNQVAPVDYSSIGNMPGKSAARSGPHVGKKLTNSNLGYG----EYYHEDNRVVKNITGAP  284

Query  920   NVHNQE-VNFDMQKAEVLHSK-NVVDKLKESSETSNQRSNERISVPQEKSSGRSANIS--  1087
              VH ++ ++F M    V  +K +  D    SSE  +   ++  +V     + RS  +   
Sbjct  285   GVHKRKSMDFPMGSDTVASTKISSKDMPHASSELKDLEKHKVAAVQPTDFTHRSKTVEAY  344

Query  1088  -----------NGLDQSFQQ-----GEK-----SVIYDQRLDASAPEGKRSTQTV-----  1189
                          +   FQQ     GE       +   ++       G  +T  V     
Sbjct  345   DYAYSAYRDRETSMQLDFQQKRAYTGENRDPTNKIHRKEKHGMGEFSGMATTGVVYSAQV  404

Query  1190  ----RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD-NSSQAIKRRLPPEIKQ  1354
                  R+GS  + K T LE+AIRDLEK  AE RPP  ++ + D N    +KRRLPPE+KQ
Sbjct  405   MPITSREGSGTKPKGTRLERAIRDLEKIAAEYRPPAIDMNELDLNGQVTVKRRLPPEVKQ  464

Query  1355  KLAKVARYAQASHGKLSKE-LINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRV  1531
             KLAKVAR + A+ GK+ +  L++RLM IVGH+VQ RTL+RN+K M+  GLSAKQEK ++ 
Sbjct  465   KLAKVARLS-ANQGKIQEHALMDRLMGIVGHIVQRRTLRRNMKEMVESGLSAKQEKADKF  523

Query  1532  QQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICD  1711
             Q++K E+ EMIK RV   K+K  E Q GTSDDFQ IA ++K + K K  MD+ LE+RICD
Sbjct  524   QRVKMEINEMIKSRVA-AKAKVNEHQGGTSDDFQ-IANDDKRSLKAKSVMDSTLEDRICD  581

Query  1712  LYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK--N  1885
             LYDLYVEG++ED GPQ RKLY ELA  WP G MDN GIK AI R+K+RRK LYN+ K  +
Sbjct  582   LYDLYVEGMDEDKGPQSRKLYVELAELWPEGSMDNVGIKDAIYRSKERRKALYNQQKVRS  641

Query  1886  QEKMRRNKI-SAQKEEEGYRVETTTR-----DQPVQIQEKSAVDARDHGSTATNK  2032
             +EK++R ++ +A K  +GY V   +       QP   +  ++    DHG    +K
Sbjct  642   EEKLKRRRLAAAAKLRDGYPVVMQSALVQQVTQPPMTKPVTSYPVTDHGQNQGSK  696



>ref|XP_010416667.1| PREDICTED: uncharacterized protein LOC104702508 isoform X2 [Camelina 
sativa]
Length=654

 Score =   369 bits (947),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 270/576 (47%), Positives = 338/576 (59%), Gaps = 70/576 (12%)
 Frame = +2

Query  188   DEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapg  367
             D+GS+ GEP    +S+    AG R+   VEL   ET  VSWKKL+ EA+           
Sbjct  9     DDGSNPGEPC--EISSEVLTAGDRRLLKVELLLEETNYVSWKKLMYEASN----------  56

Query  368   paprasaaaaELQPLILPPHNDSPGPGF----SPEQPVEKEAKDAPPGNRLNAVIEKIER  535
                        L P    P + +P P F    + + P E E    P   R N VI+KIER
Sbjct  57    --------ENGLFPSSTNP-SLNPNPNFENLLAQKAPTENEMAGQPQAYRFNDVIQKIER  107

Query  536   LYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI  715
             LY+G+ S D E+L   PD+D+YDTEDSFIDD ELDDYF+VDNS IKHDGFF++RGKLERI
Sbjct  108   LYMGRDSSDGEELGGAPDDDDYDTEDSFIDDAELDDYFEVDNSPIKHDGFFISRGKLERI  167

Query  716   EPTSQQNQLPNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVV  892
             EPT+  NQ P KRR+K   K C    D      K AK+ K AG     AA   S      
Sbjct  168   EPTT-SNQTPKKRRRKKSAKPCGDVVDVS---RKQAKMAKTAGGKDQSAAPEPS------  217

Query  893   MPTLYRENANV-----HNQEVNFDMQKAEVLHSKNVVDKLKE----SSETSNQRSNERIS  1045
             +  +  ++  V     H  E N   + A    SK            SS+ ++Q SN   S
Sbjct  218   LKNISNDSKTVPDSIPHTDEANHQPRNATSPKSKAAESSAPRHPICSSKNAHQESN---S  274

Query  1046  VPQEKSSGRS-ANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKI  1222
             +P     G+S  N+S       QQ E S ++D  +              ++ GS+VR K 
Sbjct  275   LP-----GKSRPNVSAKSTVVCQQ-ENSGMHDLNI------------PTKKSGSNVRPKA  316

Query  1223  TMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGK  1399
             + LEKAIR+LEK VAES PP A E QD D SSQA+KRRLP ++K KLAKVAR A  S G 
Sbjct  317   STLEKAIRELEKVVAESSPPAATENQDADISSQAVKRRLPRDVKLKLAKVARIA-GSQGD  375

Query  1400  LSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVP  1579
             +S ELINRLMSIVGHL+Q+R+LKRNLK+MI  G +A +EKD R QQIK EV EM+K R+P
Sbjct  376   VSGELINRLMSIVGHLIQIRSLKRNLKLMIESGDNANREKDTRFQQIKNEVIEMLKTRIP  435

Query  1580  LMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQ  1759
             LM+S+A  Q+ GTSDDF  + +  K   K K+ MD  LE ++CDLYD +VEGL+ED+  Q
Sbjct  436   LMESQANNQEAGTSDDFLDVGSVGKPPLK-KFVMDATLEGKLCDLYDNFVEGLDEDSSSQ  494

Query  1760  VRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
             +RKLYA LA  WPN  MDN  IKRAICR K+RR+ L
Sbjct  495   IRKLYANLAELWPNSLMDNREIKRAICREKERRRAL  530



>emb|CDM85459.1| unnamed protein product [Triticum aestivum]
Length=738

 Score =   363 bits (931),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 290/707 (41%), Positives = 392/707 (55%), Gaps = 92/707 (13%)
 Frame = +2

Query  257   RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDS  436
             RQ F+VELRPGETTIVSWKKLLKEA    +  +      P   A AA+  P       ++
Sbjct  54    RQVFSVELRPGETTIVSWKKLLKEAGHAAAAPSQPQAVVPAEPAVAAQPGPPAAAHPAEN  113

Query  437   PGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedS  616
                   PE P +         NR NAVIEKIERLY+GK S D+EDLDDVPD+D+YDT+DS
Sbjct  114   -----DPEDPAQP--------NRFNAVIEKIERLYMGKHSSDEEDLDDVPDDDQYDTDDS  160

Query  617   FIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQT-----KCQ  781
             FIDD ELD+YF+VDN   KH GFFVN+G LE+IEP +  N  P KRR KDQ+       Q
Sbjct  161   FIDDAELDEYFEVDNLTTKHTGFFVNKGTLEQIEPGTSANVAPKKRRSKDQSANHIENNQ  220

Query  782   SGSDDGCNP-NKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENANVHNQEVNF----  946
               + D  N  N P K     GK V    G        V+ T     A +  +  +F    
Sbjct  221   GATGDYLNIRNMPGKAS--GGKKVATGNGEYYHEGSRVVKTKSSATALLKRRSTDFATGV  278

Query  947   DMQKAEVLHSKNV----------VDKLKESSETSNQRSNERIS--VPQEKSSGRSANISN  1090
             D  K   + SK+V          ++K K  +       N+  +       S+ R  + S 
Sbjct  279   DATKRTKISSKDVPYSSPKELKDLEKHKAPAFQPTDFGNKSTTSETYDYASAYRDKDPST  338

Query  1091  GLDQSFQQ-----GEK----SVIYDQR---------LDASAPEGKRSTQ----TVRRDGS  1204
              LD  FQQ     GE     S IY +          +D S       TQ    T  R+ +
Sbjct  339   QLD--FQQKQTYNGENVDPTSKIYHKDRAGTNDFSGVDVSGTATAYPTQAMHLTTGRESA  396

Query  1205  SVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQA-IKRRLPPEIKQKLAKVARYA  1381
               + K T LE+AIRDL+K  A  + P  ++ + D + QA  +RRLPPE+KQKLAKVAR +
Sbjct  397   GTKPKGTRLERAIRDLQKIAANYKSPAIDISEADPNVQASAQRRLPPEVKQKLAKVARLS  456

Query  1382  QASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAE  1558
               +HGK+ + EL++RLM IVGHLV  RTLKRN+K ++  GLSAKQEK +R+QQ+K E++E
Sbjct  457   -TNHGKVQENELMDRLMGIVGHLVVRRTLKRNMKELVKSGLSAKQEKADRLQQVKMEISE  515

Query  1559  MIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGL  1738
             M+K  +   K+K  EQQ G++DDFQ++ T+ +   K K  MD+ALE+RICDLYDLYVEG+
Sbjct  516   MVKASMA-AKAKVNEQQDGSADDFQTV-TDGRRDLKGKSAMDSALEDRICDLYDLYVEGM  573

Query  1739  EEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK--NQEKMRRNKI  1912
             +ED GPQ RKLY ELA  WP G+MD  GIK AI R+K+R+ TL+N+ K  N+E+++R ++
Sbjct  574   DEDKGPQSRKLYVELAELWPQGYMDKFGIKDAISRSKERKGTLHNQQKVLNEERLKRKRL  633

Query  1913  SAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPG  2092
             +A  +             PV  Q  +AV             ++  + +N V   PV   G
Sbjct  634   AAAAK--------LPDSHPVVTQSTAAVQ------------VAHPSMLNPVTTYPVTDYG  673

Query  2093  GTSLDRPKP-EKVKGTGNST-DRHITTDALTKKKMKRKPEPELGEGQ  2227
                +  PK  E+V+ T +S      + +A   KK KRK +P++ + Q
Sbjct  674   QNQV--PKSLERVRETSSSAIADESSKNAGDMKKKKRKSDPDVVDTQ  718



>ref|XP_011031128.1| PREDICTED: uncharacterized protein LOC105130359 isoform X4 [Populus 
euphratica]
Length=689

 Score =   355 bits (911),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 236/606 (39%), Positives = 345/606 (57%), Gaps = 90/606 (15%)
 Frame = +2

Query  260   QRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDSP  439
             QRF +EL+PGETTIVSWKKLLK+A   ++N + +      A+A A+    ++ P   ++ 
Sbjct  17    QRFYIELKPGETTIVSWKKLLKDAAANKANPSHSNNRTAAAAAGASTSSFVMEPASVETA  76

Query  440   G--PGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydted  613
                  F+  Q  +   K+AP  +RL +VIEKIE+LYV                       
Sbjct  77    QQEAQFALGQLTKPIPKNAPSSSRLGSVIEKIEQLYV-----------------------  113

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSD  793
                     D YF+VD S  KH+GFFVN+GKLE +      +   +K+RK +  K +   D
Sbjct  114   --------DGYFEVDQSTTKHNGFFVNKGKLEHMNRPISSSHFQSKKRKNNMQKAREEKD  165

Query  794   DGCNPNKPAKVGKK----AGKSVPLAAGTSSPSYGVVMPTLYRENANVH--------NQE  937
                  +K AK+G+     A  ++P+     + +  + +   +  N  +H        +++
Sbjct  166   GDRIRDKHAKLGQGRMNVATGNIPMDEPFRTNTQNLAVNGEHHHNGKLHSLMHPIFSDKK  225

Query  938   VNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERIS-VPQEKSSGR----SANISNGLDQ  1102
             V     ++E      + ++    S T    + ++++ V Q  + GR    ++ +S   D+
Sbjct  226   VAGTDIRSEYSPYPEITNRDDSISNTGQNDTEKQMNGVLQPGNLGRIVKDTSELSRVADR  285

Query  1103  SFQQGE---KSVIYDQRL-----DASAP-----------------------EGKRSTQTV  1189
              +Q+     +S    +RL     +AS+P                       + ++ T T+
Sbjct  286   KYQENNAPGQSAPQSKRLASETCNASSPKVPHRNKKGRHELPDLNLPHYPVQAEKKTATM  345

Query  1190  R-RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAK  1366
               +D SS++ K +M+E+AIRDLEK VAESRP N + QD D SS +IKRRLP E+KQKLAK
Sbjct  346   HPKDVSSLQPKGSMVERAIRDLEKVVAESRPRNTDAQDADTSSMSIKRRLPFEVKQKLAK  405

Query  1367  VARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKR  1546
             VAR AQ+S GK+S+ELI+ LM+I+GHL+QL TLK+NL+ M+ MGL+AKQEK +R Q+IK+
Sbjct  406   VARLAQSSQGKISEELISHLMTILGHLIQLSTLKKNLREMVEMGLTAKQEKADRFQKIKK  465

Query  1547  EVAEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIATEEKEAFKRKYCMDNALENRICDLYDL  1723
             EV EMI+ ++   + KA+        DFQ  I   EK A  RKY MD+ +E++ICDLYDL
Sbjct  466   EVMEMIELQLFKQRDKAVV-------DFQKGIIHGEKGAINRKYVMDDKMEDKICDLYDL  518

Query  1724  YVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRR  1903
             +V+G++ED GPQ+RKLYAE+A  WPNG MDNHGIK AICRAK+RR+  YN  K QEK R 
Sbjct  519   FVQGMDEDKGPQIRKLYAEVAEMWPNGAMDNHGIKIAICRAKERRRIFYNNEKVQEKARI  578

Query  1904  NKISAQ  1921
              K+S Q
Sbjct  579   EKLSRQ  584



>dbj|BAJ94008.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=748

 Score =   355 bits (911),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 262/580 (45%), Positives = 340/580 (59%), Gaps = 45/580 (8%)
 Frame = +2

Query  254   GRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHND  433
             GRQ F+VELRPGETTIVSWKKLLKEA    +     P  A       A L          
Sbjct  47    GRQLFSVELRPGETTIVSWKKLLKEAGLGAAPPPSLPAAAAAVQPVVAPLA---------  97

Query  434   SPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydted  613
               GP  +   P E +  D    NR NAVIEKIERLY+GK S D+EDLDDVPD+D+YDTED
Sbjct  98    --GPSGAAVHPTENDPNDPSQSNRFNAVIEKIERLYMGKHSSDEEDLDDVPDDDQYDTED  155

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPN---------KRRKKD  766
             SFIDD ELD+YF+VDN   KH GFFVN+GKLE+ E  S QN  P+         KRR++D
Sbjct  156   SFIDDAELDEYFEVDNLETKHTGFFVNKGKLEQSEYGSVQNVGPDGTVQNVGPKKRRRRD  215

Query  767   QTKCQ-SGSDDGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENAN--VHNQE  937
              +      S D    + P KV K+      L  G    S  +   + Y    N  + N+ 
Sbjct  216   SSNSYLENSKDLAPGSMPVKVPKRNA----LEIGKHIASSNLSSYSEYHSEGNKPLANKS  271

Query  938   VN-FDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANISN-GLDQSFQ  1111
             ++   MQK  V  S N       S         +  +V  +    +S+N++   L +   
Sbjct  272   ISPARMQK--VNASDNATGAEYASHPKLPTYLEKDTAVQLDLQLKKSSNVAKPDLPKKMH  329

Query  1112  QGEKSVIYDQRLDASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAES  1273
             + EK    +Q    +  +   STQT       R +GS +++K T LE+AIRDLE  V E 
Sbjct  330   RKEK-FGANQFPGLTTTDNVYSTQTTHLAANRRIEGSGIKAKGTRLERAIRDLENIVGEY  388

Query  1274  RPPNAEVQDGD-NSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSK-ELINRLMSIVGHL  1447
             +P   +V   D N   A+KRRLP EIKQKLAKVAR + A+ GK+S+ ELINRLM IVGHL
Sbjct  389   KPHTLDVPFIDPNCQGAVKRRLPQEIKQKLAKVARLS-ANQGKISEDELINRLMGIVGHL  447

Query  1448  VQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDD  1627
             VQ RTLKRN+K M+  G+ AKQEK ++ QQ+K E+ EM+K R+   K K  EQ+  ++D 
Sbjct  448   VQRRTLKRNIKEMVESGMCAKQEKADKFQQVKTEIYEMVKARLA-TKPKVTEQRDDSADA  506

Query  1628  FQ-SIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNG  1804
             FQ  +  ++K A K K+ +D  LE+RICDLYDLYVEG++ED GPQ RKLY ELA  WP G
Sbjct  507   FQGGVNIDDKTALKGKFVLDAPLEDRICDLYDLYVEGMDEDKGPQSRKLYVELADLWPQG  566

Query  1805  FMDNHGIKRAICRAKDRRKTLYNRHK--NQEKMRRNKISA  1918
             +MD   I+ AI R+K+RR  LY + K  N+E+M+R +I+A
Sbjct  567   YMDKVEIRNAISRSKERRNLLYRQRKVRNEERMKRRRIAA  606



>ref|XP_002306272.1| hypothetical protein POPTR_0005s06890g [Populus trichocarpa]
 gb|EEE93268.1| hypothetical protein POPTR_0005s06890g [Populus trichocarpa]
Length=539

 Score =   348 bits (893),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 228/516 (44%), Positives = 312/516 (60%), Gaps = 57/516 (11%)
 Frame = +2

Query  482   KDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDN  661
             K+AP  +RL +VIEKIE+LYV  QS D+E+LD  PDED YDT+DSFIDDTELD+YF+V  
Sbjct  22    KNAPSSSRLGSVIEKIEQLYVVNQSSDEEELDGAPDEDHYDTKDSFIDDTELDEYFEVYE  81

Query  662   SAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKK--  835
             S  KH+GFFVN+GKLE +      +    K+RK +  K +   D  C  +K AK+G+   
Sbjct  82    STTKHNGFFVNKGKLEHMNRPISSSHFQPKKRKNNMQKAREEKDGDCVRDKHAKLGQGRM  141

Query  836   --AGKSVPL-----------------------------------AAGTSSPSYGVVMPTL  904
               A  ++P+                                    AGT   S     P +
Sbjct  142   NVATGNIPMDEPFPTNTQNLAVNGEHHHDGKLHSLMHPIFSDKKVAGTDIRSEYSSYPGI  201

Query  905   YRENANVHNQ-EVNFDMQKAEVLHSKNVVDKLKESSETSN---QRSNER----ISVPQEK  1060
                + ++ N  +++ + Q   VL   N+   +K++SE S    Q+  E      S PQ K
Sbjct  202   TNRDDSISNTGQIDTEKQMNGVLQPGNLGRIVKDTSELSRVAYQKYQENNAPGQSAPQSK  261

Query  1061  SSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVR-RDGSSVRSKITMLEK  1237
                   + S  +    ++G +  + D  L     + ++ T T+  +D SS++ K +M+E+
Sbjct  262   RLASETSSSPKVSPRNKKG-RHELPDLNLPHYPVQAEKKTATMHPKDVSSLQPKGSMVER  320

Query  1238  AIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELI  1417
             AIRDLEK VAESRP N + QD D SS +IKRRLP E+KQKLAKVAR AQ+S GK+S+ELI
Sbjct  321   AIRDLEKVVAESRPRNTDAQDADTSSMSIKRRLPFEVKQKLAKVARLAQSSQGKISEELI  380

Query  1418  NRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKA  1597
               LM+I+GHL+QLRTLK+NL+ M+  GL+AKQEK +R Q+IK+EV EMI+ ++   + KA
Sbjct  381   GHLMTILGHLIQLRTLKKNLREMVETGLTAKQEKADRFQKIKKEVMEMIELKLFKQRDKA  440

Query  1598  IEQQPGTSDDFQ-SIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLY  1774
             +        DFQ  I   EK    RKY MD+ +E++ICDLYDL+V+G++ED GPQ+RKLY
Sbjct  441   VV-------DFQKGIIHGEKGTINRKYVMDDKMEDKICDLYDLFVQGMDEDKGPQIRKLY  493

Query  1775  AELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK  1882
             AE+A  WPNG MDNHGIK AICRAK+RR+  YN  K
Sbjct  494   AEVAEMWPNGAMDNHGIKIAICRAKERRRIFYNNEK  529



>ref|XP_009128221.1| PREDICTED: uncharacterized protein LOC103853066 isoform X4 [Brassica 
rapa]
Length=545

 Score =   348 bits (893),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 216/451 (48%), Positives = 281/451 (62%), Gaps = 51/451 (11%)
 Frame = +2

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQ---NQLPNKRRKKDQTK-CQ  781
             SFIDD ELD+YF+VD++ +KHDGFFVN GKLE IEP++     NQ P KR++K+  K C 
Sbjct  25    SFIDDVELDEYFEVDDAEVKHDGFFVNSGKLELIEPSTTTAIPNQKPKKRQRKELAKPCG  84

Query  782   SGSDDGCNPNKPAKVGKKAGKSVPLAAGT-------SSPSYGVVMPTL--YRENANVHNQ  934
               +D      K AK+ K AG  V  AA +       S+ S  V    L   + +A  + Q
Sbjct  85    DVADAS---RKKAKIAKTAGGKVDQAAASGPSPQKKSNDSKTVQDSVLENVKHSAKANLQ  141

Query  935   EVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANISNGLDQSF--  1108
               N    K++   S   +  LK S++ + Q+SN +                NGL +S   
Sbjct  142   PRNSTSPKSKAFESSGPL-LLKCSNKGTPQQSNSQ---------------PNGLAKSTVT  185

Query  1109  QQGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNA  1288
             ++ E +  +D  L  +   G   + TVR   SS       LEKA ++LEK VAESRPP A
Sbjct  186   RRSENNGTHD--LGNATKRG--GSNTVRPKTSST------LEKAFKELEKVVAESRPPAA  235

Query  1289  -EVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTL  1465
              E QD D SSQA+KRRLP  +K KLAKVAR  QAS G +S ELINRLMSIVGHL+Q+R+L
Sbjct  236   TENQDADTSSQAVKRRLPSNVKLKLAKVARLGQASQGSVSGELINRLMSIVGHLIQVRSL  295

Query  1466  KRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIAT  1645
             KRNLKIMI+   +A +EKD R Q IK EV EM+K +VPLM+S+A  Q+ GTSDDFQ +  
Sbjct  296   KRNLKIMIDSEDTANREKDTRFQLIKNEVIEMLKTQVPLMESQATNQEAGTSDDFQDV--  353

Query  1646  EEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGI  1825
              EK   K+K+ MD  LE+++CDLYD++V+GL+EDAGPQ+RKLYA LA  WP   MDNHGI
Sbjct  354   -EKPPTKKKFVMDAGLEDKLCDLYDIFVDGLDEDAGPQIRKLYANLAELWPKRLMDNHGI  412

Query  1826  KRAICRAKDRRKTL---YNRHKNQEKMRRNK  1909
             KRAICRAK+RR+       +  +QEK+ + K
Sbjct  413   KRAICRAKERRRASNGDLGKEMDQEKITKRK  443



>ref|XP_010231358.1| PREDICTED: ubinuclein-2-like isoform X2 [Brachypodium distachyon]
Length=748

 Score =   354 bits (908),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 271/620 (44%), Positives = 366/620 (59%), Gaps = 71/620 (11%)
 Frame = +2

Query  257   RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDS  436
             RQ F+VELRPGETTIVSWKKLLKEA        G     P +  AAA +QP++       
Sbjct  49    RQIFSVELRPGETTIVSWKKLLKEA--------GVAAALPPSLPAAAAVQPVV------E  94

Query  437   PGPGFSPEQP-VEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydted  613
             P  G S   P  E +  D    NR NAVIEKIERLY+GK S D+EDLDDVPD+D+YDTED
Sbjct  95    PLAGLSAAAPPTENDPNDPSQSNRFNAVIEKIERLYMGKHSSDEEDLDDVPDDDQYDTED  154

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQL---------PNKRRKKD  766
             SFIDD ELD+YF+VDN A KH G+FVN+GKLE+ E  S QN +         P KRR+++
Sbjct  155   SFIDDAELDEYFEVDNLATKHTGYFVNKGKLEQSEYGSVQNAVADGSVQNVGPKKRRRRE  214

Query  767   QTKCQSGSD----DGCNPNK-PAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENAN--V  925
              +     ++     G  P K P +   + GK++   A +   SY     + Y+   N  V
Sbjct  215   PSSSYIENNREFAAGSIPVKDPKRNALETGKNL---ASSDISSY-----SEYQSEGNKPV  266

Query  926   HNQEVN-FDMQK---------AEVLHSKNVVDKLKESSETSNQRSNERISVPQEKS-SGR  1072
              N+  +   MQK         AE     N+          S++ +  R+ +  EK+ +G 
Sbjct  267   KNKSTSPGRMQKMKSSDHAIGAEHASYLNISTDGYHYPAYSDKDAPVRLDLQSEKTFNGP  326

Query  1073  SANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTV------RRDGSSVRSKITMLE  1234
               ++S  + +  + G       Q    S      STQT       R +GS +++K T LE
Sbjct  327   KQDLSKKMRRKEKYG-----VSQFSGLSTANNAYSTQTTQLSANRRIEGSGIKAKGTRLE  381

Query  1235  KAIRDLEKFVAESRPPNAEVQDGD-NSSQAIKRRLPPEIKQKLAKVARYAQASHGKL-SK  1408
             +AIRDL+  V+E RP   ++QD D N   A+KRRLP E+KQKLAKVAR + A+ GK+  +
Sbjct  382   RAIRDLQNIVSEYRPQTLDIQDIDPNCQAAVKRRLPQEVKQKLAKVARLS-ANQGKIPEE  440

Query  1409  ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMK  1588
             EL+NRLM IVGHLVQ RTLKRN+K M+  G+ AKQEK ++ +Q+K E+ EMIK R+    
Sbjct  441   ELVNRLMGIVGHLVQRRTLKRNMKEMVESGIYAKQEKADKFRQVKVEICEMIKTRL-ATG  499

Query  1589  SKAIEQQPGTSDDFQ-SIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVR  1765
              K  E +  ++DDFQ ++  +E+ A K K+ +D  LE+RICDLYDLYVEG++ED GPQ R
Sbjct  500   PKVTEPKDDSADDFQGAVDIDERRALKGKFVLDAPLEDRICDLYDLYVEGMDEDKGPQSR  559

Query  1766  KLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK--NQEKMRRNKI-SAQKEEEG  1936
             KLY ELA  WP G+MD   I+ AI R+K+RR  LY + K  N+E+M+R ++ +A K  +G
Sbjct  560   KLYVELADLWPQGYMDKVEIRNAISRSKERRNLLYRQRKARNEERMKRRRLAAASKLRDG  619

Query  1937  YRV--ETTTRDQPVQIQEKS  1990
               V  + T   Q VQ+  KS
Sbjct  620   NPVVPQYTVAQQAVQVPMKS  639



>gb|KDO80487.1| hypothetical protein CISIN_1g003939mg [Citrus sinensis]
Length=427

 Score =   341 bits (874),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 211/402 (52%), Positives = 264/402 (66%), Gaps = 51/402 (13%)
 Frame = +2

Query  734   NQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGV-------  889
             NQ P KRR+KD  K  + +DDG  PNK AK+ K A  KS PL  G + P+  +       
Sbjct  3     NQQPKKRRRKDLPKAHNQNDDGRVPNKHAKLTKAATSKSAPL-VGKNIPTQNLGSKSGAH  61

Query  890   ---VMP--------------------TLYRENANVHNQEVNFDMQKAE--------VLHS  976
                V P                    TL   +  V N + +  + +A+         L S
Sbjct  62    CDEVRPQNQLNASGISPKKKSSDHKTTLDPSSIKVLNGDASVSLAEAKDADRLKTGNLQS  121

Query  977   KNVVDKLKE---SSETSNQRSNERISVPQEK-SSGRSANISNGLDQSFQQGEKSVIYDQR  1144
             K+V +KLK+    S+ S+Q+ +++ +  Q K  SG+     + L+ S +Q EK+  + + 
Sbjct  122   KSVSNKLKDISGPSDASHQKYHDQNAHIQSKFQSGKLLQNIDDLEPSARQREKNGSH-EL  180

Query  1145  LDASAPEGKRSTQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD  1306
             LD +  EGK   QT       R+DGSSVR K +MLEKAIR+LEK VAESRPP  E Q+ D
Sbjct  181   LDINVSEGKHPLQTTKASHMHRKDGSSVRPKGSMLEKAIRELEKMVAESRPPAIENQEAD  240

Query  1307  NSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIM  1486
             NSSQA+KRRLP EIK KLAKVAR AQAS GK+SKELINRLMSI+GHL+QLRTLKRNLKIM
Sbjct  241   NSSQAVKRRLPREIKLKLAKVARLAQASQGKISKELINRLMSILGHLIQLRTLKRNLKIM  300

Query  1487  INMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFK  1666
             I+MGLSAKQEKDNR QQIK+EV EMIK+RVP ++SKA EQQ G SDDFQ I +EEK   K
Sbjct  301   ISMGLSAKQEKDNRFQQIKKEVVEMIKERVPSLESKAYEQQAGASDDFQEIGSEEKGVLK  360

Query  1667  RKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAY  1792
             RKY MD+ALE++ICDLYDLYV+GL+EDAGPQ+RKLY E+  +
Sbjct  361   RKYRMDSALEDKICDLYDLYVDGLDEDAGPQIRKLYLEVFHF  402



>ref|XP_002887676.1| hypothetical protein ARALYDRAFT_476896 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63935.1| hypothetical protein ARALYDRAFT_476896 [Arabidopsis lyrata subsp. 
lyrata]
Length=698

 Score =   341 bits (874),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 279/724 (39%), Positives = 386/724 (53%), Gaps = 118/724 (16%)
 Frame = +2

Query  176   KPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT---GLQs  346
             K P D+G + GE    ++S++   AG R+   VEL   ETT VSWKKL+ EA    GL +
Sbjct  6     KLPTDDGPTFGESC--KISSAILTAGDRKLLKVELLQEETTHVSWKKLMDEACKENGLFA  63

Query  347   ngngapgpaprasaaaaELQPLILPPHNDSPGPGF--SPEQPVEKEAKDAPPGNRLNAVI  520
             +                        P N +P   F  +P    E E  + P  NRLN+VI
Sbjct  64    SAPER--------------------PPNANPNLDFRLAPGAQTENEMVNQPHPNRLNSVI  103

Query  521   EKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRG  700
              KIERLY+GK   D E+LD  PD+D+YDTEDSFIDD ELD+YF+VDNS IKHDGFFVNRG
Sbjct  104   AKIERLYMGKDGSDGEELDGAPDDDDYDTEDSFIDDAELDEYFEVDNSPIKHDGFFVNRG  163

Query  701   KLERIEPTSQQN-QLPNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTS  871
             KLERIEP++  N Q P KRR+K+  K C    D      K AK+ K A GK    A G S
Sbjct  164   KLERIEPSATSNQQQPKKRRRKESAKPCGDVVDVS---RKQAKMAKTAGGKDQSAAPGPS  220

Query  872   SPSYGVVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVP  1051
             S         +  ++  V +   +F   KA+  +   V++ +K + + ++Q  N   + P
Sbjct  221   SKK-------ISNDSKTVQD---SFSPLKAQNGNDSLVLENVKHTDKANHQPMN--ATSP  268

Query  1052  QEKSSGRSANISNGLDQSFQQGE------------KSVIYDQRLDASAP------EGKRS  1177
             + K++G S  +        +Q              KS +  Q+++   P      E K+S
Sbjct  269   KSKAAGSSFPLHLKCTSKNEQSNSLPGISRPNDSAKSAVVRQQVNNGIPDLDIATESKKS  328

Query  1178  TQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPPEIKQ  1354
              Q  ++  S+ R K + LEKAIR+LEK VAESRPP   E QD D SSQA+KR LP ++K 
Sbjct  329   VQISKKGDSNGRPKSSTLEKAIRELEKVVAESRPPAVTENQDADISSQAVKRGLPGDVKL  388

Query  1355  KLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQ  1534
              LAKVAR A AS G +S ELINRLMSIVGHL+Q+R+LK                   +  
Sbjct  389   NLAKVARIAHASQGDISGELINRLMSIVGHLIQIRSLKV------------------KAL  430

Query  1535  QIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDL  1714
               ++E+   +     +       Q+ GTSDDFQ + +  K   K K+ MD ALE ++CDL
Sbjct  431   PFQKELTRYVFISEGVQALTETSQEAGTSDDFQDVGSLGKPPVK-KFVMDVALEEKLCDL  489

Query  1715  YDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEK  1894
             YD++VEG++E +GPQ+RKLY++LA  WPN  +DNH I+RAICR K+RR+ L  +    ++
Sbjct  490   YDVFVEGMDEHSGPQIRKLYSDLAELWPNRLVDNHEIRRAICREKERRRAL--KGNLGKE  547

Query  1895  MRRNKISAQKE------EEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAI  2056
             M + KI+ +KE       EG    TT  D+   +  K++V      S  T   +   AA 
Sbjct  548   MDQTKIAKKKETQLVPKSEG----TTYPDKASGVGVKASVVL----SATTTSLVDCEAAA  599

Query  2057  NMVGRIPVPSPGGTSLDRPKP--EKVKGTGNSTDRHITTDALTKKKMKRKPEPELGEGQY  2230
             +            +S +R K   EK+KGT +     ++  A   K ++RK EP + E Q 
Sbjct  600   D------------SSCERSKQQNEKLKGTSS-----LSNPAAEGKTVRRKTEPAVEETQL  642

Query  2231  LPEK  2242
               EK
Sbjct  643   PAEK  646



>gb|AAV24767.1| unknow protein [Oryza sativa Japonica Group]
Length=695

 Score =   336 bits (861),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 237/559 (42%), Positives = 319/559 (57%), Gaps = 54/559 (10%)
 Frame = +2

Query  266   FTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDSPGP  445
             F+VELRPGETTIVSW+K+LKEA                A+           P     PGP
Sbjct  59    FSVELRPGETTIVSWRKMLKEA-------------DLGAALPPPPPAAAAQPAVAPLPGP  105

Query  446   GFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedSFID  625
                   P E    D    NR N+VIEKIERLY+GK S D+EDLDD PD+D+YDTEDSFID
Sbjct  106   S-GATHPTEN---DCAQSNRFNSVIEKIERLYMGKNSSDEEDLDDAPDDDQYDTEDSFID  161

Query  626   DTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSDDGCN  805
             D ELD+YF+VDN A KH+G+FVN+GKLE+I+  S Q   P KRR+KD +     ++   +
Sbjct  162   DDELDEYFEVDNFATKHNGYFVNKGKLEQIDFDSVQTVEPKKRRRKDSSSSYIENNKEFS  221

Query  806   PNKPAKVGK--KAGKSVPLAAGTSSPSYGVVMPTLYRENANVHNQEVNFDMQK-AEVLHS  976
             P   + +G   +  K   L  G S+              +N H    N   +        
Sbjct  222   PGSSSYMGTPLRDSKRSTLQTGKST--------------SNGHKSGANGTFEYPYSAYRD  267

Query  977   KNVVDKLKESSETSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDAS  1156
             K+    L    + ++  +N+ +S         +A   +GL  S      S IY       
Sbjct  268   KDAPGHLGLQQKITSNGANQDLSKNMHHKEKYNAGQFSGLHAS------SNIY-------  314

Query  1157  APEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQ-AIKRR  1333
             + E       +  +GS  ++K T LE+AIRDL+  V E +P   +V + + + Q A+KRR
Sbjct  315   STETMHLATKIHTEGSGTKTKGTRLERAIRDLQNIVTEYKPQILDVHEAEANCQVAVKRR  374

Query  1334  LPPEIKQKLAKVARYAQASHGKL-SKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             LP E+KQKLAKVAR + A+ GK+   ELINRLM IVGHLV  RTLKRN+K M+  GL AK
Sbjct  375   LPQEVKQKLAKVARLS-ANQGKIPEHELINRLMGIVGHLVHRRTLKRNMKEMVQSGLCAK  433

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQS-IATEEKEAFKRKYCMDN  1687
             QEK  ++QQ+K E+ EM+K R+   K K  E +  + D FQ  +  +++ A + K  MD 
Sbjct  434   QEKAGKLQQVKMEIYEMVKARLA-TKPKGAEHKVESIDGFQDPVTHDDRMALRGKSVMDA  492

Query  1688  ALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
              LE+RICDLYDLYVEG++ED GPQ RKLY ELA  WP+G MD  GI+ AI R+K+RR  L
Sbjct  493   VLEDRICDLYDLYVEGMDEDKGPQSRKLYLELANLWPHGDMDKVGIRDAISRSKERRNLL  552

Query  1868  YNRHK--NQEKMRRNKISA  1918
             Y + K  N ++M+R +++A
Sbjct  553   YRQRKVRNDQRMKRRRLAA  571



>gb|EYU23864.1| hypothetical protein MIMGU_mgv1a003415mg [Erythranthe guttata]
Length=468

 Score =   328 bits (840),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 225/460 (49%), Positives = 280/460 (61%), Gaps = 39/460 (8%)
 Frame = +2

Query  191   EGSSGGEPGVGRVSTS---YEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngnga  361
             EG  G  P     S S   +E++G R RFTVELRPGETTIVSWKKLL+EA   +S    +
Sbjct  3     EGKEGAGPDSRPGSNSGSLFESSGDRVRFTVELRPGETTIVSWKKLLREANSSKSRPGTS  62

Query  362   pgpaprasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKD----APPGNRLNAVIEKI  529
                    +      QP   PP    P    S +Q +E E+KD    A P NRL+ VIE+I
Sbjct  63    VSDPSAEAQFQPVSQPARSPPLEAPP----SSKQHLENESKDSQAQAGP-NRLSNVIERI  117

Query  530   ERLYVGKQSdddedlddvp--dedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGK  703
             ER+Y G  S D+ED+      D+DEYDTEDSFIDD ELDDYFQ+DNS+IKHDGFFVNRGK
Sbjct  118   ERMYAGNGSGDEEDVVLDNVPDDDEYDTEDSFIDDAELDDYFQIDNSSIKHDGFFVNRGK  177

Query  704   LERIEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSVPL---AAGTSS  874
             LE IEPT   NQ P KRR++D TK   GSDDG NPNK  K+G K  K+      +   +S
Sbjct  178   LEGIEPTIPTNQQPKKRRREDLTKGHGGSDDGHNPNKNVKIGNKVRKTSSSQRNSGSQAS  237

Query  875   PSYGVVMPTLYRE-------------NANVHNQEVNFDMQKAEVLHSKNVVDKLKESS--  1009
             P +   +    +              N +   Q +  D Q++ VL  K+ V KLKE+   
Sbjct  238   PMHTAEVSIKNKTAESQTTRNPSGLLNGDAVRQNMATDQQRSVVLSLKSHVSKLKETELQ  297

Query  1010  ETSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTV  1189
              TS QRSN + S   +   G+  N  +GLDQS QQ  K  +  +R D + P    ST + 
Sbjct  298   NTSTQRSNNKNSDASKSRFGKQKNNVDGLDQSIQQKGKGGLI-ERFDLNVPAMGDSTSST  356

Query  1190  ------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIK  1351
                   R++ +SVRSK T LEKAIR+LEK V+E RPP+ EV+D DNSSQA+KRRLPP IK
Sbjct  357   KAALMQRKEAASVRSKSTTLEKAIRELEKIVSEFRPPSTEVKDPDNSSQAVKRRLPPVIK  416

Query  1352  QKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKR  1471
             QKL KV R AQ S+GK+ KE+IN LMSIVGHL+Q+RTLK+
Sbjct  417   QKLGKVGRLAQISYGKIPKEVINHLMSIVGHLMQIRTLKK  456



>gb|AAC34359.1| Hypothetical protein [Arabidopsis thaliana]
Length=525

 Score =   327 bits (839),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 238/551 (43%), Positives = 320/551 (58%), Gaps = 72/551 (13%)
 Frame = +2

Query  176   KPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT----GLQ  343
             K P D+G +  E    ++S+    AG R+   VEL   ETT+VSWKKL+ EA+    GL 
Sbjct  6     KLPTDDGPTFNESC--KISSEILTAGDRKLLKVELLKEETTLVSWKKLMDEASKENGGL-  62

Query  344   sngngapgpaprasaaaaELQPLILPPH---NDSPGPGF--SPEQPVEKEAKDAPPGNRL  508
                                    +  P    N +P   F  +P    E E  + P  NRL
Sbjct  63    ----------------------FVSAPERLLNANPNLEFRLAPGAQTENEMVNQPHPNRL  100

Query  509   NAVIEKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFF  688
             N+VI KIERLY+GK   D E+LD  PD+D+YDTEDSFIDD ELD+YF+VDNS IKHDGFF
Sbjct  101   NSVIAKIERLYMGKDGSDGEELDGAPDDDDYDTEDSFIDDAELDEYFEVDNSPIKHDGFF  160

Query  689   VNRGKLERIEPTSQQNQL-PNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKKAGKSVPLAA  862
             VNRGKLERIEP++  NQ  P KRR+K+  K C    D      K AK+ K AG       
Sbjct  161   VNRGKLERIEPSATSNQQQPKKRRRKESAKPCGDVVDVS---RKRAKMAKTAG------G  211

Query  863   GTSSPSYGVVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERI  1042
                S S G     +  ++  V +   +F   KA+  +   V++ +K + + ++Q  N   
Sbjct  212   KDQSASPGPSSKKISNDSKTVQD---SFSPLKAQNGNDSLVLENVKHTDKANHQPMNA--  266

Query  1043  SVPQEKSSGRSANI-----SNGLDQSFQQ---------GEKSVIYDQRLDASAP------  1162
             + P+ K++G S  +     S  + +               KS +  Q+++   P      
Sbjct  267   TSPKSKAAGSSGPLHPKCSSKSVHEQSNSPPGKSRPNVSAKSAVVRQQVNNGMPDLDIAT  326

Query  1163  EGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLP  1339
             E K S Q  ++ GS+ R K + LEKAIR+LEK VAESRPP A E QD D SSQA+KR LP
Sbjct  327   ESKTSIQISKKSGSNGRPKYSTLEKAIRNLEKLVAESRPPAATENQDADISSQAVKRGLP  386

Query  1340  PEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEK  1519
              ++K  LAKVAR A AS G++S ELINRLM IVGHL+Q+R+LKRNLKIMI+  ++A +EK
Sbjct  387   GDVKLHLAKVARIAYASQGEISGELINRLMGIVGHLIQIRSLKRNLKIMIDSIVTANREK  446

Query  1520  DNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALEN  1699
             D R Q+IK E+ EM+K +VPL++S+   Q+ GTSDDFQ + +  K   K K+ MD ALE 
Sbjct  447   DTRFQRIKSEITEMLKTQVPLVESQETNQEAGTSDDFQDVGSLGKSPVK-KFVMDVALEE  505

Query  1700  RICDLYDLYVE  1732
             ++CDLYD++VE
Sbjct  506   KLCDLYDVFVE  516



>gb|AAG29192.1|AC078898_2 unknown protein [Arabidopsis thaliana]
Length=699

 Score =   332 bits (850),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 276/729 (38%), Positives = 385/729 (53%), Gaps = 125/729 (17%)
 Frame = +2

Query  176   KPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT----GLQ  343
             K P D+G +  E    ++S+    AG R+   VEL   ETT+VSWKKL+ EA+    GL 
Sbjct  6     KLPTDDGPTFNESC--KISSEILTAGDRKLLKVELLKEETTLVSWKKLMDEASKENGGL-  62

Query  344   sngngapgpaprasaaaaELQPLILPPH---NDSPGPGF--SPEQPVEKEAKDAPPGNRL  508
                                    +  P    N +P   F  +P    E E  + P  NRL
Sbjct  63    ----------------------FVSAPERLLNANPNLEFRLAPGAQTENEMVNQPHPNRL  100

Query  509   NAVIEKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFF  688
             N+VI KIERLY+GK   D E+LD  PD+D+YDTEDSFIDD ELD+YF+VDNS IKHDGFF
Sbjct  101   NSVIAKIERLYMGKDGSDGEELDGAPDDDDYDTEDSFIDDAELDEYFEVDNSPIKHDGFF  160

Query  689   VNRGKLERIEPTSQQNQL-PNKRRKKDQTK-CQSGSDDGCNPNKPAKVGKKAGKSVPLAA  862
             VNRGKLERIEP++  NQ  P KRR+K+  K C    D      K AK+ K AG       
Sbjct  161   VNRGKLERIEPSATSNQQQPKKRRRKESAKPCGDVVDVS---RKRAKMAKTAG------G  211

Query  863   GTSSPSYGVVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERI  1042
                S S G     +  ++  V +   +F   KA+  +   V++ +K + + ++Q  N   
Sbjct  212   KDQSASPGPSSKKISNDSKTVQD---SFSPLKAQNGNDSLVLENVKHTDKANHQPMN--A  266

Query  1043  SVPQEKSSGRSANI-----SNGLDQSFQQ---------GEKSVIYDQRLDASAP------  1162
             + P+ K++G S  +     S  + +               KS +  Q+++   P      
Sbjct  267   TSPKSKAAGSSGPLHPKCSSKSVHEQSNSPPGKSRPNVSAKSAVVRQQVNNGMPDLDIAT  326

Query  1163  EGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLP  1339
             E K S Q  ++ GS+ R K + LEKAIR+LEK VAESRPP A E QD D SSQA+KR LP
Sbjct  327   ESKTSIQISKKSGSNGRPKYSTLEKAIRNLEKLVAESRPPAATENQDADISSQAVKRGLP  386

Query  1340  PEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEK  1519
              ++K  LAKVAR A AS G++S ELINRLM IVGHL+Q+R+LK          L  ++E 
Sbjct  387   GDVKLHLAKVARIAYASQGEISGELINRLMGIVGHLIQIRSLKVK-------ALPFQKE-  438

Query  1520  DNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALEN  1699
                   + R V   + + V  +      Q+ GTSDDFQ + +  K   K K+ MD ALE 
Sbjct  439   ------LTRSV--FVSEGVQALTE--TNQEAGTSDDFQDVGSLGKSPVK-KFVMDVALEE  487

Query  1700  RICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRH  1879
             ++CDLYD++VEG++E +G Q+RKLY++LA  WPN  +DNH I+RAICR K+RR+ L    
Sbjct  488   KLCDLYDVFVEGMDEHSGSQIRKLYSDLAQLWPNSLVDNHEIRRAICREKERRRALEGNI  547

Query  1880  KNQEKMRRNKISAQKE------EEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPIS  2041
               +  M + KI+ +K+       EG     T  D+   ++ K++V             + 
Sbjct  548   GKE--MDQTKITKKKQTQLVPKSEGI----TYPDKTSGVEVKASV-------------VL  588

Query  2042  STAAINMVGRIPVPSPGGTSLDRPKP--EKVKGTGNSTDRHITTDALTKKKMKRKPEPEL  2215
             +    ++V   P      +S +R K   EK+K T +     ++  A   KK++RK EP L
Sbjct  589   TATTTSLVDCQPA---ADSSFERSKQQHEKLKRTSS-----LSNPAAEGKKVRRKTEPAL  640

Query  2216  GEGQYLPEK  2242
              E     EK
Sbjct  641   EETHLPAEK  649



>ref|XP_006465112.1| PREDICTED: uncharacterized protein LOC102619623 isoform X3 [Citrus 
sinensis]
Length=668

 Score =   319 bits (817),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 224/552 (41%), Positives = 313/552 (57%), Gaps = 57/552 (10%)
 Frame = +2

Query  635   LDDYFQVDNSAIKHDGFFVNRGKLERI-EPTSQQN-QLPNKRRKKDQTKCQSGSDDGCNP  808
             LD+YFQ +N   +++ F + +G +E   EP S  + QL  K+RK    K      D   P
Sbjct  74    LDEYFQDENPTTEYNDFTIRKGIMEHSNEPVSSSDCQL--KKRKTHIPKGLVEKVDDHVP  131

Query  809   NKPAKVGK---KAGKSVPLAAGTSSPSYGVVMPTLYRENANVH---NQEVNFDMQK----  958
             NK AK+G    KA K+V +   +SS S  +     +  +  +    +  + F  +K    
Sbjct  132   NKHAKLGHARLKAAKNVTVVGQSSSHSQSLAASREHYHDRKLQHPLDSPIGFSKKKHDDT  191

Query  959   -----------------AEVLHSKNVVDKLKESSETSNQRSN-------ERISVPQ-EKS  1063
                              A  L+S+    +   +S+  N  +N       E+I   Q E  
Sbjct  192   STKSEYSMHSGISDDASAGFLNSQYAEKQRPVTSQCRNAGNNLKERKYVEKIDSEQLEFP  251

Query  1064  SGRSANISNGLDQSFQ--QGEK---SVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKITM  1228
             + R    ++G + S +  Q EK   S + D  + AS  E  +S  +++ D  ++R K T 
Sbjct  252   AKRMLTDTSGHEFSTKARQREKNGSSGLPDLNIPASPVEPVKSATSLK-DIPTLRPKGTT  310

Query  1229  LEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGKLSK  1408
             LE+AIRDLEK VAESRPPN EVQD D SS A KRRLP E+KQKLAKVAR AQ+S GK+S+
Sbjct  311   LERAIRDLEKVVAESRPPNVEVQDADTSSPAFKRRLPHEVKQKLAKVARLAQSSQGKISE  370

Query  1409  ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMK  1588
             EL+NRLMSI+GHLVQLRTLKRNL+ M+ +GLSAK+EK +R+Q IK EV EMIK    L  
Sbjct  371   ELVNRLMSILGHLVQLRTLKRNLREMVLLGLSAKREKADRIQLIKNEVIEMIK----LQA  426

Query  1589  SKAIEQQPGTSDDFQSIATEEKEAF-KRKYCMDNALENRICDLYDLYVEGLEEDAGPQVR  1765
             +K      G +DDFQ     E++ F K K+C+++ LE++ICDLYDLY++G++ED GPQ+R
Sbjct  427   NKLTN---GAADDFQDTFHSEEKGFQKEKFCINSMLEDKICDLYDLYIQGMDEDKGPQIR  483

Query  1766  KLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRV  1945
             KLYAELA  WP G MDNHGIK+AICRAK+RR+  Y+  K +EK R  K+   + E     
Sbjct  484   KLYAELAELWPEGTMDNHGIKKAICRAKERRRASYDDEKVREKARGQKLPMARTEVAVCG  543

Query  1946  ETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPG----GTSLDRP  2113
             E ++  Q   + E+    +      + +K ISS  A+N     PV +        ++D P
Sbjct  544   EVSSTAQAKAVPERIITVSNTLFLGSPSKMISSATALNHHLTAPVRTSSLMLKSFNMDFP  603

Query  2114  KPEKVKGTGNST  2149
             K EK++ T   T
Sbjct  604   KQEKLERTAYPT  615



>gb|EMT33534.1| hypothetical protein F775_15647 [Aegilops tauschii]
Length=968

 Score =   317 bits (811),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 236/557 (42%), Positives = 318/557 (57%), Gaps = 70/557 (13%)
 Frame = +2

Query  449   FSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedSFIDD  628
              S   P E +  D    NR NAVIEKIERLY+GK S D+EDL DVPD+D+YDTEDSFIDD
Sbjct  68    LSQVHPTENDPNDPSQSNRFNAVIEKIERLYMGKHSSDEEDLGDVPDDDQYDTEDSFIDD  127

Query  629   TELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPN---------KRRKKDQTKCQ  781
              ELD+YF+VDN   KH GFFVN+GKLE+ E  S QN +P+         KRR++D +   
Sbjct  128   AELDEYFEVDNLETKHTGFFVNKGKLEQSEYGSVQNVVPDGAVQNVGPKKRRRRDSSNSY  187

Query  782   SGSDDGCNP-NKPAKVGKK----AGKSVPLAAGTSSPSYGVV--MPTLYRENANVHNQEV  940
               +     P + P KV K+     GK++  +  +S   Y      P   + N+ V  Q+V
Sbjct  188   IENSKELAPGSMPVKVPKRNALEIGKNIASSDLSSYSEYHSEGNKPLTNKSNSPVRMQKV  247

Query  941   NF--DMQKAEVL-HSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANISNGLDQ--S  1105
             N   +   AE   H K     +   S      +  + +VPQ     R +  +N ++   +
Sbjct  248   NASDNATGAEYASHPKISSKGVSLPSSEIKDLNKHKTAVPQAVDFARKST-TNAINPYPA  306

Query  1106  FQQGEKSVIYDQRLDASAPEGK---------------------------RSTQTV-----  1189
             + + + +V  D +L  S+   K                            STQT      
Sbjct  307   YLEKDAAVQLDLQLKKSSNVAKPDLPKKMRRKENYGVNQFPGLTTADNVYSTQTTVIIRG  366

Query  1190  ---------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD-NSSQAIKRRLP  1339
                      R +GS +++K T LE+AIRDLE  V E +P   +V   D N   A+KRRLP
Sbjct  367   TGTHLAANRRIEGSGIKAKGTRLERAIRDLENIVGEYKPHTLDVPYIDPNCQGAVKRRLP  426

Query  1340  PEIKQKLAKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQE  1516
              EIKQKLAKVAR + A+ GK+S+ ELINRLM IVGHLVQ RTLKRN+K M+  G+ AKQE
Sbjct  427   QEIKQKLAKVARLS-ANQGKISEDELINRLMGIVGHLVQRRTLKRNMKEMVESGMCAKQE  485

Query  1517  KDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQS-IATEEKEAFKRKYCMDNAL  1693
             K ++ QQ+K E+ EM+K R+   K K  EQ+  ++ DFQ  +  ++K A K K+ +D  L
Sbjct  486   KADKFQQVKTEIYEMVKARLD-TKPKVTEQRDDSAHDFQGGVNIDDKTALKGKFVLDAPL  544

Query  1694  ENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYN  1873
             E+RICDLYDLYVEG++ED GPQ RKLY ELA  WP G+MD   I+ AI R+K+RR  LY 
Sbjct  545   EDRICDLYDLYVEGMDEDKGPQSRKLYVELADLWPQGYMDKVEIRNAISRSKERRNLLYR  604

Query  1874  RHK--NQEKMRRNKISA  1918
             + K  N+E+M+R +I+A
Sbjct  605   QRKVRNEERMKRRRIAA  621



>ref|XP_006465110.1| PREDICTED: uncharacterized protein LOC102619623 isoform X1 [Citrus 
sinensis]
 ref|XP_006465111.1| PREDICTED: uncharacterized protein LOC102619623 isoform X2 [Citrus 
sinensis]
Length=671

 Score =   310 bits (793),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 220/327 (67%), Gaps = 12/327 (4%)
 Frame = +2

Query  1184  TVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLA  1363
             T  +D  ++R K T LE+AIRDLEK VAESRPPN EVQD D SS A KRRLP E+KQKLA
Sbjct  299   TSLKDIPTLRPKGTTLERAIRDLEKVVAESRPPNVEVQDADTSSPAFKRRLPHEVKQKLA  358

Query  1364  KVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIK  1543
             KVAR AQ+S GK+S+EL+NRLMSI+GHLVQLRTLKRNL+ M+ +GLSAK+EK +R+Q IK
Sbjct  359   KVARLAQSSQGKISEELVNRLMSILGHLVQLRTLKRNLREMVLLGLSAKREKADRIQLIK  418

Query  1544  REVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAF-KRKYCMDNALENRICDLYD  1720
              EV EMIK    L  +K      G +DDFQ     E++ F K K+C+++ LE++ICDLYD
Sbjct  419   NEVIEMIK----LQANKLTN---GAADDFQDTFHSEEKGFQKEKFCINSMLEDKICDLYD  471

Query  1721  LYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMR  1900
             LY++G++ED GPQ+RKLYAELA  WP G MDNHGIK+AICRAK+RR+  Y+  K +EK R
Sbjct  472   LYIQGMDEDKGPQIRKLYAELAELWPEGTMDNHGIKKAICRAKERRRASYDDEKVREKAR  531

Query  1901  RNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPV  2080
               K+   + E     E ++  Q   + E+    +      + +K ISS  A+N     PV
Sbjct  532   GQKLPMARTEVAVCGEVSSTAQAKAVPERIITVSNTLFLGSPSKMISSATALNHHLTAPV  591

Query  2081  PSPG----GTSLDRPKPEKVKGTGNST  2149
              +        ++D PK EK++ T   T
Sbjct  592   RTSSLMLKSFNMDFPKQEKLERTAYPT  618



>ref|XP_006847173.1| hypothetical protein AMTR_s00017p00245850 [Amborella trichopoda]
 gb|ERN08754.1| hypothetical protein AMTR_s00017p00245850 [Amborella trichopoda]
Length=794

 Score =   308 bits (790),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 176/367 (48%), Positives = 240/367 (65%), Gaps = 24/367 (7%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVA  1372
             ++G++VR K TMLE+AIR+LE  VAE RPP  ++Q+ D S+Q IKRRLP +IKQKLAKVA
Sbjct  389   KEGAAVRPKGTMLERAIRELENKVAELRPPAMDLQEVDASAQGIKRRLPQDIKQKLAKVA  448

Query  1373  RYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREV  1552
             R AQ+S G++S+ELINRLMSI+GH+VQ++TLKR++K M+ +GLSAKQEK++++Q++K EV
Sbjct  449   RLAQSSQGRISEELINRLMSILGHVVQIKTLKRHMKEMVELGLSAKQEKEDKLQKMKNEV  508

Query  1553  AEMIKDRVPLMKSKAIEQQPGTSDDFQSIA-TEEKEAFKRKYCMDNALENRICDLYDLYV  1729
              EM+K++V ++KSK  +    +SDDFQ    ++EK A K +Y  DNA E+R+CDLYD YV
Sbjct  509   TEMVKEQVSILKSKEADMHKLSSDDFQDAPNSDEKGALKGRYKWDNATEDRLCDLYDQYV  568

Query  1730  EGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNK  1909
             EG++ED GPQ+RKLY ELA  WP G+MDN+GIK A+CRAK+RRK LY   K+ EK+RR K
Sbjct  569   EGMDEDKGPQIRKLYVELAELWPEGWMDNNGIKYAVCRAKERRKRLYGHGKDGEKLRRKK  628

Query  1910  ISAQKEEEGYRVE-----TTTRDQPVQIQEKSAVDAR----DHGSTATNKPISSTAAIN-  2059
             IS+       RVE       T  Q   +QE+   + +     HG    +  +SS++  N 
Sbjct  629   ISSA----AVRVEENLGAAATNSQARSLQERPPSNQQQPYTSHGHLIIHNTLSSSSPRNH  684

Query  2060  MVGRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHITTD---ALTKKKMKRKPEPELGEGQY  2230
              +G +P       + D     +  G      R  T D    L  KK+KRK     G   Y
Sbjct  685   ALGALP-----NRTSDSFISNEATGAILEKVRRTTIDHESGLVSKKLKRKSMEASGSPMY  739

Query  2231  LPEKLSS  2251
              P KL S
Sbjct  740   -PSKLQS  745


 Score =   129 bits (323),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 103/241 (43%), Positives = 132/241 (55%), Gaps = 39/241 (16%)
 Frame = +2

Query  203  GGEPGVGRVSTS----------YEAAGG---RQRFTVELRPGETTIVSWKKLLKEATGLQ  343
            GG   V R S S          Y+  G    RQ F+V+LRPGETTIVSWK+L+K++    
Sbjct  6    GGPSVVARASVSPSGAVASSSLYDPKGAISQRQSFSVDLRPGETTIVSWKRLVKDSNKAI  65

Query  344  sngngapgpaprasaaaaELQPLILPPHNDSPG--PGFSPEQPVEKEAKDA-PPGNRLNA  514
             N                     + PP    P      +PE     E +D  PP NR +A
Sbjct  66   RNSAS------------------VEPPVGAHPALESRIAPEGHARHELEDVVPPSNRFSA  107

Query  515  VIEKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVN  694
            VI+KIERLY G++S D+EDLDD+PD+D+YDT+DSFIDD ELD+YFQVD S  KH+GFFVN
Sbjct  108  VIQKIERLYKGRESSDEEDLDDIPDDDQYDTDDSFIDDAELDEYFQVDKSETKHNGFFVN  167

Query  695  RGKLERI-EPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVG----KKAGKSVPLA  859
            RGKLE+  +P S     P KRR++D     S +     P +   VG    K A ++ PL 
Sbjct  168  RGKLEKTNDPISSPVHAPKKRRRRDLNNAISENAAENLPKRHLNVGGVRMKAAARNAPLV  227

Query  860  A  862
             
Sbjct  228  G  228



>ref|XP_008783318.1| PREDICTED: uncharacterized protein LOC103702606 isoform X2 [Phoenix 
dactylifera]
Length=571

 Score =   300 bits (768),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 221/545 (41%), Positives = 308/545 (57%), Gaps = 57/545 (10%)
 Frame = +2

Query  743   PNKRRKKDQTKCQSGSDDGCNPNKPAKVG----KKAGKSVPLAAG-TSSPSYGVVMPTL-  904
             P KRR+K+ TK +   D    P++   +G    K A ++ PL     SSP+  + +P + 
Sbjct  8     PKKRRRKESTKVRGERDHDHVPSESINMGNMRIKAAARNAPLVGKKLSSPAKVLALPYVE  67

Query  905   -YRENANVHNQEVNF---DMQKAEVLH-SKNVVDKLKESSETSNQRSNERISVPQEKSSG  1069
              Y E   + + ++N       K ++ H S+   D      +TS  +    +S   E  S 
Sbjct  68    NYYEENKLADNKLNAPTGAYNKRDLTHKSRGTGDSFDPMYQTSRDKG---VSSQVEFQSR  124

Query  1070  RSANISNG-------LDQSFQQGEKSVIYDQRLDASAPEGKRSTQ-----TVRRDGSSVR  1213
             R  N  N          + +  GE S       D ++     +TQ     T  ++GS+VR
Sbjct  125   RLLNGENEEVSAKIRRKEKYGTGEFS-------DMNSSGSVYTTQAQPTFTRVKEGSTVR  177

Query  1214  SKITMLEKAIRDLEKFVAESRPPNAEVQDG----DNSSQAIKRRLPPEIKQKLAKVARYA  1381
              K T LE+AIRDLEK VAESRPP+  VQ+     D SSQ +KRRLP E+KQKLAKVAR +
Sbjct  178   PKGTTLERAIRDLEKIVAESRPPSIYVQETVQEIDPSSQGVKRRLPQEVKQKLAKVARLS  237

Query  1382  QASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAE  1558
              AS  K+S+ ELI+RLM I+GHLVQ +TLKRN+K M+ +GLSAKQ+K +R QQ K+EV E
Sbjct  238   -ASQAKVSEDELIDRLMGILGHLVQRKTLKRNMKEMVELGLSAKQQKADRFQQTKKEVHE  296

Query  1559  MIKDRVPLMKSKAIEQQPGTSDDFQS-IATEEKEAFKRKYCMDNALENRICDLYDLYVEG  1735
             +I+ RV  + S   E Q  ++DDFQ  I  +E+ A K KY MD ALE++ICDLYDLYVEG
Sbjct  297   LIRARVSNLNSHVAELQDISADDFQEVINNDERRALKGKYSMDTALEDKICDLYDLYVEG  356

Query  1736  LEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY--NRHKNQEKMRRNK  1909
             ++ED GPQ RKLY ELA  WP+G+MDN GIK AI R+K+R++ LY  N+ +++E+++R K
Sbjct  357   MDEDKGPQSRKLYVELAELWPHGYMDNVGIKDAIYRSKERKRALYRQNKVRDEERIKRKK  416

Query  1910  ISAQKEEEGYRVETTT---RDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPV  2080
             ++A       RVE T      Q    QE+   D       + +K +S+    ++ GRI  
Sbjct  417   LAA-----AVRVEETNPGPASQARAGQERPVTDPTGPFLVSPDKLVSNQLPASL-GRITD  470

Query  2081  PSP----GGTSLDRPKPEKVKGTGNSTDRHITTDALT--KKKMKRKPEPELGEGQYLPEK  2242
             P+P     G       P+K KG   S      + A+   KKKMKRK E +LGE    P K
Sbjct  471   PTPLSSDSGQQHVLKNPDKAKGGSMSVIPDDGSKAVVDMKKKMKRKSESDLGEIHVHPLK  530

Query  2243  LSSKQ  2257
             + S+ 
Sbjct  531   VPSQH  535



>ref|XP_010459876.1| PREDICTED: uncharacterized protein LOC104740856 isoform X2 [Camelina 
sativa]
Length=377

 Score =   290 bits (743),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 151/253 (60%), Positives = 194/253 (77%), Gaps = 9/253 (4%)
 Frame = +2

Query  1166  GKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNA-EVQDGDNSSQAIKRRLPP  1342
              ++S+Q  +RDGS+V+SKI++LEKAIR+LEK VAESRPP   E Q+ D SS A+KRRLP 
Sbjct  9     SRQSSQASKRDGSNVKSKISILEKAIRELEKVVAESRPPAINENQEADTSSLAVKRRLPR  68

Query  1343  EIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKD  1522
             ++K KLAKVAR A AS GK + ELINRLMSIVGHL+QLR+LKRNLKIMI+MG SA +EKD
Sbjct  69    DVKLKLAKVARIA-ASQGKYTAELINRLMSIVGHLIQLRSLKRNLKIMIDMGDSANREKD  127

Query  1523  NRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENR  1702
              R QQI  EV +MIK +V LM+++  + + GTSDDF      EK + K K+ MD ALE++
Sbjct  128   TRFQQINNEVLDMIKAKVSLMETQETKPEGGTSDDFHDPV--EKPSLK-KFVMDAALEDK  184

Query  1703  ICDLYDLYVEGL-EEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY---  1870
             +C LYD+++EGL EED GP +RKLYA LA  WPN  MDNHGIKRAICRAK+R+K L+   
Sbjct  185   LCHLYDIFIEGLDEEDQGPPIRKLYANLAELWPNRLMDNHGIKRAICRAKERQKALFGNL  244

Query  1871  NRHKNQEKMRRNK  1909
              +  +Q KM++++
Sbjct  245   GKEMDQTKMKKSR  257



>ref|XP_007048469.1| Wound-responsive family protein isoform 1 [Theobroma cacao]
 gb|EOX92626.1| Wound-responsive family protein isoform 1 [Theobroma cacao]
 gb|EOX92627.1| Wound-responsive family protein isoform 1 [Theobroma cacao]
Length=669

 Score =   299 bits (765),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 166/317 (52%), Positives = 219/317 (69%), Gaps = 13/317 (4%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVA  1372
             +D S++R K TMLE+AIR+LEK VAESR    +VQD D S+ AIKRRLP E+KQKLAKVA
Sbjct  299   KDVSNLRPKGTMLERAIRELEKVVAESRLATMDVQDVDASAAAIKRRLPREVKQKLAKVA  358

Query  1373  RYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREV  1552
             R AQ+S G++S+ELINRLM+I+GH VQLRTLKRNL+ M+ +GLSAK+EK +R +QIK EV
Sbjct  359   RLAQSSQGRISEELINRLMNILGHSVQLRTLKRNLREMVLLGLSAKREKADRFRQIKMEV  418

Query  1553  AEMIKDRVPLMKSKAIEQQPGTSDDFQSIA-TEEKEAFKRKYCMDNALENRICDLYDLYV  1729
              EMI       K +A +Q+   +DD+Q +  +EE+   K +Y MDNA+E++ICDLYDLYV
Sbjct  419   TEMI-------KLQASKQRDVATDDYQEVLNSEEQVVLKEQYSMDNAMEDKICDLYDLYV  471

Query  1730  EGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNK  1909
             +G++ED GPQ+RKLY EL+  WPNG MDNHGIK AI RAK+RR+ L +  K +EK RR K
Sbjct  472   QGMDEDKGPQIRKLYVELSELWPNGIMDNHGIKTAIRRAKERRRALCDNDKVREKDRRKK  531

Query  1910  ISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIPVP--  2083
               AQK E G R E ++  Q   +QEK   +   H      + IS T  ++     P+   
Sbjct  532   -PAQKLEVGVRGEASSISQLQAVQEKQTSEPSSHVLALPCRMISCTETMDEHLAAPLEIS  590

Query  2084  --SPGGTSLDRPKPEKV  2128
               S  G+S+D  K E++
Sbjct  591   SISLKGSSMDISKQEEI  607



>ref|XP_011022885.1| PREDICTED: uncharacterized protein LOC105124533 isoform X3 [Populus 
euphratica]
Length=698

 Score =   299 bits (765),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 151/242 (62%), Positives = 187/242 (77%), Gaps = 9/242 (4%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVA  1372
             +D SS++ K +MLE+AIRDLEK VAESRP N EVQD D SS AIKRRLP E+KQKLAKVA
Sbjct  343   KDVSSLQLKGSMLERAIRDLEKVVAESRPRNIEVQDTDASSTAIKRRLPSEVKQKLAKVA  402

Query  1373  RYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREV  1552
             + AQ+S GK+S+ELINRLMSI+GHL+QLRTLK+NL+ M+ MG +AKQEK +R Q I+REV
Sbjct  403   KLAQSSQGKISEELINRLMSILGHLIQLRTLKKNLREMVEMGPTAKQEKADRFQLIRREV  462

Query  1553  AEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIATEEKEAFKRKYCMDNALENRICDLYDLYV  1729
              EMI+     +++   E+  G   DFQ +I  EEK A   KY MDN +E++ICDLYDL+V
Sbjct  463   MEMIE-----LQASKREKAGG---DFQKAIIYEEKGAMDEKYVMDNKMEDKICDLYDLFV  514

Query  1730  EGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNK  1909
             +G++ED GP +RKLY ELA  WPNG MDNHGIK AICRAK+RR+T YN  K QEK R  +
Sbjct  515   QGMDEDKGPHIRKLYVELAEMWPNGAMDNHGIKNAICRAKERRRTFYNNEKVQEKARLEE  574

Query  1910  IS  1915
             +S
Sbjct  575   MS  576



>ref|NP_001045013.2| Os01g0883200 [Oryza sativa Japonica Group]
 dbj|BAD82574.1| wound-responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAF06927.2| Os01g0883200 [Oryza sativa Japonica Group]
Length=383

 Score =   289 bits (739),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 172/350 (49%), Positives = 227/350 (65%), Gaps = 33/350 (9%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD-NSSQAIKRRLPPEIKQKLAKV  1369
             RDGS  + K T LE+AIRDL+K  AE RPP  ++ + D N   A+KRRLPPE+KQKLAKV
Sbjct  24    RDGSGTKPKGTRLERAIRDLQKIAAEYRPPAIDINEVDPNGQVAVKRRLPPEVKQKLAKV  83

Query  1370  ARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKR  1546
             AR + A+HGK+ + EL++RLM IVGHLVQ RTL+RN+K M+  GLSAKQEK ++ Q++K 
Sbjct  84    ARLS-ANHGKIQEHELMDRLMGIVGHLVQRRTLRRNMKEMVESGLSAKQEKADKFQRVKM  142

Query  1547  EVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLY  1726
             E+ EMIK RV   K+K  E   G++DDFQ IA +EK   K K  MD ALE+RICDLYDLY
Sbjct  143   EINEMIKSRVA-AKAKVNEHHSGSADDFQ-IANDEKRYLKGKSVMDAALEDRICDLYDLY  200

Query  1727  VEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK--NQEKMR  1900
             VEG++ED GPQ RKLY ELA  WP G MDN GIK AI R+K+RR++LYN+ K  N+E+M+
Sbjct  201   VEGMDEDKGPQSRKLYVELAELWPEGSMDNVGIKDAINRSKERRRSLYNQQKVRNEERMK  260

Query  1901  RNKI-SAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRIP  2077
             R ++ +A K ++GY         PV +Q            +A  + ++     N V   P
Sbjct  261   RKRLAAAAKLQDGY---------PVVMQ------------SALIQQVAQPPITNPVATYP  299

Query  2078  VPSPGGTSLDRPKPEKVKGTGNSTDRHITTDALTKKKMKRKPEPELGEGQ  2227
             V   G  S DR +  ++  + N  D +  T  + KK  KRKPE +L + Q
Sbjct  300   VTDQGSKSFDRVR--EISASANPDDINRNTGEMKKK--KRKPESDLVDTQ  345



>ref|XP_008783317.1| PREDICTED: uncharacterized protein LOC103702606 isoform X1 [Phoenix 
dactylifera]
Length=613

 Score =   296 bits (757),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 183/378 (48%), Positives = 243/378 (64%), Gaps = 24/378 (6%)
 Frame = +2

Query  1178  TQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDG----DNSSQAIKRRLPPE  1345
             T T  ++GS+VR K T LE+AIRDLEK VAESRPP+  VQ+     D SSQ +KRRLP E
Sbjct  208   TFTRVKEGSTVRPKGTTLERAIRDLEKIVAESRPPSIYVQETVQEIDPSSQGVKRRLPQE  267

Query  1346  IKQKLAKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKD  1522
             +KQKLAKVAR + AS  K+S+ ELI+RLM I+GHLVQ +TLKRN+K M+ +GLSAKQ+K 
Sbjct  268   VKQKLAKVARLS-ASQAKVSEDELIDRLMGILGHLVQRKTLKRNMKEMVELGLSAKQQKA  326

Query  1523  NRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQS-IATEEKEAFKRKYCMDNALEN  1699
             +R QQ K+EV E+I+ RV  + S   E Q  ++DDFQ  I  +E+ A K KY MD ALE+
Sbjct  327   DRFQQTKKEVHELIRARVSNLNSHVAELQDISADDFQEVINNDERRALKGKYSMDTALED  386

Query  1700  RICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY--N  1873
             +ICDLYDLYVEG++ED GPQ RKLY ELA  WP+G+MDN GIK AI R+K+R++ LY  N
Sbjct  387   KICDLYDLYVEGMDEDKGPQSRKLYVELAELWPHGYMDNVGIKDAIYRSKERKRALYRQN  446

Query  1874  RHKNQEKMRRNKISAQKEEEGYRVETTT---RDQPVQIQEKSAVDARDHGSTATNKPISS  2044
             + +++E+++R K++A       RVE T      Q    QE+   D       + +K +S+
Sbjct  447   KVRDEERIKRKKLAA-----AVRVEETNPGPASQARAGQERPVTDPTGPFLVSPDKLVSN  501

Query  2045  TAAINMVGRIPVPSP----GGTSLDRPKPEKVKGTGNSTDRHITTDALT--KKKMKRKPE  2206
                 ++ GRI  P+P     G       P+K KG   S      + A+   KKKMKRK E
Sbjct  502   QLPASL-GRITDPTPLSSDSGQQHVLKNPDKAKGGSMSVIPDDGSKAVVDMKKKMKRKSE  560

Query  2207  PELGEGQYLPEKLSSKQA  2260
              +LGE    P K+ S+  
Sbjct  561   SDLGEIHVHPLKVPSQHT  578



>ref|XP_010459875.1| PREDICTED: uncharacterized protein LOC104740856 isoform X1 [Camelina 
sativa]
Length=378

 Score =   286 bits (731),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 151/254 (59%), Positives = 194/254 (76%), Gaps = 10/254 (4%)
 Frame = +2

Query  1166  GKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAES-RPPNA-EVQDGDNSSQAIKRRLP  1339
              ++S+Q  +RDGS+V+SKI++LEKAIR+LEK VAES RPP   E Q+ D SS A+KRRLP
Sbjct  9     SRQSSQASKRDGSNVKSKISILEKAIRELEKVVAESARPPAINENQEADTSSLAVKRRLP  68

Query  1340  PEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEK  1519
              ++K KLAKVAR A AS GK + ELINRLMSIVGHL+QLR+LKRNLKIMI+MG SA +EK
Sbjct  69    RDVKLKLAKVARIA-ASQGKYTAELINRLMSIVGHLIQLRSLKRNLKIMIDMGDSANREK  127

Query  1520  DNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALEN  1699
             D R QQI  EV +MIK +V LM+++  + + GTSDDF      EK + K K+ MD ALE+
Sbjct  128   DTRFQQINNEVLDMIKAKVSLMETQETKPEGGTSDDFHDPV--EKPSLK-KFVMDAALED  184

Query  1700  RICDLYDLYVEGL-EEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY--  1870
             ++C LYD+++EGL EED GP +RKLYA LA  WPN  MDNHGIKRAICRAK+R+K L+  
Sbjct  185   KLCHLYDIFIEGLDEEDQGPPIRKLYANLAELWPNRLMDNHGIKRAICRAKERQKALFGN  244

Query  1871  -NRHKNQEKMRRNK  1909
               +  +Q KM++++
Sbjct  245   LGKEMDQTKMKKSR  258



>ref|XP_011031131.1| PREDICTED: uncharacterized protein LOC105130359 isoform X7 [Populus 
euphratica]
Length=555

 Score =   291 bits (745),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/244 (60%), Positives = 187/244 (77%), Gaps = 8/244 (3%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVA  1372
             +D SS++ K +M+E+AIRDLEK VAESRP N + QD D SS +IKRRLP E+KQKLAKVA
Sbjct  214   KDVSSLQPKGSMVERAIRDLEKVVAESRPRNTDAQDADTSSMSIKRRLPFEVKQKLAKVA  273

Query  1373  RYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREV  1552
             R AQ+S GK+S+ELI+ LM+I+GHL+QL TLK+NL+ M+ MGL+AKQEK +R Q+IK+EV
Sbjct  274   RLAQSSQGKISEELISHLMTILGHLIQLSTLKKNLREMVEMGLTAKQEKADRFQKIKKEV  333

Query  1553  AEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIATEEKEAFKRKYCMDNALENRICDLYDLYV  1729
              EMI+ ++   + KA+        DFQ  I   EK A  RKY MD+ +E++ICDLYDL+V
Sbjct  334   MEMIELQLFKQRDKAVV-------DFQKGIIHGEKGAINRKYVMDDKMEDKICDLYDLFV  386

Query  1730  EGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNK  1909
             +G++ED GPQ+RKLYAE+A  WPNG MDNHGIK AICRAK+RR+  YN  K QEK R  K
Sbjct  387   QGMDEDKGPQIRKLYAEVAEMWPNGAMDNHGIKIAICRAKERRRIFYNNEKVQEKARIEK  446

Query  1910  ISAQ  1921
             +S Q
Sbjct  447   LSRQ  450



>ref|NP_001055588.2| Os05g0422600 [Oryza sativa Japonica Group]
 dbj|BAF17502.2| Os05g0422600 [Oryza sativa Japonica Group]
Length=694

 Score =   293 bits (751),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 215/512 (42%), Positives = 287/512 (56%), Gaps = 52/512 (10%)
 Frame = +2

Query  266   FTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDSPGP  445
             F+VELRPGETTIVSW+K+LKEA                A+           P     PGP
Sbjct  59    FSVELRPGETTIVSWRKMLKEA-------------DLGAALPPPPPAAAAQPAVAPLPGP  105

Query  446   GFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedSFID  625
                   P E    D    NR N+VIEKIERLY+GK S D+EDLDD PD+D+YDTEDSFID
Sbjct  106   S-GATHPTEN---DCAQSNRFNSVIEKIERLYMGKNSSDEEDLDDAPDDDQYDTEDSFID  161

Query  626   DTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSDDGCN  805
             D ELD+YF+VDN A KH+G+FVN+GKLE+I+  S Q   P KRR+KD +     ++   +
Sbjct  162   DDELDEYFEVDNFATKHNGYFVNKGKLEQIDFDSVQTVEPKKRRRKDSSSSYIENNKEFS  221

Query  806   PNKPAKVGK--KAGKSVPLAAGTSSPSYGVVMPTLYRENANVHNQEVNFDMQK-AEVLHS  976
             P   + +G   +  K   L  G S+              +N H    N   +        
Sbjct  222   PGSSSYMGTPLRDSKRSTLQTGKST--------------SNGHKSGANGTFEYPYSAYRD  267

Query  977   KNVVDKLKESSETSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDAS  1156
             K+    L    + ++  +N+ +S         +A   +GL  S      S IY       
Sbjct  268   KDAPGHLGLQQKITSNGANQDLSKNMHHKEKYNAGQFSGLHAS------SNIY-------  314

Query  1157  APEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQ-AIKRR  1333
             + E       +  +GS  ++K T LE+AIRDL+  V E +P   +V + + + Q A+KRR
Sbjct  315   STETMHLATKIHTEGSGTKTKGTRLERAIRDLQNIVTEYKPQILDVHEAEANCQVAVKRR  374

Query  1334  LPPEIKQKLAKVARYAQASHGKL-SKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             LP E+KQKLAKVAR + A+ GK+   ELINRLM IVGHLV  RTLKRN+K M+  GL AK
Sbjct  375   LPQEVKQKLAKVARLS-ANQGKIPEHELINRLMGIVGHLVHRRTLKRNMKEMVQSGLCAK  433

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQS-IATEEKEAFKRKYCMDN  1687
             QEK  ++QQ+K E+ EM+K R+   K K  E +  + D FQ  +  +++ A + K  MD 
Sbjct  434   QEKAGKLQQVKMEIYEMVKARLA-TKPKGAEHKVESIDGFQDPVTHDDRMALRGKSVMDA  492

Query  1688  ALENRICDLYDLYVEGLEEDAGPQVRKLYAEL  1783
              LE+RICDLYDLYVEG++ED GPQ RKLY E+
Sbjct  493   VLEDRICDLYDLYVEGMDEDKGPQSRKLYLEV  524



>ref|XP_011022888.1| PREDICTED: uncharacterized protein LOC105124533 isoform X4 [Populus 
euphratica]
Length=577

 Score =   290 bits (741),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/252 (60%), Positives = 187/252 (74%), Gaps = 19/252 (8%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVA  1372
             +D SS++ K +MLE+AIRDLEK VAESRP N EVQD D SS AIKRRLP E+KQKLAKVA
Sbjct  212   KDVSSLQLKGSMLERAIRDLEKVVAESRPRNIEVQDTDASSTAIKRRLPSEVKQKLAKVA  271

Query  1373  RYA----------QASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKD  1522
             + A          Q+S GK+S+ELINRLMSI+GHL+QLRTLK+NL+ M+ MG +AKQEK 
Sbjct  272   KLAVQKSFSCFSYQSSQGKISEELINRLMSILGHLIQLRTLKKNLREMVEMGPTAKQEKA  331

Query  1523  NRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIATEEKEAFKRKYCMDNALEN  1699
             +R Q I+REV EMI+     +++   E+  G   DFQ +I  EEK A   KY MDN +E+
Sbjct  332   DRFQLIRREVMEMIE-----LQASKREKAGG---DFQKAIIYEEKGAMDEKYVMDNKMED  383

Query  1700  RICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRH  1879
             +ICDLYDL+V+G++ED GP +RKLY ELA  WPNG MDNHGIK AICRAK+RR+T YN  
Sbjct  384   KICDLYDLFVQGMDEDKGPHIRKLYVELAEMWPNGAMDNHGIKNAICRAKERRRTFYNNE  443

Query  1880  KNQEKMRRNKIS  1915
             K QEK R  ++S
Sbjct  444   KVQEKARLEEMS  455



>ref|XP_011022883.1| PREDICTED: uncharacterized protein LOC105124533 isoform X1 [Populus 
euphratica]
Length=708

 Score =   290 bits (743),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 151/252 (60%), Positives = 187/252 (74%), Gaps = 19/252 (8%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVA  1372
             +D SS++ K +MLE+AIRDLEK VAESRP N EVQD D SS AIKRRLP E+KQKLAKVA
Sbjct  343   KDVSSLQLKGSMLERAIRDLEKVVAESRPRNIEVQDTDASSTAIKRRLPSEVKQKLAKVA  402

Query  1373  RYA----------QASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKD  1522
             + A          Q+S GK+S+ELINRLMSI+GHL+QLRTLK+NL+ M+ MG +AKQEK 
Sbjct  403   KLAVQKSFSCFSYQSSQGKISEELINRLMSILGHLIQLRTLKKNLREMVEMGPTAKQEKA  462

Query  1523  NRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIATEEKEAFKRKYCMDNALEN  1699
             +R Q I+REV EMI+     +++   E+  G   DFQ +I  EEK A   KY MDN +E+
Sbjct  463   DRFQLIRREVMEMIE-----LQASKREKAGG---DFQKAIIYEEKGAMDEKYVMDNKMED  514

Query  1700  RICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRH  1879
             +ICDLYDL+V+G++ED GP +RKLY ELA  WPNG MDNHGIK AICRAK+RR+T YN  
Sbjct  515   KICDLYDLFVQGMDEDKGPHIRKLYVELAEMWPNGAMDNHGIKNAICRAKERRRTFYNNE  574

Query  1880  KNQEKMRRNKIS  1915
             K QEK R  ++S
Sbjct  575   KVQEKARLEEMS  586



>ref|XP_011022884.1| PREDICTED: uncharacterized protein LOC105124533 isoform X2 [Populus 
euphratica]
Length=707

 Score =   289 bits (739),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 187/251 (75%), Gaps = 18/251 (7%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVA  1372
             +D SS++ K +MLE+AIRDLEK VAESRP N EVQD D SS AIKRRLP E+KQKLAKVA
Sbjct  343   KDVSSLQLKGSMLERAIRDLEKVVAESRPRNIEVQDTDASSTAIKRRLPSEVKQKLAKVA  402

Query  1373  R---------YAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDN  1525
             +         ++ +S GK+S+ELINRLMSI+GHL+QLRTLK+NL+ M+ MG +AKQEK +
Sbjct  403   KLAVQKSFSCFSYSSQGKISEELINRLMSILGHLIQLRTLKKNLREMVEMGPTAKQEKAD  462

Query  1526  RVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIATEEKEAFKRKYCMDNALENR  1702
             R Q I+REV EMI+     +++   E+  G   DFQ +I  EEK A   KY MDN +E++
Sbjct  463   RFQLIRREVMEMIE-----LQASKREKAGG---DFQKAIIYEEKGAMDEKYVMDNKMEDK  514

Query  1703  ICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK  1882
             ICDLYDL+V+G++ED GP +RKLY ELA  WPNG MDNHGIK AICRAK+RR+T YN  K
Sbjct  515   ICDLYDLFVQGMDEDKGPHIRKLYVELAEMWPNGAMDNHGIKNAICRAKERRRTFYNNEK  574

Query  1883  NQEKMRRNKIS  1915
              QEK R  ++S
Sbjct  575   VQEKARLEEMS  585



>gb|KHG06858.1| (-)-trans-carveol dehydrogenase [Gossypium arboreum]
Length=649

 Score =   285 bits (730),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 181/421 (43%), Positives = 241/421 (57%), Gaps = 42/421 (10%)
 Frame = +2

Query  635   LDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNK  814
             LD+  + D S  K +G  V   KLE    T      P+++R K+  + Q G  DG   ++
Sbjct  70    LDECCRDDKSTSKQNGLLVKFDKLECTNETVLSVAQPSRKRSKNMAEAQ-GEKDG--DHE  126

Query  815   PAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRENANVHNQEVNFDMQKAEVLHSKNVVDK  994
             P    + + K V +     SPS    +    R   + +N E N D               
Sbjct  127   P----RVSNKDVSI-----SPSNSEDVDKYRRVTVHSNNLENNTD---------------  162

Query  995   LKESSETSNQRSNERISVPQEKSSGRSANISN---GLDQSFQQGEKSV--IYDQRLDASA  1159
                 S  +NQ+  E+    + +S  R   I N   G+    +Q E++   + D  L    
Sbjct  163   ----SLATNQKYVEKKPCKKLESPVRKLMIENDVEGISTKVEQREETCGELPDLNLPVYP  218

Query  1160  PEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLP  1339
              + ++S     +D S++R+K  MLE+A+R+LEK VAESR    EVQD D SS  IKRRLP
Sbjct  219   VQSEKSLSLQSKDVSNLRTKGIMLERAMRELEKVVAESRLSTMEVQDIDASSTTIKRRLP  278

Query  1340  PEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEK  1519
              E+KQKLAKVAR A +S GK+SKELIN+LM+I+GH VQLRTLKRNLK MI MG+SAKQEK
Sbjct  279   CEVKQKLAKVARLAHSSQGKISKELINKLMNILGHSVQLRTLKRNLKEMILMGISAKQEK  338

Query  1520  DNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALEN  1699
               R +QIK EV EMIK +  ++          T D  + +  EEK A K++Y MDN +E+
Sbjct  339   AYRFEQIKLEVIEMIKSQASMLGDVP------TGDIQEVLGYEEKVALKKQYSMDNVIED  392

Query  1700  RICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRH  1879
             +ICDLYDLY +G++ED G Q+RKLY ELA  WPNG MD HGIK AICRAK+RR+ L    
Sbjct  393   KICDLYDLYTQGIDEDKGTQIRKLYVELAELWPNGIMDKHGIKSAICRAKERRRALCEHD  452

Query  1880  K  1882
             K
Sbjct  453   K  453


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 3/45 (7%)
 Frame = +2

Query  203  GGEPG--VGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEA  331
            GGE    V   STS+  A  RQRFT+ELRPGETTIVSWK+L+K+A
Sbjct  11   GGEISTRVSAGSTSWLFAS-RQRFTIELRPGETTIVSWKRLIKDA  54



>ref|XP_006655339.1| PREDICTED: uncharacterized protein LOC102722582 [Oryza brachyantha]
Length=536

 Score =   281 bits (719),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 184/440 (42%), Positives = 249/440 (57%), Gaps = 46/440 (10%)
 Frame = +2

Query  614   SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSD  793
             SFIDD ELD+YF+VDN A KH+G+FVN+GKLE+IE    Q   P KRR+KD       S 
Sbjct  25    SFIDDDELDEYFEVDNLAAKHNGYFVNKGKLEQIEFDPVQTAEPKKRRRKD------SSS  78

Query  794   DGCNPNKPAKVGKKAGKSVPLAAGTSSPSYGVVMPTLYRE----NANVHNQEVNFD----  949
                  NK   +G  +   +PL              TL  E    NA    Q+ NF     
Sbjct  79    SYIENNKEFALGSSSYIDMPLK--------DFKRRTLQTEKNNSNALERVQKKNFSDPTT  130

Query  950   ------MQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANISNGLDQSFQ  1111
                     K      K+    L    E ++  +N+ +S     +   +A+  +GL+ +  
Sbjct  131   GAEYAAHLKMTAYRDKDAPGHLGVQQEKASNEANQDLSKNTHHNEKHNASEISGLNIA--  188

Query  1112  QGEKSVIYDQRLDASAPEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAE  1291
                 S IY       A +G       R +GS  ++K T LE+AIRDL+  V E +P   +
Sbjct  189   ----SSIYSTETMHLATKG-------RIEGSGTKTKGTRLERAIRDLQNIVTEYKPQILD  237

Query  1292  VQDGDNSSQ-AIKRRLPPEIKQKLAKVARYAQASHGKLS-KELINRLMSIVGHLVQLRTL  1465
             V + + + Q A+KRRLP E+KQKLAKVAR + A+ GK+S +E+INRLM IVGHLV  RTL
Sbjct  238   VHEAEANCQVAVKRRLPQEVKQKLAKVARLS-ANQGKISEREMINRLMGIVGHLVHRRTL  296

Query  1466  KRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIA  1642
             KRN+K M+  GLSAKQEK  ++QQ+K E+ EMIK R+   K K  E +  +++ FQ ++ 
Sbjct  297   KRNMKEMVQSGLSAKQEKAGKLQQVKTEIYEMIKTRLA-TKPKGAEHKDESTNGFQDAVT  355

Query  1643  TEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHG  1822
              +++ A + K  MD  LE+RICDLYDLYVE ++ED GPQ RKLY ELA  WP G MD  G
Sbjct  356   NDDRRALRGKSIMDTVLEDRICDLYDLYVEDMDEDKGPQSRKLYVELADMWPQGHMDKIG  415

Query  1823  IKRAICRAKDRRKTLYNRHK  1882
             I+ AI R++ RR  LY + K
Sbjct  416   IRDAISRSQKRRNLLYRQRK  435



>ref|XP_007048471.1| Wound-responsive family protein isoform 3 [Theobroma cacao]
 gb|EOX92628.1| Wound-responsive family protein isoform 3 [Theobroma cacao]
Length=542

 Score =   277 bits (709),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/237 (61%), Positives = 182/237 (77%), Gaps = 10/237 (4%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVA  1372
             +D S++R K TMLE+AIR+LEK VAESR    +VQD D S+ AIKRRLP E+KQKLAKVA
Sbjct  299   KDVSNLRPKGTMLERAIRELEKVVAESRLATMDVQDVDASAAAIKRRLPREVKQKLAKVA  358

Query  1373  RYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREV  1552
             R AQ+S G++S+ELINRLM+I+GH VQLRTLKRNL+ M+ +GLSAK+EK +R +QIK EV
Sbjct  359   RLAQSSQGRISEELINRLMNILGHSVQLRTLKRNLREMVLLGLSAKREKADRFRQIKMEV  418

Query  1553  AEMIKDRVPLMKSKAIEQQPGTSDDFQSIA-TEEKEAFKRKYCMDNALENRICDLYDLYV  1729
              EMIK    L  SK   Q+   +DD+Q +  +EE+   K +Y MDNA+E++ICDLYDLYV
Sbjct  419   TEMIK----LQASK---QRDVATDDYQEVLNSEEQVVLKEQYSMDNAMEDKICDLYDLYV  471

Query  1730  EGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK--NQEK  1894
             +G++ED GPQ+RKLY EL+  WPNG MDNHGIK AI RAK+RR+ L +  K   QEK
Sbjct  472   QGMDEDKGPQIRKLYVELSELWPNGIMDNHGIKTAIRRAKERRRALCDNDKREGQEK  528



>ref|XP_007048470.1| Wound-responsive family protein isoform 1 [Theobroma cacao]
Length=561

 Score =   277 bits (709),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 180/232 (78%), Gaps = 8/232 (3%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVA  1372
             +D S++R K TMLE+AIR+LEK VAESR    +VQD D S+ AIKRRLP E+KQKLAKVA
Sbjct  299   KDVSNLRPKGTMLERAIRELEKVVAESRLATMDVQDVDASAAAIKRRLPREVKQKLAKVA  358

Query  1373  RYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREV  1552
             R AQ+S G++S+ELINRLM+I+GH VQLRTLKRNL+ M+ +GLSAK+EK +R +QIK EV
Sbjct  359   RLAQSSQGRISEELINRLMNILGHSVQLRTLKRNLREMVLLGLSAKREKADRFRQIKMEV  418

Query  1553  AEMIKDRVPLMKSKAIEQQPGTSDDFQSIA-TEEKEAFKRKYCMDNALENRICDLYDLYV  1729
              EMIK    L  SK   Q+   +DD+Q +  +EE+   K +Y MDNA+E++ICDLYDLYV
Sbjct  419   TEMIK----LQASK---QRDVATDDYQEVLNSEEQVVLKEQYSMDNAMEDKICDLYDLYV  471

Query  1730  EGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKN  1885
             +G++ED GPQ+RKLY EL+  WPNG MDNHGIK AI RAK+RR+ L +  K+
Sbjct  472   QGMDEDKGPQIRKLYVELSELWPNGIMDNHGIKTAIRRAKERRRALCDNDKH  523



>ref|XP_009420998.1| PREDICTED: uncharacterized protein LOC104000627 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=708

 Score =   276 bits (707),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 138/242 (57%), Positives = 187/242 (77%), Gaps = 4/242 (2%)
 Frame = +2

Query  1202  SSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYA  1381
             SSVR K T LE+AI DLEK VAE RPP+ +VQ+ D + Q  KRRLP E+KQKLAKVAR +
Sbjct  401   SSVRPKGTTLERAICDLEKIVAECRPPSLDVQEVDLAFQGTKRRLPKEVKQKLAKVARLS  460

Query  1382  QASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAE  1558
              AS GK+S+ EL++RLM I+GHLVQ RTLKRN+++M+ +GLSAKQ+K +R  Q+K    E
Sbjct  461   -ASQGKISEDELVDRLMGILGHLVQRRTLKRNMRVMVELGLSAKQQKADRFHQVKGAATE  519

Query  1559  MIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGL  1738
             MI+ RV  +KSK  E Q G++D+FQ I  +EK   K +Y MD+ALE++ICDLYDLYVEG+
Sbjct  520   MIRARVSQLKSKLPELQDGSADNFQKINNDEKRVLKGRYSMDSALEDKICDLYDLYVEGM  579

Query  1739  EEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK--NQEKMRRNKI  1912
             +ED GPQ RKLY ELA  WP+G+MD+ GIK AI R+K+R++ +Y+ +K  N+E+++R K+
Sbjct  580   DEDKGPQSRKLYVELAELWPSGYMDDVGIKDAIQRSKERKRAIYSHNKVHNEERIKRRKL  639

Query  1913  SA  1918
             ++
Sbjct  640   AS  641


 Score =   140 bits (352),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 139/226 (62%), Gaps = 29/226 (13%)
 Frame = +2

Query  245  AAGG-RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILP  421
            A GG R RF+V+L+PGETTIVSWK+LLKE++          G        A+   PL+  
Sbjct  37   AGGGQRVRFSVDLKPGETTIVSWKRLLKESS---------KGSGGGFPPNASAADPLL--  85

Query  422  PHNDSPGPGFSPEQPVEKEAKDA-PPGNRLNAVIEKIERLYVGKQSdddedlddvpdede  598
               DS      P  P   E +DA PP NR +AVIEKIERLYVGKQS  DE+LDD+P +D+
Sbjct  86   ---DSLAQAGGP--PAANELEDAVPPTNRFSAVIEKIERLYVGKQS-SDEELDDIPCDDQ  139

Query  599  ydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKC  778
            YDTEDSFIDDTELD+YFQVD  + KH+G+FVN+GKLE+IEP++   + P+KRR+ D TK 
Sbjct  140  YDTEDSFIDDTELDEYFQVDKMSTKHNGYFVNKGKLEQIEPSTSLKEAPSKRRRNDSTKL  199

Query  779  QSGSDDGCNPNKPAKVG----KKAGKSVPLAAGTSSP-----SYGV  889
              G  +   P+ P  V     K A ++ P       P     +YGV
Sbjct  200  H-GDGNVLVPSGPVNVDNMHIKDAARNAPEVGRKPKPGKIYATYGV  244



>ref|XP_004970812.1| PREDICTED: uncharacterized protein LOC101765842 [Setaria italica]
Length=655

 Score =   271 bits (694),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 148/249 (59%), Positives = 186/249 (75%), Gaps = 11/249 (4%)
 Frame = +2

Query  1175  STQTVR----RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD-NSSQAIKRRLP  1339
             STQTV     R+GS  + K T LE+AIRDL+K VAE RPP  ++ + D N   A+KRRLP
Sbjct  274   STQTVNPIVGREGSGTKPKGTRLERAIRDLQKIVAEYRPPTIDINEVDPNGHAAVKRRLP  333

Query  1340  PEIKQKLAKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQE  1516
              E+KQKLAKVAR + A+ GK+ + EL++RLM IVGHLVQ RTLKRN+K M+  GLSAK E
Sbjct  334   QEVKQKLAKVARLS-ANQGKIQEHELMDRLMGIVGHLVQRRTLKRNMKEMVESGLSAKLE  392

Query  1517  KDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALE  1696
             K +R Q+IK E+ EMIK RV   KSK  EQQ G++DDFQ +A +E+ A K K  MD+ALE
Sbjct  393   KADRFQRIKMEINEMIKARV-AAKSKVNEQQDGSADDFQ-VANDERRAIKGKSVMDSALE  450

Query  1697  NRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNR  1876
             +RICDLYDLYVEG++ED GPQ RKLY ELA  WP G+MDN GIK AI R+K+R++ L+N+
Sbjct  451   DRICDLYDLYVEGMDEDKGPQSRKLYVELAELWPQGYMDNVGIKDAISRSKERKRLLHNQ  510

Query  1877  HK--NQEKM  1897
              K  N+E+M
Sbjct  511   QKVRNEERM  519


 Score = 78.2 bits (191),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  614  SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQT  772
            SFIDD ELD+YF+VDN   KHDG+FVN+GKLE+I+P +  N  P KRR+KD +
Sbjct  25   SFIDDAELDEYFEVDNLKTKHDGYFVNKGKLEQIDPGTSTNIAPKKRRRKDSS  77



>ref|XP_002456749.1| hypothetical protein SORBIDRAFT_03g041880 [Sorghum bicolor]
 gb|EES01869.1| hypothetical protein SORBIDRAFT_03g041880 [Sorghum bicolor]
Length=776

 Score =   273 bits (699),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 146/266 (55%), Positives = 198/266 (74%), Gaps = 12/266 (5%)
 Frame = +2

Query  1175  STQT----VRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD-NSSQAIKRRLP  1339
             STQT    V R+GS  + K T LE+AIRDL+K VAE RPP  ++ + D N   A+KRRLP
Sbjct  391   STQTMHPVVGREGSGTKPKGTRLERAIRDLQKIVAEYRPPTIDINEVDPNGQAAVKRRLP  450

Query  1340  PEIKQKLAKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQE  1516
             PE+KQKLAKVAR + A+ GK+ + EL+NRLM IVGHLVQ RTLKRN+K M+  G+SAK E
Sbjct  451   PEVKQKLAKVARLS-ANQGKIQEHELMNRLMGIVGHLVQRRTLKRNMKEMVESGISAKLE  509

Query  1517  KDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALE  1696
             K +R Q++K E+ +MIK R+   KSK  EQQ G++DDFQ+   +++ A K KY MD ALE
Sbjct  510   KADRFQRVKLEINDMIKARM-AAKSKVNEQQDGSADDFQAT-NDDRRALKTKYAMDTALE  567

Query  1697  NRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNR  1876
             +++CDLYD+YVEG++ED GPQ RKLY ELA  WP G+MDN GIK AI R+K+R++ LY++
Sbjct  568   DKMCDLYDMYVEGMDEDKGPQSRKLYVELAELWPQGYMDNVGIKDAISRSKERKRLLYSQ  627

Query  1877  HK--NQEKMRRNKI-SAQKEEEGYRV  1945
              K  ++E+M+R ++ +A K ++G+ V
Sbjct  628   QKVRSEERMKRKRMAAAAKLQDGFPV  653


 Score =   141 bits (355),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 116/182 (64%), Gaps = 30/182 (16%)
 Frame = +2

Query  245  AAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPP  424
            AA  RQ FTV+LRPGETTIVSWKKLLKE TG                      Q  + P 
Sbjct  59   AACRRQLFTVDLRPGETTIVSWKKLLKE-TG----------------------QTAVAPS  95

Query  425  HNDSP------GPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvp  586
                P      GP  +   P E + KD    NR NAVIEKIERLY+GK S D+EDL+DVP
Sbjct  96   VKTEPAFAAHAGPSGA-AHPAENDPKDPTQPNRFNAVIEKIERLYMGKHSSDEEDLNDVP  154

Query  587  dedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKD  766
            D+D+YDTEDSFIDD ELD+YF+VDN   KHDG+FVN+GKLE+IEP +  N  P KRR+KD
Sbjct  155  DDDQYDTEDSFIDDAELDEYFEVDNLKTKHDGYFVNKGKLEQIEPGTSANVAPKKRRRKD  214

Query  767  QT  772
             +
Sbjct  215  AS  216



>gb|EEE63774.1| hypothetical protein OsJ_18595 [Oryza sativa Japonica Group]
Length=665

 Score =   270 bits (690),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 190/450 (42%), Positives = 260/450 (58%), Gaps = 35/450 (8%)
 Frame = +2

Query  452   SPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedSFIDDT  631
             +P +       D    NR N+VIEKIERLY+GK S D+EDLDD PD+D+YDTEDSFIDD 
Sbjct  108   APRRKTHPTENDCAQSNRFNSVIEKIERLYMGKNSSDEEDLDDAPDDDQYDTEDSFIDDD  167

Query  632   ELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPN  811
             ELD+YF+VDN A KH+G+FVN+GKLE+I+  S Q   P KRR+KD +     ++   +P 
Sbjct  168   ELDEYFEVDNFATKHNGYFVNKGKLEQIDFDSVQTVEPKKRRRKDSSSSYIENNKEFSPG  227

Query  812   KPAKVGK--KAGKSVPLAAGTSSPSYGVVMPTLYRENANVHNQEVNFDMQK-AEVLHSKN  982
               + +G   +  K   L  G S+              +N H    N   +        K+
Sbjct  228   SSSYMGTPLRDSKRSTLQTGKST--------------SNGHKSGANGTFEYPYSAYRDKD  273

Query  983   VVDKLKESSETSNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAP  1162
                 L    + ++  +N+ +S         +A   +GL  S      S IY       + 
Sbjct  274   APGHLGLQQKITSNGANQDLSKNMHHKEKYNAGQFSGLHAS------SNIY-------ST  320

Query  1163  EGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQ-AIKRRLP  1339
             E       +  +GS  ++K T LE+AIRDL+  V E +P   +V + + + Q A+KRRLP
Sbjct  321   ETMHLATKIHTEGSGTKTKGTRLERAIRDLQNIVTEYKPQILDVHEAEANCQVAVKRRLP  380

Query  1340  PEIKQKLAKVARYAQASHGKL-SKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQE  1516
              E+KQKLAKVAR + A+ GK+   ELINRLM IVGHLV  RTLKRN+K M+  GL AKQE
Sbjct  381   QEVKQKLAKVARLS-ANQGKIPEHELINRLMGIVGHLVHRRTLKRNMKEMVQSGLCAKQE  439

Query  1517  KDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQS-IATEEKEAFKRKYCMDNAL  1693
             K  ++QQ+K E+ EM+K R+   K K  E +  + D FQ  +  +++ A + K  MD  L
Sbjct  440   KAGKLQQVKMEIYEMVKARLA-TKPKGAEHKVESIDGFQDPVTHDDRMALRGKSVMDAVL  498

Query  1694  ENRICDLYDLYVEGLEEDAGPQVRKLYAEL  1783
             E+RICDLYDLYVEG++ED GPQ RKLY E+
Sbjct  499   EDRICDLYDLYVEGMDEDKGPQSRKLYLEV  528



>gb|EEC79254.1| hypothetical protein OsI_20017 [Oryza sativa Indica Group]
Length=564

 Score =   267 bits (682),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 188/439 (43%), Positives = 255/439 (58%), Gaps = 35/439 (8%)
 Frame = +2

Query  485   DAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNS  664
             D    NR N+VIEKIERLY+GK S D+EDLDD PD+D+YDTEDSFIDD ELD+YF+VDN 
Sbjct  19    DCAQSNRFNSVIEKIERLYMGKNSSDEEDLDDAPDDDQYDTEDSFIDDDELDEYFEVDNF  78

Query  665   AIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGK--KA  838
             A KH+G+FVN+GKLE+I+  S Q   P K+R+KD +     ++    P   + +G   + 
Sbjct  79    ATKHNGYFVNKGKLEQIDFDSVQTVEPKKQRRKDSSSSYIENNKEFAPGSSSYMGTPLRD  138

Query  839   GKSVPLAAGTSSPSYGVVMPTLYRENANVHNQEVNFDMQK-AEVLHSKNVVDKLKESSET  1015
              K   L  G S+               N H    N   +        K+    L    + 
Sbjct  139   SKRSTLQTGKST--------------INGHKSGANGTFEYPYSAYRDKDAPGHLGLQQKI  184

Query  1016  SNQRSNERISVPQEKSSGRSANISNGLDQSFQQGEKSVIYDQRLDASAPEGKRSTQTVRR  1195
             ++  +N+ +S         +A   +GL  S      S IY       + E       +  
Sbjct  185   TSNGANQDLSKNMHHKEKYNAGQFSGLHAS------SNIY-------STETMHLATKIHT  231

Query  1196  DGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQ-AIKRRLPPEIKQKLAKVA  1372
             +GS  ++K T LE+AIRDL+  V E +P   +V + + + Q A+KRRLP E+KQKLAKVA
Sbjct  232   EGSGTKTKGTRLERAIRDLQNIVTEYKPQILDVHEAEANCQVAVKRRLPQEVKQKLAKVA  291

Query  1373  RYAQASHGKL-SKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKRE  1549
             R + A+ GK+   ELINRLM IVGHLV  RTLKRN+K M+  GL AKQEK  ++QQ+K E
Sbjct  292   RLS-ANQGKIPEHELINRLMGIVGHLVHRRTLKRNMKEMVQSGLCAKQEKAGKLQQVKME  350

Query  1550  VAEMIKDRVPLMKSKAIEQQPGTSDDFQS-IATEEKEAFKRKYCMDNALENRICDLYDLY  1726
             + EM+K R+   K K  E +  + D FQ  +  +++ A + K  MD  LE+RICDLYDLY
Sbjct  351   IYEMVKARLA-TKPKGAEHKVESIDGFQDPVTHDDRMALRGKSVMDAVLEDRICDLYDLY  409

Query  1727  VEGLEEDAGPQVRKLYAEL  1783
             VEG++ED GPQ RKLY E+
Sbjct  410   VEGMDEDKGPQSRKLYLEV  428



>ref|XP_008674734.1| PREDICTED: uncharacterized protein LOC103650918 [Zea mays]
Length=771

 Score =   271 bits (693),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 195/256 (76%), Gaps = 14/256 (5%)
 Frame = +2

Query  1175  STQT----VRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQ-AIKRRLP  1339
             STQT    V R+GS  + K T LE+AIRDL+K VAE RPP  ++ + D + Q A+KRRLP
Sbjct  388   STQTMHPVVGREGSGTKPKGTRLERAIRDLQKIVAEYRPPTIDINEVDPNGQVAVKRRLP  447

Query  1340  PEIKQKLAKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQE  1516
             PEIKQKLAKVA+   A++GK+ + EL+NRLM IVGHLVQ RTLKRN+K M+  G+SAK E
Sbjct  448   PEIKQKLAKVAK---ANNGKIQEHELMNRLMGIVGHLVQRRTLKRNMKEMVESGISAKLE  504

Query  1517  KDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALE  1696
             K +R Q++K E+ EMIK+R+   KSK + +Q G++DDFQ +A +E+ A K KY MD ALE
Sbjct  505   KADRFQRVKLEINEMIKERM-ATKSK-VNEQDGSADDFQ-VANDERRALKTKYTMDTALE  561

Query  1697  NRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNR  1876
             +++CDLYD+YVEG++ED GPQ RKLY ELA  WP+G MDN GIK AI R+K+RR+ LY++
Sbjct  562   DKMCDLYDMYVEGMDEDKGPQSRKLYVELAELWPHGCMDNVGIKDAIYRSKERRRLLYSQ  621

Query  1877  HK--NQEKMRRNKISA  1918
              K  ++E+M+R +++A
Sbjct  622   QKVRSEERMKRKRLAA  637


 Score =   145 bits (366),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 113/172 (66%), Gaps = 18/172 (10%)
 Frame = +2

Query  257  RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDS  436
            RQ FTVELRPGETTIVSWKKLLKEA                     A   P+ + P   +
Sbjct  61   RQLFTVELRPGETTIVSWKKLLKEA------------------GHTAAAPPVAVEPAFAA  102

Query  437  PGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedS  616
                  P  P E + KD    NR NAVIEKIERLY+GK S D+EDL+DVPD+D+YDTEDS
Sbjct  103  HAGPSGPAHPAENDPKDPTQPNRFNAVIEKIERLYMGKHSSDEEDLNDVPDDDQYDTEDS  162

Query  617  FIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQT  772
            FIDD ELD+YF+VDN   KHDG+FVN+GKLE+IEP +  N  P KRR+KD +
Sbjct  163  FIDDAELDEYFEVDNLKTKHDGYFVNKGKLEQIEPGTAANVAPKKRRRKDAS  214



>ref|XP_003567336.1| PREDICTED: ubinuclein-1-like isoform X2 [Brachypodium distachyon]
Length=775

 Score =   269 bits (687),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 169/351 (48%), Positives = 228/351 (65%), Gaps = 33/351 (9%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAE-SRPPNAEVQDGDNSSQA-IKRRLPPEIKQKLAK  1366
             R  +  + K T LE+AIRDL+K VAE    P  +V + D + QA +KRRLP E+KQKLAK
Sbjct  408   RGSAGTKPKGTRLERAIRDLQKIVAEIEYRPAIDVNEADPNGQASVKRRLPQEVKQKLAK  467

Query  1367  VARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIK  1543
             VAR + A+HGK+ + EL++RLM IVGHLVQ RTLKRN+K M+ +GLSAKQEK +R Q++K
Sbjct  468   VARLS-ANHGKVQEHELMDRLMGIVGHLVQRRTLKRNMKEMVELGLSAKQEKADRFQRVK  526

Query  1544  REVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDL  1723
              E+ EM++ RV   K+KA EQQ G++DDFQ I  +E+ A K K+ MD ALE+RICDLYDL
Sbjct  527   MEINEMVQTRVA-AKAKANEQQDGSADDFQ-IMNDEQRASKGKFVMDTALEDRICDLYDL  584

Query  1724  YVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK--NQEKM  1897
             YVEG++ED GPQ RKLY ELA  WP G MDN GIK AI R+K+R++ LYN+ K  ++E++
Sbjct  585   YVEGMDEDKGPQSRKLYVELAELWPQGCMDNVGIKDAITRSKERKRALYNQQKVRDEERL  644

Query  1898  RRNKIS-AQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGRI  2074
             +R +++ A K  +GY         PV +Q  SAV A+  G  +   P+SS    +     
Sbjct  645   KRKRLAEAAKLPDGY---------PVAMQ--SAV-AQQAGQPSIINPVSSYRVTDY----  688

Query  2075  PVPSPGGTSLDRPKPEKVKGTGNSTDRHITTDALTKKKMKRKPEPELGEGQ  2227
                   G +      E+V+ T  S   + T   + KK  KRKPE +L + Q
Sbjct  689   ------GQNQASKCLERVRDTSTSDGNNKTAGEVKKK--KRKPESDLLDAQ  731


 Score =   125 bits (315),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 114/182 (63%), Gaps = 14/182 (8%)
 Frame = +2

Query  257  RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDS  436
            RQ F+VEL+PGETTIVSWKKLLKE+         +  P   A+A  A    L LP     
Sbjct  64   RQIFSVELKPGETTIVSWKKLLKES----GQAGTSQPPPAAAAAEPAVAAQLGLP-----  114

Query  437  PGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedS  616
                     P E + +D    NR NAVIEKIERLY+GK S D+EDLDDVPD+D+Y T+DS
Sbjct  115  -----GAAHPAENDPEDPTQPNRFNAVIEKIERLYMGKHSSDEEDLDDVPDDDQYATDDS  169

Query  617  FIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSDD  796
            FIDD ELD+YF+VDN   KH+G+F+N+G LE IE ++  N    KRR+KD +     ++ 
Sbjct  170  FIDDAELDEYFEVDNLTTKHNGYFINKGSLELIETSTTANVSTKKRRRKDSSGAHIENNK  229

Query  797  GC  802
            G 
Sbjct  230  GA  231



>ref|XP_010232653.1| PREDICTED: ubinuclein-1-like isoform X1 [Brachypodium distachyon]
Length=778

 Score =   268 bits (684),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 169/354 (48%), Positives = 228/354 (64%), Gaps = 36/354 (10%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAE-SRPPNAEVQDGDNSSQA-IKRRLPPEIKQKLAK  1366
             R  +  + K T LE+AIRDL+K VAE    P  +V + D + QA +KRRLP E+KQKLAK
Sbjct  408   RGSAGTKPKGTRLERAIRDLQKIVAEIEYRPAIDVNEADPNGQASVKRRLPQEVKQKLAK  467

Query  1367  VARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIK  1543
             VAR + A+HGK+ + EL++RLM IVGHLVQ RTLKRN+K M+ +GLSAKQEK +R Q++K
Sbjct  468   VARLS-ANHGKVQEHELMDRLMGIVGHLVQRRTLKRNMKEMVELGLSAKQEKADRFQRVK  526

Query  1544  REVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDL  1723
              E+ EM++ RV   K+KA EQQ G++DDFQ I  +E+ A K K+ MD ALE+RICDLYDL
Sbjct  527   MEINEMVQTRVA-AKAKANEQQDGSADDFQ-IMNDEQRASKGKFVMDTALEDRICDLYDL  584

Query  1724  YVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK-----NQ  1888
             YVEG++ED GPQ RKLY ELA  WP G MDN GIK AI R+K+R++ LYN+ K     ++
Sbjct  585   YVEGMDEDKGPQSRKLYVELAELWPQGCMDNVGIKDAITRSKERKRALYNQQKVKNVRDE  644

Query  1889  EKMRRNKIS-AQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMV  2065
             E+++R +++ A K  +GY         PV +Q  SAV A+  G  +   P+SS    +  
Sbjct  645   ERLKRKRLAEAAKLPDGY---------PVAMQ--SAV-AQQAGQPSIINPVSSYRVTDY-  691

Query  2066  GRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHITTDALTKKKMKRKPEPELGEGQ  2227
                      G +      E+V+ T  S   + T   + KK  KRKPE +L + Q
Sbjct  692   ---------GQNQASKCLERVRDTSTSDGNNKTAGEVKKK--KRKPESDLLDAQ  734


 Score =   125 bits (315),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 114/182 (63%), Gaps = 14/182 (8%)
 Frame = +2

Query  257  RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDS  436
            RQ F+VEL+PGETTIVSWKKLLKE+         +  P   A+A  A    L LP     
Sbjct  64   RQIFSVELKPGETTIVSWKKLLKES----GQAGTSQPPPAAAAAEPAVAAQLGLP-----  114

Query  437  PGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedS  616
                     P E + +D    NR NAVIEKIERLY+GK S D+EDLDDVPD+D+Y T+DS
Sbjct  115  -----GAAHPAENDPEDPTQPNRFNAVIEKIERLYMGKHSSDEEDLDDVPDDDQYATDDS  169

Query  617  FIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSDD  796
            FIDD ELD+YF+VDN   KH+G+F+N+G LE IE ++  N    KRR+KD +     ++ 
Sbjct  170  FIDDAELDEYFEVDNLTTKHNGYFINKGSLELIETSTTANVSTKKRRRKDSSGAHIENNK  229

Query  797  GC  802
            G 
Sbjct  230  GA  231



>gb|EMS49370.1| hypothetical protein TRIUR3_32737 [Triticum urartu]
Length=652

 Score =   259 bits (661),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 157/353 (44%), Positives = 224/353 (63%), Gaps = 29/353 (8%)
 Frame = +2

Query  1184  TVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQA-IKRRLPPEIKQKL  1360
             T  R+ +  + K T LE+AIRDL+K  A  + P  ++ + D + QA  +RRLPPE+KQKL
Sbjct  304   TTGRESAGTKPKGTRLERAIRDLQKIAANYKSPAIDISEADPNVQASAQRRLPPEVKQKL  363

Query  1361  AKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQ  1537
             AKVAR +  +HGK+ + EL++RLM IVGHLV  RTLKRN+K ++  GLSAKQEK  R+QQ
Sbjct  364   AKVARLS-TNHGKVQENELMDRLMGIVGHLVVRRTLKRNMKELVKSGLSAKQEKAGRLQQ  422

Query  1538  IKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLY  1717
             +K E+ EM+K  +   K+K  EQQ G++DDFQ++ T+E+   K K  MD+ALE+RICDLY
Sbjct  423   VKMEINEMVKASMA-AKAKVNEQQDGSADDFQTV-TDERRDLKGKSAMDSALEDRICDLY  480

Query  1718  DLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK--NQE  1891
             DLYVEG++ED GPQ RKLY ELA  WP G+MD  GIK AI R+K+R+ TL+N+ K  N+E
Sbjct  481   DLYVEGMDEDKGPQSRKLYVELAELWPQGYMDKFGIKDAISRSKERKGTLHNQQKVQNEE  540

Query  1892  KMRRNKI-SAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVG  2068
             K++R ++ +A K  + Y         PV  Q  +AV        + + P+ +T  +   G
Sbjct  541   KLKRKRLAAAAKLPDSY---------PVVTQSTAAVQV---AHPSMSNPV-TTYPVTDYG  587

Query  2069  RIPVPSPGGTSLDRPKPEKVKGTGNSTDRHITTDALTKKKMKRKPEPELGEGQ  2227
             +  VP     SL+R +        + + ++    A   KK KRK +P++ + Q
Sbjct  588   QNQVPK----SLERVRETSSSAIADESSKN----AGDMKKKKRKSDPDVVDTQ  632


 Score =   107 bits (267),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +2

Query  464  PVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDD  643
            P E + +D    NR NAVIEKIERLY+GK S D+EDLDDVPD+D+YDT+DSFIDD ELD+
Sbjct  30   PAENDPEDPAQPNRFNAVIEKIERLYMGKHSSDEEDLDDVPDDDQYDTDDSFIDDAELDE  89

Query  644  YFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQT  772
            YF+VDN   KH GFFVN+G LE+IEP +  N  P KRR KDQ+
Sbjct  90   YFEVDNLTTKHTGFFVNKGTLEQIEPGTSANVAPKKRRSKDQS  132



>ref|XP_009420990.1| PREDICTED: uncharacterized protein LOC104000627 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=738

 Score =   261 bits (666),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 187/272 (69%), Gaps = 34/272 (13%)
 Frame = +2

Query  1202  SSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYA  1381
             SSVR K T LE+AI DLEK VAE RPP+ +VQ+ D + Q  KRRLP E+KQKLAKVAR +
Sbjct  401   SSVRPKGTTLERAICDLEKIVAECRPPSLDVQEVDLAFQGTKRRLPKEVKQKLAKVARLS  460

Query  1382  QASHGKLSK-ELINRLMSIVGHLVQLRTLK------------------------------  1468
              AS GK+S+ EL++RLM I+GHLVQ RTLK                              
Sbjct  461   -ASQGKISEDELVDRLMGILGHLVQRRTLKEKKTLKVNLGEKNIGAYCSTYICTRQHALI  519

Query  1469  RNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATE  1648
             RN+++M+ +GLSAKQ+K +R  Q+K    EMI+ RV  +KSK  E Q G++D+FQ I  +
Sbjct  520   RNMRVMVELGLSAKQQKADRFHQVKGAATEMIRARVSQLKSKLPELQDGSADNFQKINND  579

Query  1649  EKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIK  1828
             EK   K +Y MD+ALE++ICDLYDLYVEG++ED GPQ RKLY ELA  WP+G+MD+ GIK
Sbjct  580   EKRVLKGRYSMDSALEDKICDLYDLYVEGMDEDKGPQSRKLYVELAELWPSGYMDDVGIK  639

Query  1829  RAICRAKDRRKTLYNRHK--NQEKMRRNKISA  1918
              AI R+K+R++ +Y+ +K  N+E+++R K+++
Sbjct  640   DAIQRSKERKRAIYSHNKVHNEERIKRRKLAS  671


 Score =   140 bits (352),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 139/226 (62%), Gaps = 29/226 (13%)
 Frame = +2

Query  245  AAGG-RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILP  421
            A GG R RF+V+L+PGETTIVSWK+LLKE++          G        A+   PL+  
Sbjct  37   AGGGQRVRFSVDLKPGETTIVSWKRLLKESS---------KGSGGGFPPNASAADPLL--  85

Query  422  PHNDSPGPGFSPEQPVEKEAKDA-PPGNRLNAVIEKIERLYVGKQSdddedlddvpdede  598
               DS      P  P   E +DA PP NR +AVIEKIERLYVGKQS  DE+LDD+P +D+
Sbjct  86   ---DSLAQAGGP--PAANELEDAVPPTNRFSAVIEKIERLYVGKQS-SDEELDDIPCDDQ  139

Query  599  ydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKC  778
            YDTEDSFIDDTELD+YFQVD  + KH+G+FVN+GKLE+IEP++   + P+KRR+ D TK 
Sbjct  140  YDTEDSFIDDTELDEYFQVDKMSTKHNGYFVNKGKLEQIEPSTSLKEAPSKRRRNDSTKL  199

Query  779  QSGSDDGCNPNKPAKVG----KKAGKSVPLAAGTSSP-----SYGV  889
              G  +   P+ P  V     K A ++ P       P     +YGV
Sbjct  200  H-GDGNVLVPSGPVNVDNMHIKDAARNAPEVGRKPKPGKIYATYGV  244



>gb|EMT18280.1| hypothetical protein F775_10685 [Aegilops tauschii]
Length=672

 Score =   256 bits (655),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 184/249 (74%), Gaps = 7/249 (3%)
 Frame = +2

Query  1184  TVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQA-IKRRLPPEIKQKL  1360
             T  R+ +  + K T LE+AIRDL+K  A  + P  ++ + D + QA  +RRLPPE+KQKL
Sbjct  324   TTGRESAGTKPKGTRLERAIRDLQKIAANYKSPAIDISEADPNVQASAQRRLPPEVKQKL  383

Query  1361  AKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQ  1537
             AKVAR +  +HGK+ + EL++RLM IVGHLV  RTLKRN+K ++  GLSAKQEK +R+QQ
Sbjct  384   AKVARLS-TNHGKVQENELMDRLMGIVGHLVVRRTLKRNMKELVKSGLSAKQEKADRLQQ  442

Query  1538  IKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLY  1717
             +K E+ EM+K  +   K+K  EQQ G++DDFQ++ T+E+   K K  M++ALE+RICDLY
Sbjct  443   VKMEINEMVKASMA-AKAKVNEQQDGSADDFQTV-TDERRDLKGKSAMNSALEDRICDLY  500

Query  1718  DLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK--NQE  1891
             DLYVEG++ED GPQ RKLY ELA  WP G+MD  GIK AI R+K+R+ TL+N+ K  N+E
Sbjct  501   DLYVEGMDEDKGPQSRKLYVELAELWPQGYMDKFGIKDAISRSKERKGTLHNQQKVLNEE  560

Query  1892  KMRRNKISA  1918
             +++R +++A
Sbjct  561   RLKRKRLAA  569


 Score = 93.6 bits (231),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 90/161 (56%), Gaps = 36/161 (22%)
 Frame = +2

Query  464  PVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDD  643
            P E +A+D    NR NAVIEKIERLY+GK S D+EDLDDVPD+D+YDT+DSFIDD ELD+
Sbjct  19   PAENDAEDPAQPNRFNAVIEKIERLYMGKHSSDEEDLDDVPDDDQYDTDDSFIDDAELDE  78

Query  644  YFQVDNSAIKHDGFFVNRGKLERI-------------------------------EPTSQ  730
            YF+VDN   KH GFFVN+G LE++                               EP + 
Sbjct  79   YFEVDNLTTKHTGFFVNKGTLEQMAQHVATVASKDELIIIKALAGTTQTTDERTGEPGTS  138

Query  731  QNQLPNKRRKKDQT-----KCQSGSDDGCNPNKPAKVGKKA  838
             N  P KRR KDQ+       Q  + D   P K + + K A
Sbjct  139  ANVAPKKRRSKDQSADHIENNQGATGDYLKPGKASGLKKVA  179



>ref|XP_010232654.1| PREDICTED: ubinuclein-1-like isoform X3 [Brachypodium distachyon]
Length=773

 Score =   258 bits (659),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 164/354 (46%), Positives = 224/354 (63%), Gaps = 41/354 (12%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAE-SRPPNAEVQDGDNSSQA-IKRRLPPEIKQKLAK  1366
             R  +  + K T LE+AIRDL+K VAE    P  +V + D + QA +KRRLP E+KQKLAK
Sbjct  408   RGSAGTKPKGTRLERAIRDLQKIVAEIEYRPAIDVNEADPNGQASVKRRLPQEVKQKLAK  467

Query  1367  VARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIK  1543
             VAR + A+HGK+ + EL++RLM IVGHLVQ RTLKRN+K M+ +GLSAKQEK +R Q++K
Sbjct  468   VARLS-ANHGKVQEHELMDRLMGIVGHLVQRRTLKRNMKEMVELGLSAKQEKADRFQRVK  526

Query  1544  REVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDL  1723
              E+ EM++ RV      A + + G++DDFQ I  +E+ A K K+ MD ALE+RICDLYDL
Sbjct  527   MEINEMVQTRV------AAKAKDGSADDFQ-IMNDEQRASKGKFVMDTALEDRICDLYDL  579

Query  1724  YVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK-----NQ  1888
             YVEG++ED GPQ RKLY ELA  WP G MDN GIK AI R+K+R++ LYN+ K     ++
Sbjct  580   YVEGMDEDKGPQSRKLYVELAELWPQGCMDNVGIKDAITRSKERKRALYNQQKVKNVRDE  639

Query  1889  EKMRRNKIS-AQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMV  2065
             E+++R +++ A K  +GY         PV +Q  SAV A+  G  +   P+SS    +  
Sbjct  640   ERLKRKRLAEAAKLPDGY---------PVAMQ--SAV-AQQAGQPSIINPVSSYRVTDY-  686

Query  2066  GRIPVPSPGGTSLDRPKPEKVKGTGNSTDRHITTDALTKKKMKRKPEPELGEGQ  2227
                      G +      E+V+ T  S   + T   + KK  KRKPE +L + Q
Sbjct  687   ---------GQNQASKCLERVRDTSTSDGNNKTAGEVKKK--KRKPESDLLDAQ  729


 Score =   125 bits (315),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 114/182 (63%), Gaps = 14/182 (8%)
 Frame = +2

Query  257  RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDS  436
            RQ F+VEL+PGETTIVSWKKLLKE+         +  P   A+A  A    L LP     
Sbjct  64   RQIFSVELKPGETTIVSWKKLLKES----GQAGTSQPPPAAAAAEPAVAAQLGLP-----  114

Query  437  PGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedS  616
                     P E + +D    NR NAVIEKIERLY+GK S D+EDLDDVPD+D+Y T+DS
Sbjct  115  -----GAAHPAENDPEDPTQPNRFNAVIEKIERLYMGKHSSDEEDLDDVPDDDQYATDDS  169

Query  617  FIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKCQSGSDD  796
            FIDD ELD+YF+VDN   KH+G+F+N+G LE IE ++  N    KRR+KD +     ++ 
Sbjct  170  FIDDAELDEYFEVDNLTTKHNGYFINKGSLELIETSTTANVSTKKRRRKDSSGAHIENNK  229

Query  797  GC  802
            G 
Sbjct  230  GA  231



>ref|XP_010231359.1| PREDICTED: ubinuclein-2-like isoform X3 [Brachypodium distachyon]
Length=747

 Score =   253 bits (646),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 195/286 (68%), Gaps = 16/286 (6%)
 Frame = +2

Query  1175  STQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD-NSSQAIKRR  1333
             STQT       R +GS +++K T LE+AIRDL+  V+E RP   ++QD D N   A+KRR
Sbjct  355   STQTTQLSANRRIEGSGIKAKGTRLERAIRDLQNIVSEYRPQTLDIQDIDPNCQAAVKRR  414

Query  1334  LPPEIKQKLAKVARYAQASHGKL-SKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             LP E+KQKLAKVAR + A+ GK+  +EL+NRLM IVGHLVQ RTLKRN+K M+  G+ AK
Sbjct  415   LPQEVKQKLAKVARLS-ANQGKIPEEELVNRLMGIVGHLVQRRTLKRNMKEMVESGIYAK  473

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIATEEKEAFKRKYCMDN  1687
             QEK ++ +Q+K E+ EMIK R+     K  E +  ++DDFQ ++  +E+ A K K+ +D 
Sbjct  474   QEKADKFRQVKVEICEMIKTRL-ATGPKVTEPKDDSADDFQGAVDIDERRALKGKFVLDA  532

Query  1688  ALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
              LE+RICDLYDLYVEG++ED GPQ RKLY ELA  WP G+MD   I+ AI R+K+RR  L
Sbjct  533   PLEDRICDLYDLYVEGMDEDKGPQSRKLYVELADLWPQGYMDKVEIRNAISRSKERRNLL  592

Query  1868  YNRHK--NQEKMRRNKI-SAQKEEEGYRV--ETTTRDQPVQIQEKS  1990
             Y + K  N+E+M+R ++ +A K  +G  V  + T   Q VQ+  KS
Sbjct  593   YRQRKARNEERMKRRRLAAASKLRDGNPVVPQYTVAQQAVQVPMKS  638



>ref|XP_003568423.1| PREDICTED: uncharacterized protein LOC100826032 isoform X1 [Brachypodium 
distachyon]
Length=782

 Score =   253 bits (646),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 195/286 (68%), Gaps = 16/286 (6%)
 Frame = +2

Query  1175  STQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD-NSSQAIKRR  1333
             STQT       R +GS +++K T LE+AIRDL+  V+E RP   ++QD D N   A+KRR
Sbjct  390   STQTTQLSANRRIEGSGIKAKGTRLERAIRDLQNIVSEYRPQTLDIQDIDPNCQAAVKRR  449

Query  1334  LPPEIKQKLAKVARYAQASHGKL-SKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             LP E+KQKLAKVAR + A+ GK+  +EL+NRLM IVGHLVQ RTLKRN+K M+  G+ AK
Sbjct  450   LPQEVKQKLAKVARLS-ANQGKIPEEELVNRLMGIVGHLVQRRTLKRNMKEMVESGIYAK  508

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIATEEKEAFKRKYCMDN  1687
             QEK ++ +Q+K E+ EMIK R+     K  E +  ++DDFQ ++  +E+ A K K+ +D 
Sbjct  509   QEKADKFRQVKVEICEMIKTRL-ATGPKVTEPKDDSADDFQGAVDIDERRALKGKFVLDA  567

Query  1688  ALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
              LE+RICDLYDLYVEG++ED GPQ RKLY ELA  WP G+MD   I+ AI R+K+RR  L
Sbjct  568   PLEDRICDLYDLYVEGMDEDKGPQSRKLYVELADLWPQGYMDKVEIRNAISRSKERRNLL  627

Query  1868  YNRHK--NQEKMRRNKI-SAQKEEEGYRV--ETTTRDQPVQIQEKS  1990
             Y + K  N+E+M+R ++ +A K  +G  V  + T   Q VQ+  KS
Sbjct  628   YRQRKARNEERMKRRRLAAASKLRDGNPVVPQYTVAQQAVQVPMKS  673


 Score =   129 bits (325),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 118/180 (66%), Gaps = 24/180 (13%)
 Frame = +2

Query  257  RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDS  436
            RQ F+VELRPGETTIVSWKKLLKEA        G     P +  AAA +QP++       
Sbjct  49   RQIFSVELRPGETTIVSWKKLLKEA--------GVAAALPPSLPAAAAVQPVV------E  94

Query  437  PGPGFSPEQP-VEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydted  613
            P  G S   P  E +  D    NR NAVIEKIERLY+GK S D+EDLDDVPD+D+YDTED
Sbjct  95   PLAGLSAAAPPTENDPNDPSQSNRFNAVIEKIERLYMGKHSSDEEDLDDVPDDDQYDTED  154

Query  614  SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQL---------PNKRRKKD  766
            SFIDD ELD+YF+VDN A KH G+FVN+GKLE+ E  S QN +         P KRR+++
Sbjct  155  SFIDDAELDEYFEVDNLATKHTGYFVNKGKLEQSEYGSVQNAVADGSVQNVGPKKRRRRE  214



>dbj|BAJ98239.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=788

 Score =   250 bits (639),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 181/259 (70%), Gaps = 13/259 (5%)
 Frame = +2

Query  1175  STQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD-NSSQAIKRR  1333
             STQT       R +GS +++K T LE+AIRDLE  V E +P   +V   D N   A+KRR
Sbjct  390   STQTTHLAANRRIEGSGIKAKGTRLERAIRDLENIVGEYKPHTLDVPFIDPNCQGAVKRR  449

Query  1334  LPPEIKQKLAKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             LP EIKQKLAKVAR + A+ GK+S+ ELINRLM IVGHLVQ RTLKRN+K M+  G+ AK
Sbjct  450   LPQEIKQKLAKVARLS-ANQGKISEDELINRLMGIVGHLVQRRTLKRNIKEMVESGMCAK  508

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQ-SIATEEKEAFKRKYCMDN  1687
             QEK ++ QQ+K E+ EM+K R+   K K  EQ+  ++D FQ  +  ++K A K K+ +D 
Sbjct  509   QEKADKFQQVKTEIYEMVKARLA-TKPKVTEQRDDSADAFQGGVNIDDKTALKGKFVLDA  567

Query  1688  ALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
              LE+RICDLYDLYVEG++ED GPQ RKLY ELA  WP G+MD   I+ AI R+K+RR  L
Sbjct  568   PLEDRICDLYDLYVEGMDEDKGPQSRKLYVELADLWPQGYMDKVEIRNAISRSKERRNLL  627

Query  1868  YNRHK--NQEKMRRNKISA  1918
             Y + K  N+E+M+R +I+A
Sbjct  628   YRQRKVRNEERMKRRRIAA  646


 Score =   131 bits (329),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 121/204 (59%), Gaps = 21/204 (10%)
 Frame = +2

Query  254  GRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHND  433
            GRQ F+VELRPGETTIVSWKKLLKEA    +     P  A       A L          
Sbjct  47   GRQLFSVELRPGETTIVSWKKLLKEAGLGAAPPPSLPAAAAAVQPVVAPLA---------  97

Query  434  SPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydted  613
              GP  +   P E +  D    NR NAVIEKIERLY+GK S D+EDLDDVPD+D+YDTED
Sbjct  98   --GPSGAAVHPTENDPNDPSQSNRFNAVIEKIERLYMGKHSSDEEDLDDVPDDDQYDTED  155

Query  614  SFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPN---------KRRKKD  766
            SFIDD ELD+YF+VDN   KH GFFVN+GKLE+ E  S QN  P+         KRR++D
Sbjct  156  SFIDDAELDEYFEVDNLETKHTGFFVNKGKLEQSEYGSVQNVGPDGTVQNVGPKKRRRRD  215

Query  767  QTKCQ-SGSDDGCNPNKPAKVGKK  835
             +      S D    + P KV K+
Sbjct  216  SSNSYLENSKDLAPGSMPVKVPKR  239



>tpg|DAA56508.1| TPA: hypothetical protein ZEAMMB73_820373 [Zea mays]
Length=819

 Score =   243 bits (620),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 145/304 (48%), Positives = 194/304 (64%), Gaps = 62/304 (20%)
 Frame = +2

Query  1175  STQT----VRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD-NSSQAIKRRLP  1339
             STQT    V R+GS  + K T LE+AIRDL+K VAE RPP  ++ + D N   A+KRRLP
Sbjct  388   STQTMHPVVGREGSGTKPKGTRLERAIRDLQKIVAEYRPPTIDINEVDPNGQVAVKRRLP  447

Query  1340  PEIKQKLAKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLK----------------  1468
             PEIKQKLAKVA+   A++GK+ + EL+NRLM IVGHLVQ RTLK                
Sbjct  448   PEIKQKLAKVAK---ANNGKIQEHELMNRLMGIVGHLVQRRTLKGWQRVRYYPHMSIPVI  504

Query  1469  --------------RNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQ  1606
                           RN+K M+  G+SAK EK +R Q++K E+ EMIK+R+   KSK + +
Sbjct  505   LIFTRAREHTCGLRRNMKEMVESGISAKLEKADRFQRVKLEINEMIKERM-ATKSK-VNE  562

Query  1607  QPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVE------------------  1732
             Q G++DDFQ +A +E+ A K KY MD ALE+++CDLYD+YVE                  
Sbjct  563   QDGSADDFQ-VANDERRALKTKYTMDTALEDKMCDLYDMYVEPDKALARIVSFIICMLVK  621

Query  1733  GLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK--NQEKMRRN  1906
             G++ED GPQ RKLY ELA  WP+G MDN GIK AI R+K+RR+ LY++ K  ++E+M+R 
Sbjct  622   GMDEDKGPQSRKLYVELAELWPHGCMDNVGIKDAIYRSKERRRLLYSQQKVRSEERMKRK  681

Query  1907  KISA  1918
             +++A
Sbjct  682   RLAA  685


 Score =   145 bits (365),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 113/172 (66%), Gaps = 18/172 (10%)
 Frame = +2

Query  257  RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDS  436
            RQ FTVELRPGETTIVSWKKLLKEA                     A   P+ + P   +
Sbjct  61   RQLFTVELRPGETTIVSWKKLLKEA------------------GHTAAAPPVAVEPAFAA  102

Query  437  PGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedS  616
                  P  P E + KD    NR NAVIEKIERLY+GK S D+EDL+DVPD+D+YDTEDS
Sbjct  103  HAGPSGPAHPAENDPKDPTQPNRFNAVIEKIERLYMGKHSSDEEDLNDVPDDDQYDTEDS  162

Query  617  FIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQT  772
            FIDD ELD+YF+VDN   KHDG+FVN+GKLE+IEP +  N  P KRR+KD +
Sbjct  163  FIDDAELDEYFEVDNLKTKHDGYFVNKGKLEQIEPGTAANVAPKKRRRKDAS  214



>ref|XP_002981398.1| hypothetical protein SELMODRAFT_444826 [Selaginella moellendorffii]
 gb|EFJ17586.1| hypothetical protein SELMODRAFT_444826 [Selaginella moellendorffii]
Length=649

 Score =   238 bits (606),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 219/595 (37%), Positives = 305/595 (51%), Gaps = 112/595 (19%)
 Frame = +2

Query  215   GVGRVSTSYEAA------GGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpap  376
             G G V T+++A+       GRQRF VEL    + +VSWKKLLK A    +          
Sbjct  4     GSGFV-TAFQASPFAGTESGRQRFHVEL---TSNVVSWKKLLKSAPPPPAAEAPPGANPA  59

Query  377   rasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQS  556
               +  A E   L   P     GP                  NR + VIEKIERLY G+  
Sbjct  60    LEARLAPETVLLCKEPRG---GP------------------NRFSNVIEKIERLYQGQGQ  98

Query  557   dddedlddvpded-----eydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEP  721
             + D+++ D   ++     +Y+T+DSFIDD ELD+YF VD +  KH GFF+N+GKLE IEP
Sbjct  99    ESDDEIVDNHLDNVPDDDQYNTDDSFIDDKELDEYFSVDYAKTKHSGFFINKGKLENIEP  158

Query  722   TSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSV--PLAAGTSSPSYGVVM  895
                   +P KR++K+     S      +  K   VG+   +SV  P + G          
Sbjct  159   NPPCLPVPKKRKRKEVKTSGSEMHAQDSSKKSKAVGRVEQESVDRPSSDGIGECLVNKQS  218

Query  896   PTLYRENANVHNQEVNFDMQK-----------AEVLHSKNVVDK--LKESSETSNQRSNE  1036
              T  R+ A   N   +FD  K           A  + SKNV  K   K SS T   + NE
Sbjct  219   ETQVRQAAG--NDAFSFDYNKFFSRDGSSCREANYI-SKNVSLKGLTKNSSRT---KENE  272

Query  1037  RISVPQEKSSGRS------ANISNGLDQS-FQQGEKSVIYDQRLDASAPEGKRSTQTVRR  1195
             R  V  +KS+  S          +G D         S + +  +D   P+ KRST     
Sbjct  273   RNEVALKKSAVGSPSRPKFVKAYSGADACKVSSSANSTLGNSSVD---PQ-KRST-----  323

Query  1196  DGSSVRSKITMLEKAIRDLEKFVAESRP------PNAEVQDGDNSSQAIKRRLPPEIKQK  1357
                   +K+++LE+AI+DL+  VA+ RP      PNA  +          RRLP EIK K
Sbjct  324   ------AKVSLLERAIQDLKAGVAQLRPIPDVLEPNATGK---------VRRLPREIKAK  368

Query  1358  LAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQ  1537
             +AKVAR A A  GK+  ELI+RLMSI+GHL+QL+TLKRNLK M+ MGL AK EK++R+  
Sbjct  369   IAKVARLA-ARQGKVPDELIDRLMSILGHLMQLKTLKRNLKEMVEMGLVAKHEKEHRLSH  427

Query  1538  IKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLY  1717
             +KR++ E+++ RV  +++KA E   G S+D Q +        ++ Y  D A E+RIC+LY
Sbjct  428   MKRDLTEIVRSRVQSIQAKAEE---GFSNDVQGVG-------EKNYKWDQATEDRICELY  477

Query  1718  DLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK  1882
             D Y+E         +++L  +LA  WP G+MD  GIK A+ RAK+RRK L  +H+
Sbjct  478   DQYLE-----VYLLLQRL--KLADLWPEGWMDKDGIKNAVYRAKERRKALQKQHR  525



>ref|XP_002969922.1| hypothetical protein SELMODRAFT_440877 [Selaginella moellendorffii]
 gb|EFJ29046.1| hypothetical protein SELMODRAFT_440877 [Selaginella moellendorffii]
Length=649

 Score =   235 bits (600),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 216/592 (36%), Positives = 301/592 (51%), Gaps = 106/592 (18%)
 Frame = +2

Query  215   GVGRVSTSYEAA------GGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpap  376
             G G V T+++A+       GRQRF VEL    + +VSWKKLLK A    +          
Sbjct  4     GSGFV-TAFQASPFAGTESGRQRFHVEL---TSNVVSWKKLLKSAPPPPAAEAPPGANPA  59

Query  377   rasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQS  556
               +  A E   L   P     GP                  NR + VIEKIERLY G+  
Sbjct  60    LEARLAPETVLLCKEPRG---GP------------------NRFSNVIEKIERLYQGQGQ  98

Query  557   dddedlddvpded-----eydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEP  721
             + D+++ D   ++     +Y+T+DSFIDD ELD+YF VD +  KH GFF+N+GKLE IEP
Sbjct  99    ESDDEIVDNHLDNVPDDDQYNTDDSFIDDKELDEYFSVDYAKTKHSGFFINKGKLENIEP  158

Query  722   TSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKSV--PLAAGTSSPSYGVVM  895
                   +P KR++K+     S      +  K   VG+   +SV  P + G          
Sbjct  159   NPPCLPVPKKRKRKEVKTSGSEMHAQDSSKKSKAVGRVEQESVDRPSSDGIGECLVNKQS  218

Query  896   PTLYRENANVHNQEVNFDMQK-----------AEVLHSKNVVDK--LKESSETSNQRSNE  1036
              T  R+ A   N   +FD  K           A  + SKNV  K   K SS T     NE
Sbjct  219   ETQVRQAAG--NDAFSFDYNKFFSRDGSSCREANYI-SKNVSLKGLTKNSSRTKESERNE  275

Query  1037  ---RISVPQEKSSGRSANISNGLDQS-FQQGEKSVIYDQRLDASAPEGKRSTQTVRRDGS  1204
                + S     S  +     +G D         S + +  +D   P+ KRST        
Sbjct  276   VALKKSAVGSPSRPKFVKPYSGADACKVSSSANSTLGNSSVD---PQ-KRST--------  323

Query  1205  SVRSKITMLEKAIRDLEKFVAESRP------PNAEVQDGDNSSQAIKRRLPPEIKQKLAK  1366
                +K+++LE+AI+DL+  VA+ RP      PNA  +          RRLP EIK K+AK
Sbjct  324   ---AKVSLLERAIQDLKAGVAQLRPIPDVLEPNATGK---------VRRLPREIKAKIAK  371

Query  1367  VARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKR  1546
             VAR A A  GK+  ELI+RLMSI+GHL+QL+TLKRNLK M+ MGL AK EK++R+  +KR
Sbjct  372   VARLA-ARQGKVPDELIDRLMSILGHLMQLKTLKRNLKEMVEMGLVAKHEKEHRLSHMKR  430

Query  1547  EVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLY  1726
             ++ E+++ RV  +++KA E   G S+D Q +        ++ Y  D A E+RIC+LYD Y
Sbjct  431   DLTEIVRSRVQSIQAKAEE---GFSNDVQGVG-------EKNYKWDQATEDRICELYDQY  480

Query  1727  VEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHK  1882
             +E         +++L  +LA  WP G+MD  GIK A+ RAK+RRK L  +H+
Sbjct  481   LE-----VYLLLQRL--KLADLWPEGWMDKDGIKNAVYRAKERRKALQKQHR  525



>ref|XP_010501545.1| PREDICTED: uncharacterized protein LOC104778812 [Camelina sativa]
Length=544

 Score =   226 bits (575),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 158/378 (42%), Positives = 211/378 (56%), Gaps = 78/378 (21%)
 Frame = +2

Query  1187  VRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAK  1366
              +RDGS+V+SKI++LEKAIR+LEK                                    
Sbjct  225   TKRDGSNVKSKISILEKAIRELEK------------------------------------  248

Query  1367  VARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKR  1546
                   AS GK + ELINRLMSIVGHL+QLR+LKRNLKIMI+MG SA +EKD R QQI  
Sbjct  249   ------ASQGKYTAELINRLMSIVGHLIQLRSLKRNLKIMIDMGDSANREKDTRFQQINN  302

Query  1547  EVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLY  1726
             EV +MIK +V LM+++  + + GTSDDF      EK + K K+ MD ALE+++C LYD++
Sbjct  303   EVLDMIKAKVSLMETQETKPEGGTSDDFHDPV--EKPSLK-KFVMDAALEDKLCHLYDIF  359

Query  1727  VEGL-EEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLY---NRHKNQEK  1894
             +EGL EED GP +RKLYA LA  WPN  MDNHGIKRAICRAK+R+K L+    +  +Q K
Sbjct  360   IEGLDEEDQGPPIRKLYANLAELWPNRLMDNHGIKRAICRAKERQKALFGNLGKEMDQTK  419

Query  1895  MRRN-KISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGSTATNKPISSTAAINMVGR  2071
             M+++ K    K E   +  T +  Q  Q  EK  VD     +T+T+   S T    MV R
Sbjct  420   MKKSRKQLVTKTEWTAQPNTESVAQRRQSGEKMTVDP---NATSTSLVTSQT----MVDR  472

Query  2072  IPVPSPGGTSLDRPKPEKVKGTGNSTDRHITTDALTKKKMKRKPEPELGEGQYLPEKLSS  2251
                         + + EK+KG+ NS +    T  + +K      E  + E Q +   L+ 
Sbjct  473   -----------SKQQHEKLKGSLNSCNPPEETRVVKRKTT----EGIMAEKQVV---LAL  514

Query  2252  KQAEYKPQEPIAAAPVPK  2305
             K+ E+ P   I   PVP+
Sbjct  515   KKPEHPPTRVI---PVPQ  529


 Score =   152 bits (383),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 125/193 (65%), Gaps = 16/193 (8%)
 Frame = +2

Query  197  SSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpap  376
            S GGE    R S     AG R+   VELRPG+TT VSWKKL+++A+ +  +    P P P
Sbjct  11   SIGGESL--RASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDASKVNGSSASVPDPPP  68

Query  377  rasaaaaELQPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQS  556
             A+     L+  I PP            QP E E  D P  NR NAVIEKIERLY G  S
Sbjct  69   NANP---NLESRIAPPG-----------QPAEIETNDQPHSNRFNAVIEKIERLYKGNDS  114

Query  557  dddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQN  736
             D E+LD  PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGF+VNRGKLERIEP++  N
Sbjct  115  SDGEELDGAPDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFYVNRGKLERIEPSTTSN  174

Query  737  QLPNKRRKKDQTK  775
            Q P KRR+KD  K
Sbjct  175  QQPKKRRRKDPAK  187



>ref|XP_007048472.1| Wound-responsive family protein isoform 4 [Theobroma cacao]
 gb|EOX92629.1| Wound-responsive family protein isoform 4 [Theobroma cacao]
Length=485

 Score =   206 bits (525),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 145/194 (75%), Gaps = 10/194 (5%)
 Frame = +2

Query  1160  PEGKRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLP  1339
             PE   S  +  +D S++R K TMLE+AIR+LEK VAESR    +VQD D S+ AIKRRLP
Sbjct  290   PEKSLSVHS--KDVSNLRPKGTMLERAIRELEKVVAESRLATMDVQDVDASAAAIKRRLP  347

Query  1340  PEIKQKLAKVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEK  1519
              E+KQKLAKVAR AQ+S G++S+ELINRLM+I+GH VQLRTLKRNL+ M+ +GLSAK+EK
Sbjct  348   REVKQKLAKVARLAQSSQGRISEELINRLMNILGHSVQLRTLKRNLREMVLLGLSAKREK  407

Query  1520  DNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIA-TEEKEAFKRKYCMDNALE  1696
              +R +QIK EV EMIK    L  SK   Q+   +DD+Q +  +EE+   K +Y MDNA+E
Sbjct  408   ADRFRQIKMEVTEMIK----LQASK---QRDVATDDYQEVLNSEEQVVLKEQYSMDNAME  460

Query  1697  NRICDLYDLYVEGL  1738
             ++ICDLYDLYV+ L
Sbjct  461   DKICDLYDLYVQVL  474



>ref|XP_001771064.1| predicted protein [Physcomitrella patens]
 gb|EDQ64065.1| predicted protein [Physcomitrella patens]
Length=762

 Score =   211 bits (537),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 156/221 (71%), Gaps = 6/221 (3%)
 Frame = +2

Query  1217  KITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQ--AIKRRLPPEIKQKLAKVARYAQAS  1390
             K T++E+AI+DL K VA   PP+ E ++ +  SQ  A  +RLP E+K +LAKVAR AQA 
Sbjct  358   KGTVMERAIQDLIKMVALLCPPSPEGEEQEALSQPGAKAKRLPREVKTRLAKVARLAQAK  417

Query  1391  HGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKD  1570
              GK+  EL+ RL  I+GH+++  TLKRNLK M+  GLSAKQEK+ R+  IKREV EM+++
Sbjct  418   QGKVPDELVERLHGILGHIMRPNTLKRNLKEMVEHGLSAKQEKEGRLLDIKREVTEMVRN  477

Query  1571  RVPLMKSKAIEQQPGTSDDFQS--IATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEE  1744
             +V   K K  E + G+SDDFQ+     E+  +   KY  D+A+E+ +C+LYD Y+EG++E
Sbjct  478   QV--TKFKNAEVREGSSDDFQAGPSTVEKAGSSAEKYKWDHAIEDLLCNLYDQYLEGMDE  535

Query  1745  DAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
               GPQ+RKLY ELA  WP G+MDN+GIK A+ RAK+R+K L
Sbjct  536   HKGPQIRKLYFELAELWPEGWMDNNGIKAAVLRAKERQKRL  576


 Score = 83.2 bits (204),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 84/160 (53%), Gaps = 27/160 (17%)
 Frame = +2

Query  257  RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPH---  427
            RQRF VEL+  ETT+VSWKKL+ +A G       +   +   + A   L+  I P     
Sbjct  4    RQRFFVELKDEETTVVSWKKLVSDAEG----KLVSARVSDAPAGANPALEARIAPEKGAG  59

Query  428  ----NDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpded  595
                ND P     P+ P           NR ++VIE+IERLY G  SDDD   D   ++ 
Sbjct  60   SVTGNDDP----LPQVP-----------NRFSSVIERIERLYKGGDSDDDGAEDTPDEDQ  104

Query  596  eydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI  715
                +  FIDD EL++YF V+ +  KH GFF+NRG LE+I
Sbjct  105  YDTDD-PFIDDEELNEYFMVEEAKTKHTGFFINRGALEKI  143



>gb|EMS50906.1| hypothetical protein TRIUR3_23085 [Triticum urartu]
Length=749

 Score =   207 bits (526),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 150/212 (71%), Gaps = 11/212 (5%)
 Frame = +2

Query  1175  STQTV------RRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD-NSSQAIKRR  1333
             STQT       R +GS +++K T LE+AIRDLE  V E +P   +V   D N   A+KRR
Sbjct  386   STQTTHLAANRRIEGSGIKAKGTRLERAIRDLENIVGEYKPHTLDVPYIDPNCQGAVKRR  445

Query  1334  LPPEIKQKLAKVARYAQASHGKLSK-ELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAK  1510
             LP EIKQKLAKVAR + A+ GK+S+ ELINRLM IVGHLVQ RTLKRN+K M+  G+ AK
Sbjct  446   LPQEIKQKLAKVARLS-ANQGKISEDELINRLMGIVGHLVQRRTLKRNMKEMVESGMCAK  504

Query  1511  QEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQS-IATEEKEAFKRKYCMDN  1687
             QEK ++ QQ+K E+ EM+K R+   K K  EQ+  ++ DFQ  ++ ++K A K K+ +D 
Sbjct  505   QEKADKFQQVKTEIYEMVKARLD-TKPKVTEQRDDSAHDFQGGVSIDDKTALKGKFVLDA  563

Query  1688  ALENRICDLYDLYVEGLEEDAGPQVRKLYAEL  1783
              LE+RICDLYDLYVEG++ED GPQ RKLY E+
Sbjct  564   PLEDRICDLYDLYVEGMDEDKGPQSRKLYVEV  595



>ref|XP_001781658.1| predicted protein [Physcomitrella patens]
 gb|EDQ53544.1| predicted protein [Physcomitrella patens]
Length=823

 Score =   199 bits (505),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 113/246 (46%), Positives = 156/246 (63%), Gaps = 31/246 (13%)
 Frame = +2

Query  1217  KITMLEKAIRDLEKFVAESRPPNAE--VQDGDNSSQAIKRRLPPEIKQKLAKVARYA---  1381
             K T++E+AI+DL K VA   P +AE  VQ+  +   A  +RLP E+K +LAKVAR A   
Sbjct  351   KGTVMERAIQDLIKMVALLCPQSAEGEVQEAPSQPGAKAKRLPREVKTRLAKVARLAVRF  410

Query  1382  ----------------------QASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINM  1495
                                   QA  GK+  EL+ RL  I+GH+++  TLKRNLK M+  
Sbjct  411   TETFQDLSIYSVTLSSLIIKEQQAKQGKVPDELVVRLHGILGHIMRPNTLKRNLKEMVEH  470

Query  1496  GLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQS--IATEEKEAFKR  1669
             GLSAKQEK+ R+  IKREV EM++++V   K K  E + G+SDDFQ+  ++ E+      
Sbjct  471   GLSAKQEKEGRLLDIKREVTEMVRNQV--TKFKGAEAREGSSDDFQAGPLSVEKAGTSTE  528

Query  1670  KYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAK  1849
             KY  D+A+E+ +C+LYD Y+EG++E  GPQ+RKLY ELA  WP G+MDN+GIK A+ RAK
Sbjct  529   KYKWDHAMEDLLCNLYDQYLEGMDEHKGPQIRKLYFELAELWPEGWMDNNGIKAAVLRAK  588

Query  1850  DRRKTL  1867
             +R+K L
Sbjct  589   ERQKRL  594


 Score = 83.6 bits (205),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 88/164 (54%), Gaps = 14/164 (9%)
 Frame = +2

Query  257  RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILPPHNDS  436
            RQRF VEL+  ETT+VSWKKL+ +A G   +      PA    A  A + P I       
Sbjct  4    RQRFFVELKDEETTVVSWKKLVSDAEGKLGSAKLPDAPAGANPALEARIAPEI------G  57

Query  437  PGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddvpdedeydtedS  616
             G     E P+ +     P  NR ++VIE+IERLY G  SDDD   D   ++     +  
Sbjct  58   AGSVAGNEDPLPQ----VP--NRFSSVIERIERLYKGGDSDDDGAEDSPDEDQYDTDD-P  110

Query  617  FIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIE-PTSQQNQLP  745
            FIDD EL++YF V+ +  KH GFF+NRG LE+I  PT     LP
Sbjct  111  FIDDEELNEYFMVEEAKTKHTGFFINRGALEKINVPTPSPAVLP  154



>ref|XP_010459873.1| PREDICTED: uncharacterized protein LOC104740854 isoform X4 [Camelina 
sativa]
Length=361

 Score =   182 bits (463),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 154/369 (42%), Positives = 206/369 (56%), Gaps = 48/369 (13%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S     AG R+   VELRPG+TT VSWKKL+++A+ +  +    P P P A+     L
Sbjct  18    RASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDASKVNGSSASVPDPPPNANP---NL  74

Query  404   QPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddv  583
             +  I PP            QP E E  D P  NR NAVIEKIERLY G  S D E+LD  
Sbjct  75    ESRIAPPG-----------QPAEIETNDQPHSNRFNAVIEKIERLYKGNDSSDGEELDGA  123

Query  584   pdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKK  763
             PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGF+VNRGKLERIEP++  NQ P KRR+K
Sbjct  124   PDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFYVNRGKLERIEPSTTSNQQPKKRRRK  183

Query  764   DQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGVVMPTLYRENANVHNQEV  940
             D  K   G   G + +K  K+   A GK    A+G+S       +   Y           
Sbjct  184   DPAK-PFGDAVGVS-DKHTKLSLTARGKDQSTASGSS-------LKRKYNVARKTQEPPF  234

Query  941   NFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANI-----SNGLDQS  1105
              F  Q A +  S   +D +K S   ++Q  N++ + P+ K +G S+ +     + GL Q 
Sbjct  235   PFGAQDANISLS---LDDVKHSDRANHQ--NKKDTCPKSKETGSSSALHQKYSNKGLHQQ  289

Query  1106  FQQ---------GEKSVIYDQRLDASAPE-----GKRSTQTVRRDGSSVRSKITMLEKAI  1243
              +            ++ I  Q+ +    E      ++S+Q  +RDGS+V+SKI++LEKAI
Sbjct  290   SKSLPGKSLPNVSAEATIVRQKENNGMHELANAKSRQSSQASKRDGSNVKSKISILEKAI  349

Query  1244  RDLEKFVAE  1270
             R+LEK VAE
Sbjct  350   RELEKVVAE  358



>ref|XP_010459872.1| PREDICTED: uncharacterized protein LOC104740854 isoform X3 [Camelina 
sativa]
Length=367

 Score =   181 bits (460),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 151/378 (40%), Positives = 199/378 (53%), Gaps = 60/378 (16%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S     AG R+   VELRPG+TT VSWKKL+++A+ +      +         A   L
Sbjct  18    RASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDASKVN---GSSASVPDPPPNANPNL  74

Query  404   QPLILPP-----HNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSddde  568
             +  I PP     H           QP E E  D P  NR NAVIEKIERLY G  S D E
Sbjct  75    ESRIAPPVSLMLHEMG--------QPAEIETNDQPHSNRFNAVIEKIERLYKGNDSSDGE  126

Query  569   dlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPN  748
             +LD  PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGF+VNRGKLERIEP++  NQ P 
Sbjct  127   ELDGAPDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFYVNRGKLERIEPSTTSNQQPK  186

Query  749   KRRKKDQTKCQSGSDDGCNPNKPAKVGKKAGKS-----VPLAAGTSSPSYGVVMPTLYRE  913
             KRR+KD             P KP   G   G S     + L A   S + G  +   Y  
Sbjct  187   KRRRKD-------------PAKP--FGDAVGVSDKHTKLSLTARGKSTASGSSLKRKYNV  231

Query  914   NANVHNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANI---  1084
                       F  Q A +  S   +D +K S   ++Q  N++ + P+ K +G S+ +   
Sbjct  232   ARKTQEPPFPFGAQDANISLS---LDDVKHSDRANHQ--NKKDTCPKSKETGSSSALHQK  286

Query  1085  --SNGLDQSFQQ---------GEKSVIYDQRLDASAPE-----GKRSTQTVRRDGSSVRS  1216
               + GL Q  +            ++ I  Q+ +    E      ++S+Q  +RDGS+V+S
Sbjct  287   YSNKGLHQQSKSLPGKSLPNVSAEATIVRQKENNGMHELANAKSRQSSQASKRDGSNVKS  346

Query  1217  KITMLEKAIRDLEKFVAE  1270
             KI++LEKAIR+LEK VAE
Sbjct  347   KISILEKAIRELEKVVAE  364



>ref|XP_010459870.1| PREDICTED: uncharacterized protein LOC104740854 isoform X2 [Camelina 
sativa]
Length=367

 Score =   181 bits (459),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 154/369 (42%), Positives = 207/369 (56%), Gaps = 42/369 (11%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S     AG R+   VELRPG+TT VSWKKL+++A+ +  +    P P P A+     L
Sbjct  18    RASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDASKVNGSSASVPDPPPNANP---NL  74

Query  404   QPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddv  583
             +  I PP +         E P E E  D P  NR NAVIEKIERLY G  S D E+LD  
Sbjct  75    ESRIAPPVS-----LMLHEMPAEIETNDQPHSNRFNAVIEKIERLYKGNDSSDGEELDGA  129

Query  584   pdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKK  763
             PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGF+VNRGKLERIEP++  NQ P KRR+K
Sbjct  130   PDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFYVNRGKLERIEPSTTSNQQPKKRRRK  189

Query  764   DQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGVVMPTLYRENANVHNQEV  940
             D  K   G   G + +K  K+   A GK    A+G+S       +   Y           
Sbjct  190   DPAK-PFGDAVGVS-DKHTKLSLTARGKDQSTASGSS-------LKRKYNVARKTQEPPF  240

Query  941   NFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANI-----SNGLDQS  1105
              F  Q A +  S   +D +K S   ++Q  N++ + P+ K +G S+ +     + GL Q 
Sbjct  241   PFGAQDANISLS---LDDVKHSDRANHQ--NKKDTCPKSKETGSSSALHQKYSNKGLHQQ  295

Query  1106  FQQ---------GEKSVIYDQRLDASAPE-----GKRSTQTVRRDGSSVRSKITMLEKAI  1243
              +            ++ I  Q+ +    E      ++S+Q  +RDGS+V+SKI++LEKAI
Sbjct  296   SKSLPGKSLPNVSAEATIVRQKENNGMHELANAKSRQSSQASKRDGSNVKSKISILEKAI  355

Query  1244  RDLEKFVAE  1270
             R+LEK VAE
Sbjct  356   RELEKVVAE  364



>ref|XP_010459874.1| PREDICTED: uncharacterized protein LOC104740854 isoform X5 [Camelina 
sativa]
Length=359

 Score =   181 bits (459),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 153/369 (41%), Positives = 205/369 (56%), Gaps = 50/369 (14%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S     AG R+   VELRPG+TT VSWKKL+++A+ +  +    P P P A+     L
Sbjct  18    RASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDASKVNGSSASVPDPPPNANP---NL  74

Query  404   QPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddv  583
             +  I PP             P E E  D P  NR NAVIEKIERLY G  S D E+LD  
Sbjct  75    ESRIAPP-------------PAEIETNDQPHSNRFNAVIEKIERLYKGNDSSDGEELDGA  121

Query  584   pdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKK  763
             PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGF+VNRGKLERIEP++  NQ P KRR+K
Sbjct  122   PDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFYVNRGKLERIEPSTTSNQQPKKRRRK  181

Query  764   DQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGVVMPTLYRENANVHNQEV  940
             D  K   G   G + +K  K+   A GK    A+G+S       +   Y           
Sbjct  182   DPAK-PFGDAVGVS-DKHTKLSLTARGKDQSTASGSS-------LKRKYNVARKTQEPPF  232

Query  941   NFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANI-----SNGLDQS  1105
              F  Q A +  S   +D +K S   ++Q  N++ + P+ K +G S+ +     + GL Q 
Sbjct  233   PFGAQDANISLS---LDDVKHSDRANHQ--NKKDTCPKSKETGSSSALHQKYSNKGLHQQ  287

Query  1106  FQQ---------GEKSVIYDQRLDASAPE-----GKRSTQTVRRDGSSVRSKITMLEKAI  1243
              +            ++ I  Q+ +    E      ++S+Q  +RDGS+V+SKI++LEKAI
Sbjct  288   SKSLPGKSLPNVSAEATIVRQKENNGMHELANAKSRQSSQASKRDGSNVKSKISILEKAI  347

Query  1244  RDLEKFVAE  1270
             R+LEK VAE
Sbjct  348   RELEKVVAE  356



>ref|XP_010459869.1| PREDICTED: uncharacterized protein LOC104740854 isoform X1 [Camelina 
sativa]
Length=369

 Score =   180 bits (456),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 152/374 (41%), Positives = 203/374 (54%), Gaps = 50/374 (13%)
 Frame = +2

Query  224   RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
             R S     AG R+   VELRPG+TT VSWKKL+++A+ +      +         A   L
Sbjct  18    RASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDASKVN---GSSASVPDPPPNANPNL  74

Query  404   QPLILPP-----HNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSddde  568
             +  I PP     H           QP E E  D P  NR NAVIEKIERLY G  S D E
Sbjct  75    ESRIAPPVSLMLHEMG--------QPAEIETNDQPHSNRFNAVIEKIERLYKGNDSSDGE  126

Query  569   dlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPN  748
             +LD  PD+DEYDTEDSFIDD ELD+YF+VDNSA+KHDGF+VNRGKLERIEP++  NQ P 
Sbjct  127   ELDGAPDDDEYDTEDSFIDDAELDEYFEVDNSAVKHDGFYVNRGKLERIEPSTTSNQQPK  186

Query  749   KRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAAGTSSPSYGVVMPTLYRENANV  925
             KRR+KD  K   G   G + +K  K+   A GK    A+G+S       +   Y      
Sbjct  187   KRRRKDPAK-PFGDAVGVS-DKHTKLSLTARGKDQSTASGSS-------LKRKYNVARKT  237

Query  926   HNQEVNFDMQKAEVLHSKNVVDKLKESSETSNQRSNERISVPQEKSSGRSANI-----SN  1090
                   F  Q A +  S   +D +K S   ++Q  N++ + P+ K +G S+ +     + 
Sbjct  238   QEPPFPFGAQDANISLS---LDDVKHSDRANHQ--NKKDTCPKSKETGSSSALHQKYSNK  292

Query  1091  GLDQSFQQ---------GEKSVIYDQRLDASAPE-----GKRSTQTVRRDGSSVRSKITM  1228
             GL Q  +            ++ I  Q+ +    E      ++S+Q  +RDGS+V+SKI++
Sbjct  293   GLHQQSKSLPGKSLPNVSAEATIVRQKENNGMHELANAKSRQSSQASKRDGSNVKSKISI  352

Query  1229  LEKAIRDLEKFVAE  1270
             LEKAIR+LEK VAE
Sbjct  353   LEKAIRELEKVVAE  366



>ref|XP_009421005.1| PREDICTED: uncharacterized protein LOC104000627 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=692

 Score =   183 bits (465),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 112/272 (41%), Positives = 153/272 (56%), Gaps = 80/272 (29%)
 Frame = +2

Query  1202  SSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYA  1381
             SSVR K T LE+AI DLEK VAE RPP+ +VQ+ D + Q  KRRLP E+KQKLAKVAR +
Sbjct  401   SSVRPKGTTLERAICDLEKIVAECRPPSLDVQEVDLAFQGTKRRLPKEVKQKLAKVARLS  460

Query  1382  QASHGKLSK-ELINRLMSIVGHLVQLRTLK------------------------------  1468
              AS GK+S+ EL++RLM I+GHLVQ RTLK                              
Sbjct  461   -ASQGKISEDELVDRLMGILGHLVQRRTLKEKKTLKVNLGEKNIGAYCSTYICTRQHALI  519

Query  1469  RNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATE  1648
             RN+++M+ +GLSAKQ+K +R  Q+K    EMI+ RV  +KSK                  
Sbjct  520   RNMRVMVELGLSAKQQKADRFHQVKGAATEMIRARVSQLKSK------------------  561

Query  1649  EKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIK  1828
                                         G++ED GPQ RKLY ELA  WP+G+MD+ GIK
Sbjct  562   ----------------------------GMDEDKGPQSRKLYVELAELWPSGYMDDVGIK  593

Query  1829  RAICRAKDRRKTLYNRHK--NQEKMRRNKISA  1918
              AI R+K+R++ +Y+ +K  N+E+++R K+++
Sbjct  594   DAIQRSKERKRAIYSHNKVHNEERIKRRKLAS  625


 Score =   140 bits (352),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 139/226 (62%), Gaps = 29/226 (13%)
 Frame = +2

Query  245  AAGG-RQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaELQPLILP  421
            A GG R RF+V+L+PGETTIVSWK+LLKE++          G        A+   PL+  
Sbjct  37   AGGGQRVRFSVDLKPGETTIVSWKRLLKESS---------KGSGGGFPPNASAADPLL--  85

Query  422  PHNDSPGPGFSPEQPVEKEAKDA-PPGNRLNAVIEKIERLYVGKQSdddedlddvpdede  598
               DS      P  P   E +DA PP NR +AVIEKIERLYVGKQS  DE+LDD+P +D+
Sbjct  86   ---DSLAQAGGP--PAANELEDAVPPTNRFSAVIEKIERLYVGKQS-SDEELDDIPCDDQ  139

Query  599  ydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERIEPTSQQNQLPNKRRKKDQTKC  778
            YDTEDSFIDDTELD+YFQVD  + KH+G+FVN+GKLE+IEP++   + P+KRR+ D TK 
Sbjct  140  YDTEDSFIDDTELDEYFQVDKMSTKHNGYFVNKGKLEQIEPSTSLKEAPSKRRRNDSTKL  199

Query  779  QSGSDDGCNPNKPAKVG----KKAGKSVPLAAGTSSP-----SYGV  889
              G  +   P+ P  V     K A ++ P       P     +YGV
Sbjct  200  H-GDGNVLVPSGPVNVDNMHIKDAARNAPEVGRKPKPGKIYATYGV  244



>ref|XP_006432117.1| hypothetical protein CICLE_v10002136mg [Citrus clementina]
 gb|ESR45357.1| hypothetical protein CICLE_v10002136mg [Citrus clementina]
Length=273

 Score =   171 bits (434),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 137/227 (60%), Gaps = 12/227 (5%)
 Frame = +2

Query  1484  MINMGLSAKQEKDNRVQQIKREVAEMIKDRVPLMKSKAIEQQPGTSDDFQSIATEEKEAF  1663
             M+ +GLSAK+EK +R+Q IK EV EMIK        +A +   G +DDFQ     E++ F
Sbjct  1     MVLLGLSAKREKADRIQLIKNEVIEMIK-------LQANKLTNGAADDFQDTFHSEEKGF  53

Query  1664  -KRKYCMDNALENRICDLYDLYVEGLEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAIC  1840
              K K+C+++ LE++ICDLYDLY++G++ED GPQ+RKLYAELA  WP G MDNHGIK+AIC
Sbjct  54    QKEKFCINSMLEDKICDLYDLYIQGMDEDKGPQIRKLYAELAELWPEGTMDNHGIKKAIC  113

Query  1841  RAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEKSAVDARDHGST  2020
             RAK+RR+  Y+  K +EK R  K+   + E     E ++  Q   + E+    +      
Sbjct  114   RAKERRRASYDDEKVREKARGQKLPMARTEVAVCGEVSSTAQAKAVPERIITVSNTLFLG  173

Query  2021  ATNKPISSTAAINMVGRIPVPSPG----GTSLDRPKPEKVKGTGNST  2149
             + +K ISS  A+N     PV +        ++D PK EK++ T   T
Sbjct  174   SPSKMISSATALNHHLTAPVRTSSLMLKSFNMDFPKQEKLERTAYPT  220



>ref|XP_002961073.1| hypothetical protein SELMODRAFT_402672 [Selaginella moellendorffii]
 gb|EFJ38612.1| hypothetical protein SELMODRAFT_402672 [Selaginella moellendorffii]
Length=581

 Score =   179 bits (453),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 98/234 (42%), Positives = 146/234 (62%), Gaps = 16/234 (7%)
 Frame = +2

Query  1217  KITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHG  1396
             K+TML++AI++LEK VA+  PP+ E     N     K+R+P E+K +LAKVAR AQ    
Sbjct  252   KLTMLDRAIQELEKEVADRCPPSTE----KNHETEYKKRIPKEVKARLAKVARLAQKQSK  307

Query  1397  KLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRV  1576
                +EL+N LM I+GHL+Q+R+LKRNLK M  +G+SA++EK ++++ +K+E+ +M+K R 
Sbjct  308   IGPEELLNVLMKIMGHLMQIRSLKRNLKEMAELGISAQKEKQSKLETMKKEIVDMLKSR-  366

Query  1577  PLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGP  1756
                    I  Q    D+ Q     E+     +Y  D   E+RI D Y+LYVEG++E    
Sbjct  367   -------ITPQQSAQDNSQC----EEATCDGRYRWDAPTEDRISDFYELYVEGIDEHKSA  415

Query  1757  QVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISA  1918
               +K YAELA  WP G+MD++GIK A+ RAK+R+K    + K +E+ R+    A
Sbjct  416   ATKKFYAELAELWPEGWMDSNGIKNAVLRAKERKKGAMKQAKLEERKRKKATVA  469


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 78/168 (46%), Gaps = 28/168 (17%)
 Frame = +2

Query  224  RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
            R     E+   RQRF VE   G +  VSW KL K                  A A +A L
Sbjct  4    RCWLEMESFPARQRFHVESERG-SVEVSWSKLQK-------------LLPTNAVATSANL  49

Query  404  QPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddv  583
                 P  +    P       +  EA D     R+NAVIEKIERLY G   DD+   +D 
Sbjct  50   LATTRPGLDSRIAPEM-----ISSEAYDG----RMNAVIEKIERLYQGHSEDDEGGDEDD  100

Query  584  pdedeyd-----tedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER  712
                        TED+FIDD +LD+YF+V+ +  KH GF+VN+G LE+
Sbjct  101  RTTCVPAEEDYDTEDTFIDDEDLDEYFEVNRTKTKHTGFYVNKGSLEK  148



>ref|XP_002966934.1| hypothetical protein SELMODRAFT_408197 [Selaginella moellendorffii]
 gb|EFJ31533.1| hypothetical protein SELMODRAFT_408197 [Selaginella moellendorffii]
Length=577

 Score =   176 bits (445),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 96/229 (42%), Positives = 145/229 (63%), Gaps = 19/229 (8%)
 Frame = +2

Query  1217  KITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHG  1396
             K+TML++AI++LEK VA+  PP+ E     N     K+R+P E+K +LAKVAR AQ    
Sbjct  251   KLTMLDRAIQELEKEVADRCPPSME----KNHETEYKKRIPKEVKARLAKVARLAQKQSK  306

Query  1397  KLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRV  1576
                +EL+N LM I+GHL+Q+R+LKRNLK M  +G+SA++EK ++++ +K+E+ +M+K R+
Sbjct  307   IGPEELLNVLMKIMGHLMQIRSLKRNLKEMAELGISAQKEKQSKLETMKKEIVDMLKSRI  366

Query  1577  PLMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGP  1756
                +S A + +  T D               +Y  D   E+RI D Y+LYVEG++E    
Sbjct  367   TPQQS-AQQCEEATCDG--------------RYRWDAPTEDRISDFYELYVEGIDEHKSA  411

Query  1757  QVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTLYNRHKNQEKMRR  1903
               +K YAELA  WP G+MD++GIK A+ RAK+R+K    + K  E+ R+
Sbjct  412   ATKKFYAELAELWPEGWMDSNGIKNAVLRAKERKKGAMKQAKLDERKRK  460


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 74/168 (44%), Gaps = 29/168 (17%)
 Frame = +2

Query  224  RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
            R     E+   RQRF VE   G    VSW KL K      +    A   A       + +
Sbjct  4    RCWLEMESFPARQRFHVESERGSVE-VSWSKLQK-LLPTNAVATSANLLATTRPGLDSRI  61

Query  404  QPLILPPHNDSPGPGFSPEQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedlddv  583
             P +   H D                       R+NAVIEKIERLY G   DD+   +D 
Sbjct  62   APEVAAAHKD----------------------GRMNAVIEKIERLYQGHSEDDEGGDEDD  99

Query  584  pdedeyd-----tedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLER  712
                        TED+FIDD +LD+YF+V+ +  KH GF+VN+G LE+
Sbjct  100  KTTCVPAEEDYDTEDTFIDDEDLDEYFEVNRTKTKHTGFYVNKGSLEK  147



>gb|KFK41011.1| hypothetical protein AALP_AA2G073700 [Arabis alpina]
Length=226

 Score =   155 bits (391),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 140/234 (60%), Gaps = 26/234 (11%)
 Frame = +2

Query  173  MKPPIDEGSSGGEPGVGRVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEAT-GLQsn  349
            M  P D GS+ GE    ++S     AG R+   V+L   ETTIVSWKKL+KE + G+ S+
Sbjct  1    MDEPNDVGSNSGESA--KLSPKLLFAGDRKLLKVKLLEEETTIVSWKKLMKETSKGIVSS  58

Query  350  gngapgpaprasaaaaELQPLILPPHNDSPG--PGFSPEQPVEKEAKDAPPGNRLNAVIE  523
                                   PP N +P      +P QP E E  D P  NR NAVIE
Sbjct  59   SVAHE------------------PPPNANPNLESRIAPGQPAEGEVADQPHSNRFNAVIE  100

Query  524  KIERLYVGKQSdddedlddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGK  703
            KIERLY+G+ S D E+LD  PD+DEYDTEDSFIDD ELD YFQVDNSAIKHDGFFVNRGK
Sbjct  101  KIERLYMGEDSSDGEELDGAPDDDEYDTEDSFIDDVELDAYFQVDNSAIKHDGFFVNRGK  160

Query  704  LERIEPTSQQNQLPNKRRKKDQTKCQSGSDDGCNPNKPAKVGKKA-GKSVPLAA  862
            LERIEP++  NQ P KR++K+  K    + D     K +K+ K A GK  PL A
Sbjct  161  LERIEPSTTSNQQPKKRKRKESAKPNGDAVDVS--RKQSKIVKTAGGKVAPLLA  212



>ref|XP_006380393.1| hypothetical protein POPTR_0007s04600g [Populus trichocarpa]
 gb|ERP58190.1| hypothetical protein POPTR_0007s04600g [Populus trichocarpa]
Length=355

 Score =   155 bits (393),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 105/131 (80%), Gaps = 1/131 (1%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVA  1372
             +D SS++ K + LE+AIRDLEK VAESRP N EVQD D SS AIKRRLP E+KQKLAKVA
Sbjct  219   KDVSSLQLKGSTLERAIRDLEKVVAESRPRNIEVQDTDASSTAIKRRLPSEVKQKLAKVA  278

Query  1373  RYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREV  1552
             + A +S GK+S+ELIN LMSI+GHL+QLRTLK+NL+ M+ M  +AKQEK +R Q I+REV
Sbjct  279   KLA-SSQGKISEELINCLMSILGHLIQLRTLKKNLREMVEMEPTAKQEKADRFQLIRREV  337

Query  1553  AEMIKDRVPLM  1585
              EMI+ +V  M
Sbjct  338   MEMIELQVSNM  348



>gb|AAL17693.1| wound-responsive protein 14.05 [Castanea sativa]
Length=127

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 91/108 (84%), Gaps = 2/108 (2%)
 Frame = +2

Query  1193  RDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVA  1372
             +DGS+VR K + LEKAIR+LEK VAESRPP  + Q+ DNSSQ +KRRLP EIK KLAKVA
Sbjct  13    KDGSNVRPK-SSLEKAIRELEKMVAESRPPAVDNQEADNSSQGVKRRLPREIKLKLAKVA  71

Query  1373  RYAQA-SHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQ  1513
             R A + + G +SKEL+NRLMSI+GHL+QL TLKRNLK+MI+MGLSAKQ
Sbjct  72    RIAASQAKGGISKELLNRLMSILGHLIQLTTLKRNLKVMISMGLSAKQ  119



>ref|XP_010087180.1| hypothetical protein L484_003820 [Morus notabilis]
 gb|EXB28437.1| hypothetical protein L484_003820 [Morus notabilis]
Length=178

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 116/167 (69%), Gaps = 20/167 (12%)
 Frame = +2

Query  224  RVSTSYEAAGGRQRFTVELRPGETTIVSWKKLLKEATGLQsngngapgpaprasaaaaEL  403
            R S+S+  +G RQ FTVELRPGETTIVSWKKL+K+A  +      AP             
Sbjct  13   RASSSFVKSGDRQMFTVELRPGETTIVSWKKLMKDANKVDGGSASAPE------------  60

Query  404  QPLILPPHNDSP--GPGFSP-EQPVEKEAKDAPPGNRLNAVIEKIERLYVGKQSdddedl  574
                 PP N  P      +P +QP  +E K+ P  +R +AVIEKIERLY+GK S DDED+
Sbjct  61   -----PPANAHPRLESRIAPVQQPANEEVKEDPAPHRFSAVIEKIERLYMGKDSSDDEDM  115

Query  575  ddvpdedeydtedSFIDDTELDDYFQVDNSAIKHDGFFVNRGKLERI  715
            +++PD+D+YDTEDSFIDD ELD+YF+VDNSAIKHDGFFVNRGKLER+
Sbjct  116  NEIPDDDQYDTEDSFIDDAELDEYFEVDNSAIKHDGFFVNRGKLERL  162



>ref|XP_002967163.1| hypothetical protein SELMODRAFT_408609 [Selaginella moellendorffii]
 gb|EFJ31762.1| hypothetical protein SELMODRAFT_408609 [Selaginella moellendorffii]
Length=312

 Score =   140 bits (354),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 136/216 (63%), Gaps = 27/216 (13%)
 Frame = +2

Query  1220  ITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGK  1399
             +++LE+AI+DL+  VA+  P   +V + + + +   RRLP EIK K+AKVAR A A  GK
Sbjct  60    MSLLERAIQDLKAGVAQLHPI-PDVLEPNATGKV--RRLPREIKAKIAKVARLA-ARQGK  115

Query  1400  LSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVP  1579
             +  ELI+ LMSI+GHL+QL+TLK         GL AKQEK++R+  +KR++ E+++ RV 
Sbjct  116   VPDELIDCLMSILGHLMQLKTLKFE-----GDGLVAKQEKEHRLSHMKRDLTEIVRSRVQ  170

Query  1580  LMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQ  1759
              +++KA E   G S+D Q +        ++ Y  D A E+ IC+LYD Y+  L       
Sbjct  171   SIQAKAEE---GFSNDVQGVG-------EKNYKWDQATEDWICELYDQYLGLLA------  214

Query  1760  VRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
             +++L  +LA  WP G+MD  GIK A+ RAK+RRK L
Sbjct  215   LQRL--KLADLWPEGWMDKDGIKNAVYRAKERRKAL  248



>ref|XP_002960851.1| hypothetical protein SELMODRAFT_402260 [Selaginella moellendorffii]
 gb|EFJ38390.1| hypothetical protein SELMODRAFT_402260 [Selaginella moellendorffii]
Length=255

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/216 (41%), Positives = 134/216 (62%), Gaps = 27/216 (13%)
 Frame = +2

Query  1220  ITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQAIKRRLPPEIKQKLAKVARYAQASHGK  1399
             +++LE+AI+DL+  +A+ RP   +V + + + +   RRLP EIK K+AKVAR A A  GK
Sbjct  54    MSLLERAIQDLKAGLAQLRPI-PDVLEPNATGKV--RRLPREIKAKIAKVARLA-ARQGK  109

Query  1400  LSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIKREVAEMIKDRVP  1579
             +  ELI+ LMSI+GHL++L+TLK         GL AKQEK++R+  +KR++ E+++  V 
Sbjct  110   VPDELIDCLMSILGHLMRLKTLKFE-----GDGLVAKQEKEHRLSHMKRDLTEIVRSSVQ  164

Query  1580  LMKSKAIEQQPGTSDDFQSIATEEKEAFKRKYCMDNALENRICDLYDLYVEGLEEDAGPQ  1759
              +++KA E   G S+D Q +        ++ Y  D A E+  C+LYD Y+  L       
Sbjct  165   SIQAKAEE---GFSNDVQGVG-------EKNYKWDQATEDWTCELYDQYLGLL------A  208

Query  1760  VRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
             +++L  +LA  W  G+MD  GIK A+ RAK+RRK L
Sbjct  209   LQRL--KLADLWLEGWMDKDGIKNAVYRAKERRKAL  242



>gb|ACU17249.1| unknown [Glycine max]
Length=177

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 107/185 (58%), Gaps = 16/185 (9%)
 Frame = +2

Query  1808  MDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETT--TRDQPVQIQ  1981
             MDNHGIKRAICR+K+RR+ LYNRHK+QEK++R K+ A ++EE  + + +  T  QP  ++
Sbjct  1     MDNHGIKRAICRSKERRRALYNRHKDQEKIKRKKLLAPRQEEDVQFDPSPITSQQP--MR  58

Query  1982  EKSAVDARDHGSTATNKPISSTAAINMVGRIPVPSPGGTSLDRPKPEKVKG--TGNSTDR  2155
             E+ A D+  H  T+ NK +S+T       R+  PS  G     PK E+ KG  +G   D 
Sbjct  59    ERLATDSSSHTHTSVNKTVSNTIT---AARVHNPSENG-----PKQERAKGSSSGFLDDV  110

Query  2156  HITTDALTKKKMKRKPEPELGEGQYLPEKLSS-KQAEYKPQEPIAAAPV-PKPSIQLNEP  2329
                   L KKK+KRKP+  L    + PEK ++  Q E KP+    +A V PK ++Q    
Sbjct  111   KGADGVLIKKKVKRKPDQGLEGTHFRPEKSAAFLQGEEKPRSLKQSAGVPPKSNLQPTSL  170

Query  2330  PSFEE  2344
             P  E+
Sbjct  171   PGLEQ  175



>gb|AAT44256.1| unknown protein [Oryza sativa Japonica Group]
Length=194

 Score = 67.0 bits (162),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 62/131 (47%), Gaps = 42/131 (32%)
 Frame = +2

Query  1187  VRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGDNSSQ-AIKRRLPPEIKQKLA  1363
             +  +GS  ++K T LE+AIRDL+  V E +P   +V + + + Q A+KRRLP E      
Sbjct  98    IHTEGSGTKTKGTRLERAIRDLQNIVTEYKPQILDVHEAEANCQVAVKRRLPQE------  151

Query  1364  KVARYAQASHGKLSKELINRLMSIVGHLVQLRTLKRNLKIMINMGLSAKQEKDNRVQQIK  1543
                                                RN+K M+  GL AKQEK  ++QQ+K
Sbjct  152   -----------------------------------RNMKEMVQSGLCAKQEKAGKLQQVK  176

Query  1544  REVAEMIKDRV  1576
              E+ EM+K R+
Sbjct  177   MEIYEMVKARL  187



>gb|AFW84369.1| hypothetical protein ZEAMMB73_776342, partial [Zea mays]
Length=228

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = +2

Query  1169  KRSTQTVRRDGSSVRSKITMLEKAIRDLEKFVAESRPPNAEVQDGD-NSSQAIKRRLPPE  1345
             +R    V R GS ++ K T LE+ IRDL+K  AE RPP  ++ + D N   A+KRRLPPE
Sbjct  160   QRKHPVVGRAGSCIKPKGTRLERGIRDLQKIAAEYRPPTIDINEVDPNGQAAVKRRLPPE  219

Query  1346  IKQKLAKVA  1372
             +KQK+A+++
Sbjct  220   VKQKVARLS  228



>gb|AAD02829.1| unknown [Arabidopsis thaliana]
Length=200

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  1736  LEEDAGPQVRKLYAELAAYWPNGFMDNHGIKRAICRAKDRRKTL  1867
             ++E +G Q+RKLY++LA  WPN  +DN  I+RAICR K+RR+ L
Sbjct  1     MDEHSGSQIRKLYSDLAQLWPNSLVDNDEIRRAICREKERRRAL  44



>ref|XP_008783505.1| PREDICTED: uncharacterized protein LOC103702731 [Phoenix dactylifera]
Length=172

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 51/99 (52%), Gaps = 28/99 (28%)
 Frame = +2

Query  257  RQRFTVELRPGETTIVSWKKLLKEA-TGLQsngngapgpaprasaaaaELQPLILPPH--  427
            RQRF+VELRPGETTIVSWKKLL+E+  G  +                        PP   
Sbjct  58   RQRFSVELRPGETTIVSWKKLLRESGKGTDA-----------------------FPPSGV  94

Query  428  -NDSPGPGFSPEQPVEKEAKDA-PPGNRLNAVIEKIERL  538
                  P  +    VE E KDA PP NR +AVIEKIERL
Sbjct  95   DPALGPPAAAAAATVENELKDAVPPPNRFSAVIEKIERL  133



>gb|KDO57500.1| hypothetical protein CISIN_1g044291mg [Citrus sinensis]
Length=118

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 0/91 (0%)
 Frame = +2

Query  1808  MDNHGIKRAICRAKDRRKTLYNRHKNQEKMRRNKISAQKEEEGYRVETTTRDQPVQIQEK  1987
             MDNHGIK+AICRAK+RR+  Y+  K +EK R  K+   + E     E ++  Q   + E+
Sbjct  1     MDNHGIKKAICRAKERRRASYDDEKVREKARGQKLPMARTEVAVCGEVSSTAQAKAVPER  60

Query  1988  SAVDARDHGSTATNKPISSTAAINMVGRIPV  2080
                 +      + +K ISS  A+N     PV
Sbjct  61    IITVSNTLFLGSPSKMISSATALNHHLTAPV  91



>ref|NP_001132603.1| uncharacterized protein LOC100194075 [Zea mays]
 gb|ACF81518.1| unknown [Zea mays]
Length=173

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  257  RQRFTVELRPGETTIVSWKKLLKEA  331
            RQ FTVELRPGE+TIVSWKKLLKEA
Sbjct  63   RQLFTVELRPGESTIVSWKKLLKEA  87



>ref|XP_002306271.1| hypothetical protein POPTR_0005s06880g [Populus trichocarpa]
 gb|EEE93267.1| hypothetical protein POPTR_0005s06880g [Populus trichocarpa]
Length=90

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  257  RQRFTVELRPGETTIVSWKKLLKEATG  337
            RQRF +EL+PGETTIVSWKKLLK+A  
Sbjct  16   RQRFYIELKPGETTIVSWKKLLKDAAA  42



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9441102856812