BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23636_g1_i1 len=2203 path=[9644:0-390 4832:391-414 10058:415-598
5040:599-622 10265:623-860 5302:861-905 1213:906-1113 1421:1114-1147
1455:1148-1297 @1605@!:1298-1976 2296:1977-2202]

Length=2203
                                                                      Score     E

ref|XP_004235299.1|  PREDICTED: RNA polymerase sigma factor sigA        700   0.0      
ref|XP_009771934.1|  PREDICTED: RNA polymerase sigma factor sigA        690   0.0      
dbj|BAA88921.1|  sigma factor                                           690   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009601815.1|  PREDICTED: RNA polymerase sigma factor sigA-...    689   0.0      
ref|XP_009629626.1|  PREDICTED: RNA polymerase sigma factor sigA-...    671   0.0      
ref|XP_006347341.1|  PREDICTED: RNA polymerase sigma factor sigA-...    668   0.0      
dbj|BAA88922.1|  sigma factor                                           667   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009767654.1|  PREDICTED: RNA polymerase sigma factor sigA-...    664   0.0      
ref|XP_009629625.1|  PREDICTED: RNA polymerase sigma factor sigA-...    663   0.0      
ref|XP_004241445.1|  PREDICTED: RNA polymerase sigma factor sigA        655   0.0      
ref|XP_011075762.1|  PREDICTED: RNA polymerase sigma factor sigA        640   0.0      
ref|XP_002524027.1|  RNA polymerase sigma factor rpoD, putative         632   0.0      Ricinus communis
ref|XP_007029766.1|  Sigma factor A isoform 1                           628   0.0      
ref|XP_002325882.1|  RNA POLYMERASE SIGMA SUBUNIT 1 family protein      628   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011012457.1|  PREDICTED: RNA polymerase sigma factor sigA        627   0.0      
gb|KDP39565.1|  hypothetical protein JCGZ_02585                         627   0.0      
ref|XP_010275189.1|  PREDICTED: RNA polymerase sigma factor sigA-...    626   0.0      
ref|XP_006484698.1|  PREDICTED: RNA polymerase sigma factor sigA-...    623   0.0      
ref|XP_006437403.1|  hypothetical protein CICLE_v10031289mg             623   0.0      
gb|KDO48032.1|  hypothetical protein CISIN_1g010521mg                   623   0.0      
ref|XP_010266387.1|  PREDICTED: RNA polymerase sigma factor sigA-...    617   0.0      
gb|KHG03684.1|  RNA polymerase sigma factor rpoD                        612   0.0      
emb|CDP04910.1|  unnamed protein product                                610   0.0      
ref|XP_008462812.1|  PREDICTED: RNA polymerase sigma factor sigA        610   0.0      
ref|XP_008234513.1|  PREDICTED: RNA polymerase sigma factor sigA        607   0.0      
gb|KHG22597.1|  RNA polymerase sigma factor rpoD                        607   0.0      
ref|XP_007219023.1|  hypothetical protein PRUPE_ppa004393mg             606   0.0      
ref|XP_004151855.1|  PREDICTED: RNA polymerase sigma factor sigA-...    605   0.0      
gb|KDO48034.1|  hypothetical protein CISIN_1g010521mg                   600   0.0      
ref|XP_003539986.1|  PREDICTED: RNA polymerase sigma factor sigA-...    599   0.0      
ref|XP_003534364.1|  PREDICTED: RNA polymerase sigma factor sigA-...    597   0.0      
emb|CBI26421.3|  unnamed protein product                                593   0.0      
ref|XP_002319237.2|  hypothetical protein POPTR_0013s07290g             590   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010662046.1|  PREDICTED: RNA polymerase sigma factor sigA ...    588   0.0      
ref|XP_010662045.1|  PREDICTED: RNA polymerase sigma factor sigA ...    588   0.0      
ref|XP_011011636.1|  PREDICTED: RNA polymerase sigma factor sigA-...    586   0.0      
ref|XP_009361126.1|  PREDICTED: RNA polymerase sigma factor sigA ...    584   0.0      
ref|XP_010550940.1|  PREDICTED: RNA polymerase sigma factor sigA        582   0.0      
ref|XP_008376946.1|  PREDICTED: RNA polymerase sigma factor sigA-...    580   0.0      
ref|XP_007131471.1|  hypothetical protein PHAVU_011G016400g             579   0.0      
gb|EYU44877.1|  hypothetical protein MIMGU_mgv1a004509mg                580   0.0      
ref|XP_006419162.1|  hypothetical protein EUTSA_v10002486mg             577   0.0      
gb|EYU44876.1|  hypothetical protein MIMGU_mgv1a004509mg                574   0.0      
ref|XP_008382369.1|  PREDICTED: RNA polymerase sigma factor sigA-...    573   0.0      
gb|KEH16477.1|  RNA polymerase sigma factor                             572   0.0      
ref|XP_010414870.1|  PREDICTED: RNA polymerase sigma factor sigA-...    572   0.0      
ref|XP_004499502.1|  PREDICTED: RNA polymerase sigma factor sigA-...    568   0.0      
ref|XP_004499501.1|  PREDICTED: RNA polymerase sigma factor sigA-...    567   0.0      
ref|XP_004499499.1|  PREDICTED: RNA polymerase sigma factor sigA-...    566   0.0      
ref|XP_010511140.1|  PREDICTED: RNA polymerase sigma factor sigA        567   0.0      
ref|XP_010470329.1|  PREDICTED: RNA polymerase sigma factor sigA-...    566   0.0      
gb|KDO48031.1|  hypothetical protein CISIN_1g010521mg                   565   0.0      
ref|XP_009348922.1|  PREDICTED: RNA polymerase sigma factor sigA-...    565   0.0      
ref|NP_176666.1|  RNA polymerase sigma subunit 1                        563   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAA22214.1|  plastid RNA polymerase sigma-subunit                   563   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004307835.1|  PREDICTED: RNA polymerase sigma factor sigA-...    563   0.0      
gb|AAB81958.1|  RNA polymerase sigma subunit 1                          562   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAG40388.1|AF325036_1  At1g64860                                     561   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CAA74896.1|  sigma factorB                                          561   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302143.1|  hypothetical protein CARUB_v10020145mg             560   0.0      
ref|XP_010670766.1|  PREDICTED: RNA polymerase sigma factor sigA        559   0.0      
ref|XP_009128472.1|  PREDICTED: RNA polymerase sigma factor sigA        557   0.0      
emb|CDY52962.1|  BnaCnng23900D                                          556   0.0      
ref|XP_002886771.1|  RNA polymerase sigma subunit 1                     557   0.0      
ref|XP_008808794.1|  PREDICTED: RNA polymerase sigma factor sigA        557   0.0      
emb|CDY56127.1|  BnaA02g20170D                                          553   0.0      
emb|CAA75859.1|  Sig1                                                   543   0.0      Sinapis alba [bai jie]
ref|XP_010910228.1|  PREDICTED: RNA polymerase sigma factor sigA ...    541   0.0      
ref|XP_006878659.1|  hypothetical protein AMTR_s00011p00266100          539   0.0      
ref|XP_010063584.1|  PREDICTED: RNA polymerase sigma factor sigA        540   0.0      
ref|XP_009382828.1|  PREDICTED: RNA polymerase sigma factor sigA-...    537   1e-180   
ref|XP_010910226.1|  PREDICTED: RNA polymerase sigma factor sigA ...    541   2e-180   
gb|KHN11742.1|  Maltose excess protein 1, chloroplastic                 540   7e-180   
ref|XP_009361127.1|  PREDICTED: RNA polymerase sigma factor sigA ...    531   3e-178   
ref|XP_010662047.1|  PREDICTED: RNA polymerase sigma factor sigA ...    531   8e-178   
ref|XP_008376947.1|  PREDICTED: RNA polymerase sigma factor sigA-...    527   1e-176   
ref|XP_009397520.1|  PREDICTED: RNA polymerase sigma factor sigA-...    527   2e-176   
ref|XP_007029767.1|  Sigma factor A isoform 2                           511   3e-171   
ref|XP_006371210.1|  hypothetical protein POPTR_0019s06020g             510   1e-170   
ref|NP_001185314.1|  RNA polymerase sigma subunit 1                     509   8e-170   
gb|KDO48035.1|  hypothetical protein CISIN_1g010521mg                   501   2e-167   
gb|EPS67249.1|  sigma factor                                            501   3e-166   
gb|KCW90982.1|  hypothetical protein EUGRSUZ_A02994                     488   6e-161   
gb|KDO48036.1|  hypothetical protein CISIN_1g010521mg                   468   9e-155   
gb|KDO48037.1|  hypothetical protein CISIN_1g010521mg                   465   9e-154   
ref|XP_010910227.1|  PREDICTED: RNA polymerase sigma factor sigA ...    455   1e-147   
ref|XP_010087437.1|  RNA polymerase sigma factor rpoD                   442   3e-143   
ref|XP_008662828.1|  PREDICTED: RNA polymerase sigma factor sigA        439   3e-142   
ref|XP_004972754.1|  PREDICTED: RNA polymerase sigma factor sigA-...    439   3e-142   
dbj|BAC99906.1|  putative plastid RNA polymerase sigma factor           428   3e-140   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ05701.1|  hypothetical protein OsI_27933                          429   3e-140   Oryza sativa Indica Group [Indian rice]
ref|XP_002443917.1|  hypothetical protein SORBIDRAFT_07g004340          434   3e-140   Sorghum bicolor [broomcorn]
dbj|BAC99905.1|  putative plastid RNA polymerase sigma factor           429   4e-140   Oryza sativa Japonica Group [Japonica rice]
gb|AAC78467.1|  RNA polymerase sigma factor 1                           429   6e-140   Zea mays [maize]
ref|XP_008678254.1|  PREDICTED: RNA polymerase sigma factor sigA ...    433   7e-140   
gb|EAZ41616.1|  hypothetical protein OsJ_26150                          429   1e-139   Oryza sativa Japonica Group [Japonica rice]
emb|CAA74653.1|  plastid RNA polymerase sigma factor                    431   2e-139   Sorghum bicolor [broomcorn]
gb|AAC78468.1|  RNA polymerase sigma factor 2                           426   3e-139   Zea mays [maize]
ref|NP_001061065.2|  Os08g0163400                                       430   1e-138   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA24364.1|  plastid RNA polymerase sigma factor                    430   1e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008678253.1|  PREDICTED: RNA polymerase sigma factor sigA ...    427   2e-137   
gb|KCW90985.1|  hypothetical protein EUGRSUZ_A02994                     426   2e-137   
ref|XP_006659164.1|  PREDICTED: LOW QUALITY PROTEIN: RNA polymera...    424   2e-136   
ref|XP_003573435.1|  PREDICTED: RNA polymerase sigma factor sigA        423   7e-136   
dbj|BAJ92935.1|  predicted protein                                      419   2e-134   
gb|EMS46133.1|  RNA polymerase sigma factor rpoD                        419   2e-134   
dbj|BAJ99592.1|  predicted protein                                      419   2e-134   
emb|CAA10725.1|  chloroplast sigma factor                               411   4e-132   Triticum aestivum [Canadian hard winter wheat]
gb|EMT32448.1|  RNA polymerase sigma factor rpoD                        379   2e-120   
ref|XP_006302141.1|  hypothetical protein CARUB_v10020145mg             366   8e-115   
gb|KCW90984.1|  hypothetical protein EUGRSUZ_A02994                     364   9e-114   
gb|KDO48038.1|  hypothetical protein CISIN_1g010521mg                   337   2e-105   
gb|KDO48039.1|  hypothetical protein CISIN_1g010521mg                   333   5e-103   
gb|KDO48040.1|  hypothetical protein CISIN_1g010521mg                   270   5e-80    
gb|AEO45243.1|  sigma factor                                            265   7e-79    
ref|XP_001770550.1|  plastid sigma factor SIG1                          268   2e-75    
dbj|BAM45408.1|  sigma factor 1                                         231   1e-62    
ref|XP_010094612.1|  RNA polymerase sigma factor rpoD                   192   3e-53    
gb|AGW24512.1|  putative RNA polymerase sigma-C factor                  183   4e-51    
ref|WP_036477198.1|  RNA polymerase sigma factor                        187   4e-49    
ref|WP_002802747.1|  RNA polymerase sigma factor                        185   7e-49    
dbj|GAL91301.1|  cyanobacteria-specific RpoD-like sigma factor, t...    184   8e-49    
ref|WP_012267117.1|  RNA polymerase sigma factor                        183   3e-48    
ref|WP_002748320.1|  RNA polymerase sigma factor rpoD2                  182   5e-48    
ref|WP_004161486.1|  RNA polymerase sigma factor                        182   5e-48    
ref|WP_002739411.1|  RNA polymerase sigma factor                        182   8e-48    
ref|WP_002766753.1|  RNA polymerase sigma factor                        181   1e-47    
ref|WP_002790918.1|  RNA polymerase sigma factor                        181   1e-47    
ref|WP_002782870.1|  RNA polymerase sigma factor rpoD3                  180   2e-47    
ref|WP_036616142.1|  RNA polymerase sigma factor                        182   3e-47    
ref|WP_017326070.1|  hypothetical protein                               181   3e-47    
ref|WP_018398551.1|  RNA polymerase sigma factor                        180   3e-47    
gb|EKQ71084.1|  RNA polymerase sigma factor, cyanobacterial RpoD-...    182   4e-47    
ref|WP_002761297.1|  RNA polymerase sigma factor                        179   4e-47    
ref|WP_008199027.1|  RNA polymerase sigma factor                        179   6e-47    
ref|WP_017714813.1|  RNA polymerase sigma factor SigC                   182   7e-47    
ref|WP_015191629.1|  RNA polymerase, sigma 70 subunit, RpoD subfa...    180   1e-46    
gb|AFP65672.1|  RNA-polymerase sigma factor                             182   2e-46    
ref|WP_008233573.1|  Cyanobacteria-specific RpoD-like sigma facto...    179   2e-46    
ref|WP_036030486.1|  RNA polymerase sigma factor SigC                   179   2e-46    
ref|WP_015227046.1|  RpoD subfamily RNA polymerase sigma-70 subunit     179   3e-46    
ref|WP_017299165.1|  hypothetical protein                               179   3e-46    
ref|WP_013322297.1|  RNA polymerase sigma factor SigC                   180   4e-46    
ref|WP_013321507.1|  RNA polymerase sigma factor                        176   6e-46    
ref|WP_013732278.1|  RNA polymerase sigma factor                        177   7e-46    
ref|WP_016872734.1|  RNA polymerase sigma factor                        178   7e-46    
ref|WP_007456891.1|  RNA polymerase sigma factor                        176   1e-45    
ref|WP_037221191.1|  RNA polymerase sigma factor                        178   1e-45    
ref|WP_035987770.1|  RNA polymerase sigma factor                        176   1e-45    
emb|CDN14121.1|  Cyanobacteria-specific RpoD-like sigma factor, t...    177   1e-45    
gb|EWM65257.1|  RNA polymerase principal sigma factor SigB              176   1e-45    
ref|WP_016861675.1|  RNA polymerase sigma factor                        177   1e-45    
ref|WP_017312428.1|  RNA polymerase sigma factor                        177   2e-45    
ref|WP_035987353.1|  RNA polymerase sigma factor                        177   3e-45    
ref|WP_035760005.1|  RNA polymerase sigma factor                        174   3e-45    
ref|WP_036001574.1|  RNA polymerase sigma factor                        176   3e-45    
ref|WP_006622657.1|  RNA polymerase sigma factor                        174   4e-45    
ref|WP_006617776.1|  RNA polymerase sigma factor                        174   4e-45    
ref|WP_027844250.1|  RNA polymerase sigma factor                        176   4e-45    
ref|WP_013284771.1|  MULTISPECIES: RNA polymerase sigma factor          174   5e-45    
ref|WP_019508255.1|  hypothetical protein                               175   5e-45    
ref|WP_006098067.1|  RNA polymerase sigma factor                        175   6e-45    
ref|WP_018785996.1|  RNA polymerase sigma factor                        174   6e-45    
ref|WP_015083407.1|  RpoD family RNA polymerase sigma factor SigE       176   6e-45    
ref|WP_017327858.1|  hypothetical protein                               174   7e-45    
ref|WP_015194125.1|  RNA polymerase, sigma 70 subunit, RpoD subfa...    173   7e-45    
ref|WP_008054282.1|  RNA polymerase sigma factor                        174   8e-45    
ref|WP_016866539.1|  RNA polymerase sigma factor                        175   9e-45    
ref|WP_035158447.1|  RNA polymerase sigma factor                        174   9e-45    
ref|WP_012626060.1|  RNA polymerase sigma factor                        174   9e-45    
ref|WP_006510917.1|  RNA polymerase sigma factor, cyanobacterial ...    173   1e-44    
gb|KFB82371.1|  RNA polymerase sigma factor                             175   1e-44    
ref|WP_024544660.1|  RNA polymerase sigma factor SigC                   175   1e-44    
ref|WP_026719111.1|  RNA polymerase sigma factor                        175   1e-44    
ref|WP_009454317.1|  MULTISPECIES: RNA polymerase sigma factor          175   1e-44    
ref|WP_039739214.1|  RNA polymerase sigma factor                        175   1e-44    
ref|WP_027402234.1|  RNA polymerase sigma factor                        175   1e-44    
ref|WP_012305904.1|  RNA polymerase sigma factor SigC                   175   1e-44    
ref|WP_030006065.1|  RNA polymerase sigma factor SigC                   175   1e-44    
ref|WP_015163011.1|  RpoD subfamily RNA polymerase sigma-70 subunit     172   1e-44    
ref|WP_017319617.1|  RNA polymerase sigma factor                        174   1e-44    
ref|WP_012413167.1|  RNA polymerase sigma factor                        172   1e-44    
ref|WP_011434275.1|  RNA polymerase sigma factor SigC                   174   2e-44    
ref|WP_011318042.1|  RNA polymerase sigma factor                        174   2e-44    
ref|WP_014274110.1|  group 2 RNA polymerase sigma factor SigD           172   2e-44    
ref|XP_001712214.1|  rpoD                                               176   2e-44    Hemiselmis andersenii
ref|WP_016864299.1|  RNA polymerase sigma factor                        172   3e-44    
ref|WP_026734798.1|  RNA polymerase sigma factor                        173   3e-44    
ref|WP_033375375.1|  RNA polymerase sigma factor                        171   3e-44    
ref|WP_015121468.1|  RNA polymerase sigma factor, cyanobacterial ...    173   3e-44    
ref|WP_009456183.1|  MULTISPECIES: RNA polymerase sigma factor          171   4e-44    
ref|WP_039716965.1|  RNA polymerase sigma factor                        171   4e-44    
ref|WP_030337412.1|  RNA polymerase sigma factor SigB                   171   5e-44    
ref|WP_015178894.1|  RNA polymerase, sigma 70 subunit, RpoD subfa...    172   5e-44    
ref|WP_039714940.1|  RNA polymerase sigma factor SigC                   174   5e-44    
ref|WP_017309882.1|  RNA polymerase sigma factor                        171   5e-44    
ref|WP_015227673.1|  RpoD subfamily RNA polymerase sigma-70 subunit     173   5e-44    
ref|WP_015364264.1|  RNA polymerase, sigma 70 subunit, RpoD subfa...    171   6e-44    
ref|WP_011430851.1|  RNA polymerase sigma factor SigC                   172   6e-44    
ref|WP_015114702.1|  RpoD subfamily RNA polymerase sigma-70 subunit     172   6e-44    
ref|WP_015135175.1|  RpoD subfamily RNA polymerase sigma-70 subunit     172   6e-44    
ref|WP_039200267.1|  RNA polymerase sigma factor                        172   7e-44    
ref|WP_026206947.1|  RNA polymerase sigma factor SigB                   171   7e-44    
ref|WP_009148755.1|  RNA polymerase sigma factor SigC                   173   7e-44    
ref|WP_016953126.1|  RNA polymerase sigma factor                        172   7e-44    
ref|WP_015152358.1|  RNA polymerase, sigma subunit, RpsC/SigC           173   7e-44    
ref|WP_026720446.1|  RNA polymerase sigma factor                        170   8e-44    
ref|WP_015155343.1|  RpoD subfamily RNA polymerase sigma-70 subunit     170   8e-44    
ref|WP_026097712.1|  RNA polymerase sigma factor SigC                   173   8e-44    
ref|WP_017316251.1|  RNA polymerase sigma factor                        172   8e-44    
ref|WP_013192486.1|  RNA polymerase sigma factor                        172   9e-44    
ref|WP_015956473.1|  RNA polymerase sigma factor                        170   9e-44    
ref|WP_015212692.1|  RNA polymerase, sigma 70 subunit, RpoD subfa...    172   1e-43    
ref|WP_033374969.1|  RNA polymerase sigma factor SigC                   170   1e-43    
ref|WP_012181632.1|  RNA polymerase sigma factor                        170   1e-43    
ref|WP_019506980.1|  RNA polymerase sigma factor                        170   1e-43    
ref|WP_011143751.1|  RNA polymerase sigma factor SigC                   171   1e-43    
gb|EEP74122.1|  sigma-70 region 2 domain-containing protein             170   1e-43    Micromonospora sp. ATCC 39149
ref|WP_017656193.1|  RNA polymerase sigma factor                        170   1e-43    
ref|WP_011613739.1|  RNA polymerase sigma factor                        172   1e-43    
ref|WP_017299116.1|  RNA polymerase sigma factor                        170   1e-43    
ref|WP_011934516.1|  RNA polymerase sigma factor                        170   1e-43    
ref|WP_038017230.1|  RNA polymerase sigma factor                        171   1e-43    
ref|WP_006276735.1|  RNA polymerase sigma factor                        170   1e-43    
ref|WP_036374855.1|  RNA polymerase sigma factor SigB                   170   1e-43    
ref|WP_015114783.1|  RpoD subfamily RNA polymerase sigma-70 subunit     170   1e-43    
ref|WP_028084629.1|  RNA polymerase sigma factor                        171   2e-43    
ref|WP_006634048.1|  RNA polymerase sigma factor                        171   2e-43    
ref|WP_010998387.1|  RNA polymerase sigma factor                        171   2e-43    
ref|WP_038542649.1|  RNA polymerase sigma70                             170   2e-43    
dbj|BAB87262.1|  RNA polymerase sigma factor                            174   2e-43    Guillardia theta
ref|WP_023075830.1|  rna polymerase sigma factor                        169   2e-43    
ref|WP_017307580.1|  RNA polymerase sigma factor                        170   2e-43    
ref|WP_017294941.1|  hypothetical protein                               169   2e-43    
ref|WP_009342359.1|  RNA polymerase sigma factor                        169   2e-43    
ref|WP_009768864.1|  RNA polymerase sigma factor, cyanobacterial ...    169   2e-43    
ref|WP_018587510.1|  RNA polymerase sigma factor                        169   2e-43    
ref|WP_008276791.1|  RNA polymerase sigma factor                        169   2e-43    
dbj|BAA11832.1|  chloroplast RNA polymerase sigma subunit               175   2e-43    Cyanidium caldarium
ref|WP_015200470.1|  RpoD subfamily RNA polymerase sigma-70 subunit     171   3e-43    
ref|WP_013190087.1|  RNA polymerase sigma factor                        169   3e-43    
ref|WP_009545244.1|  MULTISPECIES: RNA polymerase sigma factor          169   3e-43    
dbj|BAP17692.1|  RNA polymerase sigma factor SigD                       169   3e-43    
ref|XP_003079732.1|  SigA (ISS)                                         174   3e-43    
ref|WP_033665690.1|  RNA polymerase sigma factor SigB                   169   3e-43    
ref|WP_009785765.1|  RNA polymerase sigma factor                        169   3e-43    
ref|WP_006510827.1|  RNA polymerase sigma factor, cyanobacterial ...    170   3e-43    
ref|WP_012407118.1|  RNA polymerase sigma factor                        170   3e-43    
ref|WP_017651329.1|  RNA polymerase sigma factor                        171   3e-43    
ref|WP_031291900.1|  RNA polymerase sigma factor SigC                   171   3e-43    
gb|ESA37825.1|  rna sigma                                               171   3e-43    
ref|WP_038080586.1|  RNA polymerase sigma factor                        171   3e-43    
ref|WP_016872512.1|  RNA polymerase sigma factor                        169   3e-43    
ref|WP_029019968.1|  RNA polymerase sigma factor SigB                   169   4e-43    
ref|WP_036021406.1|  RNA polymerase sigma factor                        169   4e-43    
ref|WP_015138714.1|  RNA polymerase sigma factor, cyanobacterial ...    170   4e-43    
ref|WP_015155366.1|  RpoD subfamily RNA polymerase sigma-70 subunit     171   4e-43    
ref|WP_015128224.1|  RpoD subfamily RNA polymerase sigma-70 subunit     168   4e-43    
ref|WP_012164269.1|  RNA polymerase sigma factor                        168   4e-43    
ref|WP_010475110.1|  RNA polymerase sigma factor                        168   4e-43    
ref|WP_029631058.1|  RNA polymerase sigma factor [                      169   4e-43    
ref|WP_015220109.1|  RpoD subfamily RNA polymerase sigma-70 subunit     168   4e-43    
ref|WP_017747774.1|  RNA polymerase sigma factor                        170   5e-43    
ref|WP_019494357.1|  RNA polymerase sigma factor                        168   5e-43    
ref|WP_015183361.1|  RNA polymerase, sigma subunit, RpsC/SigC           171   5e-43    
ref|WP_026732505.1|  RNA polymerase sigma factor                        168   5e-43    
gb|EDX84110.1|  RNA polymerase sigma factor, cyanobacterial RpoD-...    172   5e-43    Synechococcus sp. PCC 7335
ref|WP_019486907.1|  RNA polymerase sigma factor                        169   5e-43    
ref|WP_017320557.1|  RNA polymerase sigma factor                        168   5e-43    
ref|XP_001757475.1|  predicted protein                                  174   5e-43    
ref|WP_015187150.1|  RNA polymerase, sigma 70 subunit, RpoD subfa...    170   5e-43    
gb|EKV03154.1|  RNA polymerase sigma factor, cyanobacterial RpoD-...    170   6e-43    
ref|WP_035998314.1|  RNA polymerase sigma factor SigC                   171   6e-43    
ref|WP_006514862.1|  RNA polymerase sigma factor, cyanobacterial ...    168   6e-43    
ref|WP_015133900.1|  RpoD subfamily RNA polymerase sigma-70 subunit     168   6e-43    
ref|WP_018219098.1|  RNA polymerase sigma factor                        168   6e-43    
ref|WP_039780631.1|  RNA polymerase sigma factor                        168   6e-43    
ref|WP_023069022.1|  RNA polymerase sigma factor rpoD2                  167   7e-43    
ref|WP_028953351.1|  RNA polymerase sigma70                             168   7e-43    
ref|WP_015188758.1|  RNA polymerase, sigma subunit, RpsC/SigC           170   7e-43    
ref|WP_038651635.1|  RNA polymerase sigma factor RpoD                   170   8e-43    
ref|WP_010467783.1|  RNA polymerase sigma factor                        168   8e-43    
ref|WP_029028922.1|  RNA polymerase sigma factor SigB                   167   8e-43    
ref|WP_016869371.1|  RNA polymerase sigma factor                        167   9e-43    
ref|WP_015173804.1|  RpoD subfamily RNA polymerase sigma-70 subunit     169   9e-43    
ref|WP_017656177.1|  RNA polymerase sigma factor                        167   9e-43    
ref|WP_015133087.1|  RNA polymerase, sigma subunit, RpsC/SigC           169   1e-42    
ref|XP_001713512.1|  RNA-polymerase sigma factor                        171   1e-42    
ref|WP_009788445.1|  RNA polymerase sigma factor                        167   1e-42    
ref|WP_027841279.1|  RNA polymerase sigma factor                        167   1e-42    
ref|WP_016879207.1|  RNA polymerase sigma factor                        167   1e-42    
gb|AAB39998.1|  sigma factor                                            169   1e-42    
ref|WP_011358981.1|  RNA polymerase sigma factor                        167   1e-42    
ref|WP_039725405.1|  RNA polymerase sigma factor SigC                   169   1e-42    
ref|WP_015174477.1|  RNA polymerase, sigma 70 subunit, RpoD subfa...    167   1e-42    
ref|WP_011823292.1|  RNA polymerase sigma factor RpoD                   169   1e-42    
ref|WP_023073305.1|  rna polymerase sigma cyanobacterial -like fa...    169   1e-42    
ref|WP_011363132.1|  RNA polymerase sigma factor                        167   1e-42    
gb|AAG00589.1|AF288784_1  SigC                                          169   1e-42    
ref|WP_039717750.1|  RNA polymerase sigma factor                        168   1e-42    
emb|CEF98266.1|  RNA polymerase sigma-70 region 2                       173   1e-42    
ref|WP_039726144.1|  RNA polymerase sigma factor                        167   1e-42    
ref|WP_006633882.1|  RNA polymerase sigma factor                        167   1e-42    
ref|WP_015181223.1|  RNA polymerase sigma factor, cyanobacterial ...    168   1e-42    
ref|WP_012412038.1|  RNA polymerase sigma factor                        167   1e-42    
ref|XP_011025491.1|  PREDICTED: RNA polymerase sigma factor sigD,...    169   2e-42    
ref|WP_036906895.1|  RNA polymerase sigma factor RpoD                   169   2e-42    
ref|WP_039710154.1|  RNA polymerase sigma factor                        167   2e-42    
ref|WP_039729682.1|  RNA polymerase sigma factor                        168   2e-42    
ref|WP_015203230.1|  RpoD subfamily RNA polymerase sigma-70 subunit     168   2e-42    
ref|WP_012954599.1|  RNA polymerase sigma factor                        166   2e-42    
ref|WP_006196582.1|  RNA polymerase sigma factor                        167   2e-42    
ref|WP_011431421.1|  elongation factor GreAB                            167   2e-42    
gb|AHJ27327.1|  Cyanobacteria-specific RpoD-like sigma factor, ty...    166   2e-42    
ref|WP_006529140.1|  RNA polymerase sigma factor, cyanobacterial ...    167   2e-42    
ref|WP_015204630.1|  RpoD subfamily RNA polymerase sigma-70 subunit     166   2e-42    
ref|WP_011244555.1|  RNA polymerase sigma factor SigC                   168   2e-42    
ref|WP_015115086.1|  RpoD subfamily RNA polymerase sigma-70 subunit     167   2e-42    
dbj|BAM45409.1|  sigma factor 2                                         172   2e-42    
ref|WP_015624782.1|  sigma-70 region 2 domain-containing protein        167   2e-42    
ref|WP_017300067.1|  hypothetical protein                               169   2e-42    
ref|WP_017307569.1|  RNA polymerase sigma factor                        167   2e-42    
ref|WP_011318691.1|  RNA polymerase sigma factor                        166   2e-42    
ref|WP_008226289.1|  Cyanobacteria-specific RpoD-like sigma facto...    166   3e-42    
ref|XP_006379084.1|  hypothetical protein POPTR_0009s06210g             169   3e-42    
ref|WP_015218367.1|  RpoD subfamily RNA polymerase sigma-70 subunit     167   3e-42    
ref|WP_024544575.1|  RNA polymerase sigma factor                        167   3e-42    
ref|WP_028954150.1|  RNA polymerase sigma factor SigC                   168   3e-42    
ref|WP_017285734.1|  RNA polymerase sigma factor                        166   3e-42    
ref|WP_006516765.1|  RNA polymerase, sigma subunit, RpsC/SigC           169   3e-42    
ref|XP_001757584.1|  predicted protein                                  171   3e-42    
ref|WP_011432306.1|  elongation factor GreAB                            167   3e-42    
ref|WP_012162824.1|  RNA polymerase sigma factor                        166   3e-42    
ref|WP_035985672.1|  RNA polymerase sigma factor SigC                   168   3e-42    
ref|WP_010993943.1|  RNA polymerase sigma factor                        166   4e-42    
ref|WP_030006142.1|  RNA polymerase sigma factor                        167   4e-42    
ref|WP_029633688.1|  RNA polymerase sigma factor [                      167   4e-42    
ref|WP_016870592.1|  RNA polymerase sigma factor                        166   4e-42    
ref|WP_012305998.1|  RNA polymerase sigma factor                        167   4e-42    
ref|WP_038556319.1|  RNA polymerase sigma factor RpoD                   169   4e-42    
ref|WP_015221517.1|  RpoD subfamily RNA polymerase sigma-70 subunit     165   5e-42    
ref|WP_036005471.1|  RNA polymerase sigma factor                        165   5e-42    
ref|WP_026098076.1|  RNA polymerase sigma factor                        165   5e-42    
ref|WP_015208099.1|  RNA polymerase sigma factor, cyanobacterial ...    167   5e-42    
ref|WP_026148680.1|  RNA polymerase sigma factor                        167   5e-42    
ref|WP_018728453.1|  RNA polymerase sigma factor                        166   5e-42    
gb|ABQ42602.1|  chloroplast RNA-polymerase sigma factor precursor       167   5e-42    
ref|WP_011360447.1|  RNA polymerase sigma factor RpoD                   168   7e-42    
ref|WP_015229474.1|  RNA polymerase sigma factor, cyanobacterial ...    166   7e-42    
ref|WP_012596303.1|  MULTISPECIES: RNA polymerase sigma factor          165   7e-42    
ref|WP_011294461.1|  RNA polymerase sigma factor RpoD                   167   7e-42    
ref|WP_015221886.1|  RpoD subfamily RNA polymerase sigma-70 subunit     166   7e-42    
ref|XP_003239821.1|  RNA-polymerase sigma factor                        167   8e-42    
ref|WP_015210375.1|  RNA polymerase sigma factor, cyanobacterial ...    166   8e-42    
ref|WP_036483956.1|  RNA polymerase sigma factor SigC                   167   8e-42    
ref|WP_009555331.1|  RNA polymerase, sigma subunit, RpsC/SigC           167   8e-42    
ref|WP_015206419.1|  RNA polymerase sigma factor, cyanobacterial ...    165   8e-42    
ref|YP_002049481.1|  RNA polymerase sigma factor                        168   8e-42    
ref|WP_022604966.1|  RNA polymerase sigma factor (RpoD-like family)     166   9e-42    
gb|AII46674.1|  RNA polymerase sigma factor                             165   9e-42    
ref|WP_015173425.1|  RNA polymerase, sigma subunit, RpsC/SigC           167   9e-42    
ref|WP_008314618.1|  RNA polymerase sigma factor, cyanobacterial ...    166   9e-42    
ref|WP_022605855.1|  RNA polymerase sigma factor, cyanobacterial ...    164   9e-42    
ref|WP_009789238.1|  RNA polymerase sigma factor RpoD                   168   9e-42    
ref|WP_016871586.1|  RNA polymerase sigma factor                        165   1e-41    
ref|WP_035997048.1|  RNA polymerase sigma factor                        165   1e-41    
ref|WP_011363683.1|  RNA polymerase sigma factor RpoD                   167   1e-41    
ref|WP_036480341.1|  RNA polymerase sigma factor                        164   1e-41    
ref|WP_038016765.1|  RNA polymerase sigma factor SigC                   166   1e-41    
ref|WP_015200175.1|  RpoD subfamily RNA polymerase sigma-70 subunit     164   1e-41    
gb|EDX85679.1|  RNA polymerase sigma factor, cyanobacterial RpoD-...    167   1e-41    
gb|KFF41770.1|  RNA polymerase sigma factor, cyanobacterial RpoD-...    164   1e-41    
ref|WP_038545720.1|  RNA polymerase sigma factor RpoD                   164   1e-41    
ref|WP_036897481.1|  RNA polymerase sigma factor RpoD                   166   1e-41    
ref|WP_016951833.1|  RNA polymerase sigma factor                        164   2e-41    
ref|WP_019475092.1|  RNA polymerase sigma factor RpoD                   166   2e-41    
ref|WP_015123987.1|  RNA polymerase sigma factor, cyanobacterial ...    166   2e-41    
ref|YP_002049100.1|  type II alternative RNA polymerase sigma fac...    164   2e-41    
ref|WP_010997951.1|  RNA polymerase sigma factor                        164   2e-41    
emb|CBI24961.3|  unnamed protein product                                164   2e-41    
ref|WP_013423381.1|  RNA polymerase sigma 70                            166   2e-41    
ref|WP_018746127.1|  RNA polymerase sigma factor                        164   2e-41    
gb|AHF63128.1|  Sigma-70 factor                                         167   2e-41    
ref|WP_019504081.1|  hypothetical protein                               166   2e-41    
gb|KEI67892.1|  SigA                                                    164   2e-41    
ref|WP_015954827.1|  RNA polymerase sigma factor SigC                   166   2e-41    
ref|WP_006195301.1|  RNA polymerase sigma factor                        165   2e-41    
ref|WP_018396976.1|  hypothetical protein                               165   2e-41    
emb|CBN79861.1|  chloroplast RNA-polymerase sigma factor precursor      170   2e-41    
ref|XP_001418397.1|  predicted protein                                  164   2e-41    
ref|WP_012627132.1|  RNA polymerase sigma factor                        163   2e-41    
ref|WP_026100047.1|  RNA polymerase sigma factor                        163   3e-41    
ref|WP_017296697.1|  hypothetical protein                               163   3e-41    
ref|WP_008313776.1|  RNA polymerase sigma factor, cyanobacterial ...    163   3e-41    
dbj|BAB87264.1|  RNA polymerase sigma factor                            166   3e-41    
ref|WP_015141008.1|  RNA polymerase sigma factor, cyanobacterial ...    163   3e-41    
ref|WP_008314117.1|  RNA polymerase sigma factor, cyanobacterial ...    163   3e-41    
ref|WP_011819876.1|  RNA polymerase sigma factor RpoD                   165   3e-41    
ref|WP_036901201.1|  RNA polymerase sigma factor RpoD                   166   3e-41    
gb|AHJ28278.1|  Cyanobacteria-specific RpoD-like sigma factor, ty...    164   3e-41    
ref|WP_039203234.1|  RNA polymerase sigma factor                        163   4e-41    
ref|WP_035931778.1|  RNA polymerase sigma70                             165   4e-41    
ref|WP_011935306.1|  RNA polymerase sigma factor RpoD                   165   4e-41    
ref|WP_015228677.1|  RNA polymerase sigma factor, cyanobacterial ...    164   4e-41    
ref|WP_015214763.1|  RNA polymerase, sigma 70 subunit, RpoD subfa...    162   4e-41    
ref|WP_019871301.1|  RNA polymerase sigma factor                        163   4e-41    
ref|WP_025926138.1|  RNA polymerase sigma factor RpoD                   164   4e-41    
ref|WP_025945754.1|  MULTISPECIES: RNA polymerase sigma factor RpoD     164   4e-41    
ref|WP_025955336.1|  RNA polymerase sigma factor RpoD                   164   4e-41    
ref|WP_026323627.1|  RNA polymerase sigma factor SigB                   163   5e-41    
ref|WP_030006383.1|  RNA polymerase sigma factor                        162   5e-41    
ref|WP_019478440.1|  RNA polymerase sigma factor RpoD                   164   5e-41    
ref|WP_016871755.1|  RNA polymerase sigma factor                        162   5e-41    
ref|WP_025929923.1|  RNA polymerase sigma factor RpoD                   164   5e-41    
ref|WP_011376056.1|  RNA polymerase sigma factor RpoD                   164   5e-41    
ref|WP_015203707.1|  RNA polymerase, sigma subunit, RpsC/SigC           165   5e-41    
ref|WP_015116573.1|  RNA polymerase sigma factor, cyanobacterial ...    162   5e-41    
ref|WP_014694083.1|  RNA polymerase sigma factor                        162   5e-41    
ref|WP_002805209.1|  RNA polymerase sigma factor RpoD                   164   5e-41    
ref|WP_024125761.1|  group 2 RNA polymerase sigma-70 subunit SigB       162   5e-41    
ref|WP_025914315.1|  RNA polymerase sigma factor RpoD                   164   5e-41    
ref|WP_012627241.1|  RNA polymerase sigma factor SigC                   166   5e-41    
ref|WP_009343574.1|  RNA polymerase sigma factor SigC                   165   6e-41    
ref|XP_010269782.1|  PREDICTED: RNA polymerase sigma factor sigD,...    166   6e-41    
ref|WP_032526796.1|  RNA polymerase sigma factor RpoD                   164   6e-41    
ref|WP_009454913.1|  RNA polymerase sigma factor                        162   6e-41    
ref|WP_015208835.1|  RNA polymerase sigma factor, cyanobacterial ...    164   6e-41    
ref|WP_007357246.1|  MULTISPECIES: RNA polymerase sigma factor          162   6e-41    
ref|WP_036534557.1|  RNA polymerase sigma factor SigC                   165   6e-41    
ref|XP_002272444.2|  PREDICTED: RNA polymerase sigma factor sigD,...    165   6e-41    
ref|WP_018399704.1|  RNA polymerase sigma factor                        162   6e-41    
ref|WP_027404959.1|  RNA polymerase sigma factor                        162   6e-41    
ref|WP_012307443.1|  RNA polymerase sigma factor                        162   6e-41    
ref|WP_035991983.1|  RNA polymerase sigma factor                        162   6e-41    
ref|WP_006527945.1|  RNA polymerase sigma factor, cyanobacterial ...    162   6e-41    
ref|WP_011128643.1|  RNA polymerase sigma factor RpoD                   166   7e-41    
ref|WP_019504635.1|  RNA polymerase sigma factor RpoD                   164   7e-41    
ref|WP_015195117.1|  RNA polymerase, sigma 70 subunit, RpoD subfa...    163   7e-41    
ref|WP_012007320.1|  RNA polymerase sigma factor RpoD                   164   7e-41    
ref|WP_036923371.1|  RNA polymerase sigma factor RpoD                   162   7e-41    
ref|WP_035150351.1|  RNA polymerase sigma factor                        162   7e-41    
ref|WP_028084705.1|  RNA polymerase sigma factor                        162   8e-41    
ref|WP_032514870.1|  RNA polymerase sigma factor RpoD                   164   8e-41    
ref|WP_025960325.1|  RNA polymerase sigma factor RpoD                   164   8e-41    
ref|WP_011378168.1|  RNA polymerase sigma factor                        162   8e-41    
ref|WP_032517801.1|  RNA polymerase sigma factor RpoD                   164   8e-41    
ref|WP_035154934.1|  RNA polymerase sigma factor                        162   8e-41    
ref|WP_018736759.1|  RNA polymerase sigma factor                        162   8e-41    
ref|WP_032519424.1|  RNA polymerase sigma factor RpoD                   164   8e-41    
ref|WP_029634766.1|  RNA polymerase sigma factor [                      162   8e-41    
ref|WP_015145104.1|  RNA polymerase sigma factor, cyanobacterial ...    163   8e-41    
ref|WP_016864722.1|  RNA polymerase sigma factor                        162   8e-41    
ref|WP_026787803.1|  MULTISPECIES: RNA polymerase sigma factor RpoD     164   8e-41    
ref|WP_017306598.1|  RNA polymerase sigma factor RpoD                   163   9e-41    
ref|WP_006277325.1|  RNA polymerase sigma factor                        164   9e-41    
ref|WP_018352861.1|  hypothetical protein                               161   9e-41    
ref|WP_025964657.1|  RNA polymerase sigma factor RpoD                   164   9e-41    
gb|AII42744.1|  RNA polymerase sigma factor RpoD                        162   9e-41    
ref|WP_025931515.1|  MULTISPECIES: RNA polymerase sigma factor RpoD     164   9e-41    
ref|WP_025980881.1|  RNA polymerase sigma factor RpoD                   164   9e-41    
ref|WP_025973773.1|  RNA polymerase sigma factor RpoD                   164   9e-41    
ref|WP_011818005.1|  RNA polymerase sigma factor RpoD                   164   9e-41    
ref|WP_026788246.1|  MULTISPECIES: RNA polymerase sigma factor          162   9e-41    
dbj|BAA22190.1|  RpoD2 protein                                          162   9e-41    
ref|WP_012307623.1|  MULTISPECIES: RNA polymerase sigma factor RpoD     163   1e-40    
ref|WP_011126980.1|  RNA polymerase sigma factor                        162   1e-40    
ref|WP_025981223.1|  RNA polymerase sigma factor RpoD                   164   1e-40    
ref|WP_020461887.1|  RNA polymerase sigma 70                            164   1e-40    
gb|KEI67364.1|  SigA                                                    164   1e-40    
ref|WP_025894144.1|  MULTISPECIES: RNA polymerase sigma factor RpoD     164   1e-40    
ref|WP_015080422.1|  RpoD family RNA polymerase sigma subunit SigD      162   1e-40    
ref|WP_025941422.1|  RNA polymerase sigma factor RpoD                   164   1e-40    
ref|WP_019475598.1|  RNA polymerase sigma factor RpoD                   163   1e-40    
ref|WP_002748790.1|  RNA polymerase sigma factor                        163   1e-40    
ref|WP_025953539.1|  RNA polymerase sigma factor RpoD                   163   1e-40    
ref|WP_025942216.1|  MULTISPECIES: RNA polymerase sigma factor RpoD     163   1e-40    
ref|WP_025887735.1|  MULTISPECIES: RNA polymerase sigma factor RpoD     163   1e-40    
ref|WP_018399753.1|  RNA polymerase sigma factor RpoD                   163   1e-40    
ref|WP_008182019.1|  RNA polymerase sigma factor RpoD                   163   1e-40    
ref|WP_025970648.1|  RNA polymerase sigma factor RpoD                   163   1e-40    
ref|WP_038077692.1|  RNA polymerase sigma factor                        161   1e-40    
ref|WP_015147576.1|  RNA polymerase sigma factor, cyanobacterial ...    161   1e-40    
ref|WP_032524682.1|  RNA polymerase sigma factor RpoD                   163   1e-40    
ref|WP_027842167.1|  RNA polymerase sigma factor                        161   1e-40    
ref|WP_035925303.1|  RNA polymerase sigma70                             164   1e-40    
ref|WP_025925092.1|  MULTISPECIES: RNA polymerase sigma factor RpoD     163   1e-40    
ref|WP_017307561.1|  RNA polymerase sigma factor                        162   1e-40    
ref|WP_015199943.1|  RpoD subfamily RNA polymerase sigma-70 subunit     162   1e-40    
ref|WP_009341423.1|  RNA polymerase sigma factor                        162   1e-40    
ref|WP_025929226.1|  RNA polymerase sigma factor RpoD                   163   1e-40    
ref|WP_025954001.1|  RNA polymerase sigma factor RpoD                   163   1e-40    
ref|WP_034937910.1|  RNA polymerase sigma factor SigC                   162   1e-40    
ref|WP_011862516.1|  RNA polymerase sigma factor RpoD                   163   1e-40    
gb|AIQ94564.1|  Group 2 RNA polymerasee sigma factor RNA polymera...    163   1e-40    
ref|WP_015172027.1|  RpoD subfamily RNA polymerase sigma-70 subunit     161   1e-40    
ref|WP_025952492.1|  RNA polymerase sigma factor RpoD                   163   1e-40    
gb|KGG14595.1|  Cyanobacteria-specific RpoD-like sigma factor           162   1e-40    
ref|WP_026795410.1|  MULTISPECIES: RNA polymerase sigma factor RpoD     163   1e-40    
ref|WP_032522483.1|  RNA polymerase sigma factor RpoD                   163   1e-40    
ref|WP_007305096.1|  RNA polymerase sigma factor                        161   1e-40    



>ref|XP_004235299.1| PREDICTED: RNA polymerase sigma factor sigA [Solanum lycopersicum]
Length=509

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/509 (71%), Positives = 437/509 (86%), Gaps = 1/509 (0%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM T  ++GLSAGKRLL SSFYYSD  EKLSC SDH+LPCHQV +V + + AKKSS+YS 
Sbjct  1     MMATTAVIGLSAGKRLLSSSFYYSDLNEKLSCSSDHSLPCHQVPTVKNVISAKKSSDYSP  60

Query  1624  SCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQ-Kqsseeenqledllllqkfml  1448
             SCVS++++ S+KA+KEHV +AS+  +++   +R +QLQ +   EE++ +E LLLLQK ML
Sbjct  61    SCVSSRKLQSVKALKEHVDIASDPSDVQSWFERFEQLQNESDDEEDDSVEVLLLLQKSML  120

Query  1447  ekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKR  1268
             EKQWNLSAE++    T  + NCK + + CSGTSARRRR+D+R++++ QK+S   I  +K 
Sbjct  121   EKQWNLSAEETLTASTQRKKNCKKMHIACSGTSARRRRMDSRQRVLAQKSSATPISATKP  180

Query  1267  VRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDP  1088
             +RSI+G + LQN LKGYVKGIVSEELLTH EV++LSK IK+GL++EEQKSRLKERLGC+P
Sbjct  181   LRSILGPDLLQNRLKGYVKGIVSEELLTHTEVLQLSKKIKVGLHVEEQKSRLKERLGCEP  240

Query  1087  SEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  908
             S++QLAVSL++SRTDL+ T+IECSLARE+L+MSNVRLVMSIAQRYDNMGAEMADL+QGGL
Sbjct  241   SDDQLAVSLKMSRTDLQSTLIECSLARERLSMSNVRLVMSIAQRYDNMGAEMADLVQGGL  300

Query  907   VGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETK  728
             +GLLRGIEKFDPSKGYK+STYVYWWIRQG+SR LV+NS  LRLP HLH RL LIRNA+ +
Sbjct  301   IGLLRGIEKFDPSKGYKISTYVYWWIRQGVSRTLVENSRTLRLPTHLHERLGLIRNAKMR  360

Query  727   LKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADS  548
             L++KGI PS++ IA SLN+S+KKV NATEA SKV+SLDRE FPS++GLPG +LHSYIAD+
Sbjct  361   LEEKGINPSVNNIAASLNMSQKKVRNATEASSKVYSLDREVFPSLNGLPGTTLHSYIADN  420

Query  547   HLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRE  368
             HLENNPWH VD  ALKDEVNNLI +TL+EREREIIRLY+GL +ECLTWEDISKRIGLSRE
Sbjct  421   HLENNPWHGVDVWALKDEVNNLISSTLREREREIIRLYYGLDSECLTWEDISKRIGLSRE  480

Query  367   RVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RVRQVGLVA EKLKHAARK RL AML+KQ
Sbjct  481   RVRQVGLVALEKLKHAARKRRLDAMLIKQ  509



>ref|XP_009771934.1| PREDICTED: RNA polymerase sigma factor sigA [Nicotiana sylvestris]
Length=508

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/508 (70%), Positives = 432/508 (85%), Gaps = 0/508 (0%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLSAGKRLL SSFYYSD  EKL+C SDH+LPCH V S+ + + AKKSS+YS 
Sbjct  1     MMSTAAVIGLSAGKRLLSSSFYYSDLNEKLTCTSDHSLPCHHVPSIKNVITAKKSSDYSP  60

Query  1624  SCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmle  1445
             SCVS+++  S K++KEHV + ++  ++    +  +QLQ +S +E+  +E LLLLQK MLE
Sbjct  61    SCVSSRKSQSTKSLKEHVDITADPSDVPSWFEMYEQLQNESDDEDESVEVLLLLQKSMLE  120

Query  1444  kQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKRV  1265
             KQWNLS E++       E   K + +TCSGTSARRRR+D+R++++ + +S      +K +
Sbjct  121   KQWNLSLEQTLTASPQHEKKSKKMHITCSGTSARRRRMDSRQRVLDRHSSATPTSAAKPL  180

Query  1264  RSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPS  1085
             RSIIG E LQN LKGYVKG+VSEELLTH EV++LSK I++GLYLEEQKSRLKERLGC+PS
Sbjct  181   RSIIGPELLQNRLKGYVKGVVSEELLTHAEVLQLSKKIQVGLYLEEQKSRLKERLGCEPS  240

Query  1084  EEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLV  905
             ++QLAVSL++SRTDL+ T+IECSLARE+LAMSNVRLVMSIAQRYDN+GAEMADL+QGGL+
Sbjct  241   DDQLAVSLKMSRTDLQSTLIECSLARERLAMSNVRLVMSIAQRYDNVGAEMADLVQGGLI  300

Query  904   GLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL  725
             GLLRGIEKFDPSKGYK+STYVYWWIRQG+SRALV+NS  LRLP +LH RLSLIRNA+ +L
Sbjct  301   GLLRGIEKFDPSKGYKISTYVYWWIRQGVSRALVENSRTLRLPTYLHERLSLIRNAKARL  360

Query  724   KDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSH  545
             ++KGITPS++ IA SLN+S+KKV NATEA SK++SLDREAFPS++GLPGE+LHSYIAD+H
Sbjct  361   EEKGITPSVNNIAASLNMSQKKVRNATEASSKMYSLDREAFPSLNGLPGETLHSYIADNH  420

Query  544   LENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRER  365
             LENNPWH VD  ALKDEVNNLI +TL++REREIIRLY+GL NECLTWEDISKRIGLSRER
Sbjct  421   LENNPWHGVDVWALKDEVNNLISSTLRDREREIIRLYYGLDNECLTWEDISKRIGLSRER  480

Query  364   VRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             VRQVGLVA EKLKHAARK +L AML+KQ
Sbjct  481   VRQVGLVALEKLKHAARKRQLDAMLIKQ  508



>dbj|BAA88921.1| sigma factor [Nicotiana tabacum]
Length=508

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/508 (70%), Positives = 432/508 (85%), Gaps = 0/508 (0%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLSAGKRLL SSFYYSD  EKL+C SDH+LPCH V S+ + + AKKSS+YS 
Sbjct  1     MMSTAAVIGLSAGKRLLSSSFYYSDLNEKLTCTSDHSLPCHHVPSIKNVITAKKSSDYSP  60

Query  1624  SCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmle  1445
             SCVS+++  S K++KEHV + ++  ++    +  +QLQ +S +E+  +E LLLLQK MLE
Sbjct  61    SCVSSRKSQSAKSLKEHVDITADPSDVPSWFEMYEQLQNESDDEDESVEVLLLLQKSMLE  120

Query  1444  kQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKRV  1265
             KQWNLS E++       E   K + +TCSGTSARRRR+D+R++++ + +S      +K +
Sbjct  121   KQWNLSLEQTLTASPQHEKKSKKMHITCSGTSARRRRMDSRQRVLDRHSSATPTSAAKPL  180

Query  1264  RSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPS  1085
             RSIIG E LQN LKGYVKG+VSEELLTH EV++LSK I++GLYLEEQKSRLKERLGC+PS
Sbjct  181   RSIIGPELLQNRLKGYVKGVVSEELLTHAEVLQLSKKIQVGLYLEEQKSRLKERLGCEPS  240

Query  1084  EEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLV  905
             ++QLAVSL++SRTDL+ T+IECSLARE+LAMSNVRLVMSIAQRYDN+GAEMADL+QGGL+
Sbjct  241   DDQLAVSLKMSRTDLQSTLIECSLARERLAMSNVRLVMSIAQRYDNVGAEMADLVQGGLI  300

Query  904   GLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL  725
             GLLRGIEKFDPSKGYK+STYVYWWIRQG+SRALV+NS  LRLP +LH RLSLIRNA+ +L
Sbjct  301   GLLRGIEKFDPSKGYKISTYVYWWIRQGVSRALVENSRTLRLPTYLHERLSLIRNAKARL  360

Query  724   KDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSH  545
             ++KGITPS++ IA SLN+S+KKV NATEA SK++SLDREAFPS++GLPGE+LHSYIAD+H
Sbjct  361   EEKGITPSVNNIAASLNMSQKKVRNATEASSKMYSLDREAFPSLNGLPGETLHSYIADNH  420

Query  544   LENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRER  365
             LENNPWH VD  ALKDEVNNLI +TL++REREIIRLY+GL NECLTWEDISKRIGLSRER
Sbjct  421   LENNPWHGVDVWALKDEVNNLISSTLRDREREIIRLYYGLDNECLTWEDISKRIGLSRER  480

Query  364   VRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             VRQVGLVA EKLKHAARK +L AML+KQ
Sbjct  481   VRQVGLVALEKLKHAARKRQLDAMLIKQ  508



>ref|XP_009601815.1| PREDICTED: RNA polymerase sigma factor sigA-like [Nicotiana tomentosiformis]
Length=508

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/508 (70%), Positives = 432/508 (85%), Gaps = 0/508 (0%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLSAGKRLL SSFYYSD  EKL+C S H+LPCHQV SV + + AKKSS+YS 
Sbjct  1     MMATAAVIGLSAGKRLLSSSFYYSDLNEKLNCTSGHSLPCHQVPSVKNVITAKKSSDYSP  60

Query  1624  SCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmle  1445
             SCVS+++  S KA+KEHV +  +  ++    +  +QLQ +S +E++ +E LLLLQK MLE
Sbjct  61    SCVSSRKPQSAKALKEHVDITDDPSDVPSWFEMYEQLQNESDDEDDSVEVLLLLQKSMLE  120

Query  1444  kQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKRV  1265
             KQWNLS E++ +     E   K   +TCSGTSARRRR+D+R++++ + +S      +K +
Sbjct  121   KQWNLSLEQTLIASPQHEKKSKKTHITCSGTSARRRRMDSRQRVLDRNSSATPTIAAKPL  180

Query  1264  RSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPS  1085
             RSIIG E LQN LKGYVKG+VSEELLTH EV++LSK I++GLYLEEQKSRLKERLGC+PS
Sbjct  181   RSIIGPELLQNRLKGYVKGVVSEELLTHAEVLQLSKKIQVGLYLEEQKSRLKERLGCEPS  240

Query  1084  EEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLV  905
             ++QLAVSL++SRTDL+ T+IECSLARE+LAMSNVRLVMSIAQRYDN+GAEMADL+QGGL+
Sbjct  241   DDQLAVSLKMSRTDLQSTLIECSLARERLAMSNVRLVMSIAQRYDNVGAEMADLVQGGLI  300

Query  904   GLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL  725
             GLLRGIEKFDPSKGYK+STYVYWWIRQG+SRALV+NS  LRLP +LH RLSLIRNA+T+L
Sbjct  301   GLLRGIEKFDPSKGYKISTYVYWWIRQGVSRALVENSRTLRLPTYLHERLSLIRNAKTRL  360

Query  724   KDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSH  545
             ++KGI PS++ IA SLN+S+KKV NATEA SK++SLDREAFPS++GLPGE+LHSYIAD+H
Sbjct  361   EEKGIIPSVNDIAASLNMSQKKVRNATEASSKMYSLDREAFPSLNGLPGETLHSYIADNH  420

Query  544   LENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRER  365
             LENNPWH VD  ALKDEVNNLI +TL++REREIIRLY+GL NECLTWEDISKRIGLSRER
Sbjct  421   LENNPWHGVDIWALKDEVNNLISSTLRDREREIIRLYYGLDNECLTWEDISKRIGLSRER  480

Query  364   VRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             VRQVGLVA EKLKHAARK +L AML+KQ
Sbjct  481   VRQVGLVALEKLKHAARKRQLDAMLIKQ  508



>ref|XP_009629626.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Nicotiana 
tomentosiformis]
Length=502

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/505 (72%), Positives = 418/505 (83%), Gaps = 7/505 (1%)
 Frame = -1

Query  1789  TIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTSCVSN  1610
              I+GLSAG R+L SSFYYSD  EK  C SDH LPCH   S  + + AK SSNYS S VSN
Sbjct  3     AIIGLSAGNRILSSSFYYSDLTEKF-CVSDHALPCHHFPSPKNVINAKNSSNYSPSYVSN  61

Query  1609  QRMHSIKAIKEHVTVASNL-FNMEPCVQRNKQLQKqsseeenqledllllqkfmlekQWN  1433
             ++  S+KA+KEHV +ASN   + EP VQ  KQLQ  S  EE+ +E LLLLQK MLEKQWN
Sbjct  62    RKKQSVKALKEHVDIASNRDSDTEPWVQMFKQLQNGSCSEEDSVEVLLLLQKSMLEKQWN  121

Query  1432  LSAEKSTMTYTTMENNCKN-IQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKRVRSI  1256
             LSAEK+     T ENNCK  +Q+TCSGTSARRRR+DTR++ +  KNS     +SKR+RS+
Sbjct  122   LSAEKAM----TNENNCKKKMQITCSGTSARRRRMDTRKRDLLPKNSATSDSSSKRLRSV  177

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             IG E LQN  KGY+ G+V +ELLTH EVV+LSK IK GLYLEEQKSRLKERLGC+PS++Q
Sbjct  178   IGPELLQNRSKGYINGVVGQELLTHTEVVQLSKKIKFGLYLEEQKSRLKERLGCEPSDDQ  237

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA+SL+ISR DL+ T+IECSLAREKLAMSNVRLVMSIAQRYD  G EMADLIQGGL+GLL
Sbjct  238   LAISLKISRADLRSTLIECSLAREKLAMSNVRLVMSIAQRYDTNGTEMADLIQGGLIGLL  297

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RLSLIRNA+ KLK+ 
Sbjct  298   RGIEKFDHSRGFKISTYVYWWIRQGVSRALVENSRTLRLPIHLHERLSLIRNAKIKLKEN  357

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GITPSI++IAE LN+S+KKV NATEA SKVFSLDREAFPS++GLPGE+LHSYIAD+ LEN
Sbjct  358   GITPSIEKIAECLNMSQKKVRNATEASSKVFSLDREAFPSLNGLPGETLHSYIADNRLEN  417

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
              PWH VDE  LKDEVNNLI +TL+EREREI+RLY+GL NECLTWEDIS+RIGLSRERVRQ
Sbjct  418   IPWHGVDEWMLKDEVNNLISSTLREREREIVRLYYGLDNECLTWEDISRRIGLSRERVRQ  477

Query  355   VGLVAFEKLKHAARKNRLKAMLVKQ  281
             VGLVA EKLKHAARK RL AMLVK 
Sbjct  478   VGLVALEKLKHAARKRRLDAMLVKH  502



>ref|XP_006347341.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006347342.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Solanum 
tuberosum]
Length=505

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/508 (69%), Positives = 421/508 (83%), Gaps = 4/508 (1%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M  A ++GL AG R+L SSFYYSD  EKL+C  DH L C+   +V   + AKKSSNYST 
Sbjct  1     MAIAAVIGLYAGNRILSSSFYYSDLTEKLACSGDHALICNPTWNV---INAKKSSNYSTG  57

Query  1621  CVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmlek  1442
              VSN++  S+KA+KEHV +ASN  ++EP V+  K+LQ +S  EE+ +E LLLLQK MLEK
Sbjct  58    YVSNRKKQSVKAVKEHVNIASNHSDVEPMVEMFKKLQNESFSEEDSVEVLLLLQKSMLEK  117

Query  1441  QWNLSAEKSTMTYTTMENNCKN-IQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKRV  1265
             QWNLSAEK+   +   E NCK  +Q+TCSGTSARRRR+DTR+++   K S A    SKR+
Sbjct  118   QWNLSAEKTLAAFPPNEKNCKKKMQITCSGTSARRRRMDTRKRVQIPKTSAAANSASKRL  177

Query  1264  RSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPS  1085
             RS++G E  QN L+GY+KG+V++ELLTH EVV+LSK IK GLYLEEQK+ LKERLGC+PS
Sbjct  178   RSVVGPELQQNRLRGYMKGVVNQELLTHKEVVQLSKKIKFGLYLEEQKASLKERLGCEPS  237

Query  1084  EEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLV  905
             ++QLAVSL++S  DL+ T++ECSLAREKLAMSNVRLVMSIAQRYD+MG EMADLIQGGL+
Sbjct  238   DDQLAVSLKMSLADLRSTLMECSLAREKLAMSNVRLVMSIAQRYDSMGTEMADLIQGGLI  297

Query  904   GLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL  725
             GLLRGIEKFD S+G+K+STYVYWWIRQG+SRALV NS  LRLP HLH RLSLIRNA+ KL
Sbjct  298   GLLRGIEKFDHSRGFKISTYVYWWIRQGVSRALVDNSRTLRLPIHLHERLSLIRNAKVKL  357

Query  724   KDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSH  545
             KD GITPSI++IAE LN+S+KKV NATEA SKVFSLDREA+PS++GLPG +LHSYIAD+ 
Sbjct  358   KDNGITPSIEKIAECLNMSQKKVRNATEASSKVFSLDREAYPSLNGLPGATLHSYIADNR  417

Query  544   LENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRER  365
             LENNPWH VD  ALKDEVNNLI +TL+ERER+I+RLY+GL NECLTWEDIS+RIGLSRER
Sbjct  418   LENNPWHGVDGWALKDEVNNLISSTLRERERDIVRLYYGLDNECLTWEDISRRIGLSRER  477

Query  364   VRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             VRQVGLVA EKLKHAARK +L AMLVK 
Sbjct  478   VRQVGLVALEKLKHAARKKQLDAMLVKH  505



>dbj|BAA88922.1| sigma factor [Nicotiana tabacum]
Length=502

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/505 (72%), Positives = 417/505 (83%), Gaps = 7/505 (1%)
 Frame = -1

Query  1789  TIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTSCVSN  1610
              I+GLSAG R+L SSFYYS   EK  C SDH LPCH   S  + + AK SSNYS S VSN
Sbjct  3     AIIGLSAGNRILSSSFYYSVLTEKF-CVSDHALPCHHFPSPKNVINAKNSSNYSPSYVSN  61

Query  1609  QRMHSIKAIKEHVTVASNL-FNMEPCVQRNKQLQKqsseeenqledllllqkfmlekQWN  1433
             ++  S+KA+KEHV +ASN   + EP VQ  KQLQ  S  EE+ +E LLLLQK MLEKQWN
Sbjct  62    RKKQSVKALKEHVDIASNRDSDTEPWVQMFKQLQNGSCSEEDSVEVLLLLQKSMLEKQWN  121

Query  1432  LSAEKSTMTYTTMENNCKN-IQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKRVRSI  1256
             LSAEK+     T ENNCK  +Q+TCSGTSARRRR+DTR++ +  KNS     +SKR+RS+
Sbjct  122   LSAEKAM----TNENNCKKKMQITCSGTSARRRRMDTRKRDLLPKNSATSDSSSKRLRSV  177

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             IG E LQN  KGY+ G+V +ELLTH EVV+LSK IK GLYLEEQKSRLKERLGC+PS++Q
Sbjct  178   IGPELLQNRSKGYINGVVGQELLTHTEVVQLSKKIKFGLYLEEQKSRLKERLGCEPSDDQ  237

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA+SL+ISR DL+ T+IECSLAREKLAMSNVRLVMSIAQRYD  G EMADLIQGGL+GLL
Sbjct  238   LAISLKISRADLRSTLIECSLAREKLAMSNVRLVMSIAQRYDTNGTEMADLIQGGLIGLL  297

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RLSLIRNA+ KLK+ 
Sbjct  298   RGIEKFDHSRGFKISTYVYWWIRQGVSRALVENSRTLRLPIHLHERLSLIRNAKIKLKEN  357

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GITPSI++IAE LN+S+KKV NATEA SKVFSLDREAFPS++GLPGE+LHSYIAD+ LEN
Sbjct  358   GITPSIEKIAECLNMSQKKVRNATEASSKVFSLDREAFPSLNGLPGETLHSYIADNRLEN  417

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
              PWH VDE  LKDEVNNLI +TL+EREREI+RLY+GL NECLTWEDIS+RIGLSRERVRQ
Sbjct  418   IPWHGVDEWMLKDEVNNLISSTLREREREIVRLYYGLDNECLTWEDISRRIGLSRERVRQ  477

Query  355   VGLVAFEKLKHAARKNRLKAMLVKQ  281
             VGLVA EKLKHAARK RL AMLVK 
Sbjct  478   VGLVALEKLKHAARKRRLDAMLVKH  502



>ref|XP_009767654.1| PREDICTED: RNA polymerase sigma factor sigA-like [Nicotiana sylvestris]
Length=504

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/505 (71%), Positives = 416/505 (82%), Gaps = 5/505 (1%)
 Frame = -1

Query  1789  TIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTSCVSN  1610
              I+GLSAG R+L SSF YSD  EKLSC SD   PCHQ  S  + + AKKSSNYS S VSN
Sbjct  3     AIIGLSAGNRILSSSFSYSDLTEKLSCASD---PCHQFPSTKNVINAKKSSNYSPSYVSN  59

Query  1609  QRMHSIKAIKEHVTVASNLFN-MEPCVQRNKQLQKqsseeenqledllllqkfmlekQWN  1433
             ++  S+KA+KEHV +ASN  +  EP VQ  KQLQ  S  EE+ +E LLLLQK MLE QWN
Sbjct  60    RKKQSVKALKEHVDIASNRDSYTEPWVQMFKQLQNGSCSEEDSVEVLLLLQKSMLENQWN  119

Query  1432  LSAEKS-TMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKRVRSI  1256
             LSAEK+ T +    +N+ K +Q+TCSGTSARRRR+DTR++ +  KNS     +SKR+R +
Sbjct  120   LSAEKAMTDSLQNEKNSKKKMQITCSGTSARRRRMDTRKRDLLPKNSATSDSSSKRLRPV  179

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             IG E LQN  KGY+ G+V +ELLTH EVV+LSK IK GLYLEEQKSRLKERLGC+PS++Q
Sbjct  180   IGPELLQNRSKGYINGVVGQELLTHTEVVQLSKKIKFGLYLEEQKSRLKERLGCEPSDDQ  239

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LAVSL+ISR DL+ T+IECSLAREKLAMSNVRLVMSIAQRYD  G EMADLIQGGL+GLL
Sbjct  240   LAVSLKISRADLRSTLIECSLAREKLAMSNVRLVMSIAQRYDTTGTEMADLIQGGLIGLL  299

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RLSLIRNA+ KLK+ 
Sbjct  300   RGIEKFDHSRGFKISTYVYWWIRQGVSRALVENSRTLRLPIHLHERLSLIRNAKIKLKEN  359

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GITPSI++IAE LN+S+KKV NATEA SKVFSLDREAFPS++GLPGE+LHSYIAD+ LEN
Sbjct  360   GITPSIEKIAECLNMSQKKVRNATEASSKVFSLDREAFPSLNGLPGETLHSYIADNRLEN  419

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
              PWH VDE  LKDEVNNLI +TL+ERE EIIRLY+GL NECLTWEDIS+RIGLSRERVRQ
Sbjct  420   IPWHGVDEWMLKDEVNNLISSTLRERESEIIRLYYGLDNECLTWEDISRRIGLSRERVRQ  479

Query  355   VGLVAFEKLKHAARKNRLKAMLVKQ  281
             VGLVA EKLKHAAR+ RL AMLVK 
Sbjct  480   VGLVALEKLKHAARRRRLDAMLVKH  504



>ref|XP_009629625.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/516 (70%), Positives = 415/516 (80%), Gaps = 18/516 (3%)
 Frame = -1

Query  1789  TIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTSCVSN  1610
              I+GLSAG R+L SSFYYSD  EK  C SDH LPCH   S  + + AK SSNYS S VSN
Sbjct  3     AIIGLSAGNRILSSSFYYSDLTEKF-CVSDHALPCHHFPSPKNVINAKNSSNYSPSYVSN  61

Query  1609  QRMHSIKAIKEHVTVASNL-FNMEPCVQRNKQLQKqsseeenqledllll----------  1463
             ++  S+KA+KEHV +ASN   + EP VQ  KQLQ  S  EE+ +++              
Sbjct  62    RKKQSVKALKEHVDIASNRDSDTEPWVQMFKQLQNGSCSEEDSVQNGSCSEEDSVEVLLL  121

Query  1462  -qkfmlekQWNLSAEKSTMTYTTMENNCKN-IQVTCSGTSArrrridtrrqiiqQKNSVA  1289
              QK MLEKQWNLSAEK+     T ENNCK  +Q+TCSGTSARRRR+DTR++ +  KNS  
Sbjct  122   LQKSMLEKQWNLSAEKAM----TNENNCKKKMQITCSGTSARRRRMDTRKRDLLPKNSAT  177

Query  1288  KIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLK  1109
                +SKR+RS+IG E LQN  KGY+ G+V +ELLTH EVV+LSK IK GLYLEEQKSRLK
Sbjct  178   SDSSSKRLRSVIGPELLQNRSKGYINGVVGQELLTHTEVVQLSKKIKFGLYLEEQKSRLK  237

Query  1108  ERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMA  929
             ERLGC+PS++QLA+SL+ISR DL+ T+IECSLAREKLAMSNVRLVMSIAQRYD  G EMA
Sbjct  238   ERLGCEPSDDQLAISLKISRADLRSTLIECSLAREKLAMSNVRLVMSIAQRYDTNGTEMA  297

Query  928   DLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSL  749
             DLIQGGL+GLLRGIEKFD S+G+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RLSL
Sbjct  298   DLIQGGLIGLLRGIEKFDHSRGFKISTYVYWWIRQGVSRALVENSRTLRLPIHLHERLSL  357

Query  748   IRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESL  569
             IRNA+ KLK+ GITPSI++IAE LN+S+KKV NATEA SKVFSLDREAFPS++GLPGE+L
Sbjct  358   IRNAKIKLKENGITPSIEKIAECLNMSQKKVRNATEASSKVFSLDREAFPSLNGLPGETL  417

Query  568   HSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISK  389
             HSYIAD+ LEN PWH VDE  LKDEVNNLI +TL+EREREI+RLY+GL NECLTWEDIS+
Sbjct  418   HSYIADNRLENIPWHGVDEWMLKDEVNNLISSTLREREREIVRLYYGLDNECLTWEDISR  477

Query  388   RIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RIGLSRERVRQVGLVA EKLKHAARK RL AMLVK 
Sbjct  478   RIGLSRERVRQVGLVALEKLKHAARKRRLDAMLVKH  513



>ref|XP_004241445.1| PREDICTED: RNA polymerase sigma factor sigA [Solanum lycopersicum]
 ref|XP_010322501.1| PREDICTED: RNA polymerase sigma factor sigA [Solanum lycopersicum]
Length=505

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/508 (69%), Positives = 416/508 (82%), Gaps = 4/508 (1%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M  A ++G  AG R+L SSFYYSD  EKL+C  DH L C+   +V   + AKKSSNYS  
Sbjct  1     MAIAAVIGPYAGNRILSSSFYYSDLTEKLACSGDHALICNPTRNV---INAKKSSNYSAG  57

Query  1621  CVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmlek  1442
              VSN++  S+KA+KEHV +ASN  ++EP V+  K+LQ +S  +E+ +E LLLLQK MLEK
Sbjct  58    YVSNRKKQSVKAVKEHVNIASNHSDVEPMVEMLKKLQNESCSKEDPVEVLLLLQKSMLEK  117

Query  1441  QWNLSAEKSTMTYTTMENNCKN-IQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKRV  1265
             QWNLSAEK+   +   E NCK  +Q+TCSGTSARRRR+DTR+++   K S      SKR+
Sbjct  118   QWNLSAEKTLEAFPPNEKNCKKKMQITCSGTSARRRRMDTRKRVQIPKASAEANSASKRL  177

Query  1264  RSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPS  1085
             RS++G E  QN L+GY+ G+V++ELLTH EVV+LSK IK GLYLEEQK+ LKERLGC+PS
Sbjct  178   RSVVGPELQQNRLRGYMNGVVNQELLTHKEVVQLSKKIKFGLYLEEQKASLKERLGCEPS  237

Query  1084  EEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLV  905
             ++QLAVSL++S  DL+ T++ECSLAREKLAMSNVRLVMSIAQRYD+MG EMADLIQGGL+
Sbjct  238   DDQLAVSLKMSLADLRSTLMECSLAREKLAMSNVRLVMSIAQRYDSMGTEMADLIQGGLI  297

Query  904   GLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL  725
             GLLRGIEKFD S+G+K+STYVYWWIRQG+SRALV NS  LRLP HLH RLSLIRNA+ KL
Sbjct  298   GLLRGIEKFDHSRGFKISTYVYWWIRQGVSRALVDNSRTLRLPIHLHERLSLIRNAKVKL  357

Query  724   KDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSH  545
             KD GITPSI++IAE LN+S+KKV NATEA SKVFSLDREA+PS++GLPG +LHSYIAD+ 
Sbjct  358   KDSGITPSIEKIAECLNMSQKKVRNATEASSKVFSLDREAYPSLNGLPGATLHSYIADNR  417

Query  544   LENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRER  365
             LENNPWH VD  ALKDEVNNLI + L+ERER+IIRLY+GL NECLTWEDIS+RIGLSRER
Sbjct  418   LENNPWHGVDGWALKDEVNNLISSILRERERDIIRLYYGLDNECLTWEDISRRIGLSRER  477

Query  364   VRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             VRQVGLVA EKLKHAARK +L AMLVK 
Sbjct  478   VRQVGLVALEKLKHAARKKQLDAMLVKH  505



>ref|XP_011075762.1| PREDICTED: RNA polymerase sigma factor sigA [Sesamum indicum]
Length=505

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/511 (67%), Positives = 419/511 (82%), Gaps = 10/511 (2%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSS-FYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYS  1628
             +M TA ++GLS GKRLL SS F YSD  +KL+C +D   P +Q+ S  + + AKKSSN+ 
Sbjct  2     IMATAAVIGLSTGKRLLLSSTFSYSDLSDKLACTTD---PHYQIASTKNAITAKKSSNF-  57

Query  1627  TSCVSNQRMH-SIKAIKEHVTVASNLFNMEPCVQRNKQLQ-Kqsseeenqledllllqkf  1454
                +SN+R   S++A+KEHV  ASN   +EP +     L   ++++ E  ++ +LLLQK 
Sbjct  58    ---ISNRRPPASVRALKEHVDTASNNCTLEPWLIHGSTLSTDETTDPEYLVDAVLLLQKS  114

Query  1453  mlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTS  1274
             MLEKQWNLSAE +T      +     I+VTCSGTSARRRR+D+R++I+ +K   +++ TS
Sbjct  115   MLEKQWNLSAETTTKAVIPKDRARNKIEVTCSGTSARRRRMDSRKKILGRKFPASQLTTS  174

Query  1273  KRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGC  1094
             ++ RSI+  E LQN LKGYVKG+VSEELLTH +VV+LS+ IK GL LEEQKSRLKERLG 
Sbjct  175   RQWRSIVSPELLQNRLKGYVKGVVSEELLTHAQVVQLSEKIKAGLLLEEQKSRLKERLGF  234

Query  1093  DPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQG  914
             +PS+EQLA SLRISRT+L+  +IECSLAR+KLAMSN+RLVMSIAQRYDNMGAEMADLIQG
Sbjct  235   EPSDEQLATSLRISRTNLQSKLIECSLARDKLAMSNIRLVMSIAQRYDNMGAEMADLIQG  294

Query  913   GLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAE  734
             GL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RLSLIRNA+
Sbjct  295   GLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPTHLHERLSLIRNAK  354

Query  733   TKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIA  554
              +L++KGITPSIDRIAE LN+S+KKV NATEA++KVFSLDREAFPS++GLPGE+LHSYIA
Sbjct  355   ARLEEKGITPSIDRIAECLNMSQKKVKNATEAITKVFSLDREAFPSLNGLPGETLHSYIA  414

Query  553   DSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLS  374
             D+H+ENNPWH VDE ALKDEV+ LI+ TL+EREREIIRLY+GL NECLTWEDIS+RIGLS
Sbjct  415   DNHVENNPWHGVDEWALKDEVDKLINLTLREREREIIRLYYGLDNECLTWEDISRRIGLS  474

Query  373   RERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RERVRQVGLVA EKLKHAARK RL  MLV+ 
Sbjct  475   RERVRQVGLVALEKLKHAARKRRLDTMLVQH  505



>ref|XP_002524027.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis]
 gb|EEF38395.1| RNA polymerase sigma factor rpoD, putative [Ricinus communis]
Length=508

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/508 (67%), Positives = 408/508 (80%), Gaps = 1/508 (0%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++GLSAGKRLL S+FYYSD  EKLS  ++H L  +Q+ S  + ++AKKSSNY  S
Sbjct  1     MATAAVIGLSAGKRLLSSTFYYSDLTEKLSSANEHGLTHYQITSTKTLIVAKKSSNYGPS  60

Query  1621  CVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmle  1445
               S N+   SIKA+KEHV  AS         +    ++++SS+ +  +E LLLLQK MLE
Sbjct  61    FPSSNRNTQSIKALKEHVDTASAPSTAATQFKTFNDMEEESSDLDYSVEALLLLQKSMLE  120

Query  1444  kQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKRV  1265
             KQWNLS E++  + +    + K I VTCSG SAR+RRI+ RR+ + Q     + +  K++
Sbjct  121   KQWNLSFERTDSSDSPSRKSQKKIPVTCSGVSARQRRINIRRKNLSQSKFTVQANVFKQL  180

Query  1264  RSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPS  1085
             +S +  E LQN LKGYVKG+VSEELL+H EVV LS++IK GL LE+ KSRLKERLGCDPS
Sbjct  181   KSAVSPELLQNRLKGYVKGVVSEELLSHAEVVRLSRIIKAGLSLEDHKSRLKERLGCDPS  240

Query  1084  EEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLV  905
             +EQ+A SL+ISR +L+   I CSLAREKLAMSNVRLVMSIAQRYDNMGAEMADL+QGGL+
Sbjct  241   DEQVATSLKISRAELQSKSIACSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLVQGGLI  300

Query  904   GLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL  725
             GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+ +L
Sbjct  301   GLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKIRL  360

Query  724   KDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSH  545
             ++KG+TPSIDRIAESLNIS+KKV NATEAVSKVFSLDREAFPS++GLPGE+ HSYIAD+ 
Sbjct  361   EEKGVTPSIDRIAESLNISQKKVRNATEAVSKVFSLDREAFPSLNGLPGETHHSYIADNC  420

Query  544   LENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRER  365
             LENNPWH VD+ ALKDEVN LI+ TL+ERE+EIIRLY+GL NE LTWEDISKRIGLSRER
Sbjct  421   LENNPWHGVDDWALKDEVNKLINLTLQEREQEIIRLYYGLDNESLTWEDISKRIGLSRER  480

Query  364   VRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             VRQVGLVA EKLKHAARK +L+AMLVK 
Sbjct  481   VRQVGLVALEKLKHAARKKKLEAMLVKH  508



>ref|XP_007029766.1| Sigma factor A isoform 1 [Theobroma cacao]
 gb|EOY10268.1| Sigma factor A isoform 1 [Theobroma cacao]
Length=508

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/509 (68%), Positives = 408/509 (80%), Gaps = 2/509 (0%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GL+ GKRLL SSF YSD  EKLS  +D+    HQ  S  S ++AKKSSN S 
Sbjct  1     MMATAAVIGLTTGKRLLSSSFSYSDIIEKLSYANDYGSSHHQTSSTKSLIVAKKSSNCSQ  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfml  1448
             S  S N+R  SIKA+KEHV  AS +   EP  Q +  L+ +S + +  +E LLLLQK ML
Sbjct  61    SLPSSNRRAQSIKALKEHVDSASIVSTAEPLFQGSNDLEVESYDLDYSVEALLLLQKSML  120

Query  1447  ekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKR  1268
             EKQW LS E++  T +      K I VTCSG SAR+RR +T+R+I+ Q  S+ + + +K+
Sbjct  121   EKQWTLSFERTVFTESPSRKIHKKIPVTCSGVSARQRRFNTKRKILIQNKSIIQPN-AKQ  179

Query  1267  VRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDP  1088
             +RS+I  E LQ+ LKGYVKG+VS+ELL+H EVV LSK IK GL LEE + RLKERLGC+P
Sbjct  180   LRSLISPELLQSRLKGYVKGVVSDELLSHAEVVRLSKKIKAGLSLEEHRLRLKERLGCEP  239

Query  1087  SEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  908
             S+EQLA SL+ISR +L+  +IECSLAREKLAMSNVRLVMSIAQRYDNMGAEM+DLIQGGL
Sbjct  240   SDEQLATSLKISRAELRSKLIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMSDLIQGGL  299

Query  907   VGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETK  728
             +GLLRGIEKFD SKGYK+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+ +
Sbjct  300   IGLLRGIEKFDSSKGYKISTYVYWWIRQGVSRALVENSRTLRLPTHLHERLGLIRNAKIR  359

Query  727   LKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADS  548
             L++KGITP+IDRIAESLN+S+KKV NATEAVSKVFSLDR+AFPS++GLPGE+ HSYIAD+
Sbjct  360   LEEKGITPTIDRIAESLNMSQKKVRNATEAVSKVFSLDRDAFPSLNGLPGETHHSYIADN  419

Query  547   HLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRE  368
             H+EN PWH VDE ALKDEVN LI  TL EREREIIRLY+GL  E LTWEDISKRIGLSRE
Sbjct  420   HVENIPWHGVDEWALKDEVNRLITITLGEREREIIRLYYGLDKESLTWEDISKRIGLSRE  479

Query  367   RVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RVRQVGLVA EKLKHAARK +++AMLVK 
Sbjct  480   RVRQVGLVALEKLKHAARKKKMEAMLVKH  508



>ref|XP_002325882.1| RNA POLYMERASE SIGMA SUBUNIT 1 family protein [Populus trichocarpa]
 gb|EEF00264.1| RNA POLYMERASE SIGMA SUBUNIT 1 family protein [Populus trichocarpa]
Length=509

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/509 (65%), Positives = 405/509 (80%), Gaps = 1/509 (0%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLS+GKRLL SSFYYSD  EKLS  +DH +  +   +  + ++AKKSSNY  
Sbjct  1     MMATAAVIGLSSGKRLLSSSFYYSDLTEKLSNVNDHGITYYPTATTKNVIVAKKSSNYGP  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfml  1448
             S  S N+  HSIKA+KEHV  AS   N+    +     +++SS  +  +E LLLLQK ML
Sbjct  61    SFPSSNRNSHSIKALKEHVDTASASSNVATWFKTFDDFEEESSALDYSVEALLLLQKSML  120

Query  1447  ekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKR  1268
             EKQWNLS E++  + +T + N K I VTCSG SAR+RR++ RR+   Q   +++    K 
Sbjct  121   EKQWNLSFERTNSSDSTSKKNNKKIPVTCSGVSARQRRVNNRRKNQNQSKFMSQSSDFKF  180

Query  1267  VRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDP  1088
             +RS+   + LQN LKGYVKG+VS+E+L H EVV LS++I+ GL  E+ KSRLKERLGC+P
Sbjct  181   LRSVSSPDLLQNRLKGYVKGVVSDEVLPHTEVVRLSRIIRAGLSFEDHKSRLKERLGCEP  240

Query  1087  SEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  908
             S+EQ+A SLRISR DL+  +I+CSLAREKLAMSNVRLVMSIAQ+YDNMGAEMADL+QGGL
Sbjct  241   SDEQIADSLRISRADLQSKLIQCSLAREKLAMSNVRLVMSIAQKYDNMGAEMADLVQGGL  300

Query  907   VGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETK  728
             +GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV NS  LRLP HLH RL LIRNA+ +
Sbjct  301   IGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVDNSRTLRLPNHLHERLGLIRNAKIR  360

Query  727   LKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADS  548
             L++KG+TPSIDRIAESLN+S++KV NATEA+SKVFSLDREAFPS++GLPGE+ HSYIAD+
Sbjct  361   LEEKGVTPSIDRIAESLNMSQRKVRNATEAISKVFSLDREAFPSLNGLPGETHHSYIADN  420

Query  547   HLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRE  368
               ENNPWH VDE ALK+EVN LI +TL+ERE+EIIRLYHGL  ECLTWEDISKR+GLSRE
Sbjct  421   RPENNPWHGVDEWALKEEVNKLIDSTLQEREKEIIRLYHGLDQECLTWEDISKRMGLSRE  480

Query  367   RVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RVRQVGLVA EKLKHAARK   +AMLVK 
Sbjct  481   RVRQVGLVALEKLKHAARKRNTEAMLVKH  509



>ref|XP_011012457.1| PREDICTED: RNA polymerase sigma factor sigA [Populus euphratica]
 ref|XP_011012458.1| PREDICTED: RNA polymerase sigma factor sigA [Populus euphratica]
Length=509

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/509 (66%), Positives = 404/509 (79%), Gaps = 1/509 (0%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLS GKRLL SSFYYSD  EKLS  +DH +      +  + V+AKKSSNY  
Sbjct  1     MMATAAVIGLSTGKRLLSSSFYYSDLTEKLSSVNDHGITYCPTATTKNVVVAKKSSNYGP  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfml  1448
             +  S N+  HSIKA+KEHV  AS   N+    +     +++SS  +  +E LLLLQK ML
Sbjct  61    NFPSSNRNSHSIKALKEHVDTASASSNVATWFKTFDDFEEESSALDYSVEALLLLQKSML  120

Query  1447  ekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKR  1268
             EKQWNLS E++  + +T + N K I VTCSG SAR+RR++ RR+   Q   +++    K 
Sbjct  121   EKQWNLSFERTNSSDSTSKKNNKKIPVTCSGVSARQRRVNNRRKNQNQSKFMSQSSDFKF  180

Query  1267  VRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDP  1088
             +RS+I  + LQN LKGYVKG+VS+E+L H EVV LS++I+ GL  E+ KSRLKERLGC+P
Sbjct  181   LRSVISPDLLQNRLKGYVKGVVSDEVLPHTEVVRLSRIIRAGLSFEDHKSRLKERLGCEP  240

Query  1087  SEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  908
             S+EQ+A SLRISR DL+  +I+CSLAREKLAMSNVRLVMSIAQ+YDNMGAEMADL+QGGL
Sbjct  241   SDEQIADSLRISRADLQAKLIQCSLAREKLAMSNVRLVMSIAQKYDNMGAEMADLVQGGL  300

Query  907   VGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETK  728
             +GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV NS  LRLP HLH RL LIRNA+ +
Sbjct  301   IGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVDNSRTLRLPNHLHERLGLIRNAKIR  360

Query  727   LKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADS  548
             L++KG+TPSIDRIAESLN+S++KV NATEA+SKVFSLDREAFPS++GLPGE+ HSYIAD+
Sbjct  361   LEEKGVTPSIDRIAESLNMSQRKVRNATEAISKVFSLDREAFPSLNGLPGETHHSYIADN  420

Query  547   HLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRE  368
               ENNPWH VDE ALK+EVN LI +TL+ERE+EIIRLYHGL  ECLTWEDISKR+GLSRE
Sbjct  421   RPENNPWHGVDEWALKEEVNKLIDSTLQEREKEIIRLYHGLDQECLTWEDISKRMGLSRE  480

Query  367   RVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RVRQVGLVA EKLKHAARK   +AMLVK 
Sbjct  481   RVRQVGLVALEKLKHAARKRNTEAMLVKH  509



>gb|KDP39565.1| hypothetical protein JCGZ_02585 [Jatropha curcas]
Length=508

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/508 (67%), Positives = 405/508 (80%), Gaps = 1/508 (0%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++GL AGKRLL S+FYYSD  EKL   +DH L  +Q  S  + ++AKKSSNY +S
Sbjct  1     MATAAVIGLHAGKRLLSSTFYYSDLTEKLFNVNDHGLTHYQSSSTKNVIVAKKSSNYGSS  60

Query  1621  C-VSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmle  1445
                SN+   SIKA+KEHV  AS+        +    +++ SS+ +  +E LLLLQK MLE
Sbjct  61    FQSSNRNAQSIKALKEHVDTASSPSTAATGFETFVDIEEASSDLDYSVEALLLLQKSMLE  120

Query  1444  kQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKRV  1265
             KQWNLS E++  + +    + K I +TCSG SAR+RRI+TRR+ + Q  S+ +    K++
Sbjct  121   KQWNLSFERTASSDSPSTKSQKQIPITCSGLSARQRRINTRRKNLIQSKSIVQASGFKQL  180

Query  1264  RSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPS  1085
             +S +  E L N LKGYVKGIVSEELLTH EVV LS++IK GL LEE KSRLK+RLGCDPS
Sbjct  181   KSAVSPELLLNRLKGYVKGIVSEELLTHAEVVSLSRIIKAGLSLEEHKSRLKDRLGCDPS  240

Query  1084  EEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLV  905
             +EQLA SLRIS  DL+  +I CSLAREKLAMSNVRLVMSIAQRYDNMGAEMADL+QGGL+
Sbjct  241   DEQLATSLRISLADLRSKLIACSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLVQGGLI  300

Query  904   GLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL  725
             GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+ +L
Sbjct  301   GLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKIRL  360

Query  724   KDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSH  545
             ++KG+TPSIDRIAESLN+S+KKV NATEA+SKVFSLDREAFPS++GLPGE+ HSYIAD+ 
Sbjct  361   EEKGVTPSIDRIAESLNMSQKKVRNATEAISKVFSLDREAFPSLNGLPGETHHSYIADNC  420

Query  544   LENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRER  365
              ENNPWH VDE ALKDEVN LI  TL++REREIIRLY+GL NE LTWEDISKRIGLSRER
Sbjct  421   PENNPWHGVDEWALKDEVNKLIDLTLQQREREIIRLYYGLDNETLTWEDISKRIGLSRER  480

Query  364   VRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             VRQVGLVA EKLKHAARK +L+AMLVK 
Sbjct  481   VRQVGLVALEKLKHAARKKKLEAMLVKH  508



>ref|XP_010275189.1| PREDICTED: RNA polymerase sigma factor sigA-like [Nelumbo nucifera]
 ref|XP_010275190.1| PREDICTED: RNA polymerase sigma factor sigA-like [Nelumbo nucifera]
 ref|XP_010275191.1| PREDICTED: RNA polymerase sigma factor sigA-like [Nelumbo nucifera]
Length=516

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/508 (66%), Positives = 409/508 (81%), Gaps = 3/508 (1%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++GL+AGKRLL S+FYYSD  ++L+   DH L  +Q     S V+AKKSSN+   
Sbjct  11    MATAAVIGLNAGKRLLSSTFYYSDVTDRLASVYDHGLAQYQTAPSKSVVIAKKSSNFDHD  70

Query  1621  CVSNQRMHSIKAIKEHV-TVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmle  1445
               SN+   SIKA+KEH+ T +++  +M   +Q +  L++ +S+ +  LE LLLLQK +LE
Sbjct  71    FASNRHNQSIKALKEHLNTFSTSTEDM--WLQTSDHLEEGNSDLDYSLEALLLLQKSLLE  128

Query  1444  kQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKRV  1265
             KQWNLS EKS       E   K IQVT SG SAR+RR +TR++ +   +S+ +    + +
Sbjct  129   KQWNLSFEKSMRKGAPKEETRKKIQVTRSGVSARQRRTNTRKKYLNTDSSMMQTTRRRHL  188

Query  1264  RSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPS  1085
              S++  E LQ+ LKGYVKG++SEELLTH EVV+LSK IK+G+ LEE K RLKERLGC+PS
Sbjct  189   GSMVSEELLQSRLKGYVKGVISEELLTHSEVVQLSKKIKVGISLEEHKMRLKERLGCEPS  248

Query  1084  EEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLV  905
             +EQLA SLRISR +L++ MIECSLAREK+AMSNVRLVMSIA +YDNMGAEMADL+QGGL+
Sbjct  249   DEQLATSLRISRAELQMKMIECSLAREKIAMSNVRLVMSIAHKYDNMGAEMADLVQGGLI  308

Query  904   GLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL  725
             GLLRGIEKFD SKG K+STYVYWWIRQG+SRALV+NS  LRLP H+H RLSLIRNA+ +L
Sbjct  309   GLLRGIEKFDSSKGCKISTYVYWWIRQGVSRALVENSRTLRLPSHMHERLSLIRNAKIRL  368

Query  724   KDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSH  545
             ++KGITPSIDRIAE LNIS+KKV NATEAV+KV SLDREAFPS++GLPGE+LHSYIAD+ 
Sbjct  369   EEKGITPSIDRIAECLNISQKKVRNATEAVNKVISLDREAFPSLNGLPGETLHSYIADNR  428

Query  544   LENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRER  365
             +ENNPWH VDE +LKDEVNNL++TTL+ERER+IIRLY+GL  ECLTWEDIS+RIGLSRER
Sbjct  429   IENNPWHGVDEWSLKDEVNNLLNTTLRERERDIIRLYYGLDEECLTWEDISRRIGLSRER  488

Query  364   VRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             VRQVGLVA EKLKHAARK RL AMLVK 
Sbjct  489   VRQVGLVALEKLKHAARKKRLDAMLVKH  516



>ref|XP_006484698.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Citrus 
sinensis]
 ref|XP_006484699.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Citrus 
sinensis]
 ref|XP_006484700.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X3 [Citrus 
sinensis]
Length=508

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/510 (66%), Positives = 409/510 (80%), Gaps = 4/510 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLSAGKRLL SSFYYSD  EK S  +D      QV S  + V AKKSSNY+ 
Sbjct  1     MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNP  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllllqkfm  1451
             S  S N++   IKA+KEHV   +N  +  EP  +    ++++SSE +  +E LLLLQK M
Sbjct  61    SFPSSNRQTQPIKALKEHVD--TNFASTAEPWAEPPNSIEEESSELDYSVEALLLLQKSM  118

Query  1450  lekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSK  1271
             LEKQWNLS E++ +T +  +   K + VTCSG SAR+RR++++++I+ Q  SV + + SK
Sbjct  119   LEKQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSVPQQNGSK  178

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
             ++RS+I  E +QN LKGYVKG+VSEELLTH EVV LSK IK GL L++ K RLKERLGC+
Sbjct  179   QLRSMISPELIQNHLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCE  238

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGG  911
             PS EQLA SLRISR +L+  ++ECSLAREKL MSNVRLVMSIAQRYDNMGA+MADL+QGG
Sbjct  239   PSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGG  298

Query  910   LVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAET  731
             L+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+ 
Sbjct  299   LIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKL  358

Query  730   KLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIAD  551
             +L++KG+TPS+DRIAE LN+S+KKV NATEA+ KVFSLDREAFPS++GLPGE+ HSYIAD
Sbjct  359   RLEEKGVTPSVDRIAEYLNMSQKKVRNATEAIGKVFSLDREAFPSLNGLPGETHHSYIAD  418

Query  550   SHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSR  371
             + +ENNPWH VD+ ALKDEVN LI  TL EREREIIRLY+GL  ECLTWEDISKRIGLSR
Sbjct  419   NRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWEDISKRIGLSR  478

Query  370   ERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             ERVRQVGLVA EKLKHAARK +++AMLVK 
Sbjct  479   ERVRQVGLVALEKLKHAARKKKMEAMLVKH  508



>ref|XP_006437403.1| hypothetical protein CICLE_v10031289mg [Citrus clementina]
 gb|ESR50643.1| hypothetical protein CICLE_v10031289mg [Citrus clementina]
Length=508

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/510 (66%), Positives = 409/510 (80%), Gaps = 4/510 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLSAGKRLL SSFYYSD  EK S  +D      QV S  + V AKKSSNY+ 
Sbjct  1     MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNP  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllllqkfm  1451
             S  S N++   IKA+KEHV   +N  +  EP  +    ++++SSE +  +E LLLLQK M
Sbjct  61    SFPSSNRQTQPIKALKEHVD--TNFASTAEPWAEPPNSIEEESSELDYSVEALLLLQKSM  118

Query  1450  lekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSK  1271
             LEKQWNLS E++ +T +  +   K + VTCSG SAR+RR++++++I+ Q  SV + + SK
Sbjct  119   LEKQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSVLQQNGSK  178

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
             ++RS+I  E +QN LKGYVKG+VSEELLTH EVV LSK IK GL L++ K RLKERLGC+
Sbjct  179   QLRSMISPELIQNHLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCE  238

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGG  911
             PS EQLA SLRISR +L+  ++ECSLAREKL MSNVRLVMSIAQRYDNMGA+MADLIQGG
Sbjct  239   PSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLIQGG  298

Query  910   LVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAET  731
             L+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+ 
Sbjct  299   LIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKL  358

Query  730   KLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIAD  551
             +L++KG+TP++DRIAE LN+S+KKV NATEA+ KVFSLDREAFPS++GLPGE+ HSYIAD
Sbjct  359   RLEEKGVTPAVDRIAEYLNMSQKKVRNATEAIGKVFSLDREAFPSLNGLPGETHHSYIAD  418

Query  550   SHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSR  371
             + +ENNPWH VD+ ALKDEVN LI  TL EREREIIRLY+GL  ECLTWEDISKRIGLSR
Sbjct  419   NRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWEDISKRIGLSR  478

Query  370   ERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             ERVRQVGLVA EKLKHAARK +++AMLVK 
Sbjct  479   ERVRQVGLVALEKLKHAARKKKMEAMLVKH  508



>gb|KDO48032.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
 gb|KDO48033.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=508

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/510 (66%), Positives = 409/510 (80%), Gaps = 4/510 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLSAGKRLL SSFYYSD  EK S  +D      QV S  + V AKKSSNY+ 
Sbjct  1     MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNP  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllllqkfm  1451
             S  S N++   IKA+KEHV   +N  +  EP  +    ++++SSE +  +E LLLLQK M
Sbjct  61    SFPSSNRQTQPIKALKEHVD--TNFASTAEPWAEPPNSIEEESSELDYSVEALLLLQKSM  118

Query  1450  lekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSK  1271
             LEKQWNLS E++ +T +  +   K + VTCSG SAR+RR++++++I+ Q  S+ + + SK
Sbjct  119   LEKQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSILQQNGSK  178

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
             ++RS+I  E +QN LKGYVKG+VSEELLTH EVV LSK IK GL L++ K RLKERLGC+
Sbjct  179   QLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCE  238

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGG  911
             PS EQLA SLRISR +L+  ++ECSLAREKL MSNVRLVMSIAQRYDNMGA+MADL+QGG
Sbjct  239   PSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGG  298

Query  910   LVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAET  731
             L+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+ 
Sbjct  299   LIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKL  358

Query  730   KLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIAD  551
             +L++KG+TPS+DRIAE LN+S+KKV NATEA+ KVFSLDREAFPS++GLPGE+ HSYIAD
Sbjct  359   RLEEKGVTPSVDRIAEYLNMSQKKVRNATEAIGKVFSLDREAFPSLNGLPGETHHSYIAD  418

Query  550   SHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSR  371
             + +ENNPWH VD+ ALKDEVN LI  TL EREREIIRLY+GL  ECLTWEDISKRIGLSR
Sbjct  419   NRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWEDISKRIGLSR  478

Query  370   ERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             ERVRQVGLVA EKLKHAARK +++AMLVK 
Sbjct  479   ERVRQVGLVALEKLKHAARKKKMEAMLVKH  508



>ref|XP_010266387.1| PREDICTED: RNA polymerase sigma factor sigA-like [Nelumbo nucifera]
Length=506

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/507 (66%), Positives = 402/507 (79%), Gaps = 1/507 (0%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++GLSAGKRLL S+FYYSD  ++L    DH L  +Q  S  + ++A+KSSN+  S
Sbjct  1     MATAAVIGLSAGKRLLNSTFYYSDVTDRLLSVYDHGLAQYQATSAKNVIIARKSSNFGDS  60

Query  1621  CVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmlek  1442
               SNQ + SI+A+KEHV   S     +  +Q +  L++++++ +  ++ LLLLQKF+LEK
Sbjct  61    FPSNQHIQSIRALKEHVNTLSTPSTADVWLQSSGLLEEENTDLDYSVDALLLLQKFLLEK  120

Query  1441  QWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKRVR  1262
             QWNLS E++       E   K IQVT SG SAR+RR  TRR  +  K+S+ +    K++ 
Sbjct  121   QWNLSFEQTITDGAPGEETHKKIQVTRSGVSARQRRTSTRRTCLSPKHSIMQPTKRKQLG  180

Query  1261  SIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSE  1082
             S++  E L+ S  GYVKG++SEELLTH EVV+LSK IK GL LEE K RLKERLGCDPS+
Sbjct  181   SMVSPELLK-SHYGYVKGVISEELLTHAEVVQLSKKIKAGLSLEEHKLRLKERLGCDPSD  239

Query  1081  EQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVG  902
             EQLA SLRISR +L+  +IECSLAREKL MSNVRLVMSIAQ+YDNMGAEMADL+QGGL+G
Sbjct  240   EQLASSLRISRAELQSKVIECSLAREKLTMSNVRLVMSIAQKYDNMGAEMADLVQGGLIG  299

Query  901   LLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLK  722
             LLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+ +L 
Sbjct  300   LLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPTHLHERLCLIRNAKIRLA  359

Query  721   DKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHL  542
             +KGITPSIDRIAE LN+S+KKV NATEAV+KVFSLDREAFPS++GLP E+LHSYIAD+ L
Sbjct  360   EKGITPSIDRIAECLNMSEKKVRNATEAVNKVFSLDREAFPSLNGLPRETLHSYIADNRL  419

Query  541   ENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERV  362
             ENNPWH VDE +LKDEVNNL+ TTL+ERER+IIRLY+GL  ECLTWEDIS+RIGLSRERV
Sbjct  420   ENNPWHGVDEWSLKDEVNNLLSTTLEERERDIIRLYYGLDKECLTWEDISRRIGLSRERV  479

Query  361   RQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RQVGLVA EKLKHAARK RL  MLVK 
Sbjct  480   RQVGLVALEKLKHAARKKRLDTMLVKH  506



>gb|KHG03684.1| RNA polymerase sigma factor rpoD [Gossypium arboreum]
 gb|KHG18047.1| RNA polymerase sigma factor rpoD [Gossypium arboreum]
Length=508

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/509 (66%), Positives = 403/509 (79%), Gaps = 2/509 (0%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLS GKRLL SSF YS+  +KLS   D+    +Q  S  + ++AK+SSN S 
Sbjct  1     MMATAAVIGLSTGKRLLSSSFSYSETVDKLSYAGDYGSSYYQTPSTKTLIVAKRSSNCSQ  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfml  1448
             +  S N+    IKA K HV  AS++  +EP +     L+++S + +  +E LLLLQK ML
Sbjct  61    NLPSSNRHTQLIKAFKGHVDTASSISTVEPWIHGANDLEQESYDLDCSVEALLLLQKSML  120

Query  1447  ekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKR  1268
             EKQW LS E++    +        + VTCSG SAR+RR +T+R+I+ Q  S+ + + +K+
Sbjct  121   EKQWTLSFERTMFIESPSRKTHSKVPVTCSGVSARQRRFNTKRKILSQNKSMIQPN-AKQ  179

Query  1267  VRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDP  1088
             +RS+IG E LQN LKGYVKG+VSE+LL+H EVV LSK IK GL LEE   RLKERLGC+P
Sbjct  180   LRSLIGPELLQNRLKGYVKGVVSEDLLSHAEVVRLSKKIKAGLSLEEHILRLKERLGCEP  239

Query  1087  SEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  908
             S+EQLA SL++SR +L+   IECSLAREKLAMSNVRLVMSIAQRYDNMGAEM+DLIQGGL
Sbjct  240   SDEQLATSLKVSRAELRSRSIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMSDLIQGGL  299

Query  907   VGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETK  728
             +GLLRGIEKFD SKGYK+STYVYWWIRQG+SRALV+NS  LRLP +LH RL LIRNA+ +
Sbjct  300   IGLLRGIEKFDSSKGYKISTYVYWWIRQGVSRALVENSRTLRLPTYLHERLGLIRNAKYR  359

Query  727   LKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADS  548
             L++KGITP+IDRIAESLN+S+KKV NATEAVSKVFSLDR+AFPS++GLPGE+ HSYIAD+
Sbjct  360   LEEKGITPTIDRIAESLNMSQKKVRNATEAVSKVFSLDRDAFPSLNGLPGETHHSYIADN  419

Query  547   HLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRE  368
             H+ENNPWH VDE ALKDEVN LI  TL EREREIIRLYHGL  E LTWEDISKRIGLSRE
Sbjct  420   HVENNPWHGVDEWALKDEVNRLIDITLGEREREIIRLYHGLDKESLTWEDISKRIGLSRE  479

Query  367   RVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RVRQVGLVA EKLKHAARK +++AMLVK 
Sbjct  480   RVRQVGLVALEKLKHAARKKKMEAMLVKH  508



>emb|CDP04910.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/508 (66%), Positives = 407/508 (80%), Gaps = 8/508 (2%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSD-FGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             M TA ++GLS GKRLL S+ YYSD F +KLSC  DH LP    +S NS + AK+SSN+S 
Sbjct  1     MATAAVIGLSPGKRLLSSASYYSDLFSDKLSCTCDHFLP----VSSNSVLAAKRSSNFSP  56

Query  1624  SCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmle  1445
               +S  +     A+KEH   A +L +++P +  N    ++  + E  ++ LLLLQK MLE
Sbjct  57    KFLSRHKTQPTYALKEHAETAPDLSSIQPWLHVNAD--EEFLDPEFSMQALLLLQKSMLE  114

Query  1444  kQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrr-qiiqQKNSVAKIDTSKR  1268
             KQWNLSAE   +   T       +QVT SG+SARRRRID+RR  +  +K+SV ++  S+ 
Sbjct  115   KQWNLSAENDYLVTGTPPTGKTCVQVTSSGSSARRRRIDSRRHPLSSRKSSVRQLRLSRH  174

Query  1267  VRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDP  1088
             +RSII  E LQN L GYVKG+VSEELLTH EVV+LS+ IK GL  EEQK+RL++RLGC+P
Sbjct  175   LRSIISPELLQNRLNGYVKGVVSEELLTHTEVVQLSEKIKQGLCFEEQKARLRKRLGCEP  234

Query  1087  SEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  908
             SEEQLA SL+I+R DL+   IECSLARE+LAMSNVRLVMSIAQRYDNMGAEMADLIQGGL
Sbjct  235   SEEQLATSLKITRADLQSKFIECSLARERLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  294

Query  907   VGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETK  728
             +GLLRGIEK+D SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RLSLIRNA+ +
Sbjct  295   IGLLRGIEKYDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPTHLHERLSLIRNAKIR  354

Query  727   LKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADS  548
             L++KGITPS+D+IAESLN+S+KKV NATEAV KV SLDREAFPS++GLPGE+LHSYIAD+
Sbjct  355   LEEKGITPSVDKIAESLNMSQKKVRNATEAVCKVISLDREAFPSLNGLPGETLHSYIADN  414

Query  547   HLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRE  368
              LENNPWH VD+ ALKDEVN LI +TL+ERER+IIRLY+GL NECLTWEDISKRIGLSRE
Sbjct  415   RLENNPWHGVDQWALKDEVNKLITSTLRERERDIIRLYYGLENECLTWEDISKRIGLSRE  474

Query  367   RVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             RVRQVGLVA EKLK+AARK RL+AM+ +
Sbjct  475   RVRQVGLVALEKLKYAARKRRLEAMIAR  502



>ref|XP_008462812.1| PREDICTED: RNA polymerase sigma factor sigA [Cucumis melo]
Length=509

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/511 (65%), Positives = 399/511 (78%), Gaps = 5/511 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM T  I+GL A KRLL SS YYSDF EK+   +D+ L   QV    S V+AK S+N+S 
Sbjct  1     MMATTAIIGLGAAKRLLNSSSYYSDFTEKILYANDYRLGQTQVSPTKSVVIAKSSANFSP  60

Query  1624  SCVSNQRMHS---IKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkf  1454
             S   + R HS   IKA+KEHV   S+    EP +      + + ++ +  +E LLLLQK 
Sbjct  61    SYPLSNR-HSQQCIKAVKEHVETPSSP-TAEPWLPNTTIWEDEETDLKCTVEALLLLQKS  118

Query  1453  mlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTS  1274
             MLEKQWNLS E++  T    E   K + VTCSG SAR+RR+ ++R+I  +   +A+   S
Sbjct  119   MLEKQWNLSFEQTVSTDMPREKTLKKVPVTCSGVSARQRRMSSKRKIQSKHVFMAQPKIS  178

Query  1273  KRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGC  1094
             K++R  I  E LQN LKGYVKG++SEELL+H EVV LSK IK+GL LEE K+RLKERLGC
Sbjct  179   KQLRPTISPELLQNRLKGYVKGLLSEELLSHAEVVRLSKKIKVGLALEEHKTRLKERLGC  238

Query  1093  DPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQG  914
             +PSE+QLA+SL+ISR +L+  M+ECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADL+QG
Sbjct  239   EPSEDQLAISLKISRAELRSRMMECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLVQG  298

Query  913   GLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAE  734
             GL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+
Sbjct  299   GLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPTHLHERLGLIRNAK  358

Query  733   TKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIA  554
              KL++KGITPS+DRIAESLN+SKKKV NATEA+SKVFSLDREAFPS++GLPGE+ HSYIA
Sbjct  359   VKLQEKGITPSLDRIAESLNMSKKKVKNATEAISKVFSLDREAFPSLNGLPGETHHSYIA  418

Query  553   DSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLS  374
             D+ LENNPWH  D   LK EVN LI+ TL +REREIIRLYHGL NECLTWE+ISKRIGLS
Sbjct  419   DNCLENNPWHGTDTWILKAEVNKLINMTLGDREREIIRLYHGLDNECLTWEEISKRIGLS  478

Query  373   RERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RERVRQVGLVA EKLK AA+  +++AML+K 
Sbjct  479   RERVRQVGLVALEKLKKAAKTRKMEAMLIKH  509



>ref|XP_008234513.1| PREDICTED: RNA polymerase sigma factor sigA [Prunus mume]
Length=512

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/513 (66%), Positives = 403/513 (79%), Gaps = 6/513 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDH--TLPCHQVLSVNSTVMAKKSSNY  1631
             MM TA ++GLS GKRLL SSFYYSD  EKL   +DH   L CH   S  + V A+K SN 
Sbjct  1     MMATAAVIGLSTGKRLLNSSFYYSDITEKLFHLNDHHGFLHCH-FSSTKNVVTARKPSNC  59

Query  1630  STSCVSNQR-MHSIKAIKEHVTVASNLFN-MEPCVQRNKQLQKqsseeenqledllllqk  1457
             S+   S+ R   SI+A+KEHV  AS   +  +   Q    L+++SS+ E  +E LLLLQK
Sbjct  60    SSRFPSSNRPQQSIRALKEHVHTASAPSSATQQWFQELNDLEEESSDLEYSVEALLLLQK  119

Query  1456  fmlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNS-VAKID  1280
              MLEKQWNLS EK  +  +T +   K I VTCSG SAR+RR+ + ++    K++ V    
Sbjct  120   SMLEKQWNLSFEKKVLRDSTSKTTDKKIPVTCSGVSARQRRMTSTKRKTLNKSTCVMHPS  179

Query  1279  TSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERL  1100
             T+K +R+I+  E LQN +KGYVKG++SE+LLTH EVV LSK IK+GL +EE KSRLKERL
Sbjct  180   TNKPLRAIVSPELLQNRVKGYVKGVLSEDLLTHTEVVRLSKKIKVGLSVEEHKSRLKERL  239

Query  1099  GCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLI  920
             GC+PS+EQLA SLRISR  L+  +IEC LAREKLAMSNVRLVMSIAQRYDNMGAEMADLI
Sbjct  240   GCEPSDEQLATSLRISRAQLQSKLIECKLAREKLAMSNVRLVMSIAQRYDNMGAEMADLI  299

Query  919   QGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRN  740
             QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRN
Sbjct  300   QGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPTHLHERLGLIRN  359

Query  739   AETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSY  560
             A+ +L++KGITPSIDRIAESLN+SKKKV NATEA+SKVFSLDR+AFPS++GLPGE+ HSY
Sbjct  360   AKIRLEEKGITPSIDRIAESLNMSKKKVRNATEAISKVFSLDRDAFPSLNGLPGETHHSY  419

Query  559   IADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIG  380
             IAD+ LEN PWH VD  ALK+EV+ LI+  L EREREII+LY+GL NECLTWEDISKRIG
Sbjct  420   IADNRLENIPWHGVDAWALKEEVSKLINMMLGEREREIIQLYYGLENECLTWEDISKRIG  479

Query  379   LSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             LSRERVRQVGLVA EKLKHAARK  ++AML+K 
Sbjct  480   LSRERVRQVGLVALEKLKHAARKREMEAMLLKH  512



>gb|KHG22597.1| RNA polymerase sigma factor rpoD [Gossypium arboreum]
Length=499

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/510 (65%), Positives = 394/510 (77%), Gaps = 13/510 (3%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHT-LPCHQVLSVNSTVMAKKSSNYS  1628
             MM TA I+GL+ GKRLL SSF YSD  EK S   D+   P +Q     S ++AKKSSN S
Sbjct  1     MMATAAIIGLTVGKRLLSSSFSYSDIIEKHSYAGDYGGAPHYQTAPTKSLIVAKKSSNCS  60

Query  1627  TSCVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfm  1451
              S  S ++R  SIKA+KEHV  AS +    P  + +   +++S E +  +E LLL QK M
Sbjct  61    QSVPSYDRRSRSIKALKEHVDTASLVSTAGPWCRGSDDFEEESYELDYSVEALLLFQKSM  120

Query  1450  lekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSK  1271
             LE+QW LS E++  T +      K + VTCSG SAR+RR +TR Q             +K
Sbjct  121   LEQQWTLSFERTVFTESPSRKTKKKVPVTCSGVSARQRRFNTRMQ-----------PNAK  169

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
             ++RS+I  E L++ LKGYV+G+VSEELL+H EVV LSK IK GL LE+Q+ RLKERLGCD
Sbjct  170   QLRSLISPELLRSRLKGYVRGVVSEELLSHAEVVRLSKKIKTGLSLEDQRLRLKERLGCD  229

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGG  911
             PS+EQLA SL+ISR +L+  +IECSLAR+KLAMSNVRLVMSIAQRYDNMGAEM DLIQGG
Sbjct  230   PSDEQLATSLKISRAELRSMLIECSLARDKLAMSNVRLVMSIAQRYDNMGAEMPDLIQGG  289

Query  910   LVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAET  731
             L+GLLRGIEKFD SKGYK+STYVYWWIRQG+SRALV NS  LRLP H+H RL LIRNA+ 
Sbjct  290   LIGLLRGIEKFDSSKGYKISTYVYWWIRQGVSRALVDNSRTLRLPTHMHERLGLIRNAKY  349

Query  730   KLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIAD  551
             +LK+KGITP+IDRIAESLN+S+KKV NATEA SKVFSLDR AFPS++GLPGE+ HSYIAD
Sbjct  350   RLKEKGITPTIDRIAESLNMSQKKVRNATEADSKVFSLDRVAFPSLNGLPGETHHSYIAD  409

Query  550   SHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSR  371
              H ENNPWH VDE ALKDEVN LI  TL EREREII+LYHGLG E LTWEDISKRIGLSR
Sbjct  410   HHEENNPWHGVDEGALKDEVNRLIGITLGEREREIIKLYHGLGKESLTWEDISKRIGLSR  469

Query  370   ERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             ERVRQ+GLVA EKLK+AARK+ ++AML+KQ
Sbjct  470   ERVRQIGLVALEKLKNAARKDGMEAMLLKQ  499



>ref|XP_007219023.1| hypothetical protein PRUPE_ppa004393mg [Prunus persica]
 gb|EMJ20222.1| hypothetical protein PRUPE_ppa004393mg [Prunus persica]
Length=512

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/513 (66%), Positives = 403/513 (79%), Gaps = 6/513 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDH--TLPCHQVLSVNSTVMAKKSSNY  1631
             MM TA ++GLS GKRLL SSFYYSD  EKL   +DH   L CH   S  + V A+K SN 
Sbjct  1     MMATAAVIGLSTGKRLLNSSFYYSDITEKLFHLNDHHGFLHCH-FSSTKNVVTARKPSNC  59

Query  1630  STSCVSNQR-MHSIKAIKEHVTVASNLFN-MEPCVQRNKQLQKqsseeenqledllllqk  1457
             S+   S+ R   SI+A+KEHV  AS   +  +   Q    L+++SS+ E  +E LLLLQK
Sbjct  60    SSRFPSSNRPQQSIRALKEHVQTASAPSSATQQWFQELNDLEEESSDLEYSVEALLLLQK  119

Query  1456  fmlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNS-VAKID  1280
              MLEKQWNLS EK  +  +T +   K I VTCSG SAR+RR+ + ++    K++ V    
Sbjct  120   SMLEKQWNLSFEKKVLRDSTSKTTDKKIPVTCSGVSARQRRMTSTKRKTFNKSTCVMHPS  179

Query  1279  TSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERL  1100
             T+K +R+I+  E LQN +KGYVKG++SE+LLTH EVV LSK IK+GL +EE KSRLKERL
Sbjct  180   TNKPLRAIVSPELLQNHVKGYVKGVLSEDLLTHTEVVRLSKKIKVGLSVEEHKSRLKERL  239

Query  1099  GCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLI  920
             GC+PS+EQLA SLRISR  L+  +IEC LAREKLAMSNVRLVMSIAQRYDNMGAEMADLI
Sbjct  240   GCEPSDEQLATSLRISRAQLQSKLIECKLAREKLAMSNVRLVMSIAQRYDNMGAEMADLI  299

Query  919   QGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRN  740
             QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRN
Sbjct  300   QGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPTHLHERLGLIRN  359

Query  739   AETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSY  560
             A+ +L++KGITPSIDRIAESLN+SKKKV NATEA+SKVFSLDR+AFPS++GLPGE+ HSY
Sbjct  360   AKIRLEEKGITPSIDRIAESLNMSKKKVRNATEAISKVFSLDRDAFPSLNGLPGETHHSY  419

Query  559   IADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIG  380
             IAD+ LEN PWH VD  ALK+EV+ LI+  L ERE+EII+LY+GL NECLTWEDISKRIG
Sbjct  420   IADNRLENIPWHGVDAWALKEEVSKLINMMLGEREKEIIQLYYGLENECLTWEDISKRIG  479

Query  379   LSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             LSRERVRQVGLVA EKLKHAARK  ++AML+K 
Sbjct  480   LSRERVRQVGLVALEKLKHAARKREMEAMLLKH  512



>ref|XP_004151855.1| PREDICTED: RNA polymerase sigma factor sigA-like [Cucumis sativus]
 ref|XP_004164521.1| PREDICTED: RNA polymerase sigma factor sigA-like [Cucumis sativus]
 gb|KGN63339.1| hypothetical protein Csa_2G431090 [Cucumis sativus]
Length=508

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/510 (65%), Positives = 401/510 (79%), Gaps = 6/510 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA I+GL A KRLL SS YYSDF EK+   +D+ L   QV S  S V+AK S+N+S 
Sbjct  1     MMATAAIIGLGAAKRLLNSSSYYSDFTEKILYANDYRLGQTQVSSSKSVVIAKSSANFSP  60

Query  1624  SCVSNQRMHS---IKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkf  1454
                S+ R HS   IKA+KEHV   S+    EP        + + +E +  +E LLLLQK 
Sbjct  61    RYPSSNR-HSQQCIKAVKEHVETPSSPI-AEPW-HNTTSWEDEETELKYTVEALLLLQKS  117

Query  1453  mlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTS  1274
             MLEKQW+LS E++  T T  E   K + VTCSG SAR+RR+ ++R+I  +   +A+   S
Sbjct  118   MLEKQWSLSFEQTVSTDTPKEKTLKKVPVTCSGVSARQRRMSSKRKIQSKHVFMAQPKIS  177

Query  1273  KRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGC  1094
             K++R  I  E LQN LKGYVKG++SEELL+H EVV LSK IK+GL LEE+K+RLK+RLGC
Sbjct  178   KQLRPTISPELLQNRLKGYVKGLLSEELLSHAEVVRLSKKIKVGLTLEERKTRLKQRLGC  237

Query  1093  DPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQG  914
             +PSE+QLA+SL+ISR +L+  M+E SLAREKLAMSNVRLVMSIAQRYDNMGAEMADL+QG
Sbjct  238   EPSEDQLAISLKISRAELRSRMMESSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLVQG  297

Query  913   GLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAE  734
             GL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+
Sbjct  298   GLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPTHLHERLGLIRNAK  357

Query  733   TKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIA  554
              KL++KGITPS+DRIAESLN+SKKKV NATEA+SKVFSLDREAFPS++GLPGE+ HSYIA
Sbjct  358   VKLQEKGITPSLDRIAESLNMSKKKVQNATEAISKVFSLDREAFPSLNGLPGETHHSYIA  417

Query  553   DSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLS  374
             D+ LENNPWH  D   LK EVN LI+ TL +REREIIRLYHGL NECLTWE+ISKRIGLS
Sbjct  418   DNCLENNPWHGTDTWILKVEVNQLINMTLGDREREIIRLYHGLDNECLTWEEISKRIGLS  477

Query  373   RERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             RERVRQVGLVA EKLK AA+  +++AML+K
Sbjct  478   RERVRQVGLVALEKLKKAAKTRKMEAMLLK  507



>gb|KDO48034.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=499

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/510 (65%), Positives = 401/510 (79%), Gaps = 13/510 (3%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLSAGKRLL SSFYYSD  EK S  +D      QV S  + V AKKSSNY+ 
Sbjct  1     MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNP  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllllqkfm  1451
             S  S N++   IKA+KEHV   +N  +  EP  +    ++++SSE +  +E LLLLQK M
Sbjct  61    SFPSSNRQTQPIKALKEHVD--TNFASTAEPWAEPPNSIEEESSELDYSVEALLLLQKSM  118

Query  1450  lekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSK  1271
             LEKQWNLS E++ +T +  +   K + VTCSG SAR+RR++++++I+ Q  S+ + + SK
Sbjct  119   LEKQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSILQQNGSK  178

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
             ++RS+I  E +QN LKGYVKG+VSEELLTH EVV LSK IK GL L++ K RLKERLG  
Sbjct  179   QLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGS-  237

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGG  911
                     SLRISR +L+  ++ECSLAREKL MSNVRLVMSIAQRYDNMGA+MADL+QGG
Sbjct  238   --------SLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGG  289

Query  910   LVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAET  731
             L+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+ 
Sbjct  290   LIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKL  349

Query  730   KLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIAD  551
             +L++KG+TPS+DRIAE LN+S+KKV NATEA+ KVFSLDREAFPS++GLPGE+ HSYIAD
Sbjct  350   RLEEKGVTPSVDRIAEYLNMSQKKVRNATEAIGKVFSLDREAFPSLNGLPGETHHSYIAD  409

Query  550   SHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSR  371
             + +ENNPWH VD+ ALKDEVN LI  TL EREREIIRLY+GL  ECLTWEDISKRIGLSR
Sbjct  410   NRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWEDISKRIGLSR  469

Query  370   ERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             ERVRQVGLVA EKLKHAARK +++AMLVK 
Sbjct  470   ERVRQVGLVALEKLKHAARKKKMEAMLVKH  499



>ref|XP_003539986.1| PREDICTED: RNA polymerase sigma factor sigA-like [Glycine max]
 gb|KHN46496.1| RNA polymerase sigma factor rpoD [Glycine soja]
Length=503

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/511 (64%), Positives = 406/511 (79%), Gaps = 12/511 (2%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYS-T  1625
             M TA ++GLS GKRLL SS++YSD  EKLS GSD     +Q++   S ++AKKSSNY+ T
Sbjct  1     MATAAVIGLSGGKRLLSSSYHYSDIIEKLSYGSDFGSTHYQIVPTKSLIVAKKSSNYTPT  60

Query  1624  SCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQ--RNKQLQKqsseeenqledllllqkfm  1451
                SNQ+  SIKA+KEHV  A  +   +P  Q   +  L+ +SSE    +E LLLLQK M
Sbjct  61    FPASNQQNQSIKALKEHVDDAPTI--ADPWFQSYNSNDLEVESSEMGYSVEALLLLQKSM  118

Query  1450  lekQWNLSAEKSTMTYTTMENN-CKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTS  1274
             LEKQWNLS E+  +T  + +   C+ + VTCSG SAR+RR++T+      + +  K   +
Sbjct  119   LEKQWNLSFEREVLTENSSKGKKCRKVAVTCSGVSARQRRMNTK------RKTAIKTCGA  172

Query  1273  KRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGC  1094
              +++S I  E LQ+ LKGYVKG+VSEELL+H EVV LS+ IK+GL LEE KSRLKE+LGC
Sbjct  173   MQLKSKISPELLQHRLKGYVKGLVSEELLSHAEVVNLSEKIKVGLSLEEHKSRLKEKLGC  232

Query  1093  DPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQG  914
             +PS++Q+A SL+ISRT+L+  MIECSLAREKLAMSNVRLVMSIAQ+YDN+GAEM DL+QG
Sbjct  233   EPSDDQMATSLKISRTELRARMIECSLAREKLAMSNVRLVMSIAQKYDNLGAEMGDLVQG  292

Query  913   GLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAE  734
             GL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RLSLIRNA+
Sbjct  293   GLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPAHLHERLSLIRNAK  352

Query  733   TKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIA  554
              +L+++GITP+IDRIA+ LN+S+KKV NATEA+SK+ SLDREAFPS++GL GE+ HSYIA
Sbjct  353   FRLEERGITPTIDRIAKYLNMSQKKVRNATEAISKIISLDREAFPSLNGLQGETHHSYIA  412

Query  553   DSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLS  374
             D+ +EN PW+ VDE ALKDEVN LI+ TL EREREIIRLY+GL  ECLTWEDISKRIGLS
Sbjct  413   DNRVENIPWNGVDEWALKDEVNRLINVTLVEREREIIRLYYGLEKECLTWEDISKRIGLS  472

Query  373   RERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RERVRQVGLVA EKLKHAARK +++AML+K 
Sbjct  473   RERVRQVGLVALEKLKHAARKRQMEAMLLKH  503



>ref|XP_003534364.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Glycine 
max]
 ref|XP_006587676.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Glycine 
max]
Length=503

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/513 (64%), Positives = 406/513 (79%), Gaps = 16/513 (3%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYS-T  1625
             M TA ++GLS GKRLL SS++YSD  EKLS GSD     +Q++   S + AKKSSNY+ T
Sbjct  1     MATAAVIGLSGGKRLLSSSYHYSDVIEKLSYGSDFGSTHYQIVPTKSLIAAKKSSNYTPT  60

Query  1624  SCVSNQRMHSIKAIKEHV----TVASNLFNMEPCVQRNKQLQKqsseeenqledllllqk  1457
                SNQ+  SIKA+KEHV    T+A + F  + C   +  L+ +SSE    +E LLLLQK
Sbjct  61    FPASNQQNQSIKALKEHVDDAPTIADSWF--QSC--NSNDLEVESSEMGYSVEALLLLQK  116

Query  1456  fmlekQWNLSAEKSTMT-YTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKID  1280
              MLEKQWNLS E+  +T +++    CK + VTCSG SAR+RR++T+      + +  K  
Sbjct  117   SMLEKQWNLSFEREVLTEHSSKGKKCKKVAVTCSGVSARQRRMNTK------RKTAIKTC  170

Query  1279  TSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERL  1100
              + +++S I  E LQ+ LKGYVKGIVSEELL+H EVV LS+ IK+GL LEE KSRLKERL
Sbjct  171   GAMQLKSKISPELLQHRLKGYVKGIVSEELLSHAEVVNLSERIKVGLSLEEHKSRLKERL  230

Query  1099  GCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLI  920
             GC+PS++Q+A+SL+ISRT+L+  MIEC+LAREKLAMSNVRLVMSIAQ+YDN+GAEM DL+
Sbjct  231   GCEPSDDQMAISLKISRTELRARMIECTLAREKLAMSNVRLVMSIAQKYDNLGAEMGDLV  290

Query  919   QGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRN  740
             QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RLSLIRN
Sbjct  291   QGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPAHLHERLSLIRN  350

Query  739   AETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSY  560
             A+ +L+++GITP+IDRIA+ LN+S+KKV NATEA+SK  SLDREAFPS++G+ GE+ HSY
Sbjct  351   AKFRLEERGITPTIDRIAKYLNMSQKKVRNATEAISKTISLDREAFPSLNGIQGETHHSY  410

Query  559   IADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIG  380
             IAD  +EN PW+ VDE ALKDEVN LI+ TL EREREIIRLY+GL  E LTWEDISKRIG
Sbjct  411   IADDRVENIPWNGVDEWALKDEVNKLINVTLVEREREIIRLYYGLDKEGLTWEDISKRIG  470

Query  379   LSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             LSRERVRQVGLVA EKLKHAARK +++AML+K 
Sbjct  471   LSRERVRQVGLVALEKLKHAARKRQMEAMLLKH  503



>emb|CBI26421.3| unnamed protein product [Vitis vinifera]
Length=555

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/508 (63%), Positives = 377/508 (74%), Gaps = 26/508 (5%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCG-SDHTLPCHQVLSVNSTVMAKKSSNYS  1628
             MM TA ++GLSAG RLL SS +YSD  EKLS   +D   P H      + + AKK SNY+
Sbjct  72    MMGTAAVIGLSAGNRLLASSHHYSDVAEKLSSYVNDVGFPHHPSPPPKNLISAKKPSNYT  131

Query  1627  TSCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfml  1448
              S  SN+ + S+KA+KEHV  AS     +P +  +    +           L        
Sbjct  132   PS--SNRSIQSMKALKEHVESASAPSTADPDLSSSSSEVEDEEYLVEAFLLLQKSMLEKQ  189

Query  1447  ekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKR  1268
                WNLS           +   K  +VTCSGTSAR+RRI         +  V    +  R
Sbjct  190   ---WNLS----------FKARQKRREVTCSGTSARQRRISG-------RKRVMNEKSKSR  229

Query  1267  VRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDP  1088
             VR+ +G+E   N LKGYVKG+VSEELLTH +VV LS  IK GL LE+ KSRLKER+G +P
Sbjct  230   VRAALGVE---NRLKGYVKGVVSEELLTHAQVVLLSNKIKAGLLLEDHKSRLKERIGSEP  286

Query  1087  SEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  908
             ++EQ+A SLR+SR +L+  +IECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADL+QGGL
Sbjct  287   TDEQVAASLRMSRAELQSKLIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLVQGGL  346

Query  907   VGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETK  728
             +GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RLSLIRNA+ +
Sbjct  347   IGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPSHLHERLSLIRNAKIR  406

Query  727   LKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADS  548
             L++KGITPSIDRIAE LN+S+KKV NATEA+SKVFSLDREAFPS++GLPGE+LHSYIAD 
Sbjct  407   LEEKGITPSIDRIAECLNMSQKKVRNATEAISKVFSLDREAFPSLNGLPGETLHSYIADV  466

Query  547   HLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRE  368
              LENNPWH VDE ALKDEVN LI+TTL ERER+IIRLY+GL NECLTWEDISKRIGLSRE
Sbjct  467   RLENNPWHGVDEWALKDEVNKLINTTLGERERDIIRLYYGLDNECLTWEDISKRIGLSRE  526

Query  367   RVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             RVRQVGLVA EKLK+AARK R++AMLVK
Sbjct  527   RVRQVGLVALEKLKNAARKGRMEAMLVK  554



>ref|XP_002319237.2| hypothetical protein POPTR_0013s07290g [Populus trichocarpa]
 gb|EEE95160.2| hypothetical protein POPTR_0013s07290g [Populus trichocarpa]
Length=499

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/509 (63%), Positives = 392/509 (77%), Gaps = 11/509 (2%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA+ +GL+ GKRLL SSFY+SD  EKLS  +DH +  +Q+ +  S ++AKKSS Y  
Sbjct  1     MMATASFIGLTTGKRLLSSSFYFSDLTEKLSNVNDHGVAHYQITTTKSVIVAKKSSKYGP  60

Query  1624  SCVSNQR-MHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfml  1448
             S  S+ R  HS KA+KE +  AS    +    +     +++SS  +  +E L+LLQK ML
Sbjct  61    SFPSSYRNPHSNKALKELIDTASASSTVATWFKTLDDFEEESSVLDYSVEALILLQKSML  120

Query  1447  ekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKR  1268
             EKQWNLS E    + + ++ + K I VTCSG SAR+RR+          N+  K     +
Sbjct  121   EKQWNLSFESINSSDSKIKKSNKKIPVTCSGVSARQRRL----------NNKRKNQNQSK  170

Query  1267  VRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDP  1088
               S I  + L N LKGYVKG+VS+E+L H EVV LS++I+ GL LE+ KS LKERLGC+P
Sbjct  171   FMSDISPDLLLNRLKGYVKGVVSDEVLPHTEVVRLSRIIRAGLSLEDHKSSLKERLGCEP  230

Query  1087  SEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  908
             S+EQLA SLRISR DL+  +I+CSLAREKLAMSNVRLVMSIAQ+ DNMGAEMADL+Q GL
Sbjct  231   SDEQLADSLRISRADLQSQLIQCSLAREKLAMSNVRLVMSIAQKNDNMGAEMADLVQAGL  290

Query  907   VGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETK  728
             +GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+N   LRLP HLH RL LIRNA+ +
Sbjct  291   IGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENPRTLRLPNHLHERLGLIRNAKIR  350

Query  727   LKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADS  548
             L++KG+TPSIDRIAESLN+S++KV NATEA+SKVFSLDREAFPS++GLPGE+ HSYIAD+
Sbjct  351   LEEKGVTPSIDRIAESLNMSQRKVRNATEAISKVFSLDREAFPSLNGLPGETHHSYIADN  410

Query  547   HLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRE  368
              LENNPWH VDE ALK+EVN LI + L+EREREIIRLYHGL  ECLTWEDISKR+GLSRE
Sbjct  411   RLENNPWHGVDEWALKEEVNKLIDSALQEREREIIRLYHGLDKECLTWEDISKRMGLSRE  470

Query  367   RVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RVRQVGLVA EKLKHAARK +L+AMLVK 
Sbjct  471   RVRQVGLVALEKLKHAARKGKLEAMLVKH  499



>ref|XP_010662046.1| PREDICTED: RNA polymerase sigma factor sigA isoform X2 [Vitis 
vinifera]
Length=507

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/521 (64%), Positives = 392/521 (75%), Gaps = 29/521 (6%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCG-SDHTLPCHQVLSVNSTVMAKKSSNYS  1628
             MM TA ++GLSAG RLL SS +YSD  EKLS   +D   P H      + + AKK SNY+
Sbjct  1     MMGTAAVIGLSAGNRLLASSHHYSDVAEKLSSYVNDVGFPHHPSPPPKNLISAKKPSNYT  60

Query  1627  TSCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfml  1448
              S  SN+ + S+KA+KEHV  AS     +P +        +  +EE  +E  LLLQK ML
Sbjct  61    PS--SNRSIQSMKALKEHVESASAPSTADPDLS---SSSSEVEDEEYLVEAFLLLQKSML  115

Query  1447  ekQWNLSAEKSTMTYTTMENNC-------------KNIQVTCSGTSArrrridtrrqiiq  1307
             EKQWNLS   + +     E                K  +VTCSGTSAR+RRI        
Sbjct  116   EKQWNLSFVGTVVGKEEEEEEEEEEEEDMGKKARQKRREVTCSGTSARQRRISG------  169

Query  1306  QKNSVAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEE  1127
              +  V    +  RVR+ +G+E   N LKGYVKG+VSEELLTH +VV LS  IK GL LE+
Sbjct  170   -RKRVMNEKSKSRVRAALGVE---NRLKGYVKGVVSEELLTHAQVVLLSNKIKAGLLLED  225

Query  1126  QKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDN  947
              KSRLKER+G +P++EQ+A SLR+SR +L+  +IECSLAREKLAMSNVRLVMSIAQRYDN
Sbjct  226   HKSRLKERIGSEPTDEQVAASLRMSRAELQSKLIECSLAREKLAMSNVRLVMSIAQRYDN  285

Query  946   MGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHL  767
             MGAEMADL+QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HL
Sbjct  286   MGAEMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPSHL  345

Query  766   HGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDG  587
             H RLSLIRNA+ +L++KGITPSIDRIAE LN+S+KKV NATEA+SKVFSLDREAFPS++G
Sbjct  346   HERLSLIRNAKIRLEEKGITPSIDRIAECLNMSQKKVRNATEAISKVFSLDREAFPSLNG  405

Query  586   LPGESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLT  407
             LPGE+LHSYIAD  LENNPWH VDE ALKDEVN LI+TTL ERER+IIRLY+GL NECLT
Sbjct  406   LPGETLHSYIADVRLENNPWHGVDEWALKDEVNKLINTTLGERERDIIRLYYGLDNECLT  465

Query  406   WEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             WEDISKRIGLSRERVRQVGLVA EKLK+AARK R++AMLVK
Sbjct  466   WEDISKRIGLSRERVRQVGLVALEKLKNAARKGRMEAMLVK  506



>ref|XP_010662045.1| PREDICTED: RNA polymerase sigma factor sigA isoform X1 [Vitis 
vinifera]
Length=513

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/521 (62%), Positives = 379/521 (73%), Gaps = 29/521 (6%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCG-SDHTLPCHQVLSVNSTVMAKKSSNYS  1628
             MM TA ++GLSAG RLL SS +YSD  EKLS   +D   P H      + + AKK SNY+
Sbjct  7     MMGTAAVIGLSAGNRLLASSHHYSDVAEKLSSYVNDVGFPHHPSPPPKNLISAKKPSNYT  66

Query  1627  TSCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfml  1448
              S  SN+ + S+KA+KEHV  AS     +P +  +    +           L        
Sbjct  67    PS--SNRSIQSMKALKEHVESASAPSTADPDLSSSSSEVEDEEYLVEAFLLLQKSMLEKQ  124

Query  1447  ekQWNLSAEKSTMTYTTMENNC-------------KNIQVTCSGTSArrrridtrrqiiq  1307
                WNLS   + +     E                K  +VTCSGTSAR+RRI        
Sbjct  125   ---WNLSFVGTVVGKEEEEEEEEEEEEDMGKKARQKRREVTCSGTSARQRRISG------  175

Query  1306  QKNSVAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEE  1127
              +  V    +  RVR+ +G+E   N LKGYVKG+VSEELLTH +VV LS  IK GL LE+
Sbjct  176   -RKRVMNEKSKSRVRAALGVE---NRLKGYVKGVVSEELLTHAQVVLLSNKIKAGLLLED  231

Query  1126  QKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDN  947
              KSRLKER+G +P++EQ+A SLR+SR +L+  +IECSLAREKLAMSNVRLVMSIAQRYDN
Sbjct  232   HKSRLKERIGSEPTDEQVAASLRMSRAELQSKLIECSLAREKLAMSNVRLVMSIAQRYDN  291

Query  946   MGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHL  767
             MGAEMADL+QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HL
Sbjct  292   MGAEMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPSHL  351

Query  766   HGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDG  587
             H RLSLIRNA+ +L++KGITPSIDRIAE LN+S+KKV NATEA+SKVFSLDREAFPS++G
Sbjct  352   HERLSLIRNAKIRLEEKGITPSIDRIAECLNMSQKKVRNATEAISKVFSLDREAFPSLNG  411

Query  586   LPGESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLT  407
             LPGE+LHSYIAD  LENNPWH VDE ALKDEVN LI+TTL ERER+IIRLY+GL NECLT
Sbjct  412   LPGETLHSYIADVRLENNPWHGVDEWALKDEVNKLINTTLGERERDIIRLYYGLDNECLT  471

Query  406   WEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             WEDISKRIGLSRERVRQVGLVA EKLK+AARK R++AMLVK
Sbjct  472   WEDISKRIGLSRERVRQVGLVALEKLKNAARKGRMEAMLVK  512



>ref|XP_011011636.1| PREDICTED: RNA polymerase sigma factor sigA-like [Populus euphratica]
 ref|XP_011011637.1| PREDICTED: RNA polymerase sigma factor sigA-like [Populus euphratica]
Length=508

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/509 (63%), Positives = 398/509 (78%), Gaps = 2/509 (0%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA+ +GL+ GKRLL S+FYYSD  E+LS  +DH +  +Q+ +  S ++AKKSS Y  
Sbjct  1     MMATASFIGLTTGKRLLSSTFYYSDLTERLSNVNDHGI-AYQITTTKSVIVAKKSSKYGP  59

Query  1624  SCVSNQR-MHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfml  1448
             S  S+ R  HS KA+KE +  AS    +    +     +++SS  +  +E L+LLQK ML
Sbjct  60    SFPSSYRNPHSNKALKELIDTASASSTVATWFKALDDFEEESSVLDYSVEALILLQKSML  119

Query  1447  ekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKR  1268
             EKQWNLS E+   + + ++ + K I VTCSG SAR+RR++++R+   Q   ++     K 
Sbjct  120   EKQWNLSFERINSSDSKIKKSNKKIPVTCSGVSARQRRLNSKRKNQNQSKFMSCSGDFKL  179

Query  1267  VRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDP  1088
              RS I  + L N LKGYVKG+VS+E+L H EVV LS++I+ G+ LE+ KS LKERLGC+P
Sbjct  180   PRSDISPDLLLNRLKGYVKGVVSDEVLPHTEVVRLSRIIRAGISLEDHKSSLKERLGCEP  239

Query  1087  SEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  908
             S+EQLA SLRISR DL+  +I+CSLA+EKLAMSNVRLVMSIAQ+ DNMGAEMADL+Q GL
Sbjct  240   SDEQLADSLRISRADLQSQLIQCSLAKEKLAMSNVRLVMSIAQKNDNMGAEMADLVQAGL  299

Query  907   VGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETK  728
             +GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA  +
Sbjct  300   IGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNARIR  359

Query  727   LKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADS  548
             L++KG+TPSIDRIAESLN+S++KV NATEA+ KVFSLDREAFPS++GLPGE+ HSYIAD+
Sbjct  360   LEEKGVTPSIDRIAESLNMSQRKVRNATEAIGKVFSLDREAFPSLNGLPGETHHSYIADN  419

Query  547   HLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRE  368
             HL NNPWH VDE ALK+EVN LI + L+EREREIIRLYHGL  ECLTWEDISKR+GLSRE
Sbjct  420   HLGNNPWHGVDEWALKEEVNKLIDSALQEREREIIRLYHGLDKECLTWEDISKRMGLSRE  479

Query  367   RVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RVRQVGLVA EKLKHAARK +L+AMLVK 
Sbjct  480   RVRQVGLVALEKLKHAARKGKLEAMLVKH  508



>ref|XP_009361126.1| PREDICTED: RNA polymerase sigma factor sigA isoform X1 [Pyrus 
x bretschneideri]
Length=514

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/514 (65%), Positives = 396/514 (77%), Gaps = 6/514 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLL-CSSFYYSDFGEKLSCGSDHT-LPCHQVLSVNSTVMAKKSSNY  1631
             MM  A ++GL+ GKRLL  SS YYSD  EKL   +DH  L CH   + N     K +SNY
Sbjct  1     MMAIAAVIGLTTGKRLLNSSSSYYSDVTEKLFHLNDHAFLHCHFSSTRNLVTARKSNSNY  60

Query  1630  STS--CVSNQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllllq  1460
             ++S    SN+  HS KA+K+ V  AS   +  +        L+ +SS+ E  ++ LLLLQ
Sbjct  61    TSSRFSSSNRADHSSKALKDQVNAASAPSSTAQQWFHDFNDLEGESSDLEYSVDALLLLQ  120

Query  1459  kfmlekQWNLSAEKSTMTYTTMENNC-KNIQVTCSGTSArrrridtrrqiiqQKNSVAKI  1283
             K MLEKQWNLS EK   T +T++    K I VTCSG SAR RR+  RR        + + 
Sbjct  121   KSMLEKQWNLSFEKKIFTDSTIKTATNKRIPVTCSGVSARHRRMSNRRNAFSLNRCLTQP  180

Query  1282  DTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKER  1103
              T+K +R +I  E LQ+ LKGYVKG++SE+LLTH EVV LSK IK+GL +EE KSRLKER
Sbjct  181   STNKSLRPVISPELLQSRLKGYVKGVLSEDLLTHTEVVRLSKKIKIGLSVEEHKSRLKER  240

Query  1102  LGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADL  923
             LGC+PS+EQLA SLRISR +LK  +IECSLAREKLAMSNVRLVMSIAQ+YDNMGAEMADL
Sbjct  241   LGCEPSDEQLATSLRISRAELKSKLIECSLAREKLAMSNVRLVMSIAQKYDNMGAEMADL  300

Query  922   IQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIR  743
             IQGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIR
Sbjct  301   IQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSKTLRLPTHLHERLGLIR  360

Query  742   NAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHS  563
             NA+ +L++KGITPSIDRIAESLN+SKKKV NATEA+SKVFSLDR+AFPS++GLPGE+ HS
Sbjct  361   NAKIRLEEKGITPSIDRIAESLNMSKKKVRNATEAISKVFSLDRDAFPSLNGLPGETHHS  420

Query  562   YIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRI  383
             YIAD+ LEN PW+ VD  ALKDEVN LI+  L EREREIIRLY+GL NECLTWEDISKRI
Sbjct  421   YIADNRLENIPWNGVDAWALKDEVNKLINMMLGEREREIIRLYYGLDNECLTWEDISKRI  480

Query  382   GLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             GLSRERVRQVGLVA EKLKHAARK  ++A+LVK 
Sbjct  481   GLSRERVRQVGLVALEKLKHAARKTEMEALLVKH  514



>ref|XP_010550940.1| PREDICTED: RNA polymerase sigma factor sigA [Tarenaya hassleriana]
Length=512

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/512 (62%), Positives = 400/512 (78%), Gaps = 4/512 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKK-SSNYS  1628
             MM TA ++GLSAGKRLL SSF +SD  EK   G+D +   +Q+    + +++KK SSNYS
Sbjct  1     MMATAAVIGLSAGKRLLSSSFCHSDVTEKFLYGNDQSAVQYQIPHTKTVIISKKPSSNYS  60

Query  1627  TSCVSN-QRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfm  1451
              S  S+  R  S KA+KE + VAS+  +      +    + +    +  +E LLLLQK M
Sbjct  61    PSLPSSTHRTQSAKAVKETLGVASSAPSSGQLWLQGYNDELEEESYDLDVEALLLLQKSM  120

Query  1450  lekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKN-SVAKIDTS  1274
             LEKQWNLS EK+  +  + +   K I VTCSG SAR+RRI+ +++    +N +V+ +  +
Sbjct  121   LEKQWNLSFEKTISSDLSTKKTRKKISVTCSGISARQRRINAKKKNAMSQNKAVSHVSAT  180

Query  1273  KRVRSIIGMEQL-QNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLG  1097
             K+ R I   E L QN +KGYVKG++S+ +L+H EVV LSK IK GL L+E KSRLKERLG
Sbjct  181   KQQRIITNSELLRQNRVKGYVKGVISDAVLSHAEVVCLSKKIKSGLLLDEHKSRLKERLG  240

Query  1096  CDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQ  917
             C+PS++QLA+SL+ISR +L+  ++EC LAREKLAMSNVRLVMSIAQRYDNMGAEM+DL+Q
Sbjct  241   CEPSDDQLAMSLKISRAELQTRLMECHLAREKLAMSNVRLVMSIAQRYDNMGAEMSDLVQ  300

Query  916   GGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNA  737
             GGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA
Sbjct  301   GGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVENSRTLRLPTHLHERLGLIRNA  360

Query  736   ETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYI  557
             + +L++KGITPSI+RIA+SLN+S+KKV NATEAVSKVFSLDR+AFPS++GLPGE+ HSYI
Sbjct  361   KLRLEEKGITPSIERIAKSLNMSQKKVKNATEAVSKVFSLDRDAFPSLNGLPGETHHSYI  420

Query  556   ADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGL  377
             AD+ LENNPWH  DE ALK+EVN L++  L +REREI+RLY+GL  E LTWEDISKRIGL
Sbjct  421   ADNRLENNPWHGYDEWALKNEVNKLLNAILGDREREIVRLYYGLDRESLTWEDISKRIGL  480

Query  376   SRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             SRERVRQVGLVA EKLKHAARK +++AMLVKQ
Sbjct  481   SRERVRQVGLVALEKLKHAARKRKMEAMLVKQ  512



>ref|XP_008376946.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Malus 
domestica]
Length=515

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/515 (64%), Positives = 392/515 (76%), Gaps = 7/515 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYS--DFGEKLSCGSDHT-LPCHQVLSVNSTVMAKKSSN  1634
             MM  A ++GL+ GKRLL SS      D  EKL   +DH  L CH   + N     K +SN
Sbjct  1     MMAIAAVIGLTTGKRLLSSSSSSYYSDVTEKLFHLNDHAFLHCHFSSTKNLVTARKSNSN  60

Query  1633  YSTS--CVSNQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllll  1463
             Y++S    SN+  HS +A+K+ V  AS   +  +        L+++SS+ E  ++ LLLL
Sbjct  61    YTSSRFSSSNRADHSSRALKDQVDAASAPSSTAQQWFHDFNDLEEESSDLEYSVDALLLL  120

Query  1462  qkfmlekQWNLSAEKSTMTYTTMENNC-KNIQVTCSGTSArrrridtrrqiiqQKNSVAK  1286
             QK MLEKQWNLS EK   T +T++    K I VTCSG SAR RR+  RR        + +
Sbjct  121   QKSMLEKQWNLSFEKKIFTDSTIKTATNKRIPVTCSGVSARHRRMSYRRNAFNLNRCLTQ  180

Query  1285  IDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKE  1106
               T+  +R +I  E LQ+ LKGYVKG++SE+LLTH EVV LSK IK+GL +EE KSRLKE
Sbjct  181   PSTNNSLRPVISPELLQSRLKGYVKGVLSEDLLTHTEVVRLSKKIKIGLSVEEHKSRLKE  240

Query  1105  RLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMAD  926
             RLGC+PS+EQLA SLRISR +LK  +IECSLAREKLAMSNVRLVMSIAQ+YDNMGAEMAD
Sbjct  241   RLGCEPSDEQLATSLRISRAELKSKLIECSLAREKLAMSNVRLVMSIAQKYDNMGAEMAD  300

Query  925   LIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLI  746
             LIQGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LI
Sbjct  301   LIQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSKTLRLPTHLHERLGLI  360

Query  745   RNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLH  566
             RNA+ +L++KGITPSIDRIAESLN+SKKKV NATEA+SKVFSLDR+AFPS++GLPGE+ H
Sbjct  361   RNAKIRLEEKGITPSIDRIAESLNMSKKKVRNATEAISKVFSLDRDAFPSLNGLPGETHH  420

Query  565   SYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKR  386
             SYIAD+ LEN PW  VD  ALKDEVN LI+  L EREREIIRLY+GL NECLTWEDISKR
Sbjct  421   SYIADNRLENIPWTGVDAWALKDEVNKLINMMLGEREREIIRLYYGLDNECLTWEDISKR  480

Query  385   IGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             IGLSRERVRQVGLVA EKLKHAARK  ++A+LVK 
Sbjct  481   IGLSRERVRQVGLVALEKLKHAARKTEMEALLVKH  515



>ref|XP_007131471.1| hypothetical protein PHAVU_011G016400g [Phaseolus vulgaris]
 gb|ESW03465.1| hypothetical protein PHAVU_011G016400g [Phaseolus vulgaris]
Length=504

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/510 (62%), Positives = 398/510 (78%), Gaps = 9/510 (2%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYS-T  1625
             M +A ++GLS GKRLL SS++YSD  EKLS GSD     +Q++S  S ++AKKSSNY+ T
Sbjct  1     MASAAVIGLSGGKRLLSSSYHYSDIIEKLSYGSDFGSTHYQIVSTKSVIVAKKSSNYTPT  60

Query  1624  SCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmle  1445
                 N++  SIK +KE V  A+ + +       +  L+ +SSE    +E LLLLQK MLE
Sbjct  61    FPAPNRQNQSIKVLKEIVDDAATVADAWFQSLSSNDLEVESSEMGYSVEALLLLQKSMLE  120

Query  1444  kQWNLSAEKSTMT-YTTMENNCKNIQ-VTCSGTSArrrridtrrqiiqQKNSVAKIDTSK  1271
             KQW+LS E   +T +++ E NC+ +  VTCSG SAR+RR++ +      + +  K   + 
Sbjct  121   KQWSLSFEGEGVTEHSSKEKNCRKVAAVTCSGVSARQRRMNAK------RKTAVKTGGAV  174

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
             +++S I  E LQN LKGYVKG+VSEELL+H +VV LS+ IK+GL LEE KSR+KERLGC+
Sbjct  175   QLKSKISPELLQNRLKGYVKGVVSEELLSHAQVVSLSEKIKVGLSLEEHKSRMKERLGCE  234

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGG  911
             PS++++A SL+IS T+L+  M+ECSLAREKLAMSNVRLVMSIAQRY+N G EM DL+QGG
Sbjct  235   PSDDEIATSLKISSTELREKMLECSLAREKLAMSNVRLVMSIAQRYENAGTEMGDLVQGG  294

Query  910   LVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAET  731
             L+GLLRGIEKFD SKG+K+STYVYWWIRQG+S+AL++NS  LRLP HLH RLSLIRNA+ 
Sbjct  295   LIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSKALIENSRTLRLPAHLHERLSLIRNAKL  354

Query  730   KLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIAD  551
             +L+++GITP+IDRIA+ LN+S+KKV NATEA+SK  SLDREAFPS++GL G++ HSYIAD
Sbjct  355   RLEERGITPTIDRIAQHLNMSQKKVRNATEAISKTISLDREAFPSLNGLRGDTHHSYIAD  414

Query  550   SHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSR  371
             + +EN PW  VDE ALKDEVN LI+ TLKEREREIIRLY+GLG ECLTWEDISKR+GLSR
Sbjct  415   NRVENIPWEGVDEWALKDEVNRLINVTLKEREREIIRLYYGLGKECLTWEDISKRMGLSR  474

Query  370   ERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             ERVRQVGLVA EKLKH AR   L+AML+K 
Sbjct  475   ERVRQVGLVALEKLKHGARNRELEAMLLKH  504



>gb|EYU44877.1| hypothetical protein MIMGU_mgv1a004509mg [Erythranthe guttata]
 gb|EYU44878.1| hypothetical protein MIMGU_mgv1a004509mg [Erythranthe guttata]
Length=520

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/525 (63%), Positives = 405/525 (77%), Gaps = 24/525 (5%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSF-YYSDFGEKL-SCGSDHTLPCHQVLSVNSTVMAKKSSNY  1631
             M   A I GLS GKRLL SS  +YSD  +K  +C +D   P   + S    + AKKSSN+
Sbjct  3     MATAAVINGLSTGKRLLLSSSLFYSDVSDKFVACSTDSHCP---IASSKKPINAKKSSNF  59

Query  1630  STSCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQL--QKqsseeenqledllllqk  1457
                  SN+  HSI+A+KEHV  AS+   +EP +     L  ++  + +E  ++ +LLLQK
Sbjct  60    ----FSNRHPHSIRALKEHVDAASDPCTLEPWLIHGSTLLGEEDETSDEYLVDAVLLLQK  115

Query  1456  fmlekQWNLSAEKST-MTYTTMENNC----------KNIQVTCSGTSArrrridtrrqii  1310
              +LEKQWNLSAE ST  T T+               K  QVTCSGTSAR RR+D+R++ +
Sbjct  116   SLLEKQWNLSAESSTKQTVTSPRERTPAPARARARKKITQVTCSGTSARSRRMDSRKKAV  175

Query  1309  qQKNSVAKID-TSKRVRSIIGMEQLQNS-LKGYVKGIVSEELLTHGEVVELSKMIKLGLY  1136
              +  S +  D   K+ RSII  E LQNS  +GYVKG++SE+LLTH +VV+LS++IK GL 
Sbjct  176   GRNISNSHHDNVRKQWRSIISPELLQNSSRRGYVKGVISEDLLTHSQVVQLSQIIKAGLL  235

Query  1135  LEEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQR  956
             LE+++SRLKERLGC+PS+EQLA SL+ISR DL+  +IECSLAREKLAMSN+RLVMSIAQR
Sbjct  236   LEDRRSRLKERLGCEPSDEQLATSLQISRADLQSKLIECSLAREKLAMSNIRLVMSIAQR  295

Query  955   YDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLP  776
             YD+MGAEMADLIQGGL+GLLRGIEK+D SKG+K+STYVYWWIRQG+S+ALV+NS  LRLP
Sbjct  296   YDHMGAEMADLIQGGLIGLLRGIEKYDSSKGFKISTYVYWWIRQGVSKALVENSRTLRLP  355

Query  775   KHLHGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPS  596
              HLH RLSLIRNA+ +L++KGITPSI RIAESLN+S+KKV NATEA SKVFSLDREAFPS
Sbjct  356   THLHERLSLIRNAKARLEEKGITPSISRIAESLNMSQKKVRNATEANSKVFSLDREAFPS  415

Query  595   IDGLPGESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNE  416
             ++G+PG++LHSYIAD+H+EN PWH VDE ALKDEV+ LI  TL+EREREIIRLY+GL NE
Sbjct  416   LNGIPGKTLHSYIADNHVENIPWHGVDEWALKDEVDKLITLTLREREREIIRLYYGLDNE  475

Query  415   CLTWEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             CLTWEDIS+RIGLSRERVRQVGLVA EKLKHAAR  RL A+ ++ 
Sbjct  476   CLTWEDISRRIGLSRERVRQVGLVALEKLKHAARNTRLDALFIQH  520



>ref|XP_006419162.1| hypothetical protein EUTSA_v10002486mg [Eutrema salsugineum]
 gb|ESQ37598.1| hypothetical protein EUTSA_v10002486mg [Eutrema salsugineum]
Length=519

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/518 (61%), Positives = 397/518 (77%), Gaps = 11/518 (2%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GL+AGKRLL SSFYYSD  EK    +DH    + + S  S + AKK+ + S+
Sbjct  1     MMATAAVIGLNAGKRLLSSSFYYSDVTEKFLSVNDHCSSQYHIASTRSGITAKKTPSSSS  60

Query  1624  SCVSN-----QRMHSIKAIKEHVTVASNLFN--MEPCVQRNKQLQKqsseeenqledlll  1466
             +   +     +   S KA+KE V V ++     + P   +  + +    +  + +E LLL
Sbjct  61    NYSPSLPSSSRHTQSAKALKETVDVVASSVQPWLPPGSDKEMEGESYEDDLGHSVEALLL  120

Query  1465  lqkfmlekQWNLSAEKSTMTYTTMENNC--KNIQVTCSGTSArrrridtrrqiiqQK-NS  1295
             LQK MLEKQWNLS EK+  + +  +     K   VTCSG SAR+RRI  +++        
Sbjct  121   LQKSMLEKQWNLSFEKAATSESPSKKRMTRKKNPVTCSGISARQRRIGAKKKTNMSHVKV  180

Query  1294  VAKIDTSKRVRSIIGMEQLQNS-LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKS  1118
             V+++ + K+V+S+I  E  QN+ +KGYV+G+VSE++L+H EVV LSK IK GL L++ KS
Sbjct  181   VSEVSSGKQVKSVINSELFQNNRVKGYVRGVVSEDVLSHAEVVRLSKKIKSGLRLDDHKS  240

Query  1117  RLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGA  938
             RLK+RLGC+PS+EQLA+SL+ISR +L+  ++EC LAREKLAMSNVRLVMSIAQRYDNMGA
Sbjct  241   RLKDRLGCEPSDEQLAISLKISRGELQAWLMECHLAREKLAMSNVRLVMSIAQRYDNMGA  300

Query  937   EMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGR  758
             EM+DL+QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP HLH R
Sbjct  301   EMSDLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHER  360

Query  757   LSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPG  578
             L LIRNA+ +L++KGITPSIDRIAESLN+S+KKV NATEAVSK+FSLDR+AFPS++GLPG
Sbjct  361   LGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKIFSLDRDAFPSLNGLPG  420

Query  577   ESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWED  398
             E+ HSYIAD+ LENNPWH  DE ALKDEV+ LI  TL EREREIIRLY+GL  ECLTWED
Sbjct  421   ETHHSYIADNRLENNPWHGYDEWALKDEVSKLISATLGEREREIIRLYYGLDKECLTWED  480

Query  397   ISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             ISKRIGLSRERVRQVGLVA EKLKHAARK +++AM++K
Sbjct  481   ISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  518



>gb|EYU44876.1| hypothetical protein MIMGU_mgv1a004509mg [Erythranthe guttata]
Length=523

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/528 (63%), Positives = 405/528 (77%), Gaps = 27/528 (5%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSF-YYSDFGEKL-SCGSDHTLPCHQVLSVNSTVMAKKSSNY  1631
             M   A I GLS GKRLL SS  +YSD  +K  +C +D   P   + S    + AKKSSN+
Sbjct  3     MATAAVINGLSTGKRLLLSSSLFYSDVSDKFVACSTDSHCP---IASSKKPINAKKSSNF  59

Query  1630  STSCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQL--QKqsseeenqledllllqk  1457
                  SN+  HSI+A+KEHV  AS+   +EP +     L  ++  + +E  ++ +LLLQK
Sbjct  60    ----FSNRHPHSIRALKEHVDAASDPCTLEPWLIHGSTLLGEEDETSDEYLVDAVLLLQK  115

Query  1456  fmlekQWNLSAEKST-MTYTTMENNC----------KNIQVTCSGTSArrrridtrrqii  1310
              +LEKQWNLSAE ST  T T+               K  QVTCSGTSAR RR+D+R++ +
Sbjct  116   SLLEKQWNLSAESSTKQTVTSPRERTPAPARARARKKITQVTCSGTSARSRRMDSRKKAV  175

Query  1309  qQKNSVAKID-TSKRVRSIIGMEQLQNS-LKGYVKGIVSEELLTHGEVVELSKMIKLGLY  1136
              +  S +  D   K+ RSII  E LQNS  +GYVKG++SE+LLTH +VV+LS++IK GL 
Sbjct  176   GRNISNSHHDNVRKQWRSIISPELLQNSSRRGYVKGVISEDLLTHSQVVQLSQIIKAGLL  235

Query  1135  LEEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQR  956
             LE+++SRLKERLGC+PS+EQLA SL+ISR DL+  +IECSLAREKLAMSN+RLVMSIAQR
Sbjct  236   LEDRRSRLKERLGCEPSDEQLATSLQISRADLQSKLIECSLAREKLAMSNIRLVMSIAQR  295

Query  955   YDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQ---GISRALVKNSSML  785
             YD+MGAEMADLIQGGL+GLLRGIEK+D SKG+K+STYVYWWIRQ   G+S+ALV+NS  L
Sbjct  296   YDHMGAEMADLIQGGLIGLLRGIEKYDSSKGFKISTYVYWWIRQHCQGVSKALVENSRTL  355

Query  784   RLPKHLHGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREA  605
             RLP HLH RLSLIRNA+ +L++KGITPSI RIAESLN+S+KKV NATEA SKVFSLDREA
Sbjct  356   RLPTHLHERLSLIRNAKARLEEKGITPSISRIAESLNMSQKKVRNATEANSKVFSLDREA  415

Query  604   FPSIDGLPGESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGL  425
             FPS++G+PG++LHSYIAD+H+EN PWH VDE ALKDEV+ LI  TL+EREREIIRLY+GL
Sbjct  416   FPSLNGIPGKTLHSYIADNHVENIPWHGVDEWALKDEVDKLITLTLREREREIIRLYYGL  475

Query  424   GNECLTWEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
              NECLTWEDIS+RIGLSRERVRQVGLVA EKLKHAAR  RL A+ ++ 
Sbjct  476   DNECLTWEDISRRIGLSRERVRQVGLVALEKLKHAARNTRLDALFIQH  523



>ref|XP_008382369.1| PREDICTED: RNA polymerase sigma factor sigA-like [Malus domestica]
Length=514

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/517 (64%), Positives = 394/517 (76%), Gaps = 12/517 (2%)
 Frame = -1

Query  1804  MMVTATIVGLSAGK-RLLCSSFYYSDFGEKLSCGSDHT-LPCHQVLSVNSTVMAKKSSNY  1631
             MM TA I+GL+ GK  L  SS Y SD  EKL   +DH  L CH   + N     K +SNY
Sbjct  1     MMATAAIIGLATGKMLLNSSSSYNSDITEKLFHLNDHAFLHCHFSSTKNLVTARKSNSNY  60

Query  1630  STSCV--SNQRMHSIKAIKEHVTVASNLFNMEPCVQR----NKQLQKqsseeenqledll  1469
             ++S    SN+   S +A+KEHV  A   F      Q+       L+++SS+ E  ++ LL
Sbjct  61    TSSRFPSSNRPDRSSRALKEHVDAA---FGPSSTAQQWFHSFNDLEEESSDLEYSVDALL  117

Query  1468  llqkfmlekQWNLSAEKSTMTYTTMENNC-KNIQVTCSGTSArrrridtrrqiiqQKNSV  1292
             LLQK MLEKQWNLS EK     +T++    K I VTCSG SAR RR+ TRR        +
Sbjct  118   LLQKSMLEKQWNLSFEKKVFMDSTIKTATNKRIPVTCSGVSARHRRMSTRRNAFSANRCL  177

Query  1291  AKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRL  1112
              +  T+K +R ++  E LQN LKGYVKG++SE+LLTH EVV LSK IK+GL +EE KSRL
Sbjct  178   TQPSTNKPLRPVMSPELLQNRLKGYVKGVLSEDLLTHTEVVRLSKKIKIGLSVEEHKSRL  237

Query  1111  KERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEM  932
             KERLGC+PS++QLA SLRISRT+L   +IECSLAREKLAMSNVRLVMSIAQ+YDNMGAEM
Sbjct  238   KERLGCEPSDKQLATSLRISRTELLSKLIECSLAREKLAMSNVRLVMSIAQKYDNMGAEM  297

Query  931   ADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLS  752
             ADLIQGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL 
Sbjct  298   ADLIQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSKTLRLPTHLHERLG  357

Query  751   LIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGES  572
             LIRNA+ +L++KGITPSIDRIAESLN+S+KKV NATEA+ KVFSLDR+AFPS++GLPGE+
Sbjct  358   LIRNAKIRLEEKGITPSIDRIAESLNMSRKKVRNATEAIGKVFSLDRDAFPSLNGLPGET  417

Query  571   LHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDIS  392
              HSYIAD+ LEN PW+ VD  ALKDEVN LI+  L +REREIIRLY+GL NECLTWEDIS
Sbjct  418   HHSYIADNRLENVPWNGVDALALKDEVNKLINMMLGDREREIIRLYYGLDNECLTWEDIS  477

Query  391   KRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             KRIGLSRERVRQVGLVA EKLKH ARKN ++A+LVK 
Sbjct  478   KRIGLSRERVRQVGLVALEKLKHGARKNEMEALLVKH  514



>gb|KEH16477.1| RNA polymerase sigma factor [Medicago truncatula]
Length=504

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/509 (62%), Positives = 392/509 (77%), Gaps = 9/509 (2%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++GLS GKRLL SS++YSD  EK S   D     +Q+    S ++AKKSS Y+ +
Sbjct  1     MATAAVIGLSGGKRLLSSSYHYSDIIEKFSHACDFGSTQYQLPPSKSVIVAKKSSKYTPT  60

Query  1621  CVSNQRMHSIKAIKEHVTVASNLFNMEPCVQ--RNKQLQKqsseeenqledllllqkfml  1448
                 ++  SIKA+KEHV V S   + E   Q   +   + +SS+ +  L+ LLLLQK ML
Sbjct  61    FPPERKNQSIKALKEHV-VDSAQADSEQWFQGYNSNDFEVESSDMDYSLDSLLLLQKSML  119

Query  1447  ekQWNLSAEKSTMTYTTMENNCK-NIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSK  1271
             EKQW+LS E+  ++  +     +  + VTCSG SAR+RR+ T+R++  +  S        
Sbjct  120   EKQWSLSFERKVLSENSRREKIRRKVSVTCSGVSARQRRMTTKRKVAAKSGSAVM-----  174

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
             ++RS I  E +QN LKGYVKG+V +ELL+H EVV+LS+ IK GL L+E KSRLKERLG +
Sbjct  175   QLRSTISPELIQNRLKGYVKGVVCDELLSHAEVVKLSEKIKAGLSLDEHKSRLKERLGSE  234

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGG  911
             PS++Q+A SL+ISR DL+  +IECSLAREKL MSNVRLV+SIAQRYDNMGAEM DL+QGG
Sbjct  235   PSDDQVATSLKISRADLRAKIIECSLAREKLTMSNVRLVLSIAQRYDNMGAEMGDLVQGG  294

Query  910   LVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAET  731
             L+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RLSLIRNAE 
Sbjct  295   LIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPAHLHERLSLIRNAEY  354

Query  730   KLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIAD  551
             KL+++GITP+IDRIA+SLN+S++KV NATEA SKVFSLDREAFPS++GLPG++ HS+IAD
Sbjct  355   KLEERGITPTIDRIAKSLNMSQRKVRNATEATSKVFSLDREAFPSLNGLPGDTHHSFIAD  414

Query  550   SHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSR  371
                EN PW+ VDE ALK+EVN LI+ TL EREREIIRLY+GL  ECLTWEDISKRIGLSR
Sbjct  415   KQNENIPWNVVDEWALKEEVNRLINLTLVEREREIIRLYYGLDKECLTWEDISKRIGLSR  474

Query  370   ERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             ERVRQVGLVA EKLKHAARK  ++AML+K
Sbjct  475   ERVRQVGLVALEKLKHAARKREMEAMLLK  503



>ref|XP_010414870.1| PREDICTED: RNA polymerase sigma factor sigA-like [Camelina sativa]
 ref|XP_010414871.1| PREDICTED: RNA polymerase sigma factor sigA-like [Camelina sativa]
Length=519

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/519 (60%), Positives = 395/519 (76%), Gaps = 13/519 (3%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKK--SSNY  1631
             MM TA ++GL+ GKRLL SSFY+SD  +K    +DH    + + S  S + AKK  SSNY
Sbjct  1     MMATAAVIGLNTGKRLLSSSFYHSDVTDKFLSVNDHCSSQYHIASTKSGITAKKASSSNY  60

Query  1630  STSCVS-NQRMHSIKAIKEHVTVASNLFNMEPC-----VQRNKQLQKqsseeenqledll  1469
             S S  S N+   S KA+ E V VAS      P      ++  +          + +E LL
Sbjct  61    SPSFPSSNRHTQSAKALTESVDVASTEQPWVPTGTDKDLEEEEDCYDDDLLIGHSVEALL  120

Query  1468  llqkfmlekQWNLSAEKSTMTYTTMENNCKNIQV---TCSGTSArrrridtrrqiiqQKN  1298
             LLQK MLEK WNLS +K++   ++ +   +  ++   TCSG SAR+RRI  +++     N
Sbjct  121   LLQKSMLEKSWNLSFDKASHESSSGKRTIRKKKIPVITCSGISARQRRIGAKKKTNMMTN  180

Query  1297  SVAKIDTSKRVRSIIGMEQLQ-NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQK  1121
             S A + + K+VRS++  +  Q N ++GYVKG++SE++L+H EVV LSK IK GL L++ K
Sbjct  181   SKA-VSSGKQVRSVMSSDLFQHNRVRGYVKGVISEDVLSHSEVVRLSKKIKSGLRLDDHK  239

Query  1120  SRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMG  941
             SRLK+RLGC+PS+EQLA+SL+ISR +L+  ++EC LAREKLAMSNVRLV+SIAQRYDNMG
Sbjct  240   SRLKDRLGCEPSDEQLAISLKISRAELQAWLMECHLAREKLAMSNVRLVLSIAQRYDNMG  299

Query  940   AEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHG  761
             AEM+DL+QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP HLH 
Sbjct  300   AEMSDLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHE  359

Query  760   RLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLP  581
             RL LIRNA+ +L++KGITPSIDRIAESLN+S+KKV NATEAVSK+FSLDR+AFPS++GLP
Sbjct  360   RLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKIFSLDRDAFPSLNGLP  419

Query  580   GESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWE  401
             GE+ HSYIAD+ LENNPW+  DE ALK+EV+ LI  TL EREREIIRLY+GL  ECLTWE
Sbjct  420   GETHHSYIADNRLENNPWYGYDEWALKEEVSKLISATLGEREREIIRLYYGLDKECLTWE  479

Query  400   DISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             DISKRIGLSRERVRQVGLVA EKLKHAARK +++AM++K
Sbjct  480   DISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  518



>ref|XP_004499502.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Cicer 
arietinum]
 ref|XP_004499503.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Cicer 
arietinum]
Length=513

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/519 (60%), Positives = 394/519 (76%), Gaps = 18/519 (3%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYS-T  1625
             M TA ++GLS GKRLL SS++YSD  EK     D     + +    S + +KKSS  + T
Sbjct  1     MATAAVIGLSGGKRLLSSSYHYSDVIEKFYHSCDFGSSQYHLPPSKSVIFSKKSSKCAPT  60

Query  1624  SCVSNQRMHSIKAIKEHVTVA----SNLFNMEPCVQ------RNKQLQKqsseeenqled  1475
                SN++ HSIKA+KEHV V     +++ N +P +Q       +  L+ ++S+    ++ 
Sbjct  61    FSASNRQNHSIKALKEHVVVVDGAPTSIANSKPWIQGCSNSNNDLGLEVETSDIGYSVDT  120

Query  1474  llllqkfmlekQWNLSAEKSTMTY-TTMENNCKNIQVTCSGTSArrrridtrrqiiqQKN  1298
             LLL+QK MLEKQW LS E   +T  +T   + + + VTCSG SAR+RR +T+      K 
Sbjct  121   LLLMQKSMLEKQWCLSFESEVLTENSTRAKSRRKVTVTCSGMSARQRRTNTK------KK  174

Query  1297  SVAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKS  1118
               +K   ++++RS I  E LQN LKGYVKGIVSEELL+H +VV+LS+ IK GL L+E KS
Sbjct  175   ITSKSGYARKLRSTISPELLQNRLKGYVKGIVSEELLSHAQVVKLSQKIKAGLSLDEHKS  234

Query  1117  RLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGA  938
             RLKERLGC+PS++Q+A SL+ISR +L+  +IECSLAREKL MSNVRLVMSIAQRYDNMGA
Sbjct  235   RLKERLGCEPSDDQVATSLKISRAELRAKIIECSLAREKLTMSNVRLVMSIAQRYDNMGA  294

Query  937   EMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGR  758
             EMADL+QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH R
Sbjct  295   EMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPTHLHDR  354

Query  757   LSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPG  578
             LSLIRNAE +L+++GITP+IDRIA+ LN+S KKV NATEA++KVFS+DREAFPS++GLPG
Sbjct  355   LSLIRNAEYRLEERGITPTIDRIAKCLNMSPKKVRNATEAINKVFSIDREAFPSLNGLPG  414

Query  577   ESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWED  398
             ++ H++IAD   EN PW+ VDE  LK+EVN LI+ TL EREREI+RLY+GL   CLTWED
Sbjct  415   DTHHNFIADKRFENIPWNGVDEWILKEEVNRLINVTLVEREREIVRLYYGLDKACLTWED  474

Query  397   ISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             ISKRIGLSRERVRQVGLVA EKLKH ARK  ++AML+K 
Sbjct  475   ISKRIGLSRERVRQVGLVALEKLKHEARKREMEAMLLKH  513



>ref|XP_004499501.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X3 [Cicer 
arietinum]
Length=513

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/519 (60%), Positives = 394/519 (76%), Gaps = 18/519 (3%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++GLS GKRLL SS++YSD  EK   G D     + +    S +++KKSS  + +
Sbjct  1     MATAAVIGLSGGKRLLSSSYHYSDVIEKFYHGCDFGSSQYHLPPSKSVILSKKSSKCAPT  60

Query  1621  CVSNQRM-HSIKAIKEHVTV---ASNLFNMEPCVQ----RNKQLQ---Kqsseeenqled  1475
               +  R  HSIKA+KEH  V   A  + N EP  Q     N  L+   + S      ++ 
Sbjct  61    FPAYDRQNHSIKALKEHAVVVDDAPAIANSEPWFQGGCNSNSDLELELETSDINCYSVDA  120

Query  1474  llllqkfmlekQWNLSAEKSTMTYTTME-NNCKNIQVTCSGTSArrrridtrrqiiqQKN  1298
             LLL+QK MLEKQW LS E+  +T  +M   N + + VTCSG SAR+RR++++      + 
Sbjct  121   LLLMQKSMLEKQWCLSFEREVVTENSMRVKNRRKVTVTCSGVSARQRRMNSK------RK  174

Query  1297  SVAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKS  1118
               +K  ++ ++RS I  E LQN LKGYVKG+VSEELL+H +VV+LS+ IK GL L+E KS
Sbjct  175   ISSKTGSAVQMRSAITPELLQNRLKGYVKGVVSEELLSHAQVVKLSQKIKAGLSLDEHKS  234

Query  1117  RLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGA  938
             RLKERLGC+PS++Q+A SL+IS+ +L+  +IECSLAREKL MSNVRLVMSIAQRYDNMGA
Sbjct  235   RLKERLGCEPSDDQVATSLKISQAELRAKIIECSLAREKLTMSNVRLVMSIAQRYDNMGA  294

Query  937   EMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGR  758
             EMADL+QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+S+ALV+NS  LRLP HLH R
Sbjct  295   EMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSKALVENSRTLRLPTHLHER  354

Query  757   LSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPG  578
             LSLIRNAE +L+++GITP+IDRIA+ LN+S+KKV NATEA++KVFS+DREAFPS++GLPG
Sbjct  355   LSLIRNAEYRLEERGITPTIDRIAKCLNMSQKKVRNATEAINKVFSIDREAFPSLNGLPG  414

Query  577   ESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWED  398
             ++ H++IAD   EN PW+ VDE ALK+EVN LI+ TL EREREI+RLY+GL  ECLTWED
Sbjct  415   DTHHNFIADKRHENIPWNGVDEWALKEEVNRLINVTLVEREREIVRLYYGLDKECLTWED  474

Query  397   ISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             ISKRIGLSRERVRQVGLVA EKLKH ARK  ++AML+K 
Sbjct  475   ISKRIGLSRERVRQVGLVALEKLKHEARKREMEAMLLKH  513



>ref|XP_004499499.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Cicer 
arietinum]
 ref|XP_004499500.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Cicer 
arietinum]
Length=514

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/520 (60%), Positives = 391/520 (75%), Gaps = 19/520 (4%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++GLS GKRLL SS++YSD  EK   G D     + +    S +++KKSS  + +
Sbjct  1     MATAAVIGLSGGKRLLSSSYHYSDVIEKFYHGCDFGSSQYHLPPSKSVILSKKSSKCAPT  60

Query  1621  CVSNQRM-HSIKAIKEHVTV---ASNLFNMEPCVQRN--------KQLQKqsseeenqle  1478
               +  R  HSIKA+KEH  V   A  + N EP  Q           +L+       +   
Sbjct  61    FPAYDRQNHSIKALKEHAVVVDDAPAIANSEPWFQGGCNSNSDLELELETSDINCYSVDA  120

Query  1477  dllllqkfmlekQWNLSAEKSTMTYTTME-NNCKNIQVTCSGTSArrrridtrrqiiqQK  1301
              LLL+QK MLEKQW LS E+  +T  +M   N + + VTCSG SAR+RR++++      +
Sbjct  121   PLLLMQKSMLEKQWCLSFEREVVTENSMRVKNRRKVTVTCSGVSARQRRMNSK------R  174

Query  1300  NSVAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQK  1121
                +K  ++ ++RS I  E LQN LKGYVKG+VSEELL+H +VV+LS+ IK GL L+E K
Sbjct  175   KISSKTGSAVQMRSAITPELLQNRLKGYVKGVVSEELLSHAQVVKLSQKIKAGLSLDEHK  234

Query  1120  SRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMG  941
             SRLKERLGC+PS++Q+A SL+IS+ +L+  +IECSLAREKL MSNVRLVMSIAQRYDNMG
Sbjct  235   SRLKERLGCEPSDDQVATSLKISQAELRAKIIECSLAREKLTMSNVRLVMSIAQRYDNMG  294

Query  940   AEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHG  761
             AEMADL+QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+S+ALV+NS  LRLP HLH 
Sbjct  295   AEMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSKALVENSRTLRLPTHLHE  354

Query  760   RLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLP  581
             RLSLIRNAE +L+++GITP+IDRIA+ LN+S+KKV NATEA++KVFS+DREAFPS++GLP
Sbjct  355   RLSLIRNAEYRLEERGITPTIDRIAKCLNMSQKKVRNATEAINKVFSIDREAFPSLNGLP  414

Query  580   GESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWE  401
             G++ H++IAD   EN PW+ VDE ALK+EVN LI+ TL EREREI+RLY+GL  ECLTWE
Sbjct  415   GDTHHNFIADKRHENIPWNGVDEWALKEEVNRLINVTLVEREREIVRLYYGLDKECLTWE  474

Query  400   DISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             DISKRIGLSRERVRQVGLVA EKLKH ARK  ++AML+K 
Sbjct  475   DISKRIGLSRERVRQVGLVALEKLKHEARKREMEAMLLKH  514



>ref|XP_010511140.1| PREDICTED: RNA polymerase sigma factor sigA [Camelina sativa]
Length=541

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/526 (59%), Positives = 395/526 (75%), Gaps = 15/526 (3%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKK--SSNY  1631
             MM TA ++GL+ GKRLL SSFY+SD  ++    +DH    + + S  S + AKK  SSNY
Sbjct  1     MMATAAVIGLNTGKRLLSSSFYHSDVTDRFLSVNDHCSSQYHIASTKSGITAKKASSSNY  60

Query  1630  STSCVS-NQRMHSIKAIKEHVTVASNLFNMEPC------VQRNKQLQKqsseeenqledl  1472
             S +  S N+   S KA+ E V VAS      P        +             + +E L
Sbjct  61    SPNFPSSNRHTQSAKALTESVDVASTEQPWVPTGTDKESEEEEDCYDDDDLLIGHSVEAL  120

Query  1471  lllqkfmlekQWNLSAEKSTMTYTTMENNCKNIQV---TCSGTSArrrridtrrqiiqQK  1301
             LLLQK MLEK WNLS +K++   ++ +   +  ++   TCSG SAR+RRI  +++     
Sbjct  121   LLLQKSMLEKSWNLSFDKASHESSSGKRTIRKKKIPVITCSGISARQRRIGAKKKTNMMT  180

Query  1300  NS--VAKIDTSKRVRSIIGMEQLQ-NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLE  1130
             N+  V+ + + K+VRS++  +  Q N ++GYVKG++SE++L+H EVV LSK IK GL L+
Sbjct  181   NAKAVSTVSSGKQVRSVMSSDLFQHNRVRGYVKGVISEDVLSHSEVVRLSKKIKSGLRLD  240

Query  1129  EQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYD  950
             + KSRLK+RLGC+PS+EQLA+SL+ISR +L+  ++EC LAREKLAMSNVRLV+SIAQRYD
Sbjct  241   DHKSRLKDRLGCEPSDEQLAISLKISRAELQAWLMECHLAREKLAMSNVRLVLSIAQRYD  300

Query  949   NMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKH  770
             NMGAEM+DL+QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP H
Sbjct  301   NMGAEMSDLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTH  360

Query  769   LHGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSID  590
             LH RL LIRNA+ +L++KGITPSIDRIAESLN+S+KKV NATEAVSK+FSLDR+AFPS++
Sbjct  361   LHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKIFSLDRDAFPSLN  420

Query  589   GLPGESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECL  410
             GLPGE+ HSYIAD+ LENNPW+  DE ALK+EV+ LI  TL EREREIIRLY+GL  ECL
Sbjct  421   GLPGETHHSYIADNRLENNPWYGYDEWALKEEVSKLISATLGEREREIIRLYYGLDKECL  480

Query  409   TWEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ*RF  272
             TWEDISKRIGLSRERVRQVGLVA EKLKHAARK +++AM++K   F
Sbjct  481   TWEDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILKNCFF  526



>ref|XP_010470329.1| PREDICTED: RNA polymerase sigma factor sigA-like [Camelina sativa]
 ref|XP_010470330.1| PREDICTED: RNA polymerase sigma factor sigA-like [Camelina sativa]
Length=520

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/520 (60%), Positives = 397/520 (76%), Gaps = 14/520 (3%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKK--SSNY  1631
             MM TA ++GL+ GKRLL SSFY+SD  +K    +DH    + + S  S + AKK  SSNY
Sbjct  1     MMATAAVIGLNTGKRLLSSSFYHSDVTDKFLSVNDHCSSQYHIASTKSGITAKKASSSNY  60

Query  1630  STSCVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeen------qledl  1472
             S S  S N+   S KA+ E V VAS      P     +  +++   +++       +E L
Sbjct  61    SPSFPSSNRHTQSAKALTESVDVASTEQPWVPTATDKELEEEEDCYDDDDLLIGHSVEAL  120

Query  1471  lllqkfmlekQWNLSAEKSTMTYTTMENNCKNIQV---TCSGTSArrrridtrrqiiqQK  1301
             LLLQK MLEK WNLS +K++   ++ +   +  ++   TCSG SAR+RRI  +++     
Sbjct  121   LLLQKSMLEKSWNLSFDKASHESSSGKRTIRKKKIPVITCSGISARQRRIGAKKKTNIMG  180

Query  1300  NSVAKIDTSKRVRSIIGMEQLQ-NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQ  1124
             N+ A +    +VRS++  +  Q N ++GYVKG++SE++L+H EVV LSK IK GL L++ 
Sbjct  181   NAKA-VSRGNQVRSVMSSDLFQHNRVRGYVKGVISEDVLSHSEVVRLSKKIKSGLRLDDH  239

Query  1123  KSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNM  944
             KSRLK+RLGC+PS+EQLA+SL+ISR +L+  ++EC LARE+LAMSNVRLV+SIAQRYDNM
Sbjct  240   KSRLKDRLGCEPSDEQLAISLKISRAELQAWLMECHLARERLAMSNVRLVLSIAQRYDNM  299

Query  943   GAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLH  764
             GAEM+DL+QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP HLH
Sbjct  300   GAEMSDLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLH  359

Query  763   GRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGL  584
              RL LIRNA+ +L++KGITPSIDRIAESLN+S+KKV NATEAVSK+FSLDR+AFPS++GL
Sbjct  360   ERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKIFSLDRDAFPSLNGL  419

Query  583   PGESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTW  404
             PGE+ HSYIAD+ LENNPW+  DE ALK+EV+ LI+ TL EREREIIRLY+GL  ECLTW
Sbjct  420   PGETHHSYIADNRLENNPWYGYDEWALKEEVSKLINGTLGEREREIIRLYYGLDKECLTW  479

Query  403   EDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             EDISKRIGLSRERVRQVGLVA EKLKHAARK +++AM++K
Sbjct  480   EDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  519



>gb|KDO48031.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=485

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/510 (62%), Positives = 387/510 (76%), Gaps = 27/510 (5%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLSAGKRLL SSFYYSD  EK S  +D      QV S  + V AKKSSNY+ 
Sbjct  1     MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNP  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllllqkfm  1451
             S  S N++   IKA+KEHV   +N  +  EP  +    ++++SSE +  +E LLLLQK M
Sbjct  61    SFPSSNRQTQPIKALKEHVD--TNFASTAEPWAEPPNSIEEESSELDYSVEALLLLQKSM  118

Query  1450  lekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSK  1271
             LEKQWNLS E++ +T +  +   K + VTCSG SAR+RR++++++I+ Q  S+ + + SK
Sbjct  119   LEKQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSILQQNGSK  178

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
             ++RS+I  E +QN LKGYVKG+VSEELLTH EVV LSK IK GL L++ K RLKERLGC+
Sbjct  179   QLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCE  238

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGG  911
             PS EQLA SLRISR +L+  ++ECSLAREKL MSNVRLVMSIAQRYDNMGA+MADL+QGG
Sbjct  239   PSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGG  298

Query  910   LVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAET  731
             L+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+ 
Sbjct  299   LIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKL  358

Query  730   KLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIAD  551
             +L++KG+TPS+DRIAE LN+S+KKV NATE +                       +YIAD
Sbjct  359   RLEEKGVTPSVDRIAEYLNMSQKKVRNATEVL-----------------------AYIAD  395

Query  550   SHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSR  371
             + +ENNPWH VD+ ALKDEVN LI  TL EREREIIRLY+GL  ECLTWEDISKRIGLSR
Sbjct  396   NRVENNPWHGVDDWALKDEVNKLIIVTLGEREREIIRLYYGLDKECLTWEDISKRIGLSR  455

Query  370   ERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             ERVRQVGLVA EKLKHAARK +++AMLVK 
Sbjct  456   ERVRQVGLVALEKLKHAARKKKMEAMLVKH  485



>ref|XP_009348922.1| PREDICTED: RNA polymerase sigma factor sigA-like [Pyrus x bretschneideri]
Length=514

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/514 (63%), Positives = 390/514 (76%), Gaps = 6/514 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGK-RLLCSSFYYSDFGEKLSCGSDHT-LPCHQVLSVNSTVMAKKSSNY  1631
             MM  A ++GL+ GK  L  SS Y SD  EKL   +DH  L CH   + N     K +SNY
Sbjct  1     MMAIAAVIGLTTGKMLLNSSSSYNSDITEKLFHLNDHAFLHCHFSSTKNLVTARKSNSNY  60

Query  1630  STS--CVSNQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllllq  1460
             ++S    SN+  HS +A KEHV  AS   +  +        L+++SS+ E  ++ LLLLQ
Sbjct  61    TSSRFASSNRPDHSSRAFKEHVDAASGPSSTAQQWFHSFNDLEEESSDLEYSVDALLLLQ  120

Query  1459  kfmlekQWNLSAEKSTMTYTTMENNC-KNIQVTCSGTSArrrridtrrqiiqQKNSVAKI  1283
             K MLEKQWNLS E+     +T++    K I VTCSG SAR RR+ TRR        + + 
Sbjct  121   KSMLEKQWNLSFERKVFMDSTIKTATNKRIPVTCSGVSARHRRMSTRRNAFSANRCLTQP  180

Query  1282  DTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKER  1103
              T+K +R ++  E LQN LKGYVKG++SE+LLTH EVV LS+ IK+GL +EE KSRLKER
Sbjct  181   STNKPLRPVMSPELLQNRLKGYVKGVLSEDLLTHTEVVRLSRKIKIGLSVEEHKSRLKER  240

Query  1102  LGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADL  923
             LGC+PS++QLA SLRISRT+L   +IECSLAREKLAMSNVRLVMSIAQ+YDNMGAEMADL
Sbjct  241   LGCEPSDKQLATSLRISRTELLSKLIECSLAREKLAMSNVRLVMSIAQKYDNMGAEMADL  300

Query  922   IQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIR  743
             IQGG +GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIR
Sbjct  301   IQGGFIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSKTLRLPTHLHERLGLIR  360

Query  742   NAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHS  563
             NA+ +L++KGI PSIDRIAESLN+S+KKV NATEA+SKV SLDR+AFPS++GLPGE+ HS
Sbjct  361   NAKIRLEEKGIAPSIDRIAESLNMSRKKVRNATEAISKVLSLDRDAFPSLNGLPGETHHS  420

Query  562   YIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRI  383
             YIAD+ LEN PW+ VD  ALKDEVN LI+  L +REREIIRLY+GL NE LTWEDISKRI
Sbjct  421   YIADNRLENVPWNGVDALALKDEVNKLINMMLGDREREIIRLYYGLDNEGLTWEDISKRI  480

Query  382   GLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             GLSRERVRQVGLVA EKLKH ARKN ++A+LVK 
Sbjct  481   GLSRERVRQVGLVALEKLKHGARKNEMEALLVKH  514



>ref|NP_176666.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
 sp|O24629.1|SIGA_ARATH RecName: Full=RNA polymerase sigma factor sigA; Short=Sigma factor 
A; Short=Sigma-A; AltName: Full=RNA polymerase sigma factor 
sig1; Short=Atsig1; Short=Sigma factor 1; AltName: Full=RNA 
polymerase sigma factor sig2; Short=Atsig2; Short=Sigma 
factor 2; AltName: Full=RNA polymerase sigma factor sigB; 
Short=Sigma factor B; Short=Sigma-B; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD38260.1|AC006193_16 RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
 gb|AAB69384.1| sigma factor 1 [Arabidopsis thaliana]
 dbj|BAA22421.1| SigA [Arabidopsis thaliana]
 emb|CAA74640.1| plastid RNA polymerase sigma factor [Arabidopsis thaliana]
 dbj|BAA82448.1| sigma factor SigA [Arabidopsis thaliana]
 gb|AAL32604.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
 gb|AAM13305.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
 dbj|BAH19492.1| AT1G64860 [Arabidopsis thaliana]
 gb|AEE34298.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
Length=502

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/515 (60%), Positives = 389/515 (76%), Gaps = 23/515 (4%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++GL+ GKRLL SSFY+SD  EK    +DH    + + S  S + AKK+SNYS S
Sbjct  1     MATAAVIGLNTGKRLLSSSFYHSDVTEKFLSVNDHCSSQYHIASTKSGITAKKASNYSPS  60

Query  1621  CVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKq----sseeenqledllllqk  1457
               S N+   S KA+KE V VAS      P    +K+L+++         + +E +LLLQK
Sbjct  61    FPSSNRHTQSAKALKESVDVASTEKPWLPN-GTDKELEEECYDDDDLISHSVEAILLLQK  119

Query  1456  fmlekQWNLSAEKSTMTYTTMENNCKNIQV---TCSGTSArrrridtrrqiiqQK-NSVA  1289
              MLEK WNLS EK+  +    +   +  ++   TCSG SAR+RRI  +++       +V+
Sbjct  120   SMLEKSWNLSFEKAVSSEYPGKGTIRKKKIPVITCSGISARQRRIGAKKKTNMTHVKAVS  179

Query  1288  KIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLK  1109
              + + K+VR             GYVKG++SE++L+H EVV LSK IK GL L++ KSRLK
Sbjct  180   DVSSGKQVR-------------GYVKGVISEDVLSHVEVVRLSKKIKSGLRLDDHKSRLK  226

Query  1108  ERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMA  929
             +RLGC+PS+EQLAVSL+ISR +L+  ++EC LAREKLAMSNVRLVMSIAQRYDN+GAEM+
Sbjct  227   DRLGCEPSDEQLAVSLKISRAELQAWLMECHLAREKLAMSNVRLVMSIAQRYDNLGAEMS  286

Query  928   DLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSL  749
             DL+QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP HLH RL L
Sbjct  287   DLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHERLGL  346

Query  748   IRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESL  569
             IRNA+ +L++KGITPSIDRIAESLN+S+KKV NATEAVSKVFSLDR+AFPS++GLPGE+ 
Sbjct  347   IRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKVFSLDRDAFPSLNGLPGETH  406

Query  568   HSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISK  389
             HSYIAD+ LENNPWH  D+ ALK+EV+ LI  TL ERE+EIIRLY+GL  ECLTWEDISK
Sbjct  407   HSYIADTRLENNPWHGYDDLALKEEVSKLISATLGEREKEIIRLYYGLDKECLTWEDISK  466

Query  388   RIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             RIGLSRERVRQVGLVA EKLKHAARK +++AM++K
Sbjct  467   RIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  501



>dbj|BAA22214.1| plastid RNA polymerase sigma-subunit [Arabidopsis thaliana]
Length=502

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/515 (60%), Positives = 388/515 (75%), Gaps = 23/515 (4%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++GL+ GKRLL SSFY+SD  EK    +DH    + + S  S + AKK+SNYS S
Sbjct  1     MATAAVIGLNTGKRLLSSSFYHSDVTEKFLSVNDHCSSQYHIASTKSGITAKKASNYSPS  60

Query  1621  CVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKq----sseeenqledllllqk  1457
               S N+   S KA+KE V VAS      P    +K+L+++         + +E +LLLQK
Sbjct  61    FPSSNRHTQSAKALKESVDVASTEKPWLPN-GTDKELEEECYDDDDLISHSVEAILLLQK  119

Query  1456  fmlekQWNLSAEKSTMTYTTMENNCKNIQV---TCSGTSArrrridtrrqiiqQK-NSVA  1289
              MLEK WNLS EK+  +    +   +  ++   TCSG SAR RRI  +++       +V+
Sbjct  120   SMLEKSWNLSFEKAVSSEYPGKGTIRKKKIPVITCSGISARPRRIGAKKKTNMTHVKAVS  179

Query  1288  KIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLK  1109
              + + K+VR             GYVKG++SE++L+H EVV LSK IK GL L++ KSRLK
Sbjct  180   DVSSGKQVR-------------GYVKGVISEDVLSHVEVVRLSKKIKSGLRLDDHKSRLK  226

Query  1108  ERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMA  929
             +RLGC+PS+EQLAVSL+ISR +L+  ++EC LAREKLAMSNVRLVMSIAQRYDN+GAEM+
Sbjct  227   DRLGCEPSDEQLAVSLKISRAELQAWLMECHLAREKLAMSNVRLVMSIAQRYDNLGAEMS  286

Query  928   DLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSL  749
             DL+QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP HLH RL L
Sbjct  287   DLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHERLGL  346

Query  748   IRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESL  569
             IRNA+ +L++KGITPSIDRIAESLN+S+KKV NATEAVSKVFSLDR+AFPS++GLPGE+ 
Sbjct  347   IRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKVFSLDRDAFPSLNGLPGETH  406

Query  568   HSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISK  389
             HSYIAD+ LENNPWH  D+ ALK+EV+ LI  TL ERE+EIIRLY+GL  ECLTWEDISK
Sbjct  407   HSYIADTRLENNPWHGYDDLALKEEVSKLISATLGEREKEIIRLYYGLDKECLTWEDISK  466

Query  388   RIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             RIGLSRERVRQVGLVA EKLKHAARK +++AM++K
Sbjct  467   RIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  501



>ref|XP_004307835.1| PREDICTED: RNA polymerase sigma factor sigA-like [Fragaria vesca 
subsp. vesca]
Length=511

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/514 (64%), Positives = 391/514 (76%), Gaps = 9/514 (2%)
 Frame = -1

Query  1804  MMVTATIVGLSA-GKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSN-Y  1631
             M   A +VGLS+ GKRLL SS  YSD  +KL   +DH     Q+ S  + V A+KSS+ Y
Sbjct  1     MATAAAVVGLSSTGKRLLSSSLSYSDITDKLFYLNDHGFVNCQLSSTKNVVTARKSSSKY  60

Query  1630  STS-CVSNQRMH--SIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllll  1463
             S S   S+ R H  SI+A++EH   AS   +     ++    L+++SS+ E  +E LLLL
Sbjct  61    SNSRFPSSNRHHEQSIRALQEHADTASAPSSTTHQLLEEYTDLEEESSDLEYSVEALLLL  120

Query  1462  qkfmlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKI  1283
             QK +LEKQWNLS EK   T    +N    I VTCSG SAR+RR+ T+R+   +  S  + 
Sbjct  121   QKSLLEKQWNLSFEKKLSTRKITDNK---IPVTCSGVSARQRRMSTKRKAFSKNTSELQP  177

Query  1282  DTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKER  1103
              T+K  R+ I    LQN   GYVKG+ S+ LLTH EVV LSK IK+GL +EE KSRLKE+
Sbjct  178   STNKYCRATISPSLLQNRTSGYVKGVTSDHLLTHTEVVRLSKKIKIGLSVEEHKSRLKEK  237

Query  1102  LGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADL  923
             LGC+PS EQLA SLRISRT+L+  +I+CSLAREKL MSNVRLVMSIAQRYDNMGAEMADL
Sbjct  238   LGCEPSVEQLATSLRISRTELQSKLIQCSLAREKLTMSNVRLVMSIAQRYDNMGAEMADL  297

Query  922   IQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIR  743
             IQGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIR
Sbjct  298   IQGGLIGLLRGIEKFDASKGFKISTYVYWWIRQGVSRALVENSRTLRLPTHLHERLGLIR  357

Query  742   NAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHS  563
             NA+ +L++KGITPSID IAESLN+SKKKV NATEA+SKVFSLDR+AFPS++GLPGE+ HS
Sbjct  358   NAKVRLEEKGITPSIDSIAESLNMSKKKVRNATEAISKVFSLDRDAFPSLNGLPGETHHS  417

Query  562   YIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRI  383
             YIAD+  EN PWH +DE ALKDEVN LI+  L EREREIIRLY+GL NECLTWEDISKRI
Sbjct  418   YIADNRHENIPWHGLDELALKDEVNKLINLMLGEREREIIRLYYGLDNECLTWEDISKRI  477

Query  382   GLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             GLSRERVRQVGLVA EKLKH ARK  L+AMLV+ 
Sbjct  478   GLSRERVRQVGLVALEKLKHGARKKELEAMLVQH  511



>gb|AAB81958.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
Length=502

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/515 (60%), Positives = 388/515 (75%), Gaps = 23/515 (4%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++GL+ GKRLL SSFY+SD  EK    +DH    + + S  S + AKK+SNY  S
Sbjct  1     MATAAVIGLNTGKRLLSSSFYHSDVTEKFLSVNDHCSSQYHIASTKSGITAKKASNYRPS  60

Query  1621  CVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKq----sseeenqledllllqk  1457
               S N+   S KA+KE V VAS      P    +K+L+++         + +E +LLLQK
Sbjct  61    FPSSNRHTQSAKALKESVDVASTEKPWLPN-GTDKELEEECYDDDDLISHSVEAILLLQK  119

Query  1456  fmlekQWNLSAEKSTMTYTTMENNCKNIQV---TCSGTSArrrridtrrqiiqQK-NSVA  1289
              MLEK WNLS EK+  +    +   +  ++   TCSG SAR+RRI  +++       +V+
Sbjct  120   SMLEKSWNLSFEKAVSSEYPGKGTIRKKKIPVITCSGISARQRRIGAKKKTNMTHVKAVS  179

Query  1288  KIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLK  1109
              + + K+VR             GYVKG++SE++L+H EVV LSK IK GL L++ KSRLK
Sbjct  180   DVSSGKQVR-------------GYVKGVISEDVLSHAEVVRLSKKIKSGLRLDDHKSRLK  226

Query  1108  ERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMA  929
             +RLGC+PS+EQLAVSL+ISR +L+  ++EC LAREKLAMSNVRLVMSIAQRYDN+GAEM+
Sbjct  227   DRLGCEPSDEQLAVSLKISRAELQAWLMECHLAREKLAMSNVRLVMSIAQRYDNLGAEMS  286

Query  928   DLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSL  749
             DL+QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP HLH RL L
Sbjct  287   DLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHERLGL  346

Query  748   IRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESL  569
             IRNA+ +L++KGITPSIDRIAESLN+S+KKV NATEAVSKVFSLDR+AFPS++GLPGE+ 
Sbjct  347   IRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKVFSLDRDAFPSLNGLPGETH  406

Query  568   HSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISK  389
             HSYIAD+ LENNPWH  D+ ALK+EV+ LI  TL ERE+EIIRLY+GL  ECLTWEDISK
Sbjct  407   HSYIADTRLENNPWHGYDDLALKEEVSKLISATLGEREKEIIRLYYGLDKECLTWEDISK  466

Query  388   RIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             RIGLSRERVRQVGLVA EKLKHAARK +++AM++K
Sbjct  467   RIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  501



>gb|AAG40388.1|AF325036_1 At1g64860 [Arabidopsis thaliana]
Length=502

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/515 (60%), Positives = 389/515 (76%), Gaps = 23/515 (4%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++GL+ GKRLL SSFY+SD  EK    +DH    + + S  S + AKK+SNYS S
Sbjct  1     MATAAVIGLNTGKRLLSSSFYHSDVTEKFLSVNDHCSSQYHIASTKSGITAKKASNYSPS  60

Query  1621  CVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKq----sseeenqledllllqk  1457
               S N+   S KA+KE V VAS      P    +K+L+++         + +E +LLLQK
Sbjct  61    FPSSNRHTQSAKALKESVDVASTEKPWLPN-GTDKELEEECYDDDDLISHSVEAILLLQK  119

Query  1456  fmlekQWNLSAEKSTMTYTTMENNCKNIQV---TCSGTSArrrridtrrqiiqQK-NSVA  1289
              MLEK WNLS EK+  +    +   +  ++   TCSG SAR+RRI  +++       +V+
Sbjct  120   SMLEKSWNLSFEKAVSSEYPGKGTIRKKKIPVITCSGISARQRRIGAKKKTNMTHVKAVS  179

Query  1288  KIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLK  1109
              + + K+VR             GYVKG++SE++L+H EVV LSK IK GL L++ KSRLK
Sbjct  180   DVSSGKQVR-------------GYVKGVISEDVLSHVEVVRLSKKIKSGLRLDDHKSRLK  226

Query  1108  ERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMA  929
             +RLGC+PS+EQLAVSL+ISR +L+  ++EC LAREKLAMSNVRLVMSIAQRY+N+GAEM+
Sbjct  227   DRLGCEPSDEQLAVSLKISRAELQAWLMECHLAREKLAMSNVRLVMSIAQRYNNLGAEMS  286

Query  928   DLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSL  749
             DL+QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP HLH RL L
Sbjct  287   DLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHERLGL  346

Query  748   IRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESL  569
             IRNA+ +L++KGITPSIDRIAESLN+S+KKV NATEAVSKVFSLDR+AFPS++GLPGE+ 
Sbjct  347   IRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKVFSLDRDAFPSLNGLPGETH  406

Query  568   HSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISK  389
             HSYIAD+ LENNPWH  D+ ALK+EV+ LI  TL ERE+EIIRLY+GL  ECLTWEDISK
Sbjct  407   HSYIADTRLENNPWHGYDDLALKEEVSKLISATLGEREKEIIRLYYGLDKECLTWEDISK  466

Query  388   RIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             RIGLSRERVRQVGLVA EKLKHAARK +++AM++K
Sbjct  467   RIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  501



>emb|CAA74896.1| sigma factorB [Arabidopsis thaliana]
Length=500

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/513 (60%), Positives = 388/513 (76%), Gaps = 23/513 (4%)
 Frame = -1

Query  1795  TATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTSCV  1616
             TA ++GL+ GKRLL SSFY+SD  EK    +DH    + + S  S + AKK+SNYS S  
Sbjct  1     TAAVIGLNTGKRLLSSSFYHSDVTEKFLSVNDHCSSQYHIASTKSGITAKKASNYSPSFP  60

Query  1615  S-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKq----sseeenqledllllqkfm  1451
             S N+   S KA+KE V VAS      P    +K+L+++         + +E +LLLQK M
Sbjct  61    SSNRHTQSAKALKESVDVASTEKPWLPN-GTDKELEEECYDDDDLISHSVEAILLLQKSM  119

Query  1450  lekQWNLSAEKSTMTYTTMENNCKNIQV---TCSGTSArrrridtrrqiiqQK-NSVAKI  1283
             LEK WNLS EK+  +    +   +  ++   TCSG SAR+RRI  +++       +V+ +
Sbjct  120   LEKSWNLSFEKAVSSEYPGKGTIRKKKIPVITCSGISARQRRIGAKKKTNMTHVKAVSDV  179

Query  1282  DTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKER  1103
              + K+VR             GYVKG++SE++L+H EVV LSK IK GL L++ KSRLK+R
Sbjct  180   SSGKQVR-------------GYVKGVISEDVLSHVEVVRLSKKIKSGLRLDDHKSRLKDR  226

Query  1102  LGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADL  923
             LGC+PS+EQLAVSL+ISR +L+  ++EC LAREKLAMSNVRLVMSIAQRYDN+GAEM+DL
Sbjct  227   LGCEPSDEQLAVSLKISRAELQAWLMECHLAREKLAMSNVRLVMSIAQRYDNLGAEMSDL  286

Query  922   IQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIR  743
             +QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP HLH RL LIR
Sbjct  287   VQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHERLGLIR  346

Query  742   NAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHS  563
             NA+ +L++KGITPSIDRIAESLN+S+KKV NATEAVSKVFSLDR+AFPS++GLPGE+ HS
Sbjct  347   NAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKVFSLDRDAFPSLNGLPGETHHS  406

Query  562   YIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRI  383
             YIAD+ LENNPWH  D+ ALK+EV+ LI  TL ERE+EIIRLY+GL  ECLTWEDISKRI
Sbjct  407   YIADTRLENNPWHGYDDLALKEEVSKLISATLGEREKEIIRLYYGLDKECLTWEDISKRI  466

Query  382   GLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             GLSRERVRQVGLVA EKLKHAARK +++AM++K
Sbjct  467   GLSRERVRQVGLVALEKLKHAARKRKMEAMILK  499



>ref|XP_006302143.1| hypothetical protein CARUB_v10020145mg [Capsella rubella]
 gb|EOA35041.1| hypothetical protein CARUB_v10020145mg [Capsella rubella]
Length=521

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/522 (59%), Positives = 397/522 (76%), Gaps = 18/522 (3%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++GL+ GKRLL SSFY+SD  EK    +DH    + + S  S + AKK+S+ S  
Sbjct  1     MATAAVIGLNTGKRLLSSSFYHSDVTEKFLSVNDHCSSQYHIASTKSGITAKKASSSSNY  60

Query  1621  CVS----NQRMHSIKAIKEHVTVASNLFNMEPCVQR--NKQLQKqsseeen----qledl  1472
               S    N+   S KA+ E V V ++    +P V    +K+ ++   +++      +E L
Sbjct  61    SPSFPSSNRHTQSAKAVTESVDVVAS--TEQPWVPNVTDKEFEEGGYDDDVLIGHSVEAL  118

Query  1471  lllqkfmlekQWNLSAEKSTMTYTTMENNCKNIQV---TCSGTSArrrri-dtrrqiiqQ  1304
             LLLQK MLEK WNLS EK+  + ++ +   +  +V   TCSG SAR+RRI   ++  +  
Sbjct  119   LLLQKSMLEKSWNLSFEKAASSESSGKRTIRKKKVPVITCSGISARQRRIGAKKKTNMTS  178

Query  1303  KNSVAKIDTSKRVRSIIGMEQLQNSL--KGYVKGIVSEELLTHGEVVELSKMIKLGLYLE  1130
               +V+ + + K+VRS++  E  Q++    GYVKG++SE++L+H EVV LSK IK GL L+
Sbjct  179   AKAVSDVSSGKQVRSVMSSELFQHNRVRGGYVKGVISEDVLSHTEVVRLSKKIKSGLRLD  238

Query  1129  EQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYD  950
             + KSRLK+RLGC+PS+EQLA+SL+ISR +L+  ++EC LAREKLAMSNVRLVMSIAQRYD
Sbjct  239   DHKSRLKDRLGCEPSDEQLAISLKISRAELQAWLMECHLAREKLAMSNVRLVMSIAQRYD  298

Query  949   NMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKH  770
             N+GAEM+DL+QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP H
Sbjct  299   NLGAEMSDLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTH  358

Query  769   LHGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSID  590
             LH RL LIRNA+ +L++KGITPSIDRIAESLN+S+KKV NATEAVSK+FSLDR+AFPS++
Sbjct  359   LHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKIFSLDRDAFPSLN  418

Query  589   GLPGESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECL  410
             GLPGE+ HSYIAD+ LENNPWH  DE ALK+EV+ LI  TL EREREIIRLY+GL  ECL
Sbjct  419   GLPGETHHSYIADNRLENNPWHGYDELALKEEVSKLITATLGEREREIIRLYYGLDKECL  478

Query  409   TWEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             TWEDISKRIGLSRERVRQVGLVA EKLKHAARK +++AM++K
Sbjct  479   TWEDISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  520



>ref|XP_010670766.1| PREDICTED: RNA polymerase sigma factor sigA [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/515 (61%), Positives = 388/515 (75%), Gaps = 13/515 (3%)
 Frame = -1

Query  1825  LFRYCA*MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAK  1646
             +FR     M TA +VGLSAG+RLL SSF YSD  EKLS    +T   HQ+    + ++AK
Sbjct  1     MFRLT---MATAAVVGLSAGQRLLSSSFCYSDLTEKLS----YTGEQHQITPTKTVIVAK  53

Query  1645  KSSNYSTSCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledlll  1466
             +++N+      NQR  S+KA+KE +         E     +  L++++S  E  LE LLL
Sbjct  54    RTANF------NQRGSSVKALKECIDGTVIPPTSETWNPGSSPLEEENSSPETPLEALLL  107

Query  1465  lqkfmlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAK  1286
             LQK MLEKQ  LS E+++MT    E   K   VT SG  AR RRI+ +++   +K    +
Sbjct  108   LQKSMLEKQLELSFERNSMTDMPRECTSKGSHVTASGIPARVRRINAKKRSQGKKIFTKE  167

Query  1285  IDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKE  1106
              +  K   + +  E LQN   GYV+G+ S+ELLTH +VV LS+ IK GL LE+QKSRLKE
Sbjct  168   SERGKPPMATVSPELLQNRSIGYVRGLTSDELLTHAQVVNLSQKIKAGLSLEDQKSRLKE  227

Query  1105  RLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMAD  926
             +LGC+PS+EQLA SLR++R +++  +IECSLAREKLAMSNVRLVMSIAQRY+NMGA+M D
Sbjct  228   KLGCEPSDEQLANSLRMNRAEVRSKLIECSLAREKLAMSNVRLVMSIAQRYENMGADMTD  287

Query  925   LIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLI  746
             L+QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+S+ALV+NS  LRLP HLH RLSLI
Sbjct  288   LVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSKALVENSRTLRLPTHLHERLSLI  347

Query  745   RNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLH  566
             R+A+ KL++KGITPSIDRIAESLN+S KK+ NATEAV  V SLDRE FPS++GLPGE+ H
Sbjct  348   RSAKNKLEEKGITPSIDRIAESLNMSHKKIKNATEAVRSVLSLDREVFPSLNGLPGETFH  407

Query  565   SYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKR  386
             SYIAD+ LENNPWH VDE ALK EV+NLI T L+ERE+EIIRLY+GL +E LTWE+ISKR
Sbjct  408   SYIADNRLENNPWHGVDEWALKHEVSNLIDTALREREKEIIRLYYGLEDESLTWEEISKR  467

Query  385   IGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             IGLSRERVRQVGLVA EKLKHAARK R++A+LVK 
Sbjct  468   IGLSRERVRQVGLVALEKLKHAARKRRMEALLVKH  502



>ref|XP_009128472.1| PREDICTED: RNA polymerase sigma factor sigA [Brassica rapa]
 ref|XP_009128474.1| PREDICTED: RNA polymerase sigma factor sigA [Brassica rapa]
 ref|XP_009128475.1| PREDICTED: RNA polymerase sigma factor sigA [Brassica rapa]
Length=492

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/518 (60%), Positives = 385/518 (74%), Gaps = 38/518 (7%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSD--HTLPCHQVLSVNSTVMAKKSSNY  1631
             MM T  +VGL+AGKRLL SSFYYSD  EK    +D   +   + + S  S + AKK+S+ 
Sbjct  1     MMATTAVVGLNAGKRLLSSSFYYSDVTEKFLSVNDLCSSQYYYHIASTRSGITAKKTSSS  60

Query  1630  STSCVSNQRMHS-------IKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledl  1472
             S+S   +   HS        KA+KE V V      + P   +  + +    E+++ +E L
Sbjct  61    SSSSNYSPSFHSSSRHTQSAKALKESVDVVQQW--LPPGSDQELEEESHEYEDDDTVEAL  118

Query  1471  lllqkfmlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSV  1292
             LLLQ+ +LEKQWNLS EK            K I VTCSGTSAR+            +   
Sbjct  119   LLLQRSLLEKQWNLSFEKKK----------KKILVTCSGTSARQ------------RRMG  156

Query  1291  AKIDTSKRVRSIIGMEQLQNSL--KGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKS  1118
             AK  T+ +V   +  +  QN+    GYVKG++S+++L+H EVV LSK IK GL L+E KS
Sbjct  157   AKKKTNIKV---VNSDLFQNNRVKGGYVKGVISDDVLSHAEVVRLSKKIKSGLRLDEHKS  213

Query  1117  RLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGA  938
             RLK+RLGC+PS+EQLAVSL+ISR +L+  ++EC+LAREKLAMSNVRLVMSIAQRYDNMGA
Sbjct  214   RLKDRLGCEPSDEQLAVSLKISRAELQAWLMECNLAREKLAMSNVRLVMSIAQRYDNMGA  273

Query  937   EMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGR  758
             EM+DL+QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP HLH R
Sbjct  274   EMSDLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHER  333

Query  757   LSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPG  578
             L LIRNA+ +L++KG+TPSIDRIAESLN+S+KKV NATEAVSK+FSLDR+AFPS++GLPG
Sbjct  334   LGLIRNAKLRLQEKGVTPSIDRIAESLNMSQKKVRNATEAVSKIFSLDRDAFPSLNGLPG  393

Query  577   ESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWED  398
             E+ HSYIAD+ LENNPWH  DE ALKDEV+ LI  TL EREREIIRLY+GL  ECLTWED
Sbjct  394   ETHHSYIADNRLENNPWHGYDEWALKDEVSKLISATLGEREREIIRLYYGLDKECLTWED  453

Query  397   ISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             ISKRIGLSRERVRQVGLVA EKLKHAARK++++AM++K
Sbjct  454   ISKRIGLSRERVRQVGLVALEKLKHAARKSKMEAMILK  491



>emb|CDY52962.1| BnaCnng23900D [Brassica napus]
Length=480

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/513 (60%), Positives = 373/513 (73%), Gaps = 41/513 (8%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSD--HTLPCHQVLSVNSTVMAKK--SSN  1634
             M T  +VGL+AGKRLL SSFYYSD  EK    +D   +   + + S  S + AKK  SSN
Sbjct  1     MATTAVVGLNAGKRLLSSSFYYSDVTEKFLSVNDLCSSQYYYHIASTRSGITAKKTSSSN  60

Query  1633  YSTSCVSNQR-MHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqk  1457
             YS S  S+ R   S KA+KE V V      + P    +++L++     E  L     L +
Sbjct  61    YSPSFHSSSRHTQSAKALKESVDVVQQW--LPPG--SDQELEEDDDTVEALLLLQRSLLE  116

Query  1456  fmlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDT  1277
                   WNLS EK            K I VTCSG SAR+            +   AK  T
Sbjct  117   KQ----WNLSFEKK-----------KKIPVTCSGISARQ------------RRMGAKKKT  149

Query  1276  SKRVRSIIGMEQLQNSL--KGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKER  1103
             + +V   +  +  QN+    GYVKG++S+++L+H EVV LSK IK GL L+E KSRLK+R
Sbjct  150   NIKV---VNSDLFQNNRVKGGYVKGVISDDVLSHAEVVRLSKKIKSGLRLDEHKSRLKDR  206

Query  1102  LGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADL  923
             LGC+PS+EQLA SL+ISR +L+  ++EC+LAREKLAMSNVRLVMSIAQRYDNMGAEM+DL
Sbjct  207   LGCEPSDEQLATSLKISRAELQAWLMECNLAREKLAMSNVRLVMSIAQRYDNMGAEMSDL  266

Query  922   IQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIR  743
             +QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP HLH RL LIR
Sbjct  267   VQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHERLGLIR  326

Query  742   NAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHS  563
             NA+ +L++KGITPSIDRIAESLN+S+KKV NATEAVSK+FSLDR+AFPS++GLPGE+ HS
Sbjct  327   NAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKIFSLDRDAFPSLNGLPGETHHS  386

Query  562   YIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRI  383
             YIAD+ LENNPWH  DE ALKDEV+ LI  TL +REREIIRLY+GL  ECLTWEDISKRI
Sbjct  387   YIADNRLENNPWHGYDEWALKDEVSKLISATLGDREREIIRLYYGLDKECLTWEDISKRI  446

Query  382   GLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             GLSRERVRQVGLVA EKLKHAARK++++AM++K
Sbjct  447   GLSRERVRQVGLVALEKLKHAARKSKMEAMILK  479



>ref|XP_002886771.1| RNA polymerase sigma subunit 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63030.1| RNA polymerase sigma subunit 1 [Arabidopsis lyrata subsp. lyrata]
Length=503

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/518 (60%), Positives = 396/518 (76%), Gaps = 28/518 (5%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKK--SSNYS  1628
             M TA ++GL+ GKRLL SSFY+SD  EK    +DH    + + S  S + AKK  SSNYS
Sbjct  1     MATAAVIGLNTGKRLLSSSFYHSDVTEKFLSVNDHCSSQYHIASTKSGITAKKASSSNYS  60

Query  1627  TSCVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQR--NKQLQKqsseee---nqledlll  1466
              S  S N+   S KA+KE V VAS     +P +    +K+L+++  +++   + +E LLL
Sbjct  61    PSFPSSNRHTQSAKALKESVDVAST---EKPWIHNGTDKELEEEGYDDDLIGHSVEALLL  117

Query  1465  lqkfmlekQWNLSAEKSTMTYTTMENNCKNIQV---TCSGTSArrrridtrrqiiqQK-N  1298
             LQK MLEK WNLS EK+  + ++ +   +  ++   TCSG SAR+RRI  +++       
Sbjct  118   LQKSMLEKSWNLSFEKAASSESSSKRTIRKKKIPVITCSGISARQRRIGAKKKTNMTHVK  177

Query  1297  SVAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKS  1118
             +V+ + + K+VR             GYVKG++SE++L+H EVV LSK IK GL L++ KS
Sbjct  178   AVSDVSSGKQVR-------------GYVKGVISEDVLSHAEVVRLSKKIKSGLRLDDHKS  224

Query  1117  RLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGA  938
             RLK+RLGC+PS+EQLAVSL+ISR +L+  ++EC LAREKLAMSNVRLVMSIAQRYDN+GA
Sbjct  225   RLKDRLGCEPSDEQLAVSLKISRAELQAWLMECHLAREKLAMSNVRLVMSIAQRYDNLGA  284

Query  937   EMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGR  758
             EM+DL+QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP HLH R
Sbjct  285   EMSDLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHER  344

Query  757   LSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPG  578
             L LIRNA+ +L++KGITPSIDRIAESLN+S+KKV NATEAVSK+FSLDR+AFPS++GLPG
Sbjct  345   LGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKIFSLDRDAFPSLNGLPG  404

Query  577   ESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWED  398
             E+ HSYIAD+ +ENNPWH  D+ ALK+EV+ LI  TL EREREIIRLY+GL  ECLTWED
Sbjct  405   ETHHSYIADNRVENNPWHGYDDLALKEEVSKLISATLGEREREIIRLYYGLDKECLTWED  464

Query  397   ISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             ISKRIGLSRERVRQVGLVA EKLKHAARK +++AM++K
Sbjct  465   ISKRIGLSRERVRQVGLVALEKLKHAARKRKMEAMILK  502



>ref|XP_008808794.1| PREDICTED: RNA polymerase sigma factor sigA [Phoenix dactylifera]
 ref|XP_008808795.1| PREDICTED: RNA polymerase sigma factor sigA [Phoenix dactylifera]
 ref|XP_008808796.1| PREDICTED: RNA polymerase sigma factor sigA [Phoenix dactylifera]
 ref|XP_008808797.1| PREDICTED: RNA polymerase sigma factor sigA [Phoenix dactylifera]
Length=508

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/510 (61%), Positives = 379/510 (74%), Gaps = 5/510 (1%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++GLS GKRLL +SFY +D  EKL    DH        S  +T+ AK+SSN+ T+
Sbjct  1     MATAAVIGLSTGKRLLSTSFYPADLAEKLFAVPDHGSMQFSTSSTKNTIAAKRSSNFGTN  60

Query  1621  CVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmlek  1442
               SN+   +IKA+KEHV  A+ L   +   +R   L+   S+ E  LE L+LLQK MLEK
Sbjct  61    IPSNRHSQAIKALKEHVDTAA-LSTADAWFRRPDPLEDGESDLEYSLEVLILLQKSMLEK  119

Query  1441  QWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKI---DTSK  1271
             QW L  E+   T      +CK  +V  SG SAR+RR  TRR+   +   +      +  K
Sbjct  120   QWKLPFEQ-IKTVDDPRESCKKTEVIRSGISARKRRTVTRRRCFNRSAYMEPFNGGEEGK  178

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
              +RS +  E LQ  ++GYV+G VSE LLTH EVV LS+ I+ GL LEE++ +LKE+LG +
Sbjct  179   ELRSTVSPELLQTRVRGYVRGTVSENLLTHAEVVHLSRKIRAGLSLEEKRMKLKEKLGFE  238

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGG  911
             PS++QLA  LR+S  +L   + ECSLAREKLAMSNVRLVMSIAQ+YDN+GAEMADLIQGG
Sbjct  239   PSDKQLASFLRMSHAELHSKLTECSLAREKLAMSNVRLVMSIAQKYDNLGAEMADLIQGG  298

Query  910   LVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAET  731
             L+GLLRGIEKFD SKG K+STYVYWWIRQG+SRALV+NS  LRLP HLH RLSLIRNA+ 
Sbjct  299   LIGLLRGIEKFDSSKGCKISTYVYWWIRQGVSRALVENSRTLRLPSHLHERLSLIRNAKI  358

Query  730   KLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIAD  551
             +L+DKG+ PSID IAESLN+S KKV NATEAVSKVFSLDREAFPS++GLPGE+LHSYIAD
Sbjct  359   RLEDKGVMPSIDNIAESLNMSPKKVKNATEAVSKVFSLDREAFPSLNGLPGETLHSYIAD  418

Query  550   SHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSR  371
              +L N PWH  ++ +LKDEVN L+H TL +RER IIRLY+G+GNE  TWEDIS++ GLSR
Sbjct  419   KNLANIPWHGFEDWSLKDEVNKLLHATLSKRERAIIRLYYGIGNETHTWEDISRQFGLSR  478

Query  370   ERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             ERVRQVGLVA EKLKHAAR+ RL+A+LVKQ
Sbjct  479   ERVRQVGLVALEKLKHAARRRRLEALLVKQ  508



>emb|CDY56127.1| BnaA02g20170D [Brassica napus]
Length=491

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/517 (60%), Positives = 383/517 (74%), Gaps = 38/517 (7%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSD--HTLPCHQVLSVNSTVMAKKSSNYS  1628
             M T  +VGL+AGKRLL SSFYYSD  EK    +D   +   + + S  S + AKK+S+ S
Sbjct  1     MATTAVVGLNAGKRLLSSSFYYSDVTEKFLSVNDLCSSQYYYHIASTRSGITAKKTSSSS  60

Query  1627  TSCVSNQRMHS-------IKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledll  1469
             +S   +   HS        KA+KE V V      + P   +  + +    E+++ +E LL
Sbjct  61    SSSNYSPSFHSSSRHTQSAKALKESVDVVQQW--LPPGSDQELEEESHEYEDDDTVEALL  118

Query  1468  llqkfmlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVA  1289
             LLQ+ +LEKQWNLS EK            K I VTCSG SAR+            +   A
Sbjct  119   LLQRSLLEKQWNLSFEKKK----------KKIPVTCSGISARQ------------RRMGA  156

Query  1288  KIDTSKRVRSIIGMEQLQNSL--KGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSR  1115
             K  T+ +V   +  +  QN+    GYVKG+VS+++L+H EVV LSK IK GL L+E KSR
Sbjct  157   KKKTNIKV---VNSDLFQNNRVKGGYVKGVVSDDVLSHAEVVRLSKKIKSGLRLDEHKSR  213

Query  1114  LKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAE  935
             LK+RLGC+PS+EQLAVSL+ISR +L+  ++EC+LAREKLAMSNVRLVMSIAQRYDNMGAE
Sbjct  214   LKDRLGCEPSDEQLAVSLKISRAELQAWLMECNLAREKLAMSNVRLVMSIAQRYDNMGAE  273

Query  934   MADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRL  755
             M+DL+QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP HLH RL
Sbjct  274   MSDLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHERL  333

Query  754   SLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGE  575
              LIRNA+ +L++KG+TPSIDRIAESLN+S+KKV NATEAVSK+FSLDR+AFPS++GLPGE
Sbjct  334   GLIRNAKLRLQEKGVTPSIDRIAESLNMSQKKVRNATEAVSKIFSLDRDAFPSLNGLPGE  393

Query  574   SLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDI  395
             + HSYIAD+ LENNPWH  DE ALKDEV+ LI  TL EREREIIRLY+GL  ECLTWEDI
Sbjct  394   THHSYIADNRLENNPWHGYDEWALKDEVSKLISATLGEREREIIRLYYGLDKECLTWEDI  453

Query  394   SKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             SKRIGLSRERVRQVGLVA EKLKHAARK++++AM++K
Sbjct  454   SKRIGLSRERVRQVGLVALEKLKHAARKSKMEAMILK  490



>emb|CAA75859.1| Sig1 [Sinapis alba]
Length=481

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/512 (60%), Positives = 380/512 (74%), Gaps = 38/512 (7%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M T  ++GL+AGKRLL SSFYYSD  EK    +D    C       S + AKK+S+ S+S
Sbjct  1     MATTAVIGLNAGKRLLSSSFYYSDVTEKFLSVND---LCSSQYHTRSGITAKKTSSSSSS  57

Query  1621  CVSN------QRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllq  1460
               S       ++  S KA+KE  +VAS++   +P +      + +  + ++ +E LLLLQ
Sbjct  58    NYSPSFPSSSRQTQSAKALKE--SVASSV---QPWLPPGSDQELEEDDIDHSVEALLLLQ  112

Query  1459  kfmlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKID  1280
             + MLEKQWNLS EK+           K + VTCSG SAR+            +   AK  
Sbjct  113   RSMLEKQWNLSFEKTR----------KKVPVTCSGISARQ------------RRIGAKKK  150

Query  1279  TSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERL  1100
             T+ +  S +  +   N +KGYVKG++S+ +L+H EVV LSK IK GL L+E KSRL +RL
Sbjct  151   TNVKAVSEVNFQN--NLVKGYVKGVISDHVLSHAEVVRLSKKIKSGLRLDEHKSRLTDRL  208

Query  1099  GCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLI  920
             GC+PS+EQLA+SL+ISR +L+  ++EC LAREKLAMSNVRLVMSIAQRYDNMGAEM+DL+
Sbjct  209   GCEPSDEQLAMSLKISRAELQAWLMECHLAREKLAMSNVRLVMSIAQRYDNMGAEMSDLV  268

Query  919   QGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRN  740
             QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP HLH RL LIRN
Sbjct  269   QGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHERLGLIRN  328

Query  739   AETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSY  560
             A+ +L++KGITPSIDRIAESLN+S+KKV NATEAVSK+FSLDR+AFPS++GLPGE+ HSY
Sbjct  329   AKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKIFSLDRDAFPSLNGLPGETHHSY  388

Query  559   IADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIG  380
             IAD+ LENNPWH  D  ALKDEV+ LI  TL EREREIIRLY+GL  ECLTWEDIS+RIG
Sbjct  389   IADNRLENNPWHGYDALALKDEVSKLISVTLGEREREIIRLYYGLDKECLTWEDISQRIG  448

Query  379   LSRERVRQVGLVAFEKLKHAARKNRLKAMLVK  284
             LSRERVRQVGLVA EKLKHAARK +++AM++K
Sbjct  449   LSRERVRQVGLVALEKLKHAARKRKMEAMILK  480



>ref|XP_010910228.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
 ref|XP_010910229.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
 ref|XP_010910230.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
 ref|XP_010910231.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
 ref|XP_010910232.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
 ref|XP_010910234.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
 ref|XP_010910235.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
 ref|XP_010910236.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Elaeis 
guineensis]
Length=508

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/510 (60%), Positives = 370/510 (73%), Gaps = 5/510 (1%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M  A + GLS GKRLL +SFY SD  EKL    DH        S  +T+ AKKSSN+ST+
Sbjct  1     MAMAAVFGLSRGKRLLSTSFYPSDLAEKLFAVPDHASMQFSTASTKNTIAAKKSSNFSTN  60

Query  1621  CVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmlek  1442
               SN+   +IKA+KEHV   S L   +   QR   L+   S+ E  LE LLLLQK MLEK
Sbjct  61    IRSNRHSQAIKALKEHVDT-SALSTADTWFQRPDLLEDGESDLEYSLEVLLLLQKSMLEK  119

Query  1441  QWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrq---iiqQKNSVAKIDTSK  1271
             Q  L  E+   T      +CK  +V  SG SAR+RR  TR            + ++   K
Sbjct  120   QRKLPFEQ-IKTVDDPRESCKKTEVIRSGISARKRRTITRMTCFNQNAYMEPLNRVKEGK  178

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
              +RS +  E LQ  ++GYV+G +S+ LL+H EVV LS+ I+ GL LEE + +LKE+LG +
Sbjct  179   ELRSTVSPELLQMHVRGYVRGTISQNLLSHAEVVHLSRKIRAGLSLEENRMKLKEKLGFE  238

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGG  911
             PS++QLA  L +S  +L   + ECSLAREKLAMSNVRLVMSIAQ+YDN+GAEMADLIQGG
Sbjct  239   PSDKQLASFLGMSNAELHSKLTECSLAREKLAMSNVRLVMSIAQKYDNLGAEMADLIQGG  298

Query  910   LVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAET  731
             L+GLLRGIEKFD SKG K+STYVYWWIR G+SRALV+NS  LRLP HLH RLSLIRNA+ 
Sbjct  299   LIGLLRGIEKFDSSKGCKISTYVYWWIRHGVSRALVENSRTLRLPAHLHERLSLIRNAKV  358

Query  730   KLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIAD  551
             +L+DKGI PSID IAESLN+S+KKV NATEAVSKVFSLDREAFPS++GLPGE+LHSYIAD
Sbjct  359   RLEDKGIIPSIDNIAESLNMSQKKVRNATEAVSKVFSLDREAFPSLNGLPGETLHSYIAD  418

Query  550   SHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSR  371
              +L NNPWH  +  +LKDEV+ L+  TL +RER IIRLY+G+G EC TWE IS++ GLSR
Sbjct  419   KNLGNNPWHGFENWSLKDEVDKLLRATLNKRERAIIRLYYGIGGECHTWEGISRQFGLSR  478

Query  370   ERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             ERVRQVGLVA EKLKHAAR+ RL+A+LVKQ
Sbjct  479   ERVRQVGLVALEKLKHAARRRRLEALLVKQ  508



>ref|XP_006878659.1| hypothetical protein AMTR_s00011p00266100 [Amborella trichopoda]
 gb|ERM94804.1| hypothetical protein AMTR_s00011p00266100 [Amborella trichopoda]
Length=497

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/507 (60%), Positives = 377/507 (74%), Gaps = 10/507 (2%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++G+S GKRLL SSF  SD  E++    D        +S  S +++KKS  +  +
Sbjct  1     MATAAVIGISTGKRLLRSSFLASDI-ERVIPIYDFGATQFPAVSHKSFIVSKKSPGFGPN  59

Query  1621  CVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmlek  1442
               SN++   I AIKEHV          P    +    + + + E+ LE L+LLQK MLEK
Sbjct  60    SPSNRQTQYINAIKEHVNA--------PSSSSSSSTTEANPDFESSLEALILLQKSMLEK  111

Query  1441  QWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKRVR  1262
             QWNLS +++  +    E +CK + V  SG SAR+RR   RR + Q+  +V  +   K+  
Sbjct  112   QWNLSFDQAGTSTDLCEESCKKLGVISSGASARQRRNSLRRPLNQRAGTVL-VRRKKQAT  170

Query  1261  SIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSE  1082
              I+  E LQ   +GYVKGI ++ LL+H EVV LS  I+ GL LEE KSRLKE+LG DPS+
Sbjct  171   PIVSPELLQGHFRGYVKGISNDSLLSHAEVVHLSWKIRAGLSLEEHKSRLKEKLGFDPSD  230

Query  1081  EQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVG  902
             E LA SL+ISR++L   +IECSLA+EKLAMSN+RLVMSIAQ+YDNMG EMADLIQGGL+G
Sbjct  231   ELLASSLKISRSELHSKLIECSLAKEKLAMSNIRLVMSIAQKYDNMGIEMADLIQGGLIG  290

Query  901   LLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLK  722
             LLRGIEKFD SKG+K+STYVYWWIRQG+SRA+V+NS  LRLP HLH RLSLIRNA+ +LK
Sbjct  291   LLRGIEKFDSSKGFKISTYVYWWIRQGVSRAMVENSRTLRLPTHLHERLSLIRNAKIRLK  350

Query  721   DKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHL  542
             ++G+TPSI RIA+SLN+SKKKV NATEA++KVFSLDREAFP+++GLPGE+LHSYIAD++L
Sbjct  351   EQGLTPSIHRIAKSLNMSKKKVKNATEAMTKVFSLDREAFPTLNGLPGETLHSYIADNNL  410

Query  541   ENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERV  362
              NNPWH VDE  LK EVN LI +TL ERE++IIRLY+GL  EC TWEDIS++IGLSRERV
Sbjct  411   MNNPWHGVDEWLLKAEVNKLISSTLAEREQDIIRLYYGLDKECHTWEDISRKIGLSRERV  470

Query  361   RQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RQVGLVA EKLK+AAR  RL+AMLVK 
Sbjct  471   RQVGLVALEKLKNAARNKRLEAMLVKH  497



>ref|XP_010063584.1| PREDICTED: RNA polymerase sigma factor sigA [Eucalyptus grandis]
 gb|KCW90983.1| hypothetical protein EUGRSUZ_A02994 [Eucalyptus grandis]
Length=521

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/526 (58%), Positives = 378/526 (72%), Gaps = 25/526 (5%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYS---------------DFGEKLSCGSDHTLPCHQVLS  1670
             +M TA ++GLSAGKRLL S    S               D  +             +V S
Sbjct  3     LMATAAVIGLSAGKRLLSSPSSSSSSSSSASASSSSSSSDIPDNYKLFYVSASASDRVSS  62

Query  1669  VNSTVMAKKSSNYSTSCVSNQRMHS-IKAIKEHVTVASNLFNMEPCVQRNKQLQKqssee  1493
               + V+ K+  N +    S+ R+ +  KA+ + +  +S   +++     +   +      
Sbjct  63    TKNAVVPKRPPNSNPCFRSSHRLPTPAKALTQRLHPSSFPISLDSPEDEDGHEEGAHHVP  122

Query  1492  en--qledllllqkfmlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrr  1319
             E    +E LLLLQK MLE QW+L  E++ +  +  +   K I VTCSG SAR+RR+ +  
Sbjct  123   EFDCSVEALLLLQKSMLETQWSLCFERTVLADSAKDKPTKKIPVTCSGLSARQRRLGS--  180

Query  1318  qiiqQKNSVAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGL  1139
                  +  +      ++ RS +  + LQ+ L GYVKG+VS++LLTHGEVV LSK IK GL
Sbjct  181   -----RRRICSPVAGRQSRSAVSPDLLQHRLHGYVKGVVSDDLLTHGEVVALSKKIKTGL  235

Query  1138  YLEEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQ  959
             +LEE+KSRLKERLGC+PS+EQLA SLRISR +L+  +IE SLAREKLAMSNVRLVMSIAQ
Sbjct  236   FLEERKSRLKERLGCEPSDEQLATSLRISRAELRSRLIESSLAREKLAMSNVRLVMSIAQ  295

Query  958   RYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRL  779
             RYDNMGAEM+DL+QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRL
Sbjct  296   RYDNMGAEMSDLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRL  355

Query  778   PKHLHGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFP  599
             P HLH RL LIRNA+ +L++KGITPS+DRIAE LN+S+KKV NATEA+ KVFSLDR+AFP
Sbjct  356   PAHLHERLGLIRNAKVRLEEKGITPSVDRIAECLNMSQKKVRNATEAIGKVFSLDRDAFP  415

Query  598   SIDGLPGESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGN  419
             S++GLPGE+ HSYIAD H+ENNPWH VDE ALKDEVN L++ TL +REREIIRLY+GL N
Sbjct  416   SLNGLPGETHHSYIADIHVENNPWHGVDEWALKDEVNKLMNVTLSKREREIIRLYYGLDN  475

Query  418   ECLTWEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             ECLTWEDISKRIGLSRERVRQVGLVA EKLKH ARK  ++AML+K 
Sbjct  476   ECLTWEDISKRIGLSRERVRQVGLVALEKLKHMARKRMMEAMLLKH  521



>ref|XP_009382828.1| PREDICTED: RNA polymerase sigma factor sigA-like [Musa acuminata 
subsp. malaccensis]
Length=491

 Score =   537 bits (1384),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 284/509 (56%), Positives = 364/509 (72%), Gaps = 19/509 (4%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM T+ +VGLS GKRLL SSF  +D  EKL    D T       S  S V+A+K S +  
Sbjct  1     MMATSAVVGLSTGKRLLTSSFCPTDLAEKLFPILDQTTLPFPTASTKSVVVAQKPSPFRP  60

Query  1624  SCVSNQRMHSIKAIKEHV-TVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfml  1448
             +    + +  IKA+KEHV T+A +  ++E  ++    LQK   E++              
Sbjct  61    NAPPTRHVPIIKALKEHVHTLAPSPTDLESSLEALILLQKSMLEKQ--------------  106

Query  1447  ekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKR  1268
                W L   + T T     N C+  ++  SG SAR RR+ +RR+ I  ++++A     ++
Sbjct  107   ---WELPFTQMT-TVAAPGNGCRVPEIARSGISARERRMISRRKCIGHRDAMAPASRVRQ  162

Query  1267  VRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDP  1088
             +RS +  E L +   GYV+G VSE LLTH EVV LSK I+ G+ +EE +SRLKE++G +P
Sbjct  163   LRSCVSPELLNSDASGYVRGTVSESLLTHAEVVNLSKKIRAGMRVEEHRSRLKEKMGYEP  222

Query  1087  SEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  908
             +++QLA SLR+SR +L   MIECSLAREKLAMSNVRLVMSIAQ+YDNMG  MADLIQGGL
Sbjct  223   TDKQLASSLRMSRAELHTKMIECSLAREKLAMSNVRLVMSIAQKYDNMGTAMADLIQGGL  282

Query  907   VGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETK  728
             +GLLRGIEKFD SKG+K+STYVYWWIRQG++R L KNS  LRLP HLH RL  IR+A+ +
Sbjct  283   IGLLRGIEKFDASKGFKISTYVYWWIRQGVTRTLFKNSRTLRLPAHLHERLGSIRHAKIR  342

Query  727   LKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADS  548
             L++KGI PSID++AESLN+S+KKV NAT+A S V S+DREAFPS++GLPG++LHSYIAD 
Sbjct  343   LEEKGIAPSIDKLAESLNMSQKKVRNATQAASIVLSIDREAFPSLNGLPGKTLHSYIADR  402

Query  547   HLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRE  368
             +LENNPWH  +E +LKDEV+ L++ TL  RER+II LYHG+ NEC TWEDI K+ GLSRE
Sbjct  403   NLENNPWHGFEEWSLKDEVDKLLYMTLSNRERDIISLYHGIDNECHTWEDIGKKFGLSRE  462

Query  367   RVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RVRQVGLVA EKLKHAAR+ +L+AMLVKQ
Sbjct  463   RVRQVGLVAMEKLKHAARRRKLEAMLVKQ  491



>ref|XP_010910226.1| PREDICTED: RNA polymerase sigma factor sigA isoform X1 [Elaeis 
guineensis]
Length=593

 Score =   541 bits (1393),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 305/511 (60%), Positives = 371/511 (73%), Gaps = 5/511 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             +M  A + GLS GKRLL +SFY SD  EKL    DH        S  +T+ AKKSSN+ST
Sbjct  85    IMAMAAVFGLSRGKRLLSTSFYPSDLAEKLFAVPDHASMQFSTASTKNTIAAKKSSNFST  144

Query  1624  SCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmle  1445
             +  SN+   +IKA+KEHV   S L   +   QR   L+   S+ E  LE LLLLQK MLE
Sbjct  145   NIRSNRHSQAIKALKEHVDT-SALSTADTWFQRPDLLEDGESDLEYSLEVLLLLQKSMLE  203

Query  1444  kQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrq---iiqQKNSVAKIDTS  1274
             KQ  L  E+   T      +CK  +V  SG SAR+RR  TR            + ++   
Sbjct  204   KQRKLPFEQ-IKTVDDPRESCKKTEVIRSGISARKRRTITRMTCFNQNAYMEPLNRVKEG  262

Query  1273  KRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGC  1094
             K +RS +  E LQ  ++GYV+G +S+ LL+H EVV LS+ I+ GL LEE + +LKE+LG 
Sbjct  263   KELRSTVSPELLQMHVRGYVRGTISQNLLSHAEVVHLSRKIRAGLSLEENRMKLKEKLGF  322

Query  1093  DPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQG  914
             +PS++QLA  L +S  +L   + ECSLAREKLAMSNVRLVMSIAQ+YDN+GAEMADLIQG
Sbjct  323   EPSDKQLASFLGMSNAELHSKLTECSLAREKLAMSNVRLVMSIAQKYDNLGAEMADLIQG  382

Query  913   GLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAE  734
             GL+GLLRGIEKFD SKG K+STYVYWWIR G+SRALV+NS  LRLP HLH RLSLIRNA+
Sbjct  383   GLIGLLRGIEKFDSSKGCKISTYVYWWIRHGVSRALVENSRTLRLPAHLHERLSLIRNAK  442

Query  733   TKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIA  554
              +L+DKGI PSID IAESLN+S+KKV NATEAVSKVFSLDREAFPS++GLPGE+LHSYIA
Sbjct  443   VRLEDKGIIPSIDNIAESLNMSQKKVRNATEAVSKVFSLDREAFPSLNGLPGETLHSYIA  502

Query  553   DSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLS  374
             D +L NNPWH  +  +LKDEV+ L+  TL +RER IIRLY+G+G EC TWE IS++ GLS
Sbjct  503   DKNLGNNPWHGFENWSLKDEVDKLLRATLNKRERAIIRLYYGIGGECHTWEGISRQFGLS  562

Query  373   RERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RERVRQVGLVA EKLKHAAR+ RL+A+LVKQ
Sbjct  563   RERVRQVGLVALEKLKHAARRRRLEALLVKQ  593



>gb|KHN11742.1| Maltose excess protein 1, chloroplastic [Glycine soja]
Length=608

 Score =   540 bits (1390),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 301/478 (63%), Positives = 374/478 (78%), Gaps = 16/478 (3%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYS-T  1625
             M TA ++GLS GKRLL SS++YSD  EKLS GSD     +Q++   S + AKKSSNY+ T
Sbjct  1     MATAAVIGLSGGKRLLSSSYHYSDVIEKLSYGSDFGSTHYQIVPTKSLIAAKKSSNYTPT  60

Query  1624  SCVSNQRMHSIKAIKEHV----TVASNLFNMEPCVQRNKQLQKqsseeenqledllllqk  1457
                SNQ+  SIKA+KEHV    T+A + F  + C   +  L+ +SSE    +E LLLLQK
Sbjct  61    FPASNQQNQSIKALKEHVDDAPTIADSWF--QSC--NSNDLEVESSEMGYSVEALLLLQK  116

Query  1456  fmlekQWNLSAEKSTMT-YTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKID  1280
              MLEKQWNLS E+  +T +++    CK + VTCSG SAR+RR++T+      + +  K  
Sbjct  117   SMLEKQWNLSFEREVLTEHSSKGKKCKKVAVTCSGVSARQRRMNTK------RKTAIKTC  170

Query  1279  TSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERL  1100
              + +++S I  E LQ+ LKGYVKGIVSEELL+H EVV LS+ IK+GL LEE KSRLKERL
Sbjct  171   GAMQLKSKISPELLQHRLKGYVKGIVSEELLSHAEVVNLSERIKVGLSLEEHKSRLKERL  230

Query  1099  GCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLI  920
             GC+PS++Q+A+SL+ISRT+L+  MIEC+LAREKLAMSNVRLVMSIAQ+YDN+GAEM DL+
Sbjct  231   GCEPSDDQMAISLKISRTELRARMIECTLAREKLAMSNVRLVMSIAQKYDNLGAEMGDLV  290

Query  919   QGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRN  740
             QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RLSLIRN
Sbjct  291   QGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPAHLHERLSLIRN  350

Query  739   AETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSY  560
             A+ +L+++GITP+IDRIA+ LN+S+KKV NATEA+SK  SLDREAFPS++G+ GE+ HSY
Sbjct  351   AKFRLEERGITPTIDRIAKYLNMSQKKVRNATEAISKTISLDREAFPSLNGIQGETHHSY  410

Query  559   IADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKR  386
             IAD  +EN PW+ VDE ALKDEVN LI+ TL EREREIIRLY+GL  E LTWEDISKR
Sbjct  411   IADDRVENIPWNGVDEWALKDEVNKLINVTLVEREREIIRLYYGLDKEGLTWEDISKR  468



>ref|XP_009361127.1| PREDICTED: RNA polymerase sigma factor sigA isoform X2 [Pyrus 
x bretschneideri]
Length=485

 Score =   531 bits (1367),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 309/480 (64%), Positives = 366/480 (76%), Gaps = 6/480 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLL-CSSFYYSDFGEKLSCGSDHT-LPCHQVLSVNSTVMAKKSSNY  1631
             MM  A ++GL+ GKRLL  SS YYSD  EKL   +DH  L CH   + N     K +SNY
Sbjct  1     MMAIAAVIGLTTGKRLLNSSSSYYSDVTEKLFHLNDHAFLHCHFSSTRNLVTARKSNSNY  60

Query  1630  STS--CVSNQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllllq  1460
             ++S    SN+  HS KA+K+ V  AS   +  +        L+ +SS+ E  ++ LLLLQ
Sbjct  61    TSSRFSSSNRADHSSKALKDQVNAASAPSSTAQQWFHDFNDLEGESSDLEYSVDALLLLQ  120

Query  1459  kfmlekQWNLSAEKSTMTYTTMENNC-KNIQVTCSGTSArrrridtrrqiiqQKNSVAKI  1283
             K MLEKQWNLS EK   T +T++    K I VTCSG SAR RR+  RR        + + 
Sbjct  121   KSMLEKQWNLSFEKKIFTDSTIKTATNKRIPVTCSGVSARHRRMSNRRNAFSLNRCLTQP  180

Query  1282  DTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKER  1103
              T+K +R +I  E LQ+ LKGYVKG++SE+LLTH EVV LSK IK+GL +EE KSRLKER
Sbjct  181   STNKSLRPVISPELLQSRLKGYVKGVLSEDLLTHTEVVRLSKKIKIGLSVEEHKSRLKER  240

Query  1102  LGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADL  923
             LGC+PS+EQLA SLRISR +LK  +IECSLAREKLAMSNVRLVMSIAQ+YDNMGAEMADL
Sbjct  241   LGCEPSDEQLATSLRISRAELKSKLIECSLAREKLAMSNVRLVMSIAQKYDNMGAEMADL  300

Query  922   IQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIR  743
             IQGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIR
Sbjct  301   IQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSKTLRLPTHLHERLGLIR  360

Query  742   NAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHS  563
             NA+ +L++KGITPSIDRIAESLN+SKKKV NATEA+SKVFSLDR+AFPS++GLPGE+ HS
Sbjct  361   NAKIRLEEKGITPSIDRIAESLNMSKKKVRNATEAISKVFSLDRDAFPSLNGLPGETHHS  420

Query  562   YIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRI  383
             YIAD+ LEN PW+ VD  ALKDEVN LI+  L EREREIIRLY+GL NECLTWEDISKRI
Sbjct  421   YIADNRLENIPWNGVDAWALKDEVNKLINMMLGEREREIIRLYYGLDNECLTWEDISKRI  480



>ref|XP_010662047.1| PREDICTED: RNA polymerase sigma factor sigA isoform X3 [Vitis 
vinifera]
Length=524

 Score =   531 bits (1368),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 291/488 (60%), Positives = 348/488 (71%), Gaps = 29/488 (6%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCG-SDHTLPCHQVLSVNSTVMAKKSSNYS  1628
             MM TA ++GLSAG RLL SS +YSD  EKLS   +D   P H      + + AKK SNY+
Sbjct  7     MMGTAAVIGLSAGNRLLASSHHYSDVAEKLSSYVNDVGFPHHPSPPPKNLISAKKPSNYT  66

Query  1627  TSCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfml  1448
              S  SN+ + S+KA+KEHV  AS     +P +  +    +           L        
Sbjct  67    PS--SNRSIQSMKALKEHVESASAPSTADPDLSSSSSEVEDEEYLVEAFLLLQKSMLEKQ  124

Query  1447  ekQWNLSAEKSTMTYTTM-------------ENNCKNIQVTCSGTSArrrridtrrqiiq  1307
                WNLS   + +                  +   K  +VTCSGTSAR+RRI        
Sbjct  125   ---WNLSFVGTVVGKEEEEEEEEEEEEDMGKKARQKRREVTCSGTSARQRRISG------  175

Query  1306  QKNSVAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEE  1127
              +  V    +  RVR+ +G+E   N LKGYVKG+VSEELLTH +VV LS  IK GL LE+
Sbjct  176   -RKRVMNEKSKSRVRAALGVE---NRLKGYVKGVVSEELLTHAQVVLLSNKIKAGLLLED  231

Query  1126  QKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDN  947
              KSRLKER+G +P++EQ+A SLR+SR +L+  +IECSLAREKLAMSNVRLVMSIAQRYDN
Sbjct  232   HKSRLKERIGSEPTDEQVAASLRMSRAELQSKLIECSLAREKLAMSNVRLVMSIAQRYDN  291

Query  946   MGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHL  767
             MGAEMADL+QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HL
Sbjct  292   MGAEMADLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPSHL  351

Query  766   HGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDG  587
             H RLSLIRNA+ +L++KGITPSIDRIAE LN+S+KKV NATEA+SKVFSLDREAFPS++G
Sbjct  352   HERLSLIRNAKIRLEEKGITPSIDRIAECLNMSQKKVRNATEAISKVFSLDREAFPSLNG  411

Query  586   LPGESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLT  407
             LPGE+LHSYIAD  LENNPWH VDE ALKDEVN LI+TTL ERER+IIRLY+GL NECLT
Sbjct  412   LPGETLHSYIADVRLENNPWHGVDEWALKDEVNKLINTTLGERERDIIRLYYGLDNECLT  471

Query  406   WEDISKRI  383
             WEDISKR+
Sbjct  472   WEDISKRV  479



>ref|XP_008376947.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Malus 
domestica]
Length=486

 Score =   527 bits (1357),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 304/481 (63%), Positives = 362/481 (75%), Gaps = 7/481 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYS--DFGEKLSCGSDHT-LPCHQVLSVNSTVMAKKSSN  1634
             MM  A ++GL+ GKRLL SS      D  EKL   +DH  L CH   + N     K +SN
Sbjct  1     MMAIAAVIGLTTGKRLLSSSSSSYYSDVTEKLFHLNDHAFLHCHFSSTKNLVTARKSNSN  60

Query  1633  YSTS--CVSNQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllll  1463
             Y++S    SN+  HS +A+K+ V  AS   +  +        L+++SS+ E  ++ LLLL
Sbjct  61    YTSSRFSSSNRADHSSRALKDQVDAASAPSSTAQQWFHDFNDLEEESSDLEYSVDALLLL  120

Query  1462  qkfmlekQWNLSAEKSTMTYTTMENNC-KNIQVTCSGTSArrrridtrrqiiqQKNSVAK  1286
             QK MLEKQWNLS EK   T +T++    K I VTCSG SAR RR+  RR        + +
Sbjct  121   QKSMLEKQWNLSFEKKIFTDSTIKTATNKRIPVTCSGVSARHRRMSYRRNAFNLNRCLTQ  180

Query  1285  IDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKE  1106
               T+  +R +I  E LQ+ LKGYVKG++SE+LLTH EVV LSK IK+GL +EE KSRLKE
Sbjct  181   PSTNNSLRPVISPELLQSRLKGYVKGVLSEDLLTHTEVVRLSKKIKIGLSVEEHKSRLKE  240

Query  1105  RLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMAD  926
             RLGC+PS+EQLA SLRISR +LK  +IECSLAREKLAMSNVRLVMSIAQ+YDNMGAEMAD
Sbjct  241   RLGCEPSDEQLATSLRISRAELKSKLIECSLAREKLAMSNVRLVMSIAQKYDNMGAEMAD  300

Query  925   LIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLI  746
             LIQGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LI
Sbjct  301   LIQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSKTLRLPTHLHERLGLI  360

Query  745   RNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLH  566
             RNA+ +L++KGITPSIDRIAESLN+SKKKV NATEA+SKVFSLDR+AFPS++GLPGE+ H
Sbjct  361   RNAKIRLEEKGITPSIDRIAESLNMSKKKVRNATEAISKVFSLDRDAFPSLNGLPGETHH  420

Query  565   SYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKR  386
             SYIAD+ LEN PW  VD  ALKDEVN LI+  L EREREIIRLY+GL NECLTWEDISKR
Sbjct  421   SYIADNRLENIPWTGVDAWALKDEVNKLINMMLGEREREIIRLYYGLDNECLTWEDISKR  480

Query  385   I  383
             I
Sbjct  481   I  481



>ref|XP_009397520.1| PREDICTED: RNA polymerase sigma factor sigA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397527.1| PREDICTED: RNA polymerase sigma factor sigA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397536.1| PREDICTED: RNA polymerase sigma factor sigA-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397544.1| PREDICTED: RNA polymerase sigma factor sigA-like [Musa acuminata 
subsp. malaccensis]
Length=498

 Score =   527 bits (1357),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 277/517 (54%), Positives = 371/517 (72%), Gaps = 28/517 (5%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDH-TLPCHQVLSVNSTVMAKKSSNYS  1628
             MM TA ++GL  GKRLL SSF  +D  EKL    DH +LP     S   T++AKKSS++ 
Sbjct  1     MMATAAVIGLHTGKRLLSSSFCQTDLTEKLFSVPDHGSLPFSGG-STKCTIVAKKSSHFG  59

Query  1627  TSCVSNQRMHSIKAIKEHVTVA----SNLFNMEPCVQRNKQ----LQKqsseeenqledl  1472
             ++    + + +IKA++E V  +    S+ ++  P ++ + +    LQK   E++      
Sbjct  60    SNVPPTRHIPTIKALRERVNTSAPSTSDTWSERPDLESSLEVLILLQKSMLEKQ------  113

Query  1471  lllqkfmlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSV  1292
                        W L   + T T    EN+C+  ++T SG SAR RR  + R+    K ++
Sbjct  114   -----------WELPFTQMT-TVVAPENSCQMPEITRSGISARERRTISSRKCFSHKANL  161

Query  1291  AKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRL  1112
                   K++   +  E L++ + GYV+G VSE LLTH EV  LSK IK G++++EQ+++L
Sbjct  162   VPSSRVKQLHPSVSRELLKSDISGYVRGTVSENLLTHAEVANLSKTIKAGIHIQEQRAKL  221

Query  1111  KERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEM  932
             +++LG +P++ QLA SLR+SR +L   MIE SLAREKLAMSNVRLVMSIAQ+YDN+GAEM
Sbjct  222   QDKLGFEPTDRQLASSLRMSRAELHTKMIESSLAREKLAMSNVRLVMSIAQKYDNLGAEM  281

Query  931   ADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLS  752
              DLIQ GL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRAL KNS  LRLP HLH RLS
Sbjct  282   TDLIQAGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALFKNSRTLRLPTHLHERLS  341

Query  751   LIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGES  572
              IR+A+ +L++KGITPSID++AE+LN+S+KK+ +AT+A SKV SLDREAFPS++GLPGE+
Sbjct  342   SIRHAKIRLEEKGITPSIDKLAETLNMSQKKIRDATQAASKVLSLDREAFPSLNGLPGET  401

Query  571   LHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDIS  392
             LHSYIAD ++ENNPW+  +E +LKDEV  L++TTL +REREIIRLYHG+ +EC TWEDI 
Sbjct  402   LHSYIADRNVENNPWYGFEEWSLKDEVKKLLYTTLSKREREIIRLYHGIDSECHTWEDIG  461

Query  391   KRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             KR GLSRERVRQVGL+A EKLKH AR+ +L+A+LVK 
Sbjct  462   KRFGLSRERVRQVGLIAMEKLKHVARRRKLEAVLVKH  498



>ref|XP_007029767.1| Sigma factor A isoform 2 [Theobroma cacao]
 gb|EOY10269.1| Sigma factor A isoform 2 [Theobroma cacao]
Length=450

 Score =   511 bits (1317),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 285/436 (65%), Positives = 345/436 (79%), Gaps = 2/436 (0%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GL+ GKRLL SSF YSD  EKLS  +D+    HQ  S  S ++AKKSSN S 
Sbjct  1     MMATAAVIGLTTGKRLLSSSFSYSDIIEKLSYANDYGSSHHQTSSTKSLIVAKKSSNCSQ  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfml  1448
             S  S N+R  SIKA+KEHV  AS +   EP  Q +  L+ +S + +  +E LLLLQK ML
Sbjct  61    SLPSSNRRAQSIKALKEHVDSASIVSTAEPLFQGSNDLEVESYDLDYSVEALLLLQKSML  120

Query  1447  ekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKR  1268
             EKQW LS E++  T +      K I VTCSG SAR+RR +T+R+I+ Q  S+ + + +K+
Sbjct  121   EKQWTLSFERTVFTESPSRKIHKKIPVTCSGVSARQRRFNTKRKILIQNKSIIQPN-AKQ  179

Query  1267  VRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDP  1088
             +RS+I  E LQ+ LKGYVKG+VS+ELL+H EVV LSK IK GL LEE + RLKERLGC+P
Sbjct  180   LRSLISPELLQSRLKGYVKGVVSDELLSHAEVVRLSKKIKAGLSLEEHRLRLKERLGCEP  239

Query  1087  SEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  908
             S+EQLA SL+ISR +L+  +IECSLAREKLAMSNVRLVMSIAQRYDNMGAEM+DLIQGGL
Sbjct  240   SDEQLATSLKISRAELRSKLIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMSDLIQGGL  299

Query  907   VGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETK  728
             +GLLRGIEKFD SKGYK+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+ +
Sbjct  300   IGLLRGIEKFDSSKGYKISTYVYWWIRQGVSRALVENSRTLRLPTHLHERLGLIRNAKIR  359

Query  727   LKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADS  548
             L++KGITP+IDRIAESLN+S+KKV NATEAVSKVFSLDR+AFPS++GLPGE+ HSYIAD+
Sbjct  360   LEEKGITPTIDRIAESLNMSQKKVRNATEAVSKVFSLDRDAFPSLNGLPGETHHSYIADN  419

Query  547   HLENNPWHRVDECALK  500
             H+EN PWH VDE ALK
Sbjct  420   HVENIPWHGVDEWALK  435



>ref|XP_006371210.1| hypothetical protein POPTR_0019s06020g [Populus trichocarpa]
 gb|ERP49007.1| hypothetical protein POPTR_0019s06020g [Populus trichocarpa]
Length=451

 Score =   510 bits (1313),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 275/436 (63%), Positives = 341/436 (78%), Gaps = 1/436 (0%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLS+GKRLL SSFYYSD  EKLS  +DH +  +   +  + ++AKKSSNY  
Sbjct  1     MMATAAVIGLSSGKRLLSSSFYYSDLTEKLSNVNDHGITYYPTATTKNVIVAKKSSNYGP  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfml  1448
             S  S N+  HSIKA+KEHV  AS   N+    +     +++SS  +  +E LLLLQK ML
Sbjct  61    SFPSSNRNSHSIKALKEHVDTASASSNVATWFKTFDDFEEESSALDYSVEALLLLQKSML  120

Query  1447  ekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKR  1268
             EKQWNLS E++  + +T + N K I VTCSG SAR+RR++ RR+   Q   +++    K 
Sbjct  121   EKQWNLSFERTNSSDSTSKKNNKKIPVTCSGVSARQRRVNNRRKNQNQSKFMSQSSDFKF  180

Query  1267  VRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDP  1088
             +RS+   + LQN LKGYVKG+VS+E+L H EVV LS++I+ GL  E+ KSRLKERLGC+P
Sbjct  181   LRSVSSPDLLQNRLKGYVKGVVSDEVLPHTEVVRLSRIIRAGLSFEDHKSRLKERLGCEP  240

Query  1087  SEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  908
             S+EQ+A SLRISR DL+  +I+CSLAREKLAMSNVRLVMSIAQ+YDNMGAEMADL+QGGL
Sbjct  241   SDEQIADSLRISRADLQSKLIQCSLAREKLAMSNVRLVMSIAQKYDNMGAEMADLVQGGL  300

Query  907   VGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETK  728
             +GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV NS  LRLP HLH RL LIRNA+ +
Sbjct  301   IGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVDNSRTLRLPNHLHERLGLIRNAKIR  360

Query  727   LKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADS  548
             L++KG+TPSIDRIAESLN+S++KV NATEA+SKVFSLDREAFPS++GLPGE+ HSYIAD+
Sbjct  361   LEEKGVTPSIDRIAESLNMSQRKVRNATEAISKVFSLDREAFPSLNGLPGETHHSYIADN  420

Query  547   HLENNPWHRVDECALK  500
               ENNPWH VDE ALK
Sbjct  421   RPENNPWHGVDEWALK  436



>ref|NP_001185314.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
 gb|AEE34299.1| RNA polymerase sigma subunit 1 [Arabidopsis thaliana]
Length=498

 Score =   509 bits (1312),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 281/482 (58%), Positives = 357/482 (74%), Gaps = 23/482 (5%)
 Frame = -1

Query  1801  MVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTS  1622
             M TA ++GL+ GKRLL SSFY+SD  EK    +DH    + + S  S + AKK+SNYS S
Sbjct  1     MATAAVIGLNTGKRLLSSSFYHSDVTEKFLSVNDHCSSQYHIASTKSGITAKKASNYSPS  60

Query  1621  CVS-NQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllll----qk  1457
               S N+   S KA+KE V VAS      P    +K+L+++  ++++ +   +      QK
Sbjct  61    FPSSNRHTQSAKALKESVDVASTEKPWLPN-GTDKELEEECYDDDDLISHSVEAILLLQK  119

Query  1456  fmlekQWNLSAEKSTMTYTTMENNCKNIQV---TCSGTSArrrridtrrqiiqQK-NSVA  1289
              MLEK WNLS EK+  +    +   +  ++   TCSG SAR+RRI  +++       +V+
Sbjct  120   SMLEKSWNLSFEKAVSSEYPGKGTIRKKKIPVITCSGISARQRRIGAKKKTNMTHVKAVS  179

Query  1288  KIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLK  1109
              + + K+VR             GYVKG++SE++L+H EVV LSK IK GL L++ KSRLK
Sbjct  180   DVSSGKQVR-------------GYVKGVISEDVLSHVEVVRLSKKIKSGLRLDDHKSRLK  226

Query  1108  ERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMA  929
             +RLGC+PS+EQLAVSL+ISR +L+  ++EC LAREKLAMSNVRLVMSIAQRYDN+GAEM+
Sbjct  227   DRLGCEPSDEQLAVSLKISRAELQAWLMECHLAREKLAMSNVRLVMSIAQRYDNLGAEMS  286

Query  928   DLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSL  749
             DL+QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP HLH RL L
Sbjct  287   DLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPTHLHERLGL  346

Query  748   IRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESL  569
             IRNA+ +L++KGITPSIDRIAESLN+S+KKV NATEAVSKVFSLDR+AFPS++GLPGE+ 
Sbjct  347   IRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEAVSKVFSLDRDAFPSLNGLPGETH  406

Query  568   HSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISK  389
             HSYIAD+ LENNPWH  D+ ALK+EV+ LI  TL ERE+EIIRLY+GL  ECLTWEDISK
Sbjct  407   HSYIADTRLENNPWHGYDDLALKEEVSKLISATLGEREKEIIRLYYGLDKECLTWEDISK  466

Query  388   RI  383
             RI
Sbjct  467   RI  468



>gb|KDO48035.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=443

 Score =   501 bits (1291),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 277/437 (63%), Positives = 345/437 (79%), Gaps = 4/437 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLSAGKRLL SSFYYSD  EK S  +D      QV S  + V AKKSSNY+ 
Sbjct  1     MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNP  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllllqkfm  1451
             S  S N++   IKA+KEHV   +N  +  EP  +    ++++SSE +  +E LLLLQK M
Sbjct  61    SFPSSNRQTQPIKALKEHVD--TNFASTAEPWAEPPNSIEEESSELDYSVEALLLLQKSM  118

Query  1450  lekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSK  1271
             LEKQWNLS E++ +T +  +   K + VTCSG SAR+RR++++++I+ Q  S+ + + SK
Sbjct  119   LEKQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSILQQNGSK  178

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
             ++RS+I  E +QN LKGYVKG+VSEELLTH EVV LSK IK GL L++ K RLKERLGC+
Sbjct  179   QLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCE  238

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGG  911
             PS EQLA SLRISR +L+  ++ECSLAREKL MSNVRLVMSIAQRYDNMGA+MADL+QGG
Sbjct  239   PSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGG  298

Query  910   LVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAET  731
             L+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+ 
Sbjct  299   LIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKL  358

Query  730   KLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIAD  551
             +L++KG+TPS+DRIAE LN+S+KKV NATEA+ KVFSLDREAFPS++GLPGE+ HSYIAD
Sbjct  359   RLEEKGVTPSVDRIAEYLNMSQKKVRNATEAIGKVFSLDREAFPSLNGLPGETHHSYIAD  418

Query  550   SHLENNPWHRVDECALK  500
             + +ENNPWH VD+ ALK
Sbjct  419   NRVENNPWHGVDDWALK  435



>gb|EPS67249.1| sigma factor [Genlisea aurea]
Length=517

 Score =   501 bits (1290),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 294/527 (56%), Positives = 385/527 (73%), Gaps = 29/527 (6%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLC--SSFYYSDFGEKLSCGSDHTLPCHQVLSVNST-----VMAK  1646
             M V A + GLS GKRLL   S+F+YSD  EK      H  P H  L    T     + A+
Sbjct  1     MTVAALVGGLSTGKRLLLLGSAFFYSDLAEK------HPDPPHCQLPSTRTRTGAVINAR  54

Query  1645  KSSNYSTSCVSNQRMHS---IKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqled  1475
             +SSN        +R  S   I+A+K+H     +    +PC   +  + ++ S+ EN ++ 
Sbjct  55    RSSNLVADRPRRRRTQSESSIRALKQH---RQSTAPTKPCSPES-WMAEEESDSENLVDA  110

Query  1474  llllqkfmlekQWNLSAEKSTMTYTTMENNC---KNIQVTCSGTSArrrridtrrqiiqQ  1304
             +LLLQK MLEKQWNL AE ++   +T ++     + I VT SGTSAR RR+++R+++I +
Sbjct  111   VLLLQKSMLEKQWNLPAEMTSGGISTADSTTDRHRQISVTGSGTSARNRRLESRKRVIGR  170

Query  1303  K-NSVAKIDTSKRVRSIIGMEQLQNSLKGYVKGIV---SEELLTHGEVVELSKMIKLGLY  1136
             +  + ++++  K+ RSI     +Q+  + ++K      SE+LLTH +VV+LS+ IK GL 
Sbjct  171   RIATSSQLNIRKQGRSITNPALVQSRPRAHLKAAAAAASEDLLTHSQVVQLSQKIKTGLM  230

Query  1135  LEEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQR  956
             LEE KSRLK +LGC+PSEEQLA SLRIS+TDL+  ++E S+AREKLA SNVRLVMSIAQR
Sbjct  231   LEEHKSRLKGKLGCEPSEEQLANSLRISKTDLQTKLMESSIAREKLAKSNVRLVMSIAQR  290

Query  955   YDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQ--GISRALVKNSSMLR  782
             YD+MG +MADLIQGGL+GLLRGIEKFD SKG+K+STYVYWWIRQ  G+SR+L++NS  LR
Sbjct  291   YDHMGVDMADLIQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQVRGVSRSLMENSRTLR  350

Query  781   LPKHLHGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAF  602
             LP HLH RLSLIR A+ +L +KG+ P++ +IAE LN+S+KKV NATEAVS V SLDREAF
Sbjct  351   LPSHLHERLSLIRTAKARLAEKGVLPTVAKIAECLNMSEKKVINATEAVSIVISLDREAF  410

Query  601   PSIDGLPGESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLG  422
             PS++GLPGE+ HSYIAD+ ++NNPW+  DE ALKDE++ L+ +TL+EREREIIRLY+GL 
Sbjct  411   PSLNGLPGETYHSYIADNQMDNNPWYGFDEWALKDEIDRLLSSTLREREREIIRLYYGLE  470

Query  421   NECLTWEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             +E LTWEDIS+RIGLSRERVRQVGLVA EKLKHAAR  +L AMLV+ 
Sbjct  471   HESLTWEDISRRIGLSRERVRQVGLVALEKLKHAARNKKLDAMLVQH  517



>gb|KCW90982.1| hypothetical protein EUGRSUZ_A02994 [Eucalyptus grandis]
Length=530

 Score =   488 bits (1256),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 276/492 (56%), Positives = 348/492 (71%), Gaps = 25/492 (5%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYS---------------DFGEKLSCGSDHTLPCHQVLS  1670
             +M TA ++GLSAGKRLL S    S               D  +             +V S
Sbjct  3     LMATAAVIGLSAGKRLLSSPSSSSSSSSSASASSSSSSSDIPDNYKLFYVSASASDRVSS  62

Query  1669  VNSTVMAKKSSNYSTSCVSNQRMHS-IKAIKEHVTVASNLFNMEPCVQRNKQLQKqssee  1493
               + V+ K+  N +    S+ R+ +  KA+ + +  +S   +++     +   +      
Sbjct  63    TKNAVVPKRPPNSNPCFRSSHRLPTPAKALTQRLHPSSFPISLDSPEDEDGHEEGAHHVP  122

Query  1492  en--qledllllqkfmlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrr  1319
             E    +E LLLLQK MLE QW+L  E++ +  +  +   K I VTCSG SAR+RR+ +  
Sbjct  123   EFDCSVEALLLLQKSMLETQWSLCFERTVLADSAKDKPTKKIPVTCSGLSARQRRLGS--  180

Query  1318  qiiqQKNSVAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGL  1139
                  +  +      ++ RS +  + LQ+ L GYVKG+VS++LLTHGEVV LSK IK GL
Sbjct  181   -----RRRICSPVAGRQSRSAVSPDLLQHRLHGYVKGVVSDDLLTHGEVVALSKKIKTGL  235

Query  1138  YLEEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQ  959
             +LEE+KSRLKERLGC+PS+EQLA SLRISR +L+  +IE SLAREKLAMSNVRLVMSIAQ
Sbjct  236   FLEERKSRLKERLGCEPSDEQLATSLRISRAELRSRLIESSLAREKLAMSNVRLVMSIAQ  295

Query  958   RYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRL  779
             RYDNMGAEM+DL+QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRL
Sbjct  296   RYDNMGAEMSDLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRL  355

Query  778   PKHLHGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFP  599
             P HLH RL LIRNA+ +L++KGITPS+DRIAE LN+S+KKV NATEA+ KVFSLDR+AFP
Sbjct  356   PAHLHERLGLIRNAKVRLEEKGITPSVDRIAECLNMSQKKVRNATEAIGKVFSLDRDAFP  415

Query  598   SIDGLPGESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGN  419
             S++GLPGE+ HSYIAD H+ENNPWH VDE ALKDEVN L++ TL +REREIIRLY+GL N
Sbjct  416   SLNGLPGETHHSYIADIHVENNPWHGVDEWALKDEVNKLMNVTLSKREREIIRLYYGLDN  475

Query  418   ECLTWEDISKRI  383
             ECLTWEDISKR 
Sbjct  476   ECLTWEDISKRF  487



>gb|KDO48036.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=419

 Score =   468 bits (1204),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 263/418 (63%), Positives = 328/418 (78%), Gaps = 4/418 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLSAGKRLL SSFYYSD  EK S  +D      QV S  + V AKKSSNY+ 
Sbjct  1     MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNP  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllllqkfm  1451
             S  S N++   IKA+KEHV   +N  +  EP  +    ++++SSE +  +E LLLLQK M
Sbjct  61    SFPSSNRQTQPIKALKEHVD--TNFASTAEPWAEPPNSIEEESSELDYSVEALLLLQKSM  118

Query  1450  lekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSK  1271
             LEKQWNLS E++ +T +  +   K + VTCSG SAR+RR++++++I+ Q  S+ + + SK
Sbjct  119   LEKQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSILQQNGSK  178

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
             ++RS+I  E +QN LKGYVKG+VSEELLTH EVV LSK IK GL L++ K RLKERLGC+
Sbjct  179   QLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCE  238

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGG  911
             PS EQLA SLRISR +L+  ++ECSLAREKL MSNVRLVMSIAQRYDNMGA+MADL+QGG
Sbjct  239   PSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGG  298

Query  910   LVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAET  731
             L+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+ 
Sbjct  299   LIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKL  358

Query  730   KLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYI  557
             +L++KG+TPS+DRIAE LN+S+KKV NATEA+ KVFSLDREAFPS++GLPGE+ HS I
Sbjct  359   RLEEKGVTPSVDRIAEYLNMSQKKVRNATEAIGKVFSLDREAFPSLNGLPGETHHSVI  416



>gb|KDO48037.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=417

 Score =   465 bits (1197),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 261/415 (63%), Positives = 326/415 (79%), Gaps = 4/415 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLSAGKRLL SSFYYSD  EK S  +D      QV S  + V AKKSSNY+ 
Sbjct  1     MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNP  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllllqkfm  1451
             S  S N++   IKA+KEHV   +N  +  EP  +    ++++SSE +  +E LLLLQK M
Sbjct  61    SFPSSNRQTQPIKALKEHVD--TNFASTAEPWAEPPNSIEEESSELDYSVEALLLLQKSM  118

Query  1450  lekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSK  1271
             LEKQWNLS E++ +T +  +   K + VTCSG SAR+RR++++++I+ Q  S+ + + SK
Sbjct  119   LEKQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSILQQNGSK  178

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
             ++RS+I  E +QN LKGYVKG+VSEELLTH EVV LSK IK GL L++ K RLKERLGC+
Sbjct  179   QLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCE  238

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGG  911
             PS EQLA SLRISR +L+  ++ECSLAREKL MSNVRLVMSIAQRYDNMGA+MADL+QGG
Sbjct  239   PSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGG  298

Query  910   LVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAET  731
             L+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRLP HLH RL LIRNA+ 
Sbjct  299   LIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRLPNHLHERLGLIRNAKL  358

Query  730   KLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLH  566
             +L++KG+TPS+DRIAE LN+S+KKV NATEA+ KVFSLDREAFPS++GLPGE+ H
Sbjct  359   RLEEKGVTPSVDRIAEYLNMSQKKVRNATEAIGKVFSLDREAFPSLNGLPGETHH  413



>ref|XP_010910227.1| PREDICTED: RNA polymerase sigma factor sigA isoform X2 [Elaeis 
guineensis]
Length=550

 Score =   455 bits (1170),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 273/511 (53%), Positives = 334/511 (65%), Gaps = 48/511 (9%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             +M  A + GLS GKRLL +SFY SD  EKL    DH        S  +T+ AKKSSN+ST
Sbjct  85    IMAMAAVFGLSRGKRLLSTSFYPSDLAEKLFAVPDHASMQFSTASTKNTIAAKKSSNFST  144

Query  1624  SCVSNQRMHSIKAIKEHVTVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkfmle  1445
             +  SN+   +IKA+KEHV   S L   +   QR   L+   S+ E  LE LLLLQK MLE
Sbjct  145   NIRSNRHSQAIKALKEHVDT-SALSTADTWFQRPDLLEDGESDLEYSLEVLLLLQKSMLE  203

Query  1444  kQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrq---iiqQKNSVAKIDTS  1274
             KQ  L  E+   T      +CK  +V  SG SAR+RR  TR            + ++   
Sbjct  204   KQRKLPFEQ-IKTVDDPRESCKKTEVIRSGISARKRRTITRMTCFNQNAYMEPLNRVKEG  262

Query  1273  KRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGC  1094
             K +RS +  E LQ  ++GYV+G +S+ LL+H EVV LS+ I+ GL LEE + +LKE+LG 
Sbjct  263   KELRSTVSPELLQMHVRGYVRGTISQNLLSHAEVVHLSRKIRAGLSLEENRMKLKEKLGF  322

Query  1093  DPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQG  914
             +PS++QLA  L +S  +L   + ECSLAREKLAMSNVRLVMSIAQ+YDN+GAEMADLIQG
Sbjct  323   EPSDKQLASFLGMSNAELHSKLTECSLAREKLAMSNVRLVMSIAQKYDNLGAEMADLIQG  382

Query  913   GLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAE  734
             GL+GLLRGIEKFD SKG K+STYVYWWIR                               
Sbjct  383   GLIGLLRGIEKFDSSKGCKISTYVYWWIRHN-----------------------------  413

Query  733   TKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIA  554
                           IAESLN+S+KKV NATEAVSKVFSLDREAFPS++GLPGE+LHSYIA
Sbjct  414   --------------IAESLNMSQKKVRNATEAVSKVFSLDREAFPSLNGLPGETLHSYIA  459

Query  553   DSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLS  374
             D +L NNPWH  +  +LKDEV+ L+  TL +RER IIRLY+G+G EC TWE IS++ GLS
Sbjct  460   DKNLGNNPWHGFENWSLKDEVDKLLRATLNKRERAIIRLYYGIGGECHTWEGISRQFGLS  519

Query  373   RERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             RERVRQVGLVA EKLKHAAR+ RL+A+LVKQ
Sbjct  520   RERVRQVGLVALEKLKHAARRRRLEALLVKQ  550



>ref|XP_010087437.1| RNA polymerase sigma factor rpoD [Morus notabilis]
 gb|EXB29118.1| RNA polymerase sigma factor rpoD [Morus notabilis]
Length=508

 Score =   442 bits (1136),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 244/393 (62%), Positives = 281/393 (72%), Gaps = 50/393 (13%)
 Frame = -1

Query  1438  WNLSAE-------KSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKID  1280
             WNLS          +T T +T  NN K + VTCSG SAR RR     +   +  +V    
Sbjct  159   WNLSFNGRRKPVMSTTQTSSTDYNNNKPV-VTCSGVSARHRRKRASARNTPRTPAVTPTS  217

Query  1279  TSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERL  1100
             T    RS        N  KGY+KG+V  +LLTH EVV LSK IK+GL LE+ KSRL+ERL
Sbjct  218   T----RST-------NDFKGYLKGVVGADLLTHAEVVRLSKKIKIGLSLEDHKSRLRERL  266

Query  1099  GCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLI  920
             GC+PS++QLA SLRISR +L   MIE SLAREKLAMSNVRLVMSIAQRYDNMGAEMADL+
Sbjct  267   GCEPSDKQLATSLRISRAELHSKMIESSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLV  326

Query  919   QGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRN  740
             QG                               +SRALV+NS  LRLP HLH RLS IRN
Sbjct  327   QG-------------------------------VSRALVENSRTLRLPTHLHERLSSIRN  355

Query  739   AETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSY  560
             A+ +L++KGITPSIDRIAE LN+SKKKV NATEA+SKVFSLDREAFPS++GLPGE+ HSY
Sbjct  356   AKIRLQEKGITPSIDRIAECLNMSKKKVRNATEAISKVFSLDREAFPSLNGLPGETHHSY  415

Query  559   IADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIG  380
             IAD+  EN PWH VDE ALK+EVN LI+TTL ERE +IIRLY+GL NECLTWEDISKRIG
Sbjct  416   IADNCSENIPWHGVDEWALKEEVNKLINTTLGERETDIIRLYYGLDNECLTWEDISKRIG  475

Query  379   LSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ  281
             LSRERVRQVGLVA EKLKHAAR+ +++AMLVK 
Sbjct  476   LSRERVRQVGLVALEKLKHAARRKQMEAMLVKH  508



>ref|XP_008662828.1| PREDICTED: RNA polymerase sigma factor sigA [Zea mays]
 gb|ACF83862.1| unknown [Zea mays]
 gb|ACN26422.1| unknown [Zea mays]
 gb|AFW57214.1| RNA polymerase sigma factor 1 isoform 1 [Zea mays]
 gb|AFW57215.1| RNA polymerase sigma factor 1 isoform 2 [Zea mays]
 gb|AFW57216.1| RNA polymerase sigma factor 1 isoform 3 [Zea mays]
 gb|AIB05282.1| sigma70-like transcription factor, partial [Zea mays]
Length=496

 Score =   439 bits (1128),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 248/526 (47%), Positives = 334/526 (63%), Gaps = 54/526 (10%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNS--TVMAKKSSNY  1631
             M  T  ++GLSAG RLL +SF  ++        S    P  Q  +     TV+A ++S  
Sbjct  1     MTATPAVIGLSAGNRLLATSFGSAELA------SPDAYPSRQFAAAAPKLTVVAHRASAS  54

Query  1630  -----STSCVSNQRMHSIKAIKEHVTVASNL-------------FNMEPCVQRNKQLQKq  1505
                  +     + R H+I+A++ H   A                F  E  ++    LQ+ 
Sbjct  55    ASSPANIGGAGHARAHAIRALRNHSAPALAPPPPADPAPELDSKFEFESSLEAIVLLQRS  114

Query  1504  sseeenqledllllqkfmlekQWNLSAEKS-TMTYTTMENNCKNIQVTCSGTSArrrrid  1328
               E++                 W L  E   + T    E+    + V  SG SAR+RR+ 
Sbjct  115   MLEKQ-----------------WELPFEDDISSTEDEDEDERSTVVVARSGVSARQRRMS  157

Query  1327  trrqiiqQKNSVAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIK  1148
                           +   K V   +  E +Q+  + Y++G VS++LLTH +VV+LS+ IK
Sbjct  158   --------GRRRGAVVGRKSV--TVSPELMQSRNRIYLRGTVSKDLLTHKQVVQLSRKIK  207

Query  1147  LGLYLEEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMS  968
              G++L+ Q+S+LKE+LG +PS +QLA SLRI   +L+  M E  LARE LAMSN RLV+S
Sbjct  208   DGIWLQHQRSKLKEKLGNEPSYKQLAQSLRIPAPELRARMRESFLAREMLAMSNTRLVIS  267

Query  967   IAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSM  788
             IAQ+YDN+G E+ DLIQGGL+GLLRGIEKFD S+G+++STYVYWWIRQG+SRAL  NS  
Sbjct  268   IAQKYDNLGVELPDLIQGGLIGLLRGIEKFDASRGFRISTYVYWWIRQGVSRALADNSRS  327

Query  787   LRLPKHLHGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDRE  608
              RLP +LH RL  IR A+  L+D+GI P+++ IAESLNIS+KKV NATEAV KV SLD++
Sbjct  328   FRLPTYLHERLVAIRGAKYALEDQGIAPTVENIAESLNISEKKVHNATEAVHKVISLDQQ  387

Query  607   AFPSIDGLPGESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHG  428
             AFPS++GLPG++LHSYI D ++ N+PWH  +E  LK+EVN+LI++TL ERER+IIRLYHG
Sbjct  388   AFPSLNGLPGDTLHSYIEDQNVANDPWHGFEERYLKEEVNSLINSTLNERERDIIRLYHG  447

Query  427   LGNECLTWEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAML  290
             +G +C TWEDIS++ GLSRERVRQVGLVA EKLKHAAR+  L A+L
Sbjct  448   IGKQCHTWEDISRQFGLSRERVRQVGLVAMEKLKHAARREHLDALL  493



>ref|XP_004972754.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X1 [Setaria 
italica]
 ref|XP_004972755.1| PREDICTED: RNA polymerase sigma factor sigA-like isoform X2 [Setaria 
italica]
Length=499

 Score =   439 bits (1128),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 208/322 (65%), Positives = 266/322 (83%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             I  E +Q+  + Y++G VS+ELLTH +VV+LSK IK G++L+ Q+S+LKE+LG +PS +Q
Sbjct  175   ISPELMQSRNRIYLRGTVSKELLTHKQVVQLSKKIKDGIWLQHQRSKLKEKLGNEPSYKQ  234

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA SLRIS  +L+  M E  LARE L MSN+RLV+SIAQ+YDN+G E+ADLIQGGL+GLL
Sbjct  235   LAQSLRISAPELRARMRESFLAREMLTMSNIRLVISIAQKYDNLGVELADLIQGGLIGLL  294

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL +NS   RLP +LH RL  IR+A+  L+D+
Sbjct  295   RGIEKFDASRGFRISTYVYWWIRQGVSRALAENSKTFRLPTYLHERLIAIRSAKYALEDQ  354

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GI P+ + IA SLNIS+KKV NATEAV+KV SLD++AFPS++GLPGE+LHSYI D ++ N
Sbjct  355   GIAPTTENIAGSLNISEKKVNNATEAVNKVLSLDQQAFPSLNGLPGETLHSYIEDENVAN  414

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVNNLI++TL ERER+IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  415   DPWHGFEERYLKEEVNNLINSTLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  474

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGLVA EKLKHAAR+  L A+L
Sbjct  475   VGLVAMEKLKHAARRKHLDALL  496



>dbj|BAC99906.1| putative plastid RNA polymerase sigma factor [Oryza sativa Japonica 
Group]
Length=342

 Score =   428 bits (1100),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 266/322 (83%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             +  E +Q+  + Y++G VS+ELLTH +VV LS  IK G++L++Q+S+LKE+LG +PS +Q
Sbjct  18    VSPELIQSRNRIYLRGTVSKELLTHKQVVHLSHKIKDGIWLQQQRSKLKEKLGNEPSYKQ  77

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA SL+IS  +L+  M E  LARE L MSN+RLV+SIAQ+YDN+G E+ADLIQGGL+GLL
Sbjct  78    LAHSLKISPPELRSRMHESFLAREMLTMSNLRLVISIAQKYDNLGVELADLIQGGLIGLL  137

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL +NS   RLP +LH RL  IR A+ +L+D+
Sbjct  138   RGIEKFDASRGFRISTYVYWWIRQGVSRALAENSKTFRLPTYLHERLIAIRGAKYELEDQ  197

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GI P+I+ IA SLNIS+KKV NATEAV+KV SLD++AFPS++GLPGE+LHSYI D ++ N
Sbjct  198   GIAPTIENIAGSLNISEKKVLNATEAVNKVLSLDQQAFPSLNGLPGETLHSYIEDQNVAN  257

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVN L+++TL ERER+IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  258   DPWHGFEEWYLKEEVNKLLNSTLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  317

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGL+A EKLKHAAR+  L+A+L
Sbjct  318   VGLIAMEKLKHAARRKNLEALL  339



>gb|EAZ05701.1| hypothetical protein OsI_27933 [Oryza sativa Indica Group]
Length=372

 Score =   429 bits (1103),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 266/322 (83%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             +  E +Q+  + Y++G VS+ELLTH +VV LS  IK G++L++Q+S+LKE+LG +PS +Q
Sbjct  48    VSPELIQSRNRIYLRGTVSKELLTHKQVVHLSHKIKDGIWLQQQRSKLKEKLGNEPSYKQ  107

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA SL+IS  +L+  M E  LARE L MSN+RLV+SIAQ+YDN+G E+ADLIQGGL+GLL
Sbjct  108   LAHSLKISPPELRSRMHESFLAREMLTMSNLRLVISIAQKYDNLGVELADLIQGGLIGLL  167

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL +NS   RLP +LH RL  IR A+ +L+D+
Sbjct  168   RGIEKFDASRGFRISTYVYWWIRQGVSRALAENSKTFRLPTYLHERLIAIRGAKYELEDQ  227

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GI P+I+ IA SLNIS+KKV NATEAV+KV SLD++AFPS++GLPGE+LHSYI D ++ N
Sbjct  228   GIAPTIENIAGSLNISEKKVLNATEAVNKVLSLDQQAFPSLNGLPGETLHSYIEDQNVAN  287

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVN L+++TL ERER+IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  288   DPWHGFEEWYLKEEVNKLLNSTLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  347

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGL+A EKLKHAAR+  L+A+L
Sbjct  348   VGLIAMEKLKHAARRKNLEALL  369



>ref|XP_002443917.1| hypothetical protein SORBIDRAFT_07g004340 [Sorghum bicolor]
 gb|EES13412.1| hypothetical protein SORBIDRAFT_07g004340 [Sorghum bicolor]
Length=500

 Score =   434 bits (1115),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 265/322 (82%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             +  E +Q+  + Y++G VS++LLTH +V++LS+ IK G++L+ Q+S+LKE+LG +PS +Q
Sbjct  176   VSPELMQSRNRIYLRGTVSKDLLTHKQVIQLSRKIKDGIWLQHQRSKLKEKLGNEPSYKQ  235

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA SL IS  +L+  M E  LARE L MSN+RLV+SIAQ+YDN+G E+ADLIQGGL+GLL
Sbjct  236   LAQSLHISPPELRARMRESFLAREMLTMSNIRLVISIAQKYDNLGVELADLIQGGLIGLL  295

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL  NS   RLP +LH RL  IR A+  L+D+
Sbjct  296   RGIEKFDASRGFRISTYVYWWIRQGVSRALADNSKAFRLPTYLHERLIAIRGAKYALEDQ  355

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GI P+++ IAESLNIS+KKV NATEAV+KV SLD++AFPS++GLPG++LHSYI D ++ N
Sbjct  356   GIAPTVENIAESLNISEKKVHNATEAVNKVLSLDQQAFPSLNGLPGDTLHSYIEDQNVAN  415

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVNNLI++TL ERER+IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  416   DPWHGFEERYLKEEVNNLINSTLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  475

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGLVA EKLKHAAR+  L A+L
Sbjct  476   VGLVAMEKLKHAARRKHLDALL  497



>dbj|BAC99905.1| putative plastid RNA polymerase sigma factor [Oryza sativa Japonica 
Group]
Length=388

 Score =   429 bits (1103),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 266/322 (83%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             +  E +Q+  + Y++G VS+ELLTH +VV LS  IK G++L++Q+S+LKE+LG +PS +Q
Sbjct  64    VSPELIQSRNRIYLRGTVSKELLTHKQVVHLSHKIKDGIWLQQQRSKLKEKLGNEPSYKQ  123

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA SL+IS  +L+  M E  LARE L MSN+RLV+SIAQ+YDN+G E+ADLIQGGL+GLL
Sbjct  124   LAHSLKISPPELRSRMHESFLAREMLTMSNLRLVISIAQKYDNLGVELADLIQGGLIGLL  183

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL +NS   RLP +LH RL  IR A+ +L+D+
Sbjct  184   RGIEKFDASRGFRISTYVYWWIRQGVSRALAENSKTFRLPTYLHERLIAIRGAKYELEDQ  243

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GI P+I+ IA SLNIS+KKV NATEAV+KV SLD++AFPS++GLPGE+LHSYI D ++ N
Sbjct  244   GIAPTIENIAGSLNISEKKVLNATEAVNKVLSLDQQAFPSLNGLPGETLHSYIEDQNVAN  303

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVN L+++TL ERER+IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  304   DPWHGFEEWYLKEEVNKLLNSTLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  363

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGL+A EKLKHAAR+  L+A+L
Sbjct  364   VGLIAMEKLKHAARRKNLEALL  385



>gb|AAC78467.1| RNA polymerase sigma factor 1 [Zea mays]
Length=398

 Score =   429 bits (1103),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 263/322 (82%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             +  E +Q+  + Y++G VS++LLTH +VV+LS+ IK G++L+ Q+S+LKE+LG +PS +Q
Sbjct  74    VSPELMQSRNRIYLRGTVSKDLLTHKQVVQLSRKIKDGIWLQHQRSKLKEKLGNEPSYKQ  133

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA SLRI   +L+  M E  LARE LAMSN RLV+SIAQ+YDN+G E+ DLIQGGL+GLL
Sbjct  134   LAQSLRIPAPELRARMRESFLAREMLAMSNTRLVISIAQKYDNLGVELPDLIQGGLIGLL  193

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL  NS   RLP +LH RL  IR A+  L+D+
Sbjct  194   RGIEKFDASRGFRISTYVYWWIRQGVSRALADNSRSFRLPTYLHERLVAIRGAKYALEDQ  253

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GI P+++ IAESLNIS+KKV NATEAV KV SLD++AFPS++GLPG++LHSYI D ++ N
Sbjct  254   GIAPTVENIAESLNISEKKVHNATEAVHKVISLDQQAFPSLNGLPGDTLHSYIEDQNVAN  313

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVN+LI++TL ERER+IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  314   DPWHGFEERYLKEEVNSLINSTLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  373

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGLVA EKLKHAAR+  L A+L
Sbjct  374   VGLVAMEKLKHAARREHLDALL  395



>ref|XP_008678254.1| PREDICTED: RNA polymerase sigma factor sigA isoform X2 [Zea mays]
 gb|AFW61126.1| RNA polymerase sigma factor 2 [Zea mays]
Length=504

 Score =   433 bits (1113),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 264/322 (82%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             I  E +Q+  + Y++G VS++LLTH +V++LS+ IK G++L+ Q+S+LKE+LG +PS +Q
Sbjct  180   ISPELMQSRNRIYLRGTVSKDLLTHKQVIQLSRKIKDGIWLQHQRSKLKEKLGNEPSYKQ  239

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA SLRIS  +L+  M E  LARE L MSN+RLV+SIA +YDN+G ++ADLIQGGL+GLL
Sbjct  240   LAQSLRISAPELRARMRESFLAREMLTMSNIRLVISIAHKYDNLGVDLADLIQGGLIGLL  299

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL  NS   RLP +LH RL  IR A+  L+D+
Sbjct  300   RGIEKFDASRGFRISTYVYWWIRQGVSRALADNSKTFRLPTYLHERLIAIRGAKYALEDQ  359

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GI P+I+ IAESLNIS+KKV NATEAV+KV SLD++AFPS++GLPG++LHSYI D ++ N
Sbjct  360   GIAPTIENIAESLNISEKKVHNATEAVNKVLSLDQQAFPSLNGLPGDTLHSYIEDQNVAN  419

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVNNLI++ L ERER+IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  420   DPWHGFEEMYLKEEVNNLINSNLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  479

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGLVA EKLKHAAR+  L A+L
Sbjct  480   VGLVAMEKLKHAARRKHLDALL  501



>gb|EAZ41616.1| hypothetical protein OsJ_26150 [Oryza sativa Japonica Group]
Length=420

 Score =   429 bits (1103),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 266/322 (83%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             +  E +Q+  + Y++G VS+ELLTH +VV LS  IK G++L++Q+S+LKE+LG +PS +Q
Sbjct  96    VSPELIQSRNRIYLRGTVSKELLTHKQVVHLSHKIKDGIWLQQQRSKLKEKLGNEPSYKQ  155

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA SL+IS  +L+  M E  LARE L MSN+RLV+SIAQ+YDN+G E+ADLIQGGL+GLL
Sbjct  156   LAHSLKISPPELRSRMHESFLAREMLTMSNLRLVISIAQKYDNLGVELADLIQGGLIGLL  215

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL +NS   RLP +LH RL  IR A+ +L+D+
Sbjct  216   RGIEKFDASRGFRISTYVYWWIRQGVSRALAENSKTFRLPTYLHERLIAIRGAKYELEDQ  275

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GI P+I+ IA SLNIS+KKV NATEAV+KV SLD++AFPS++GLPGE+LHSYI D ++ N
Sbjct  276   GIAPTIENIAGSLNISEKKVLNATEAVNKVLSLDQQAFPSLNGLPGETLHSYIEDQNVAN  335

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVN L+++TL ERER+IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  336   DPWHGFEEWYLKEEVNKLLNSTLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  395

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGL+A EKLKHAAR+  L+A+L
Sbjct  396   VGLIAMEKLKHAARRKNLEALL  417



>emb|CAA74653.1| plastid RNA polymerase sigma factor [Sorghum bicolor]
Length=500

 Score =   431 bits (1109),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 202/322 (63%), Positives = 264/322 (82%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             +  E +Q+  + Y++G VS++LLTH +V++LS+ IK G++L+ Q+S+LKE+LG +PS +Q
Sbjct  176   VSPELMQSRNRIYLRGTVSKDLLTHKQVIQLSRKIKDGIWLQHQRSKLKEKLGNEPSYKQ  235

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA SL IS  +L+  M E  LARE L MSN+RLV+SIAQ+YDN+G E+ADLIQGGL+GLL
Sbjct  236   LAQSLHISPPELRARMRESFLAREMLTMSNIRLVISIAQKYDNLGVELADLIQGGLIGLL  295

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL  NS   RLP +LH RL  IR A+  L+D+
Sbjct  296   RGIEKFDASRGFRISTYVYWWIRQGVSRALADNSKAFRLPTYLHERLIAIRGAKYALEDQ  355

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GI P+++ IAESLNIS+KKV NATEAV+KV SLD++AFPS++GLPG++LHSYI D ++ N
Sbjct  356   GIAPTVENIAESLNISEKKVHNATEAVNKVLSLDQQAFPSLNGLPGDTLHSYIEDQNVAN  415

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVNNLI++ L ERER+IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  416   DPWHGFEERYLKEEVNNLINSNLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  475

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGLVA EKLKHAAR+  L A+L
Sbjct  476   VGLVAMEKLKHAARRKHLDALL  497



>gb|AAC78468.1| RNA polymerase sigma factor 2 [Zea mays]
Length=349

 Score =   426 bits (1094),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 202/322 (63%), Positives = 261/322 (81%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             I  E +Q+  + Y++G VS++LLTH +V++LS+ IK G++L+ Q+S+LKE+LG +PS +Q
Sbjct  25    ISPELMQSRNRIYLRGTVSKDLLTHKQVIQLSRKIKDGIWLQHQRSKLKEKLGNEPSYKQ  84

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA SLRIS  +L+  M E  LARE L MSN+RLV+SIA +YDN+G ++ADLIQGGL+GLL
Sbjct  85    LAQSLRISAPELRARMRESFLAREMLTMSNIRLVISIAHKYDNLGVDLADLIQGGLIGLL  144

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL  NS   RLP +LH RL  IR A+  L+D+
Sbjct  145   RGIEKFDASRGFRISTYVYWWIRQGVSRALADNSKTFRLPTYLHERLLAIRGAKYALEDQ  204

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GI P+I+ IAESLNIS KKV NATEAV KV SLD++AFPS++GLPG++LHSYI D ++ N
Sbjct  205   GIAPTIENIAESLNISVKKVHNATEAVHKVLSLDQQAFPSLNGLPGDTLHSYIEDQNVAN  264

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVNNLI++ L ERER+IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  265   DPWHGFEEMYLKEEVNNLINSNLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  324

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             V LVA EKLKHAAR+  L A+L
Sbjct  325   VRLVAMEKLKHAARRKHLNALL  346



>ref|NP_001061065.2| Os08g0163400 [Oryza sativa Japonica Group]
 dbj|BAF22979.2| Os08g0163400 [Oryza sativa Japonica Group]
Length=520

 Score =   430 bits (1106),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 266/322 (83%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             +  E +Q+  + Y++G VS+ELLTH +VV LS  IK G++L++Q+S+LKE+LG +PS +Q
Sbjct  196   VSPELIQSRNRIYLRGTVSKELLTHKQVVHLSHKIKDGIWLQQQRSKLKEKLGNEPSYKQ  255

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA SL+IS  +L+  M E  LARE L MSN+RLV+SIAQ+YDN+G E+ADLIQGGL+GLL
Sbjct  256   LAHSLKISPPELRSRMHESFLAREMLTMSNLRLVISIAQKYDNLGVELADLIQGGLIGLL  315

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL +NS   RLP +LH RL  IR A+ +L+D+
Sbjct  316   RGIEKFDASRGFRISTYVYWWIRQGVSRALAENSKTFRLPTYLHERLIAIRGAKYELEDQ  375

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GI P+I+ IA SLNIS+KKV NATEAV+KV SLD++AFPS++GLPGE+LHSYI D ++ N
Sbjct  376   GIAPTIENIAGSLNISEKKVLNATEAVNKVLSLDQQAFPSLNGLPGETLHSYIEDQNVAN  435

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVN L+++TL ERER+IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  436   DPWHGFEEWYLKEEVNKLLNSTLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  495

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGL+A EKLKHAAR+  L+A+L
Sbjct  496   VGLIAMEKLKHAARRKNLEALL  517



>dbj|BAA24364.1| plastid RNA polymerase sigma factor [Oryza sativa Japonica Group]
Length=519

 Score =   430 bits (1106),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 266/322 (83%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             +  E +Q+  + Y++G VS+ELLTH +VV LS  IK G++L++Q+S+LKE+LG +PS +Q
Sbjct  195   VSPELIQSRNRIYLRGTVSKELLTHKQVVHLSHKIKDGIWLQQQRSKLKEKLGNEPSYKQ  254

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA SL+IS  +L+  M E  LARE L MSN+RLV+SIAQ+YDN+G E+ADLIQGGL+GLL
Sbjct  255   LAHSLKISPPELRSRMHESFLAREMLTMSNLRLVISIAQKYDNLGVELADLIQGGLIGLL  314

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL +NS   RLP +LH RL  IR A+ +L+D+
Sbjct  315   RGIEKFDASRGFRISTYVYWWIRQGVSRALAENSKTFRLPTYLHERLIAIRGAKYELEDQ  374

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GI P+I+ IA SLNIS+KKV NATEAV+KV SLD++AFPS++GLPGE+LHSYI D ++ N
Sbjct  375   GIAPTIENIAGSLNISEKKVLNATEAVNKVLSLDQQAFPSLNGLPGETLHSYIEDQNVAN  434

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVN L+++TL ERER+IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  435   DPWHGFEEWYLKEEVNKLLNSTLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  494

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGL+A EKLKHAAR+  L+A+L
Sbjct  495   VGLIAMEKLKHAARRKNLEALL  516



>ref|XP_008678253.1| PREDICTED: RNA polymerase sigma factor sigA isoform X1 [Zea mays]
Length=509

 Score =   427 bits (1097),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 203/327 (62%), Positives = 264/327 (81%), Gaps = 5/327 (2%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             I  E +Q+  + Y++G VS++LLTH +V++LS+ IK G++L+ Q+S+LKE+LG +PS +Q
Sbjct  180   ISPELMQSRNRIYLRGTVSKDLLTHKQVIQLSRKIKDGIWLQHQRSKLKEKLGNEPSYKQ  239

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA SLRIS  +L+  M E  LARE L MSN+RLV+SIA +YDN+G ++ADLIQGGL+GLL
Sbjct  240   LAQSLRISAPELRARMRESFLAREMLTMSNIRLVISIAHKYDNLGVDLADLIQGGLIGLL  299

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL  NS   RLP +LH RL  IR A+  L+D+
Sbjct  300   RGIEKFDASRGFRISTYVYWWIRQGVSRALADNSKTFRLPTYLHERLIAIRGAKYALEDQ  359

Query  715   GITPSIDRIAESLNISKKKVTNATE-----AVSKVFSLDREAFPSIDGLPGESLHSYIAD  551
             GI P+I+ IAESLNIS+KKV NATE     AV+KV SLD++AFPS++GLPG++LHSYI D
Sbjct  360   GIAPTIENIAESLNISEKKVHNATENSRLQAVNKVLSLDQQAFPSLNGLPGDTLHSYIED  419

Query  550   SHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSR  371
              ++ N+PWH  +E  LK+EVNNLI++ L ERER+IIRLYHG+G +C TWEDIS++ GLSR
Sbjct  420   QNVANDPWHGFEEMYLKEEVNNLINSNLNERERDIIRLYHGIGKQCHTWEDISRQFGLSR  479

Query  370   ERVRQVGLVAFEKLKHAARKNRLKAML  290
             ERVRQVGLVA EKLKHAAR+  L A+L
Sbjct  480   ERVRQVGLVAMEKLKHAARRKHLDALL  506



>gb|KCW90985.1| hypothetical protein EUGRSUZ_A02994 [Eucalyptus grandis]
Length=492

 Score =   426 bits (1095),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 250/470 (53%), Positives = 320/470 (68%), Gaps = 49/470 (10%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSS---------------------------FYYSDFGEKLSCG  1706
             +M TA ++GLSAGKRLL S                            FY S      +  
Sbjct  3     LMATAAVIGLSAGKRLLSSPSSSSSSSSSASASSSSSSSDIPDNYKLFYVS------ASA  56

Query  1705  SDHTLPCHQVLSVNSTVMAKKSSNYSTSCVSNQRMHS-IKAIKEHVTVASNLFNMEPCVQ  1529
             SD      +V S  + V+ K+  N +    S+ R+ +  KA+ + +  +S   +++    
Sbjct  57    SD------RVSSTKNAVVPKRPPNSNPCFRSSHRLPTPAKALTQRLHPSSFPISLDSPED  110

Query  1528  RNKQLQKqsseeen--qledllllqkfmlekQWNLSAEKSTMTYTTMENNCKNIQVTCSG  1355
              +   +      E    +E LLLLQK MLE QW+L  E++ +  +  +   K I VTCSG
Sbjct  111   EDGHEEGAHHVPEFDCSVEALLLLQKSMLETQWSLCFERTVLADSAKDKPTKKIPVTCSG  170

Query  1354  TSArrrridtrrqiiqQKNSVAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGE  1175
              SAR+RR+ +       +  +      ++ RS +  + LQ+ L GYVKG+VS++LLTHGE
Sbjct  171   LSARQRRLGS-------RRRICSPVAGRQSRSAVSPDLLQHRLHGYVKGVVSDDLLTHGE  223

Query  1174  VVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLA  995
             VV LSK IK GL+LEE+KSRLKERLGC+PS+EQLA SLRISR +L+  +IE SLAREKLA
Sbjct  224   VVALSKKIKTGLFLEERKSRLKERLGCEPSDEQLATSLRISRAELRSRLIESSLAREKLA  283

Query  994   MSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGIS  815
             MSNVRLVMSIAQRYDNMGAEM+DL+QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+S
Sbjct  284   MSNVRLVMSIAQRYDNMGAEMSDLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVS  343

Query  814   RALVKNSSMLRLPKHLHGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAV  635
             RALV+NS  LRLP HLH RL LIRNA+ +L++KGITPS+DRIAE LN+S+KKV NATEA+
Sbjct  344   RALVENSRTLRLPAHLHERLGLIRNAKVRLEEKGITPSVDRIAECLNMSQKKVRNATEAI  403

Query  634   SKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDECALKDEVNN  485
              KVFSLDR+AFPS++GLPGE+ HSYIAD H+ENNPWH VDE ALK E+ +
Sbjct  404   GKVFSLDRDAFPSLNGLPGETHHSYIADIHVENNPWHGVDEWALKVELQS  453



>ref|XP_006659164.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase sigma factor sigA-like 
[Oryza brachyantha]
Length=521

 Score =   424 bits (1091),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/322 (62%), Positives = 265/322 (82%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             +  E +Q+  + Y++G VS+ELLTH +VV LS  IK G++L++Q+S+LKE+LG +PS +Q
Sbjct  197   VSPELMQSRNRIYLRGTVSKELLTHKQVVHLSNKIKDGIWLQQQRSKLKEKLGNEPSYKQ  256

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             LA SL+IS  +L+  M E  LARE L MSN+RLV+SIAQ+YDN+G E+ADLIQGGL+GLL
Sbjct  257   LAHSLKISPPELRSRMRESFLAREMLTMSNIRLVISIAQKYDNLGVELADLIQGGLIGLL  316

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL +NS   RLP +LH RL  IR+A+  L+D+
Sbjct  317   RGIEKFDASRGFRISTYVYWWIRQGVSRALAENSKTFRLPTYLHERLIAIRSAKYALEDQ  376

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             GI P+I+ IAESLNIS+KKV NAT AV+KV SLD++AFPS++GLPGE+LHSYI D ++ N
Sbjct  377   GIAPTIENIAESLNISEKKVHNATGAVNKVLSLDQQAFPSLNGLPGETLHSYIEDQNVAN  436

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PW+  +E  LK+EVN L+++TL ERER+IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  437   DPWYGFEEQYLKEEVNKLLNSTLNERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  496

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             +GL+A EKLKHAAR+  + A+L
Sbjct  497   LGLIAMEKLKHAARRKNMDALL  518



>ref|XP_003573435.1| PREDICTED: RNA polymerase sigma factor sigA [Brachypodium distachyon]
Length=531

 Score =   423 bits (1088),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 259/310 (84%), Gaps = 0/310 (0%)
 Frame = -1

Query  1219  YVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISRTDL  1040
             Y++G VS+ELLTH +VV+LSK IK G++L++Q+S+LKE+LG +PS +Q+A SLRIS  +L
Sbjct  219   YLRGSVSKELLTHKQVVQLSKKIKDGIWLQQQRSKLKEKLGNEPSYKQMAQSLRISTPEL  278

Query  1039  KLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGY  860
             +  M +  LARE L MSN+RLV+SIAQ+YD +G E+ DLIQGGL+GLLRGIEKFD S+G+
Sbjct  279   RSRMRDSFLAREVLTMSNLRLVISIAQKYDKLGVELPDLIQGGLIGLLRGIEKFDASRGF  338

Query  859   KLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDKGITPSIDRIAES  680
             ++STYVYWWIRQG+SRAL  NS   RLP +LH RL  IR A+  L+D+GI+P+ + IAES
Sbjct  339   RISTYVYWWIRQGVSRALADNSKTFRLPTYLHERLIAIRGAKYALEDQGISPTTENIAES  398

Query  679   LNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDECALK  500
             LNIS+KKV NAT+AV+KV SLDR+AFPS++GLPG++LHSYI D ++ N+PWH  ++  LK
Sbjct  399   LNISEKKVHNATDAVNKVLSLDRQAFPSLNGLPGDTLHSYIEDQNVANDPWHGFEQWYLK  458

Query  499   DEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQVGLVAFEKLKHA  320
             +EVN L+++TL ERER+IIRLYHG+G +C TWEDIS++ GLSRERVRQVGL+A +KLKHA
Sbjct  459   EEVNKLLNSTLTERERDIIRLYHGIGKQCHTWEDISRQFGLSRERVRQVGLIAMQKLKHA  518

Query  319   ARKNRLKAML  290
             AR+ +L A+L
Sbjct  519   ARRKKLDALL  528



>dbj|BAJ92935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=506

 Score =   419 bits (1077),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/322 (61%), Positives = 258/322 (80%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             I  E LQ+  + Y++G VS+ELLTH +VV LSK IK G++L++Q+S+L E LG +PS +Q
Sbjct  182   ISPELLQSRNRIYLRGTVSKELLTHKQVVHLSKKIKDGIWLQQQRSKLTEILGNEPSYKQ  241

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             +A SLRIS  +L+  M E  LARE L MSN+RLV+SIAQ+YD +G E++DLIQGGL+GLL
Sbjct  242   MAQSLRISTPELRSRMRESFLAREVLTMSNIRLVISIAQKYDKLGVELSDLIQGGLIGLL  301

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL  NS   RLP ++H RL  IR A+  L+D+
Sbjct  302   RGIEKFDASRGFRISTYVYWWIRQGVSRALADNSKTFRLPTYMHERLIAIRAAKYALEDQ  361

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             G++P+   IAE LNIS+KKV NATEAV+K  SLD++AFPS++GLPG++LHSYI D ++ N
Sbjct  362   GVSPTTQNIAELLNISEKKVHNATEAVNKALSLDQQAFPSLNGLPGDTLHSYIEDQNVAN  421

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVNNL+ + L ERER IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  422   DPWHGFEEWYLKEEVNNLLISNLTERERHIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  481

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGL+A EKLKHAAR+ +L A+L
Sbjct  482   VGLIAMEKLKHAARRKKLDALL  503



>gb|EMS46133.1| RNA polymerase sigma factor rpoD [Triticum urartu]
Length=508

 Score =   419 bits (1076),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 196/322 (61%), Positives = 261/322 (81%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             I  E LQ+  + Y++G VS+ELLTH +VV LSK IK G++L++Q+S+LKE+LG +PS +Q
Sbjct  184   ISPELLQSRNRIYLRGTVSKELLTHKQVVHLSKKIKDGIWLQQQRSKLKEKLGNEPSYKQ  243

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             +A SLRIS  +L+  M E  LARE L MSN+RLV+SIAQ+YD +G E++DLIQGGL+GLL
Sbjct  244   MAQSLRISTPELRSRMRESFLAREVLTMSNIRLVISIAQKYDKLGVELSDLIQGGLIGLL  303

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL  NS   RLP +LH RL  IR A+  L+D+
Sbjct  304   RGIEKFDASRGFRISTYVYWWIRQGVSRALADNSKTFRLPTYLHERLIAIRGAKYALEDQ  363

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             G++P+   IA+ LNIS+KKV NAT+AV+K  SLD++AFPS++GLPG++LHSYI D ++ N
Sbjct  364   GVSPTTQNIAKLLNISEKKVHNATQAVNKALSLDQQAFPSLNGLPGDTLHSYIEDQNVAN  423

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVN L+++ L ERER+II+LYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  424   DPWHGFEEWYLKEEVNKLLNSNLTERERDIIQLYHGIGKQCHTWEDISRQFGLSRERVRQ  483

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGL+A EKLKHAAR+ +L A+L
Sbjct  484   VGLIAMEKLKHAARRKKLDALL  505



>dbj|BAJ99592.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=506

 Score =   419 bits (1076),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 198/322 (61%), Positives = 258/322 (80%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             I  E LQ+  + Y++G VS+ELLTH +VV LSK IK G++L++Q+S+L E LG +PS +Q
Sbjct  182   ISPELLQSRNRIYLRGTVSKELLTHKQVVHLSKKIKDGIWLQQQRSKLTEILGNEPSYKQ  241

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             +A SLRIS  +L+  M E  LARE L MSN+RLV+SIAQ+YD +G E++DLIQGGL+GLL
Sbjct  242   MAQSLRISTPELRSRMRESFLAREVLTMSNIRLVISIAQKYDKLGVELSDLIQGGLIGLL  301

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL  NS   RLP ++H RL  IR A+  L+D+
Sbjct  302   RGIEKFDASRGFRISTYVYWWIRQGVSRALADNSRTFRLPTYMHERLIAIRAAKYALEDQ  361

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             G++P+   IAE LNIS+KKV NATEAV+K  SLD++AFPS++GLPG++LHSYI D ++ N
Sbjct  362   GVSPTTQNIAELLNISEKKVHNATEAVNKALSLDQQAFPSLNGLPGDTLHSYIEDQNVAN  421

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVNNL+ + L ERER IIRLYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  422   DPWHGFEEWYLKEEVNNLLISNLTERERHIIRLYHGIGKQCHTWEDISRQFGLSRERVRQ  481

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGL+A EKLKHAAR+ +L A+L
Sbjct  482   VGLIAMEKLKHAARRKKLDALL  503



>emb|CAA10725.1| chloroplast sigma factor [Triticum aestivum]
Length=461

 Score =   411 bits (1056),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 194/322 (60%), Positives = 258/322 (80%), Gaps = 0/322 (0%)
 Frame = -1

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             I  E LQ+  + Y++G VS+ELLT  +VV LSK IK G++L++Q+S+LKE+LG +PS +Q
Sbjct  137   ISPELLQSRNRIYLRGTVSKELLTQKQVVHLSKKIKDGIWLQQQRSKLKEKLGNEPSYKQ  196

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
             +A SLRIS  +L+  M E  LARE L MSN+RLV+SIAQ+YD +G E++DLIQGGL+GLL
Sbjct  197   MAQSLRISTPELRSRMRESFLAREVLTMSNIRLVISIAQKYDKLGVELSDLIQGGLIGLL  256

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK  716
             RGIEKFD S+G+++STYVYWWIRQG+SRAL  NS   RLP +LH RL  IR A+  L+D+
Sbjct  257   RGIEKFDASRGFRISTYVYWWIRQGVSRALADNSKTFRLPTYLHERLIAIRGAKYALEDQ  316

Query  715   GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN  536
             G++P+   IA+ LNIS+KKV NATEAV+K  SLD++AFPS++GLPG++LHSYI D ++ N
Sbjct  317   GVSPTTQNIAKLLNISEKKVHNATEAVNKALSLDQQAFPSLNGLPGDTLHSYIEDQNVAN  376

Query  535   NPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWEDISKRIGLSRERVRQ  356
             +PWH  +E  LK+EVN L+++ L ERER+II+LYHG+G +C TWEDIS++ GLSRERVRQ
Sbjct  377   DPWHGFEEWYLKEEVNKLLNSNLTERERDIIQLYHGIGKQCHTWEDISRQFGLSRERVRQ  436

Query  355   VGLVAFEKLKHAARKNRLKAML  290
             VGL+A EKLK  AR+ +L A+L
Sbjct  437   VGLIAMEKLKQRARRKKLDALL  458



>gb|EMT32448.1| RNA polymerase sigma factor rpoD [Aegilops tauschii]
Length=388

 Score =   379 bits (972),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/276 (63%), Positives = 226/276 (82%), Gaps = 0/276 (0%)
 Frame = -1

Query  1117  RLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGA  938
             RLKE+LG +PS +Q+A SLRIS  +L+  M E  LARE L MSN+RLV+SIAQ+YD +G 
Sbjct  110   RLKEKLGNEPSYKQMAQSLRISTPELRSRMRESFLAREVLTMSNIRLVISIAQKYDKLGV  169

Query  937   EMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGR  758
             E++DLIQGGL+GLLRGIEKFD S+G+++STYVYWWIRQG+SRAL  NS   RLP +LH R
Sbjct  170   ELSDLIQGGLIGLLRGIEKFDASRGFRISTYVYWWIRQGVSRALADNSKTFRLPTYLHER  229

Query  757   LSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPG  578
             L  IR A+  L+D+G++P+   IA+ LNIS+KKV NATEAV+K  SLD++AFPS++GLPG
Sbjct  230   LIAIRGAKYALEDQGVSPTTQNIAKLLNISEKKVHNATEAVNKALSLDQQAFPSLNGLPG  289

Query  577   ESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECLTWED  398
             ++LHSYI D ++ N+PWH  +E  LK+EVN L+++ L ERER+II+LYHG+G +C TWED
Sbjct  290   DTLHSYIEDQNVANDPWHGFEEWYLKEEVNKLLNSNLTERERDIIQLYHGIGKQCHTWED  349

Query  397   ISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAML  290
             IS++ GLSRERVRQVGL+A EKLKHAAR+ +L A+L
Sbjct  350   ISRQFGLSRERVRQVGLIAMEKLKHAARRKKLDALL  385



>ref|XP_006302141.1| hypothetical protein CARUB_v10020145mg [Capsella rubella]
 ref|XP_006302142.1| hypothetical protein CARUB_v10020145mg [Capsella rubella]
 gb|EOA35039.1| hypothetical protein CARUB_v10020145mg [Capsella rubella]
 gb|EOA35040.1| hypothetical protein CARUB_v10020145mg [Capsella rubella]
Length=464

 Score =   366 bits (940),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 222/411 (54%), Positives = 295/411 (72%), Gaps = 18/411 (4%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GL+ GKRLL SSFY+SD  EK    +DH    + + S  S + AKK+S+ S 
Sbjct  1     MMATAAVIGLNTGKRLLSSSFYHSDVTEKFLSVNDHCSSQYHIASTKSGITAKKASSSSN  60

Query  1624  SCVS----NQRMHSIKAIKEHVTVASNLFNMEPCVQR--NKQLQKqsseeen----qled  1475
                S    N+   S KA+ E V V ++    +P V    +K+ ++   +++      +E 
Sbjct  61    YSPSFPSSNRHTQSAKAVTESVDVVAS--TEQPWVPNVTDKEFEEGGYDDDVLIGHSVEA  118

Query  1474  llllqkfmlekQWNLSAEKSTMTYTTMENNCKNIQV---TCSGTSArrrri-dtrrqiiq  1307
             LLLLQK MLEK WNLS EK+  + ++ +   +  +V   TCSG SAR+RRI   ++  + 
Sbjct  119   LLLLQKSMLEKSWNLSFEKAASSESSGKRTIRKKKVPVITCSGISARQRRIGAKKKTNMT  178

Query  1306  QKNSVAKIDTSKRVRSIIGMEQLQ-NSLKG-YVKGIVSEELLTHGEVVELSKMIKLGLYL  1133
                +V+ + + K+VRS++  E  Q N ++G YVKG++SE++L+H EVV LSK IK GL L
Sbjct  179   SAKAVSDVSSGKQVRSVMSSELFQHNRVRGGYVKGVISEDVLSHTEVVRLSKKIKSGLRL  238

Query  1132  EEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRY  953
             ++ KSRLK+RLGC+PS+EQLA+SL+ISR +L+  ++EC LAREKLAMSNVRLVMSIAQRY
Sbjct  239   DDHKSRLKDRLGCEPSDEQLAISLKISRAELQAWLMECHLAREKLAMSNVRLVMSIAQRY  298

Query  952   DNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPK  773
             DN+GAEM+DL+QGGL+GLLRGIEKFD SKG+++STYVYWWIRQG+SRALV NS  LRLP 
Sbjct  299   DNLGAEMSDLVQGGLIGLLRGIEKFDSSKGFRISTYVYWWIRQGVSRALVDNSRTLRLPT  358

Query  772   HLHGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFS  620
             HLH RL LIRNA+ +L++KGITPSIDRIAESLN+S+KKV NATE     FS
Sbjct  359   HLHERLGLIRNAKLRLQEKGITPSIDRIAESLNMSQKKVRNATEVKKSNFS  409



>gb|KCW90984.1| hypothetical protein EUGRSUZ_A02994 [Eucalyptus grandis]
Length=465

 Score =   364 bits (934),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 226/458 (49%), Positives = 292/458 (64%), Gaps = 52/458 (11%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYS---------------DFGEKLSCGSDHTLPCHQVLS  1670
             +M TA ++GLSAGKRLL S    S               D  +             +V S
Sbjct  3     LMATAAVIGLSAGKRLLSSPSSSSSSSSSASASSSSSSSDIPDNYKLFYVSASASDRVSS  62

Query  1669  VNSTVMAKKSSNYSTSCVSNQRMHS-IKAIKEHVTVASNLFNMEPCVQRNKQLQKqssee  1493
               + V+ K+  N +    S+ R+ +  KA+ + +  +S   +++     +   +      
Sbjct  63    TKNAVVPKRPPNSNPCFRSSHRLPTPAKALTQRLHPSSFPISLDSPEDEDGHEEGAHHVP  122

Query  1492  en--qledllllqkfmlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrr  1319
             E    +E LLLLQK MLE QW+L  E++ +  +  +   K I VTCSG SAR+RR+ +  
Sbjct  123   EFDCSVEALLLLQKSMLETQWSLCFERTVLADSAKDKPTKKIPVTCSGLSARQRRLGS--  180

Query  1318  qiiqQKNSVAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGL  1139
                  +  +      ++ RS +  + LQ+ L GYVKG+VS++LLTHGEVV LSK IK GL
Sbjct  181   -----RRRICSPVAGRQSRSAVSPDLLQHRLHGYVKGVVSDDLLTHGEVVALSKKIKTGL  235

Query  1138  YLEEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQ  959
             +LEE+KSRLKERLGC+PS+EQLA SLRISR +L+  +IE SLAREKLAMSNVRLVMSIAQ
Sbjct  236   FLEERKSRLKERLGCEPSDEQLATSLRISRAELRSRLIESSLAREKLAMSNVRLVMSIAQ  295

Query  958   RYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRL  779
             RYDNMGAEM+DL+QGGL+GLLRGIEKFD SKG+K+STYVYWWIRQG+SRALV+NS  LRL
Sbjct  296   RYDNMGAEMSDLVQGGLIGLLRGIEKFDSSKGFKISTYVYWWIRQGVSRALVENSRTLRL  355

Query  778   PKHLHGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFP  599
             P HLH RL LIRNA+ +L++KGITPS+DRIAE LN+S+KKV NATEA+            
Sbjct  356   PAHLHERLGLIRNAKVRLEEKGITPSVDRIAECLNMSQKKVRNATEAI------------  403

Query  598   SIDGLPGESLHSYIADSHLENNPWHRVDECALKDEVNN  485
                            D H+ENNPWH VDE ALK E+ +
Sbjct  404   ---------------DIHVENNPWHGVDEWALKVELQS  426



>gb|KDO48038.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=330

 Score =   337 bits (864),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 201/332 (61%), Positives = 252/332 (76%), Gaps = 4/332 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLSAGKRLL SSFYYSD  EK S  +D      QV S  + V AKKSSNY+ 
Sbjct  1     MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNP  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllllqkfm  1451
             S  S N++   IKA+KEHV   +N  +  EP  +    ++++SSE +  +E LLLLQK M
Sbjct  61    SFPSSNRQTQPIKALKEHVD--TNFASTAEPWAEPPNSIEEESSELDYSVEALLLLQKSM  118

Query  1450  lekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSK  1271
             LEKQWNLS E++ +T +  +   K + VTCSG SAR+RR++++++I+ Q  S+ + + SK
Sbjct  119   LEKQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSILQQNGSK  178

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
             ++RS+I  E +QN LKGYVKG+VSEELLTH EVV LSK IK GL L++ K RLKERLGC+
Sbjct  179   QLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCE  238

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGG  911
             PS EQLA SLRISR +L+  ++ECSLAREKL MSNVRLVMSIAQRYDNMGA+MADL+QGG
Sbjct  239   PSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQGG  298

Query  910   LVGLLRGIEKFDPSKGYKLSTYVYWWIRQGIS  815
             L+GLLRGIEKFD SKG+K+STYVYWWIRQ IS
Sbjct  299   LIGLLRGIEKFDSSKGFKISTYVYWWIRQSIS  330



>gb|KDO48039.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=391

 Score =   333 bits (854),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 200/330 (61%), Positives = 249/330 (75%), Gaps = 6/330 (2%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLSAGKRLL SSFYYSD  EK S  +D      QV S  + V AKKSSNY+ 
Sbjct  1     MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNP  60

Query  1624  SCVS-NQRMHSIKAIKEHV--TVASNLFNMEPCVQRNKQLQKqsseeenqledllllqkf  1454
             S  S N++   IKA+KEHV    AS     EP  +    ++++SSE +  +E LLLLQK 
Sbjct  61    SFPSSNRQTQPIKALKEHVDTNFAST---AEPWAEPPNSIEEESSELDYSVEALLLLQKS  117

Query  1453  mlekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTS  1274
             MLEKQWNLS E++ +T +  +   K + VTCSG SAR+RR++++++I+ Q  S+ + + S
Sbjct  118   MLEKQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSILQQNGS  177

Query  1273  KRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGC  1094
             K++RS+I  E +QN LKGYVKG+VSEELLTH EVV LSK IK GL L++ K RLKERLGC
Sbjct  178   KQLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGC  237

Query  1093  DPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQG  914
             +PS EQLA SLRISR +L+  ++ECSLAREKL MSNVRLVMSIAQRYDNMGA+MADL+QG
Sbjct  238   EPSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQG  297

Query  913   GLVGLLRGIEKFDPSKGYKLSTYVYWWIRQ  824
             GL+GLLRGIEKFD SKG+K+STYVYWWIRQ
Sbjct  298   GLIGLLRGIEKFDSSKGFKISTYVYWWIRQ  327



>gb|KDO48040.1| hypothetical protein CISIN_1g010521mg [Citrus sinensis]
Length=301

 Score =   270 bits (689),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 172/298 (58%), Positives = 220/298 (74%), Gaps = 4/298 (1%)
 Frame = -1

Query  1804  MMVTATIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYST  1625
             MM TA ++GLSAGKRLL SSFYYSD  EK S  +D      QV S  + V AKKSSNY+ 
Sbjct  1     MMATAAVIGLSAGKRLLSSSFYYSDISEKFSYINDLGSANSQVGSTKNVVAAKKSSNYNP  60

Query  1624  SCVS-NQRMHSIKAIKEHVTVASNLFNM-EPCVQRNKQLQKqsseeenqledllllqkfm  1451
             S  S N++   IKA+KEHV   +N  +  EP  +    ++++SSE +  +E LLLLQK M
Sbjct  61    SFPSSNRQTQPIKALKEHVD--TNFASTAEPWAEPPNSIEEESSELDYSVEALLLLQKSM  118

Query  1450  lekQWNLSAEKSTMTYTTMENNCKNIQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSK  1271
             LEKQWNLS E++ +T +  +   K + VTCSG SAR+RR++++++I+ Q  S+ + + SK
Sbjct  119   LEKQWNLSFERTVLTDSPSKKTHKKVPVTCSGVSARQRRLNSKKKILSQNKSILQQNGSK  178

Query  1270  RVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCD  1091
             ++RS+I  E +QN LKGYVKG+VSEELLTH EVV LSK IK GL L++ K RLKERLGC+
Sbjct  179   QLRSMISPELIQNRLKGYVKGVVSEELLTHAEVVRLSKKIKTGLSLDDHKLRLKERLGCE  238

Query  1090  PSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQ  917
             PS EQLA SLRISR +L+  ++ECSLAREKL MSNVRLVMSIAQRYDNMGA+MADL+Q
Sbjct  239   PSMEQLAASLRISRPELQSILMECSLAREKLVMSNVRLVMSIAQRYDNMGADMADLVQ  296



>gb|AEO45243.1| sigma factor [Nicotiana tabacum]
Length=264

 Score =   265 bits (677),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 169/267 (63%), Positives = 202/267 (76%), Gaps = 7/267 (3%)
 Frame = -1

Query  1789  TIVGLSAGKRLLCSSFYYSDFGEKLSCGSDHTLPCHQVLSVNSTVMAKKSSNYSTSCVSN  1610
              I+GLSAG R+L SSFYYSD  EK  C SDH LPCH   S  + + AK SSNYS S VSN
Sbjct  3     AIIGLSAGNRILSSSFYYSDLTEKF-CVSDHALPCHHFPSPKNVINAKNSSNYSPSYVSN  61

Query  1609  QRMHSIKAIKEHVTVASNL-FNMEPCVQRNKQLQKqsseeenqledllllqkfmlekQWN  1433
             ++  S+KA+KEHV +ASN   + EP VQ  KQLQ  S  EE+ +E LLLLQK MLEKQWN
Sbjct  62    RKKQSVKALKEHVDIASNRDSDTEPWVQMFKQLQNGSCSEEDSVEVLLLLQKSMLEKQWN  121

Query  1432  LSAEKSTMTYTTMENNCKN-IQVTCSGTSArrrridtrrqiiqQKNSVAKIDTSKRVRSI  1256
             LSAEK+     T ENNCK  +Q TCSGTSARRRR+DTR++ +  KNS     ++KR+RS+
Sbjct  122   LSAEKAM----TNENNCKKKMQTTCSGTSARRRRMDTRKRDLLPKNSATSDSSNKRLRSV  177

Query  1255  IGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             IG E LQN  KGY+ G+V +ELLTH EVV+LSK IK GLYLEEQKSRLKERLGC+PS++Q
Sbjct  178   IGPELLQNRSKGYINGVVGQELLTHTEVVQLSKKIKFGLYLEEQKSRLKERLGCEPSDDQ  237

Query  1075  LAVSLRISRTDLKLTMIECSLAREKLA  995
             LA+SL+ISR DL+  +IECSLAREKLA
Sbjct  238   LAISLKISRADLRSILIECSLAREKLA  264



>ref|XP_001770550.1| plastid sigma factor SIG1 [Physcomitrella patens]
 dbj|BAB62006.1| PpSIG1 [Physcomitrella patens]
 dbj|BAB62007.1| PpSIG1 [Physcomitrella patens]
 gb|EDQ64719.1| plastid sigma factor SIG1 [Physcomitrella patens]
Length=677

 Score =   268 bits (685),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 144/341 (42%), Positives = 218/341 (64%), Gaps = 5/341 (1%)
 Frame = -1

Query  1300  NSVAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQK  1121
             + + K    +RVR +   + +Q+ L  Y++ I    LLT  E V LSK +++GL L E++
Sbjct  334   HPLKKYQKGERVRRV-KFDGVQDYLTTYLREITKINLLTKQEEVFLSKKLRIGLNLLEER  392

Query  1120  SRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMG  941
              +L   LG  PS E+ A  + +S  DL   + E   AR+K+ M+N+RLV+S+A++Y + G
Sbjct  393   KKLAAELGYVPSNEEWAPHMNLSVGDLVRKLGEAEWARDKMVMANLRLVVSVAKQYHSFG  452

Query  940   AEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHG  761
              EMADLIQ G +GLLRG+EKFD ++GYKLSTYV+WWIRQG++RA+  +S  +RLP H+H 
Sbjct  453   LEMADLIQEGSIGLLRGVEKFDHTRGYKLSTYVHWWIRQGVTRAIADHSRTVRLPVHVHD  512

Query  760   RLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDRE-AFPSIDGL  584
              L  IR A++ L  +G T S+  I+E+ N++  K+ N  +   K+ SLD+E    ++   
Sbjct  513   TLGRIRKAKSTLLSEGCTASVQEISEATNLTGTKIKNTLQVTKKLVSLDKEIGRNTLQSG  572

Query  583   PGESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNE---C  413
              GE+LHS +AD  +EN PW  V+   +KD+V+ L+ + L  RER+I+RL++G+G E    
Sbjct  573   DGETLHSLVADRDIENQPWTIVERMLMKDDVDKLLTSQLGPRERDIVRLHYGVGREDGSV  632

Query  412   LTWEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAML  290
             ++ E IS R G+SRERVRQ+   A  KL+  +R+  L   L
Sbjct  633   MSLESISYRYGVSRERVRQLETAAMRKLQIKSREQGLDRYL  673



>dbj|BAM45408.1| sigma factor 1 [Marchantia polymorpha]
 dbj|BAM95330.1| plastid RNA polymerase sigma factor 1 [Marchantia polymorpha]
Length=574

 Score =   231 bits (588),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/326 (38%), Positives = 204/326 (63%), Gaps = 5/326 (2%)
 Frame = -1

Query  1288  KIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLK  1109
             K ++S +       E +Q+ L  Y++ I   + LT  E + LSK I+ G  L+E++ + +
Sbjct  235   KTESSSKADKAKKPEGVQDYLSTYLRDITKIDRLTAEEEIMLSKKIRTGYILKEERKKFE  294

Query  1108  ERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMA  929
               LG   +++Q A  + ++  DL   + E  LAR+++ M+N+RLV+S+ ++Y+  G E+ 
Sbjct  295   RALGHPITKDQWAGHMHMAVGDLDAQLHEAELARDRMVMANLRLVVSVVKQYNCEGLEVP  354

Query  928   DLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSL  749
             DLIQ G +GLL+G+EKFD ++GYKLSTYV+WWIRQG++RA+  +S  +RLP H+H  L  
Sbjct  355   DLIQEGSIGLLKGVEKFDHTRGYKLSTYVHWWIRQGVTRAIADHSRTVRLPVHVHDTLGR  414

Query  748   IRNAETKLKDKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPG--E  575
             IR    ++   G   ++  ++++LN+S  +V NA +   K+ SLD +       L G  E
Sbjct  415   IRRTRARMLQDGAPATVQTLSKALNLSDNQVKNALKVPKKLKSLDMQVGHQKSVLTGDTE  474

Query  574   SLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGN---ECLTW  404
             + HS +AD   EN+PW  V++  +K++V+ +++T L  REREII++++G+ +     ++ 
Sbjct  475   TFHSLVADQDSENHPWAVVEKAHMKEDVDKMLNTQLGSREREIIKMHYGVDSVDGYPMSL  534

Query  403   EDISKRIGLSRERVRQVGLVAFEKLK  326
             E IS R G+SRERVRQ+   A  KL+
Sbjct  535   ESISHRYGVSRERVRQLERAAKRKLQ  560



>ref|XP_010094612.1| RNA polymerase sigma factor rpoD [Morus notabilis]
 gb|EXB56431.1| RNA polymerase sigma factor rpoD [Morus notabilis]
Length=176

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 116/145 (80%), Gaps = 7/145 (5%)
 Frame = -1

Query  823  GISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDKGITPSIDRIAESLNISKKKVTNAT  644
            G+ RALV+NS  LRLP HLH RLS IRNA+ +L++KGITPSIDRIAE LN+SKKKV NAT
Sbjct  24   GVLRALVENSRTLRLPTHLHERLSTIRNAKNRLQEKGITPSIDRIAECLNMSKKKVRNAT  83

Query  643  EAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDECALK-------DEVNN  485
            EA+ KV SL+REAFPS++GLPGE+ HSY+AD+  E+ PWH VDE  LK       +EVN 
Sbjct  84   EAIRKVLSLNREAFPSLNGLPGETHHSYVADNCAEDIPWHGVDEWVLKLSKVRVQEEVNK  143

Query  484  LIHTTLKEREREIIRLYHGLGNECL  410
            LI TTL ERER+II+LY+GL NECL
Sbjct  144  LISTTLGERERDIIQLYYGLDNECL  168



>gb|AGW24512.1| putative RNA polymerase sigma-C factor, partial [Avicennia marina 
var. marina]
Length=103

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = -1

Query  1006  EKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIR  827
             EKLAMSN+RLVMSIAQR++NMG EMADLIQGGL+GLLRGIEKFD SKG+K+STYVYWWIR
Sbjct  1     EKLAMSNIRLVMSIAQRFNNMGVEMADLIQGGLIGLLRGIEKFDSSKGFKISTYVYWWIR  60

Query  826   QGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDKGITPSI  698
             QG+SRALV+NS MLRLP H+H RL+LIRNA+ +L++KGITPS+
Sbjct  61    QGVSRALVENSRMLRLPTHIHERLTLIRNAKARLEEKGITPSV  103



>ref|WP_036477198.1| RNA polymerase sigma factor [Myxosarcina sp. GI1]
Length=370

 Score =   187 bits (474),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 115/320 (36%), Positives = 183/320 (57%), Gaps = 8/320 (3%)
 Frame = -1

Query  1240  LQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSL  1061
             L++++  + K +    LLT  E + L+  +K+ + +E  + +LK++L  +PS  +L+ +L
Sbjct  55    LEDNIGAFFKEMARYPLLTAEEEIHLANDVKMMVKVEATRQQLKKQLDRNPSTTELSQAL  114

Query  1060  RI-SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIE  884
              + S   LKL +    +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  E
Sbjct  115   TLESERQLKLILYRGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAIGLNRATE  174

Query  883   KFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GIT  707
             KFDP+KGYK STY YWWIRQ I+R +  ++  +RLP H+  +L+ ++ A+  LK +    
Sbjct  175   KFDPNKGYKFSTYAYWWIRQAITRTIANDARTIRLPIHIVEKLNKLKKAQRHLKQQLQRN  234

Query  706   PSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPW  527
             P+   +AE L IS  ++    E   +  SL+     + D      L   + DS L+  P 
Sbjct  235   PNETELAEELKISLSQLRQLLELRRQSLSLNHRVGKAEDT----ELVDLLEDSELQ-LPE  289

Query  526   HRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNE-CLTWEDISKRIGLSRERVRQVG  350
              R+ E  ++ E+ ++++  L ERE+++I L +GL N+   T E++ K   LSRERVRQ+ 
Sbjct  290   ERMSESMMRQEITDVLNDVLTEREKDVICLRYGLTNDRSYTLEEVGKVFNLSRERVRQIQ  349

Query  349   LVAFEKLKHAARKNRLKAML  290
               A  KL+      RLK  L
Sbjct  350   SKAMRKLRRPQVARRLKGWL  369



>ref|WP_002802747.1| RNA polymerase sigma factor [Microcystis aeruginosa]
 emb|CCI37274.1| RNA polymerase sigma factor rpoD3 [Microcystis aeruginosa PCC 
9701]
Length=318

 Score =   185 bits (469),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 112/307 (36%), Positives = 182/307 (59%), Gaps = 9/307 (3%)
 Frame = -1

Query  1240  LQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSL  1061
             L + ++ Y++ I    LLTH E +  +K ++  ++LE+ K  LK +LG DPS+ Q + + 
Sbjct  7     LTDPVRAYLREIGRVPLLTHEEEILYAKQVQRLIFLEKIKESLKAKLGSDPSDRQWSEAA  66

Query  1060  RISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEK  881
              IS   L+  +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EK
Sbjct  67    EISEEQLRRELGAGDFAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEK  126

Query  880   FDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITP  704
             FDP+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L +DKG   
Sbjct  127   FDPTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLAQDKGRAA  186

Query  703   SIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWH  524
             +I  +AE L+++ K+V +  E   +  SLD +   + D   GE L     D+ L  +P  
Sbjct  187   TIAELAEELDLTPKQVRDYLERSRQPLSLDLKVGDNQDTELGELLE----DTGL--SPED  240

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGL  347
                  +L+ ++  L+   L  +++E+I L  GL N + LT   I  R+ +SRERVRQ+  
Sbjct  241   YTAYSSLQVDLEKLM-ADLTPQQKEVICLRFGLDNGQPLTLAKIGVRLNISRERVRQIER  299

Query  346   VAFEKLK  326
              A  KL+
Sbjct  300   EAIAKLR  306



>dbj|GAL91301.1| cyanobacteria-specific RpoD-like sigma factor, type-2 [Microcystis 
aeruginosa NIES-44]
Length=318

 Score =   184 bits (468),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 111/307 (36%), Positives = 181/307 (59%), Gaps = 9/307 (3%)
 Frame = -1

Query  1240  LQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSL  1061
             L + ++ Y++ I    LL+H E +  +K ++  ++LE+ K  LK +LG DPS+ Q + + 
Sbjct  7     LTDPVRAYLREIGRVPLLSHEEEILYAKQVQRLIFLEKIKESLKAKLGSDPSDRQWSEAA  66

Query  1060  RISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEK  881
              IS   L+  +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EK
Sbjct  67    EISEEQLRRELGAGDFAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEK  126

Query  880   FDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITP  704
             FDP+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L +DKG   
Sbjct  127   FDPTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLAQDKGRAA  186

Query  703   SIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWH  524
             +I  +AE L+++ K+V +  E   +  SLD +   + D   GE L     D  L  +P  
Sbjct  187   TIAELAEELDLTPKQVRDYLERARQPLSLDLKVGDNQDTELGELLE----DKGL--SPED  240

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGL  347
                  +L+ ++  L+   L  +++E+I L  GL N + LT   I  R+ +SRERVRQ+  
Sbjct  241   YTAYSSLQVDLEKLM-ADLTPQQKEVISLRFGLDNGQPLTLAKIGVRLNISRERVRQIER  299

Query  346   VAFEKLK  326
              A  KL+
Sbjct  300   EAIAKLR  306



>ref|WP_012267117.1| RNA polymerase sigma factor [Microcystis aeruginosa]
 ref|YP_001659539.1| RNA polymerase sigma factor SigD [Microcystis aeruginosa NIES-843]
 dbj|BAG04347.1| group 2 RNA polymerase sigma factor [Microcystis aeruginosa NIES-843]
Length=318

 Score =   183 bits (464),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 114/318 (36%), Positives = 186/318 (58%), Gaps = 11/318 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             + ++ Y++ I    LLTH E +  +K ++  ++LE+ K  LK +LG DPS+ Q + +  I
Sbjct  9     DPVRAYLREIGRVPLLTHEEEILYAKQVQRLIFLEKIKESLKVKLGSDPSDRQWSEAAEI  68

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  69    SEEQLRRELGAGDFAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFD  128

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L +DKG   +I
Sbjct  129   PTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLAQDKGRAATI  188

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L+++ K+V +  E   +  SLD +   + D   GE L     D+ L  +P    
Sbjct  189   AELAEELDLTPKQVRDYLERSRQPLSLDLKVGDNQDTELGELLE----DTGL--SPEDYT  242

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++  L+   L  +++E+I L  GL N + LT   I  R+ +SRERVRQ+   A
Sbjct  243   AYSSLQVDLEKLM-ADLTPQQKEVICLRFGLDNGQPLTLAKIGVRLNISRERVRQIEREA  301

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+   RK  ++  L 
Sbjct  302   IAKLRK--RKGNIREYLA  317



>ref|WP_002748320.1| RNA polymerase sigma factor rpoD2 [Microcystis aeruginosa]
 emb|CAO88820.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS45425.1| RNA polymerase sigma factor rpoD2 [Microcystis aeruginosa DIANCHI905]
Length=318

 Score =   182 bits (462),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 187/318 (59%), Gaps = 11/318 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             + ++ Y++ I    LL+H E +  +K ++  ++LE+ K  L+ +LG DPS+ Q + +  I
Sbjct  9     DPVRAYLREIGRVPLLSHEEEILYAKQVQRLIFLEKIKESLRAKLGSDPSDRQWSEAAEI  68

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  69    SEEQLRRELGAGDFAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFD  128

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L +DKG   +I
Sbjct  129   PTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLAQDKGRAATI  188

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L+++ K+V +  E   +  SLD +   + D   GE L     D+ L  +P    
Sbjct  189   AELAEELDLTPKQVRDYLERSRQPLSLDLKVGDNQDTELGELLE----DTGL--SPEDYT  242

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++  L+   L  +++E+I L  GL N + LT   I  R+ +SRERVRQ+   A
Sbjct  243   AHSSLQVDLEKLM-ADLTPQQKEVICLRFGLDNGQPLTLAKIGVRLNISRERVRQIEREA  301

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+   RK +++  L 
Sbjct  302   IAKLRK--RKAKIREYLA  317



>ref|WP_004161486.1| RNA polymerase sigma factor [Microcystis aeruginosa]
 emb|CCI17345.1| RNA polymerase sigma factor rpoD3 [Microcystis aeruginosa PCC 
9807]
Length=318

 Score =   182 bits (462),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 109/305 (36%), Positives = 181/305 (59%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             + ++ Y++ I    LL+H E +  +K ++  ++LE+ K  L+ +LG DPS+ Q + +  I
Sbjct  9     DPVRAYLREIGRVPLLSHEEEILYAKQVQRLIFLEKIKESLRAKLGSDPSDRQWSEAAEI  68

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  69    SEEQLRRELGAGDFAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFD  128

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L +DKG   +I
Sbjct  129   PTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLAQDKGRAATI  188

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L+++ K+V +  E   +  SLD +   + D   GE L     D+ L  +P    
Sbjct  189   AELAEELDLTPKQVRDYLERSRQPLSLDLKVGDNQDTELGELLE----DTGL--SPEDYT  242

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++  L+   L  +++E+I L  GL N + LT   I  R+ +SRERVRQ+   A
Sbjct  243   AHSSLQVDLEKLM-ADLTPQQKEVICLRFGLDNGQPLTLAKIGVRLNISRERVRQIEREA  301

Query  340   FEKLK  326
               KL+
Sbjct  302   IAKLR  306



>ref|WP_002739411.1| RNA polymerase sigma factor [Microcystis aeruginosa]
 emb|CCH95484.1| RNA polymerase sigma factor rpoD3 [Microcystis aeruginosa PCC 
9432]
 emb|CCI08956.1| RNA polymerase sigma factor rpoD3 [Microcystis aeruginosa PCC 
7941]
 gb|ELP53163.1| RNA polymerase sigma factor [Microcystis aeruginosa TAIHU98]
 gb|EPF19025.1| RNA polymerase sigma factor rpoD2 [Microcystis aeruginosa SPC777]
Length=318

 Score =   182 bits (461),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 187/318 (59%), Gaps = 11/318 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             + ++ Y++ I    LL+H E +  +K ++  ++LE+ K  L+ +LG DPS+ Q + +  I
Sbjct  9     DPVRAYLREIGRVPLLSHEEEILYAKQVQRLIFLEKIKESLRAKLGSDPSDRQWSEAAEI  68

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  69    SEEQLRRELGAGDFAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFD  128

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L +DKG   +I
Sbjct  129   PTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLAQDKGRAATI  188

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L+++ K+V +  E   +  SLD +   + D   GE L     D+ L  +P    
Sbjct  189   AELAEELDLTPKQVRDYLERSRQPLSLDLKVGDNQDTELGELLE----DTGL--SPEDYT  242

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++  L+   L  +++E+I L  GL N + LT   I  R+ +SRERVRQ+   A
Sbjct  243   AYSSLQVDLEKLM-ADLTPQQKEVICLRFGLDNGQPLTLAKIGVRLNISRERVRQIEREA  301

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+   RK +++  L 
Sbjct  302   IAKLRK--RKAKIREYLA  317



>ref|WP_002766753.1| RNA polymerase sigma factor [Microcystis aeruginosa]
 emb|CCI01445.1| RNA polymerase sigma factor rpoD3 [Microcystis aeruginosa PCC 
9443]
Length=318

 Score =   181 bits (460),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/305 (36%), Positives = 181/305 (59%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             + ++ Y++ I    LL+H E +  +K ++  ++LE+ K  L+ +LG DPS+ Q + +  I
Sbjct  9     DPVRAYLREIGRVPLLSHEEEILYAKQVQRLIFLEKIKESLRAKLGSDPSDRQWSEAAEI  68

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  69    SEEQLRRELGAGDFAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFD  128

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L +DKG   +I
Sbjct  129   PTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLAQDKGRAATI  188

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L+++ K+V +  E   +  SLD +   + D   GE L     D+ L  +P    
Sbjct  189   AELAEELDLTPKQVRDYLERSRQPLSLDLKVGDNQDTELGELLE----DTGL--SPEDYT  242

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++  L+   L  +++E+I L  GL N + LT   I  R+ +SRERVRQ+   A
Sbjct  243   AYSSLQVDLEKLM-ADLTPQQKEVICLRFGLDNGQPLTLAKIGVRLNISRERVRQIEREA  301

Query  340   FEKLK  326
               KL+
Sbjct  302   IAKLR  306



>ref|WP_002790918.1| RNA polymerase sigma factor [Microcystis aeruginosa]
 emb|CCI28324.1| RNA polymerase sigma factor rpoD3 [Microcystis aeruginosa PCC 
9808]
Length=318

 Score =   181 bits (459),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 186/318 (58%), Gaps = 11/318 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             + ++ Y++ I    LL+H E +  +K ++  ++LE+ K  L+ +LG DPS+ Q + +  I
Sbjct  9     DPVRAYLREIGRVPLLSHEEEILYAKQVQRLIFLEKIKESLRAKLGSDPSDRQWSEAAEI  68

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  69    SEEQLRRELGAGDFAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFD  128

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L +DKG   +I
Sbjct  129   PTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLAQDKGRAATI  188

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L+++ K+V +  E   +  SLD +   + D   GE L     D  L  +P    
Sbjct  189   AELAEELDLTPKQVRDYLERSRQPLSLDLKVGDNQDTELGELLE----DPGL--SPEDYT  242

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++  L+   L  +++E+I L  GL N + LT   I  R+ +SRERVRQ+   A
Sbjct  243   AYSSLQVDLEKLM-ADLTPQQKEVICLRFGLDNGQPLTLAKIGVRLNISRERVRQIEREA  301

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+   RK +++  L 
Sbjct  302   IAKLRK--RKAKIREYLA  317



>ref|WP_002782870.1| RNA polymerase sigma factor rpoD3 [Microcystis aeruginosa]
 emb|CCI12597.1| RNA polymerase sigma factor rpoD3 [Microcystis aeruginosa PCC 
9806]
Length=318

 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 109/305 (36%), Positives = 180/305 (59%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             + ++ Y++ I    LL+H E +  +K ++  ++LE+ K  L+ +LG DPS+ Q + +  I
Sbjct  9     DPVRAYLREIGRVPLLSHEEEILYAKQVQRLIFLEKIKESLRAKLGRDPSDRQWSEAAEI  68

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  69    SEEQLRRELGAGDFAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFD  128

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L +DKG   +I
Sbjct  129   PTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLAQDKGRAATI  188

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L+++ K+V +  E   +  SLD +   + D   GE L     D  L  +P    
Sbjct  189   AELAEELDLTPKQVRDYLERARQPLSLDLKVGDNQDTELGELLE----DKGL--SPEDYT  242

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++  L+   L  +++E+I L  GL N + LT   I  R+ +SRERVRQ+   A
Sbjct  243   AYSSLQVDLEKLM-ADLTPQQKEVICLRFGLDNGQPLTLAKIGVRLNISRERVRQIEREA  301

Query  340   FEKLK  326
               KL+
Sbjct  302   IAKLR  306



>ref|WP_036616142.1| RNA polymerase sigma factor [Oscillatoriales cyanobacterium JSC-12]
Length=367

 Score =   182 bits (461),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 120/337 (36%), Positives = 187/337 (55%), Gaps = 9/337 (3%)
 Frame = -1

Query  1294  VAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSR  1115
             V +I +S+ V  I  M    +S+  + K +    LL   E VEL+  I+    +EE +S+
Sbjct  37    VDEIASSRSVGYIKTMSD--DSVGAFFKEMARYPLLKPDEEVELANQIRYLNEIEELRSQ  94

Query  1114  LKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAE  935
             L + LG  PS+ +LA ++ ++   L+  +    +A+ K+  SN+RLV+SIA+RY N G  
Sbjct  95    LTQELGRCPSKAELADAVGLTERQLEHQLHRSRVAKRKMIRSNLRLVVSIAKRYINRGVP  154

Query  934   MADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRL  755
               DLIQ G +GL R  EKFDP KGYK STY YWWIRQGI+R +  +S  +RLP H+  +L
Sbjct  155   FLDLIQEGALGLNRATEKFDPDKGYKFSTYAYWWIRQGITRTIANDSRTIRLPVHIVEKL  214

Query  754   SLIRNAETKLKDK-GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPG  578
             + ++ A+  LK K    P+   +AE+L ++ +++ N  +   +  SL+       D    
Sbjct  215   NKLKGAQRDLKRKLNRNPTEAELAEALEVTPEQLQNLQQVHRRSLSLNYRVGKDEDT---  271

Query  577   ESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWE  401
               L   + D+    +P  ++ E  L+ E+ +++   L ERE++II L +GL  N+  T E
Sbjct  272   -ELVDLLEDAET-RSPESQMSETMLRQEIWDVLGNVLTEREKDIISLRYGLSSNKPCTLE  329

Query  400   DISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAML  290
             ++     LSRERVRQ+   A  KL+      RLK  L
Sbjct  330   EVGGLFNLSRERVRQIQSKAMRKLRRPQVAERLKGWL  366



>ref|WP_017326070.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=360

 Score =   181 bits (460),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 111/312 (36%), Positives = 184/312 (59%), Gaps = 9/312 (3%)
 Frame = -1

Query  1219  YVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISRTDL  1040
             Y++ I    LL   E V L++ ++  + L EQ+ +L   L   PS E  A  + +S ++L
Sbjct  52    YLQEIGRVPLLGRDEEVALAQKVQRYMELVEQREQLASELDSQPSLEAWAERVSLSVSEL  111

Query  1039  KLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGY  860
             +      S A++ +  +N+RLV+S+A++Y N G E+ DLIQ G +GL R +EKFDP+KGY
Sbjct  112   RQFQRTGSRAKDHMIKANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVEKFDPTKGY  171

Query  859   KLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDRIAE  683
             + STY YWWIRQGI+RA+   S  +RLP H+  +L+ I+ A+ K+ ++KG T +I+ IA+
Sbjct  172   RFSTYAYWWIRQGITRAIATQSRTIRLPVHITEKLNKIKKAQRKISQEKGRTATIEDIAK  231

Query  682   SLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDECAL  503
              L++SK +V +    V +  SL+ +     D   G+ L +       + +P   V   +L
Sbjct  232   ELDLSKVQVRDLLVRVPRSVSLETKVGKDKDTELGDLLEAE------DMSPEELVTRESL  285

Query  502   KDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFEKLK  326
               +++ L+   L  RER+++R+  GL +    +  +I + + LSRERVRQ+   A +KL+
Sbjct  286   SRDLSTLL-AELSSRERDVLRMRFGLEDGRTYSLAEIGRTLDLSRERVRQIESKALQKLR  344

Query  325   HAARKNRLKAML  290
                R+NR++  L
Sbjct  345   QPKRRNRIRDYL  356



>ref|WP_018398551.1| RNA polymerase sigma factor [filamentous cyanobacterium ESFC-1]
Length=317

 Score =   180 bits (456),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/305 (35%), Positives = 180/305 (59%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             ++++ Y+K I    LLTH E +  +K ++  L L++ K  L E+LG +PS  Q A ++ +
Sbjct  8     DTVRIYLKEIGRVPLLTHEEEILYAKSVQQWLGLQKSKEELAEKLGTEPSFSQWAEAVNL  67

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S  +L+  +I    A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  68    SEAELQKIIITGERAKRKMVEANLRLVVSVAKKYIKRNLDLLDLIQEGTIGMQRGVEKFD  127

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L    G   ++
Sbjct  128   PTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLSQSLGRAATV  187

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +   L+++ K+V +  E      SLD     + D   GE L     D  L  +P    
Sbjct  188   AELGAELDLTPKQVRDYLEKARHPLSLDLRVGDNQDTELGELLE----DDGL--SPEDFT  241

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
              + +L D++  L++  L  ++RE+I L +GL + + +T   I  R+G+SRERVRQ+   A
Sbjct  242   SQSSLHDDLQRLMN-DLTPQQREVIGLRYGLSDGQPMTLAKIGNRLGISRERVRQLEREA  300

Query  340   FEKLK  326
              +KL+
Sbjct  301   LKKLR  305



>gb|EKQ71084.1| RNA polymerase sigma factor, cyanobacterial RpoD-like family 
[Oscillatoriales cyanobacterium JSC-12]
Length=407

 Score =   182 bits (462),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 120/337 (36%), Positives = 187/337 (55%), Gaps = 9/337 (3%)
 Frame = -1

Query  1294  VAKIDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSR  1115
             V +I +S+ V  I  M    +S+  + K +    LL   E VEL+  I+    +EE +S+
Sbjct  77    VDEIASSRSVGYIKTMSD--DSVGAFFKEMARYPLLKPDEEVELANQIRYLNEIEELRSQ  134

Query  1114  LKERLGCDPSEEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAE  935
             L + LG  PS+ +LA ++ ++   L+  +    +A+ K+  SN+RLV+SIA+RY N G  
Sbjct  135   LTQELGRCPSKAELADAVGLTERQLEHQLHRSRVAKRKMIRSNLRLVVSIAKRYINRGVP  194

Query  934   MADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRL  755
               DLIQ G +GL R  EKFDP KGYK STY YWWIRQGI+R +  +S  +RLP H+  +L
Sbjct  195   FLDLIQEGALGLNRATEKFDPDKGYKFSTYAYWWIRQGITRTIANDSRTIRLPVHIVEKL  254

Query  754   SLIRNAETKLKDK-GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPG  578
             + ++ A+  LK K    P+   +AE+L ++ +++ N  +   +  SL+       D    
Sbjct  255   NKLKGAQRDLKRKLNRNPTEAELAEALEVTPEQLQNLQQVHRRSLSLNYRVGKDED----  310

Query  577   ESLHSYIADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWE  401
               L   + D+    +P  ++ E  L+ E+ +++   L ERE++II L +GL  N+  T E
Sbjct  311   TELVDLLEDAET-RSPESQMSETMLRQEIWDVLGNVLTEREKDIISLRYGLSSNKPCTLE  369

Query  400   DISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAML  290
             ++     LSRERVRQ+   A  KL+      RLK  L
Sbjct  370   EVGGLFNLSRERVRQIQSKAMRKLRRPQVAERLKGWL  406



>ref|WP_002761297.1| RNA polymerase sigma factor [Microcystis aeruginosa]
 emb|CCH98320.1| RNA polymerase sigma factor rpoD3 [Microcystis aeruginosa PCC 
9717]
 emb|CCI24201.1| RNA polymerase sigma factor rpoD3 [Microcystis aeruginosa PCC 
9809]
Length=318

 Score =   179 bits (455),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 109/305 (36%), Positives = 181/305 (59%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             + ++ Y++ I    LLTH E +  +K ++  ++LE+ K  L+ +LG +PS+ Q + +  I
Sbjct  9     DPVRAYLREIGRVPLLTHEEEILYAKQVQRLIFLEKIKESLRAKLGREPSDRQWSEAAEI  68

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  69    SEEQLRRELGAGDFAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFD  128

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L +DKG   +I
Sbjct  129   PTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLAQDKGRAATI  188

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L+++ K+V +  E   +  SLD +   + D   GE L     D+ L  +P    
Sbjct  189   AELAEELDLTPKQVRDYLERSRQPLSLDLKVGDNQDTELGELLE----DTGL--SPEDYT  242

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++  L+   L  +++E+I L  GL N + LT   I  R+ +SRERVRQ+   A
Sbjct  243   AYSSLQVDLEKLM-ADLTPQQKEVICLRFGLDNGQPLTLAKIGVRLNISRERVRQIEREA  301

Query  340   FEKLK  326
               KL+
Sbjct  302   IAKLR  306



>ref|WP_008199027.1| RNA polymerase sigma factor [Microcystis sp. T1-4]
 emb|CCI31394.1| RNA polymerase sigma factor rpoD3 [Microcystis sp. T1-4]
Length=318

 Score =   179 bits (454),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 109/305 (36%), Positives = 181/305 (59%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             + ++ Y++ I    LLTH E +  +K ++  ++LE+ K  L+ +LG +PS+ Q + +  I
Sbjct  9     DPVRSYLREIGRVPLLTHEEEILYAKQVQRLIFLEKIKESLRSQLGREPSDRQWSEAAEI  68

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  69    SEEQLRRELGAGDFAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFD  128

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L +DKG   +I
Sbjct  129   PTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLAQDKGRAATI  188

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L+++ K+V +  E   +  SLD +   + D   GE L     D+ L  +P    
Sbjct  189   AELAEELDLTPKQVRDYLERSRQPLSLDLKVGDNQDTELGELLE----DTGL--SPEDYT  242

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++  L+   L  +++E+I L  GL N + LT   I  R+ +SRERVRQ+   A
Sbjct  243   AYSSLQVDLEKLM-ADLTPQQKEVICLRFGLDNGQPLTLAKIGVRLNISRERVRQIEREA  301

Query  340   FEKLK  326
               KL+
Sbjct  302   IAKLR  306



>ref|WP_017714813.1| RNA polymerase sigma factor SigC [Oscillatoria sp. PCC 10802]
Length=415

 Score =   182 bits (461),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 117/317 (37%), Positives = 179/317 (56%), Gaps = 31/317 (10%)
 Frame = -1

Query  1168  ELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISRTDLK---------------L  1034
             E  ++I+  + L E   RL  +LG  PS E+ A   R+  +DLK               L
Sbjct  102   EGDELIQRYVKLMEAGDRLASQLGLRPSLERWAAEARVLASDLKPILAGGKRRWAEIAGL  161

Query  1033  TMIECSL-------AREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             T+ E  L       A+E +  +N+RLV+S+A++Y N G E+ DLIQ G +GL R +EKFD
Sbjct  162   TVEELELVQTEGIRAKEHMIKANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVEKFD  221

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P++GY+ STY YWWIRQGI+RA+   S  +RLP H+  +L+ I+ A+ K+ ++KG TP++
Sbjct  222   PTRGYRFSTYAYWWIRQGITRAIATQSRTIRLPVHITEKLNKIKKAQRKISQEKGRTPTV  281

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
             D IA  LN++  +V      V +  SL+ +     D   G+ L +  AD   E    H  
Sbjct  282   DDIAGELNMTTSQVREVLLRVPRAVSLESKVGKEKDTELGDLLET--ADLSPEEMLMHE-  338

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                AL  ++N L+   L  RER++I++  GLG+    +  +I + + LSRERVRQ+   A
Sbjct  339   ---ALHRDLNQLL-ADLTSRERDVIQMRFGLGDGHPYSLSEIGRALDLSRERVRQIEAKA  394

Query  340   FEKLKHAARKNRLKAML  290
              +KL+   R+NR++  L
Sbjct  395   LQKLRQPKRRNRVRDYL  411



>ref|WP_015191629.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Stanieria cyanosphaera]
 ref|YP_007130922.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Stanieria cyanosphaera 
PCC 7437]
 gb|AFZ33956.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Stanieria cyanosphaera 
PCC 7437]
Length=368

 Score =   180 bits (456),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/320 (35%), Positives = 178/320 (56%), Gaps = 8/320 (3%)
 Frame = -1

Query  1240  LQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSL  1061
             + +++  + K +    LL   E VEL+  +K+ +  EE + +LKE+L   P++E+   +L
Sbjct  53    IDDNIGAFFKEMARYPLLKPEEEVELANCVKVMVQAEEIRQQLKEQLNRQPTKEEWTKAL  112

Query  1060  RI-SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIE  884
             ++ S   L+  +    +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  E
Sbjct  113   QLESIRQLENRLYRGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAIGLNRATE  172

Query  883   KFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GIT  707
             KFDP+KGYK STY YWWIRQ I+R +  ++  +RLP H+  +L+ ++ A+  LK +    
Sbjct  173   KFDPNKGYKFSTYAYWWIRQAITRTIANDARTIRLPIHIVEKLNKLKKAQRNLKQQLQRN  232

Query  706   PSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPW  527
             P+   +A  LN+S  ++    E   +  SL+     + D      L   + DS L+  P 
Sbjct  233   PNEQELANELNVSLSQLHQLLELRRQSLSLNHRVGKAEDT----ELVDLLEDSELQ-LPE  287

Query  526   HRVDECALKDEVNNLIHTTLKEREREIIRLYHGLG-NECLTWEDISKRIGLSRERVRQVG  350
              R+ E  ++ E+  ++   L ERE+++I L +GL  N+  T E++     LSRERVRQ+ 
Sbjct  288   ERMSEAMMRQEIFTVLSDVLTEREKDVISLRYGLATNQPYTLEEVGGMFNLSRERVRQIQ  347

Query  349   LVAFEKLKHAARKNRLKAML  290
               A  KL+      RLK  L
Sbjct  348   SKAMRKLRRPQVARRLKGWL  367



>gb|AFP65672.1| RNA-polymerase sigma factor [Chroomonas mesostigmatica CCMP1168]
Length=485

 Score =   182 bits (462),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 115/364 (32%), Positives = 208/364 (57%), Gaps = 18/364 (5%)
 Frame = -1

Query  1285  IDTSKRVRSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKE  1106
              D+S R +++ G+++  +S++ Y++ I    LL   E ++L++ I   L+ E  K  L+E
Sbjct  116   FDSSSRNQTVKGLQKADDSVRWYLQLIGRVRLLRPEEEIQLAREISQLLHWEHVKISLRE  175

Query  1105  RLGCDPSEEQLAVSLRISRTD-LKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMA  929
             +L  +P+  +   + ++S     +  +     A+E++  +N+RLV+SIA+RY N G  + 
Sbjct  176   KLQREPTSSEWTAACKVSDVKKFRAILHNARRAKERMVAANLRLVVSIAKRYVNRGMSLQ  235

Query  928   DLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSL  749
             DLIQ G +GL+R  EKFD  KG+K STY  WW++Q ++RA+  +S  +RLP HL+  +S 
Sbjct  236   DLIQEGSLGLIRAAEKFDSEKGFKFSTYATWWVKQAVTRAIADHSRTIRLPVHLYDTISA  295

Query  748   IRNAETKLK-DKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGES  572
             IR     L  + G +P+ + IAE +++S +K+ +  ++     SL+R   P  +      
Sbjct  296   IRKTTRTLNIEIGRSPTEEEIAEKMDMSVEKLRSVLQSAQPTLSLER---PLKNDDDASQ  352

Query  571   LHSYI-ADSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECL-TWED  398
             L  +I AD   + +P   V++  L+D++ N+I+ +L  RER+++R+ +GL +  + T E+
Sbjct  353   LSDFIEAD---QESPEEHVEKSMLRDDLENVIN-SLSPRERDVVRMRYGLDDGRIKTLEE  408

Query  397   ISKRIGLSRERVRQVGLVAFEKLKHAARKNRLKAMLVKQ*RFGTFLAMVKFTVNTQIEPS  218
             I +   ++RERVRQ+   A  KL+   R + L+  ++    F       + T +T I P+
Sbjct  409   IGQIFSVTRERVRQIEAKAIRKLRQPYRSSILRDYVLTSPTFS------EKTTSTSI-PT  461

Query  217   YIPL  206
              +PL
Sbjct  462   NLPL  465



>ref|WP_008233573.1| Cyanobacteria-specific RpoD-like sigma factor,type-1 [Richelia 
intracellularis]
 emb|CCH67262.1| Cyanobacteria-specific RpoD-like sigma factor,type-1 [Richelia 
intracellularis HH01]
Length=380

 Score =   179 bits (455),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/319 (35%), Positives = 177/319 (55%), Gaps = 9/319 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL  GE VEL++ ++    +  +++ L+ ++G  PS E LA    +
Sbjct  68    DAVGAFFKEMARYPLLKPGEEVELAQRVRFLEDVRVKQTTLQGKIGYPPSRETLAQYWNL  127

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  128   TEKQLEQQLYQGKVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  187

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K G  PS 
Sbjct  188   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLGRNPSE  247

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN-NPWHR  521
               IA+SL I   ++    +   +  SL+       D      L   + D   EN +P  R
Sbjct  248   VEIADSLEIPAPQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDE--ENLSPEAR  301

Query  520   VDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLV  344
             ++E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   
Sbjct  302   MNESMMRHEIWEVLSDVLTPREKDVISLRYGLISSEPCTLEEVGNMFNLSRERVRQIQSK  361

Query  343   AFEKLKHAARKNRLKAMLV  287
             A  KL+      RLK  LV
Sbjct  362   AMRKLRRPHIAKRLKGWLV  380



>ref|WP_036030486.1| RNA polymerase sigma factor SigC, partial [Leptolyngbya sp. PCC 
6406]
Length=362

 Score =   179 bits (453),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/308 (37%), Positives = 178/308 (58%), Gaps = 31/308 (10%)
 Frame = -1

Query  1141  LYLEEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTM-----------------IECSL  1013
             ++L + + RL   LG  PS E+ A +  IS  DLK T+                 +E ++
Sbjct  58    VHLMDTRDRLTSHLGHRPSLERWAETAGISVVDLKPTLSSGKRHWAELASLTVAELEEAI  117

Query  1012  -----AREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLST  848
                  A+E +  +N+RLV+S+A++Y N G E+ DLIQ G +GL R +EKFDP+KGY+ ST
Sbjct  118   REGLRAKEHMIKANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVEKFDPTKGYRFST  177

Query  847   YVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDRIAESLNI  671
             Y YWWIRQGI+RA+   S  +RLP H+  +L+ I+ A+ K+ +D+G TP++D +A  L++
Sbjct  178   YAYWWIRQGITRAIATQSRTIRLPVHITEKLNKIKKAQRKISQDQGRTPTLDDVARELDM  237

Query  670   SKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDECALKDEV  491
             +  +V      V +  SL+ +     D   G+ L +   DS    +P   +   AL+ ++
Sbjct  238   TAAQVREVLLRVPRSVSLETKVGKERDTELGDLLET---DS---ISPEELLMREALRRDL  291

Query  490   NNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFEKLKHAAR  314
               L+   L +RERE+IRL  GLG+    +  +I + + LSRERVRQ+   A +KL+   R
Sbjct  292   QQLM-ADLTDREREVIRLRFGLGDGNPFSLAEIGRALDLSRERVRQIESKALQKLRQPKR  350

Query  313   KNRLKAML  290
             +NR++  L
Sbjct  351   RNRVRDYL  358



>ref|WP_015227046.1| RpoD subfamily RNA polymerase sigma-70 subunit [Halothece sp. 
PCC 7418]
 ref|YP_007169388.1| RpoD subfamily RNA polymerase sigma-70 subunit [Halothece sp. 
PCC 7418]
 gb|AFZ45174.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Halothece sp. 
PCC 7418]
Length=375

 Score =   179 bits (454),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 104/318 (33%), Positives = 180/318 (57%), Gaps = 7/318 (2%)
 Frame = -1

Query  1237  QNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLR  1058
             ++++  + K +    LL   E VEL++ +KL    E ++  L E+LG  P+++QLA +L 
Sbjct  63    EDTVGAFFKEMARYPLLQPDEEVELAQQVKLAADFEHKRQELAEKLGSPPTKQQLAEALE  122

Query  1057  ISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKF  878
             +   +L   + +  +A+ ++  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKF
Sbjct  123   MGVKELDRKLYQGRVAKRRMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAIGLNRAAEKF  182

Query  877   DPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPS  701
             DP+KGYK STY YWWIRQ I+R +  ++  +RLP H+  +L+ ++ A+  LK +    P+
Sbjct  183   DPNKGYKFSTYAYWWIRQAITRTIANDARTIRLPIHIVEKLNKLKKAQRDLKQELQRNPT  242

Query  700   IDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHR  521
                +A++L +S+ ++    +   +  SL+        G   ++    + + H    P  +
Sbjct  243   EAELAQALEVSQSQLHQLLQLRRQSLSLNHRV-----GKGEDTELLELLEDHEMRLPEDQ  297

Query  520   VDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLV  344
             ++E  +  E+++++   L ERE+++I + +GL  ++  T E++     LSRERVRQ+   
Sbjct  298   MNEAMMNQEISDVLSDVLTEREKDVISMRYGLNASQPYTLEEVGLMFNLSRERVRQIQSK  357

Query  343   AFEKLKHAARKNRLKAML  290
             A  KL+      RLK  L
Sbjct  358   AMRKLRRPQVARRLKGWL  375



>ref|WP_017299165.1| hypothetical protein [Nodosilinea nodulosa]
Length=391

 Score =   179 bits (454),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 107/317 (34%), Positives = 173/317 (55%), Gaps = 7/317 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E +EL++ ++    +E    +L++ LG  P+ ++L   L+I
Sbjct  79    DAVGAFFKEMARYPLLKPSEEIELARQVRFLSKVESASEKLQKELGRKPNRQELVEKLKI  138

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S  +    + E   A+ ++  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  139   SEAEFTQKLHEGRTAKRRMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGALGLNRATEKFD  198

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P KGYK STY YWWIRQGI+R +  ++  +RLP H+  +L+ ++ A   L +D    PS 
Sbjct  199   PDKGYKFSTYAYWWIRQGITRTIANDARTIRLPIHIVEKLNKLKKAHRDLRRDLQRNPSE  258

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +A++L++S  ++ +  +   +  SL+       D      L   + DS  +  P  ++
Sbjct  259   QELADALDVSVDQLRSLQQVRRRSLSLNHRVGKGEDT----ELMELLEDSSTQ-TPESKI  313

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
              E  ++ E+ +++   L ERE++II L +GL   E  T E++     LSRERVRQ+   A
Sbjct  314   SENMMRQEITSVLAEVLTEREKDIITLRYGLATGETHTLEEVGGIFNLSRERVRQIQTKA  373

Query  340   FEKLKHAARKNRLKAML  290
               KL+      RLK  L
Sbjct  374   MRKLRRPQVAARLKGWL  390



>ref|WP_013322297.1| RNA polymerase sigma factor SigC [Cyanothece sp. PCC 7822]
 ref|YP_003887467.1| RpoD subfamily RNA polymerase sigma-70 factor [Cyanothece sp. 
PCC 7822]
 gb|ADN14192.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Cyanothece 
sp. PCC 7822]
Length=418

 Score =   180 bits (456),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 116/345 (34%), Positives = 197/345 (57%), Gaps = 43/345 (12%)
 Frame = -1

Query  1246  EQLQNS--LKGYVKGI-VSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQ  1076
             E++QN+  L+ Y++ + +    + +G++V     IK  + L E++ +L  +LG  PS E+
Sbjct  81    EEVQNAQDLQRYIQLLELRSVAIANGDLV-----IKNFVSLIEKRDQLTSQLGHRPSLER  135

Query  1075  LAVSLRISRTDLKLTMIECS----------------------LAREKLAMSNVRLVMSIA  962
             LA +  I+  +LK T+ E                         A+E++  +N+RLV+S+A
Sbjct  136   LADAAEITVFELKKTLYEGKRHWAELANLEVQELERVQKAGIYAKEQMIKANLRLVVSVA  195

Query  961   QRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLR  782
             +RY N G E+ DLIQ G +GL R ++KFDP+KGY+ STY YWWIRQGI+RA+   S ++R
Sbjct  196   KRYQNRGLELLDLIQEGTLGLERAVDKFDPTKGYRFSTYAYWWIRQGITRAIATQSRIIR  255

Query  781   LPKHLHGRLSLIRNAETKLKD-KGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREA  605
             LP H+  +L+ I+ A+ K+   KG TPSI+ +++ L +S  ++      V +  SL+ + 
Sbjct  256   LPVHITEKLNKIKKAQRKIAQLKGATPSIEELSQELEMSPPQIREVLMRVPRSVSLEIKV  315

Query  604   FPSIDGLPGESLHSYIAD--SHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYH  431
                     G+   + + D     E +P   +   AL+ +++NL+   L  RERE+I+L +
Sbjct  316   --------GKEKDTELIDLLETTEASPEDNIANEALRQDLHNLL-ADLTTREREVIQLRY  366

Query  430   GLGN-ECLTWEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLK  299
             G  + +  +  DI + + LSRERVRQ+   A +KL+   R+N+++
Sbjct  367   GFKDGKSYSLADIGRTLQLSRERVRQIEAKAIQKLRQPKRRNQIR  411



>ref|WP_013321507.1| RNA polymerase sigma factor [Cyanothece sp. PCC 7822]
 ref|YP_003886675.1| RpoD subfamily RNA polymerase sigma-70 factor [Cyanothece sp. 
PCC 7822]
 gb|ADN13400.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Cyanothece 
sp. PCC 7822]
Length=318

 Score =   176 bits (447),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 111/318 (35%), Positives = 181/318 (57%), Gaps = 11/318 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             + ++ Y++ I    LLTH E + L+K ++  + L+E K  L + L  +P E + A + +I
Sbjct  9     DPVRAYLREIGRVPLLTHEEEIVLAKRVQRSMALQEIKDTLTKNLSREPLEHEWAEAAKI  68

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S  +L+ TM     A+EK+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  69    SEEELRRTMAAGKAAKEKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFD  128

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L  K G   +I
Sbjct  129   PTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLAQKQGRAATI  188

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +A+ L ++ ++V    E   +  SLD     + D   GE L     D+    +P    
Sbjct  189   SELAQELELTPRQVREYLERARQPLSLDLRVGDNQDTELGELLE----DTG--TSPEDYA  242

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++  L+ + L  ++RE++ L  GL   + LT   I  R+ +SRERVRQ+   A
Sbjct  243   THSSLQLDLEKLM-SDLTPQQREVLALRFGLVDGQPLTLAKIGVRLNISRERVRQIEREA  301

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+   RK  +K  L 
Sbjct  302   LSKLRK--RKANIKEYLA  317



>ref|WP_013732278.1| RNA polymerase sigma factor [Verrucosispora maris]
 ref|YP_004404209.1| RNA polymerase sigma factor SigB [Verrucosispora maris AB-18-032]
 gb|AEB43609.1| RNA polymerase sigma factor SigB [Verrucosispora maris AB-18-032]
Length=335

 Score =   177 bits (448),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 115/316 (36%), Positives = 175/316 (55%), Gaps = 27/316 (9%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+ GI   +LLT  + VEL+K I+ GL+ EE+ +       C P   QL       +
Sbjct  39    VRAYLNGIGRTKLLTAAQEVELAKRIEAGLFAEEKLT------TCTPVSAQL-------Q  85

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              DL L   E   A+  L  +N+RLV+SIA+RY   G    DLIQ G +GL+R +EKFD +
Sbjct  86    ADLTLIAQEGQAAKNHLLEANLRLVVSIAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYT  145

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLK-DKGITPSIDR  692
             KGYK STY  WWIRQ I+RA+   +  +R+P H+  +++ +  A  +L    G  PS+  
Sbjct  146   KGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEQVNRMVRARRELSVSLGREPSVAE  205

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             IA +L++ + +V        ++ S DRE   S+D   GE   S + D     +P   VD+
Sbjct  206   IARALDVPEFQVI-------ELISYDREPV-SLDQTVGEDGESALGDFVAAVDPSSMVDD  257

Query  511   C---ALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLV  344
                  L++EV +++  TL +RE+ +IRL  GL +    T +++ +  GLSRER+RQ+  V
Sbjct  258   ADRGELRNEV-SIVLATLSQREQAVIRLRFGLDDGRQRTLDEVGREFGLSRERIRQIEKV  316

Query  343   AFEKLKHAARKNRLKA  296
                KL+   R  RL+A
Sbjct  317   TLLKLRAPERAQRLEA  332



>ref|WP_016872734.1| RNA polymerase sigma factor [Chlorogloeopsis fritschii]
Length=392

 Score =   178 bits (452),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 109/321 (34%), Positives = 178/321 (55%), Gaps = 7/321 (2%)
 Frame = -1

Query  1243  QLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVS  1064
             +  +++  + K +    LL   E VEL++ ++    + E  + L+++LG  P++E +A  
Sbjct  77    EYDDAVGAFFKEMARYPLLKPDEEVELARRVRFLEEVNELYASLEKKLGHQPTKENIATH  136

Query  1063  LRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIE  884
             L I+   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  E
Sbjct  137   LEITEKQLEHRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATE  196

Query  883   KFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GIT  707
             KFDP KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK + G  
Sbjct  197   KFDPDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQRLGRN  256

Query  706   PSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPW  527
             PS   +AE+L I  +++    +   +  SL+       D      L   + D     +P 
Sbjct  257   PSEAEMAEALEIPAQQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPE  311

Query  526   HRVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVG  350
              +++E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+ 
Sbjct  312   AKMNESMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQ  371

Query  349   LVAFEKLKHAARKNRLKAMLV  287
               A  KL+      RLK  LV
Sbjct  372   SKAMRKLRRPHIAKRLKGWLV  392



>ref|WP_007456891.1| RNA polymerase sigma factor [Micromonospora lupini]
 emb|CCH16756.1| RNA polymerase sigma factor rpoD [Micromonospora lupini str. 
Lupac 08]
Length=338

 Score =   176 bits (447),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 112/317 (35%), Positives = 181/317 (57%), Gaps = 28/317 (9%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+ GI   +LLT  + V+L++ I+ GL+ +E+ +       C P  E+L       R
Sbjct  41    VRAYLNGIGRTKLLTAAQEVDLARRIEAGLFADEKLA------TCTPVSEEL-------R  87

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              DL+L + E   A++ L  +N+RLV+SIA+RY   G    DLIQ G +GL+R +EKFD +
Sbjct  88    ADLELIVAEGRAAKDHLLEANLRLVVSIAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYA  147

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLK-DKGITPSIDR  692
             KGYK STY  WWIRQ I+RA+   +  +R+P H+  +++ +  A  +L    G  P++  
Sbjct  148   KGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEQVNRMVRARRELAVTLGREPTVAE  207

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSID---GLPGES-LHSYIADSHLENNPWH  524
             +A +L+I + +V        ++ S DRE   S+D   G  GES L  ++A      +P  
Sbjct  208   VARALDIPEFQVI-------ELISYDREPV-SLDQAVGDDGESALGDFVASVDPRTDPGE  259

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGL  347
                +  L++EV +++ +TL +RE+ +IRL  GL +    T +++ +  GLSRER+RQ+  
Sbjct  260   GAAQGELRNEV-SIVLSTLSQREQAVIRLRFGLDDGRQRTLDEVGREFGLSRERIRQIEK  318

Query  346   VAFEKLKHAARKNRLKA  296
             V   KL+   R  RL+A
Sbjct  319   VTLLKLRAPERAQRLEA  335



>ref|WP_037221191.1| RNA polymerase sigma factor [Richelia intracellularis]
Length=392

 Score =   178 bits (451),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 112/319 (35%), Positives = 178/319 (56%), Gaps = 9/319 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    +  +++ L+++LG  PS+E LA    +
Sbjct  80    DAVGAFFKEMARYPLLKPNEEVELARRVRFLEDVRLKQASLEKKLGYPPSKETLAQCWDL  139

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  140   TEKQLEHRLYQGKVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  199

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK + G  PS 
Sbjct  200   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQRLGRNPSD  259

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN-NPWHR  521
               IAE+L I   ++    +   +  SL+       D      L   + D   EN +P  R
Sbjct  260   IEIAEALEIPAPQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDE--ENLSPEAR  313

Query  520   VDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLV  344
             ++E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   
Sbjct  314   MNESMMRHEIWEVLSDVLTPREKDVISLRYGLTSSEPCTLEEVGNMFNLSRERVRQIQSK  373

Query  343   AFEKLKHAARKNRLKAMLV  287
             A  KL+      RLK  LV
Sbjct  374   AMRKLRRPHIAKRLKGWLV  392



>ref|WP_035987770.1| RNA polymerase sigma factor [Leptolyngbya sp. KIOST-1]
Length=327

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 111/311 (36%), Positives = 177/311 (57%), Gaps = 14/311 (5%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             ++++ Y+  I    LLTH E +   K ++  + L EQK  L E LG DPS  + A +  +
Sbjct  18    DAVRTYLHEIGRVPLLTHEEEIIFGKQVQTYMALLEQKESLTESLGHDPSPAEWAEAAGL  77

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   LK T+ +   A+ K+  +N+RLV++IA++Y     E  DLIQ G +GL RG+EKFD
Sbjct  78    SEAQLKQTVRQGERAKRKMIEANLRLVVAIAKKYQKRNLEFLDLIQEGTLGLERGVEKFD  137

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P+KGYK STY YWWIRQ I+RA+ + +  +RLP H+  +L+ I+  + +L  + G +P+ 
Sbjct  138   PTKGYKFSTYAYWWIRQAITRAIAQQARTIRLPIHITEKLNKIKRVQRELSQQLGRSPNA  197

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
             + I E+L +  K++        +  SLD     + D      L   + D  +  +P    
Sbjct  198   NEIGEALELEPKQIREFLVLARQPISLDVRIGDNQDT----ELQELLEDDGI--SPETFT  251

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL--GNECLTWEDISKRIGLSRERVRQVGLV  344
              + +LK ++ NL+ + L  +++E+I L +GL  GNE L+   +  R+ +SRERVRQ+   
Sbjct  252   AQESLKQDIRNLL-SELTPQQKEVITLRYGLEDGNE-LSLAKVGNRMNISRERVRQLEQQ  309

Query  343   AFEKLKHAARK  311
             A   LKH  R+
Sbjct  310   A---LKHLRRR  317



>emb|CDN14121.1| Cyanobacteria-specific RpoD-like sigma factor, type-1 [Richelia 
intracellularis]
Length=380

 Score =   177 bits (450),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 112/319 (35%), Positives = 178/319 (56%), Gaps = 9/319 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    +  +++ L+++LG  PS+E LA    +
Sbjct  68    DAVGAFFKEMARYPLLKPNEEVELARRVRFLEDVRLKQASLEKKLGYPPSKETLAQCWDL  127

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  128   TEKQLEHRLYQGKVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  187

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK + G  PS 
Sbjct  188   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQRLGRNPSD  247

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLEN-NPWHR  521
               IAE+L I   ++    +   +  SL+       D      L   + D   EN +P  R
Sbjct  248   IEIAEALEIPAPQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDE--ENLSPEAR  301

Query  520   VDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLV  344
             ++E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   
Sbjct  302   MNESMMRHEIWEVLSDVLTPREKDVISLRYGLTSSEPCTLEEVGNMFNLSRERVRQIQSK  361

Query  343   AFEKLKHAARKNRLKAMLV  287
             A  KL+      RLK  LV
Sbjct  362   AMRKLRRPHIAKRLKGWLV  380



>gb|EWM65257.1| RNA polymerase principal sigma factor SigB [Micromonospora sp. 
M42]
Length=328

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 113/316 (36%), Positives = 171/316 (54%), Gaps = 26/316 (8%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+ GI   +LLT  + VELSK I+ GL+ EE+ +       C P   +L       R
Sbjct  31    VRAYLNGIGRTKLLTAAQEVELSKRIEAGLFAEEKLA------TCTPVSAEL-------R  77

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              DL L   E   A++ L  +N+RLV+SIA+RY   G    DLIQ G +GL+R +EKFD +
Sbjct  78    ADLALIAAEGRAAKDHLLEANLRLVVSIAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYT  137

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLK-DKGITPSIDR  692
             KGYK STY  WWIRQ I+RA+   +  +R+P H+  +++ +     +L    G  P++  
Sbjct  138   KGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEQVNRMVRVRRELSVSLGREPTVSE  197

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A +L I + +V        ++ S DRE   S+D   GE   S + D     +P     +
Sbjct  198   VAVALEIPEFQVI-------ELISYDREPV-SLDQAVGEDGESALGDFVAAVDPRTEPGD  249

Query  511   CALKDEVNN---LIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLV  344
              A   E+ N   ++  TL +RE+ +IRL  GL +    T +++ +  GLSRER+RQ+  V
Sbjct  250   AATNGELRNEVRIVLATLSQREQAVIRLRFGLDDGRQRTLDEVGREFGLSRERIRQIEKV  309

Query  343   AFEKLKHAARKNRLKA  296
                KL+   R NRL+A
Sbjct  310   TLLKLRDPERANRLEA  325



>ref|WP_016861675.1| RNA polymerase sigma factor [Fischerella muscicola]
Length=390

 Score =   177 bits (450),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/318 (34%), Positives = 176/318 (55%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++      E ++ LKE LG  P++  +A  L+I
Sbjct  78    DAVGAFFKEMARYPLLKPDEEVELARRVRFLEEFNEIQAALKEELGHQPNKSNIAAHLQI  137

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  138   TEKQLENRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  197

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK + G  P+ 
Sbjct  198   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQRLGRNPNE  257

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE+L I  +++    +   +  SL+       D      L   + D     +P  ++
Sbjct  258   IEMAEALEIPPQQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  312

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  313   NESMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQSKA  372

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  L+
Sbjct  373   MRKLRRPHIAKRLKGWLI  390



>ref|WP_017312428.1| RNA polymerase sigma factor [Fischerella sp. PCC 9339]
Length=391

 Score =   177 bits (449),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/318 (34%), Positives = 177/318 (56%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++      E ++ L+E+LG  P++  +A  L+I
Sbjct  79    DAVGAFFKEMARYPLLKPDEEVELARRVRFLEEFNEIQAVLEEQLGHQPNKSNIAAHLQI  138

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  139   TEKQLENRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  198

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K G  P+ 
Sbjct  199   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLGRNPNE  258

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE+L I  +++    +   +  SL+       D      L   + D     +P  ++
Sbjct  259   IEMAEALEIPPQQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  313

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  314   NESMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQSKA  373

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  L+
Sbjct  374   MRKLRRPHIAKRLKGWLI  391



>ref|WP_035987353.1| RNA polymerase sigma factor [Leptolyngbya sp. KIOST-1]
Length=392

 Score =   177 bits (448),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 105/319 (33%), Positives = 174/319 (55%), Gaps = 7/319 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E +EL++ ++    +E    +L++ LG  P+ ++L   L++
Sbjct  79    DAVGAFFKEMARYPLLKPSEEIELARQVRFLSKVETASEKLQKELGRKPTRQELVEKLKL  138

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S  +    + +   A+ ++  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  139   SEAEFTQKLHDGRTAKRRMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGALGLNRATEKFD  198

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P KGYK STY YWWIRQGI+R +  ++  +RLP H+  +L+ ++ A   L +D    PS 
Sbjct  199   PDKGYKFSTYAYWWIRQGITRTIANDARTIRLPIHIVEKLNKLKKAHRDLRRDLQRNPSE  258

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +A++L+++  ++ +  +   +  SL+       D      L   + DS  +  P  ++
Sbjct  259   QELADALDVTVDQLRSLQQVRRRSLSLNHRVGKGEDT----ELMELLEDSSTQ-TPESKI  313

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
              E  ++ E+ +++   L ERE++II L +GL   E  T E++     LSRERVRQ+   A
Sbjct  314   SENMMRQEITSVLAEVLTEREKDIITLRYGLATGETHTLEEVGGIFNLSRERVRQIQTKA  373

Query  340   FEKLKHAARKNRLKAMLVK  284
               KL+      RLK  L K
Sbjct  374   MRKLRRPQVAARLKGWLNK  392



>ref|WP_035760005.1| RNA polymerase sigma factor [Arthrospira platensis]
Length=319

 Score =   174 bits (442),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/305 (33%), Positives = 179/305 (59%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +S++ Y++ I    LLTH + +   K ++    L+E+++ L ++LG +P+E Q A  + +
Sbjct  10    DSVRAYLREIGRVPLLTHEQEIVYGKQVQQATLLQEKRNELAKQLGYEPTEAQWAELVNL  69

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  + +  LA+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  70    SVAQLQHILHQGQLAKRKMVEANLRLVVSVAKKYIKRNVDLLDLIQEGTIGMQRGVEKFD  129

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ +L  + G   ++
Sbjct  130   PTKGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRQLAQQLGRAATM  189

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
             + +A  L+++ K++    E      SLD     + D      L   + D+   N+P    
Sbjct  190   NELAAELDLTPKQIREYLEKSRLPLSLDLRVGDNQDT----ELVDLLEDTS--NSPEQFA  243

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++ +L+ T L +++R+++ L  GL + + LT   I  R+ +SRERVRQ+   A
Sbjct  244   LNSSLRSDLESLM-TDLTDQQRQVLALRFGLDDGQTLTLAKIGDRLNISRERVRQIEREA  302

Query  340   FEKLK  326
               KL+
Sbjct  303   LTKLR  307



>ref|WP_036001574.1| RNA polymerase sigma factor [Leptolyngbya sp. JSC-1]
Length=389

 Score =   176 bits (447),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 109/317 (34%), Positives = 177/317 (56%), Gaps = 7/317 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ +K    +EE + +L++ LG  P++  +A  L +
Sbjct  77    DAVGAFFKEMARYPLLKPNEEVELARRVKFLGEVEELRQQLQDELGRMPTKADVAAKLEL  136

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  +    +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  137   TERQLEHRLYLSRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGALGLNRATEKFD  196

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P KGYK STY YWWIRQGI+R +  ++  +RLP H+  +L+ ++ A  +L K+    P+ 
Sbjct  197   PDKGYKFSTYAYWWIRQGITRTIANDARTIRLPIHIVEKLNKLKKAHRELRKELNRNPTE  256

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +A +L+++  ++ N  +   +  SL+       D      L   + DS  + +P  ++
Sbjct  257   MELAAALDMTADQLRNLQQVRRRSLSLNHRVGKGEDT----ELMELLEDSSTQ-SPEAQM  311

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
              E  ++ E+  ++   L ERER+II L +GL   E  T E++     LSRERVRQ+   A
Sbjct  312   SEAMMRQEIYAVLGEVLTERERDIIALRYGLTTGETHTLEEVGGIFNLSRERVRQIQTKA  371

Query  340   FEKLKHAARKNRLKAML  290
               KL+     +RLK+ L
Sbjct  372   MRKLRRPQVASRLKSWL  388



>ref|WP_006622657.1| RNA polymerase sigma factor [Arthrospira maxima]
 gb|EDZ95396.1| RNA polymerase, sigma 70 subunit, RpoD family [Arthrospira maxima 
CS-328]
 gb|EKD08685.1| RNA polymerase sigma 70 subunit RpoD family [Arthrospira platensis 
C1]
Length=331

 Score =   174 bits (442),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/305 (33%), Positives = 179/305 (59%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +S++ Y++ I    LLTH + +   K ++    L+E+++ L ++LG +P+E Q A  + +
Sbjct  22    DSVRAYLREIGRVPLLTHEQEIVYGKQVQQATLLQEKRNELAKQLGYEPTEAQWAELVNL  81

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  + +  LA+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  82    SVAQLQHILHQGQLAKRKMVEANLRLVVSVAKKYIKRNVDLLDLIQEGTIGMQRGVEKFD  141

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ +L  + G   ++
Sbjct  142   PTKGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRQLAQQLGRAATM  201

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
             + +A  L+++ K++    E      SLD     + D      L   + D+   N+P    
Sbjct  202   NELAAELDLTPKQIREYLEKSRLPLSLDLRVGDNQDT----ELVDLLEDTS--NSPEQFA  255

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++ +L+ T L +++R+++ L  GL + + LT   I  R+ +SRERVRQ+   A
Sbjct  256   LNSSLRSDLESLM-TDLTDQQRQVLALRFGLDDGQTLTLAKIGDRLNISRERVRQIEREA  314

Query  340   FEKLK  326
               KL+
Sbjct  315   LTKLR  319



>ref|WP_006617776.1| RNA polymerase sigma factor [Arthrospira platensis]
 gb|KDR57372.1| RNA polymerase sigma factor [Arthrospira platensis str. Paraca]
Length=319

 Score =   174 bits (441),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/305 (33%), Positives = 179/305 (59%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +S++ Y++ I    LLTH + +   K ++    L+E+++ L ++LG +P+E Q A  + +
Sbjct  10    DSVRAYLREIGRVPLLTHEQEILYGKQVQQATLLQEKRNELAKQLGYEPTEAQWAELVNL  69

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  + +  LA+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  70    SVAQLQHILHQGQLAKRKMVEANLRLVVSVAKKYIKRNVDLLDLIQEGTIGMQRGVEKFD  129

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ +L  + G   ++
Sbjct  130   PTKGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRQLAQQLGRAATM  189

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
             + +A  L+++ K++    E      SLD     + D      L   + D+   N+P    
Sbjct  190   NELAAELDLTPKQIREYLEKSRLPLSLDLRVGDNQDT----ELVDLLEDTT--NSPEQFA  243

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++ +L+ T L +++R+++ L  GL + + LT   I  R+ +SRERVRQ+   A
Sbjct  244   LNSSLRSDLESLM-TDLTDQQRQVLALRFGLDDGQTLTLAKIGDRLNISRERVRQIEREA  302

Query  340   FEKLK  326
               KL+
Sbjct  303   LTKLR  307



>ref|WP_027844250.1| RNA polymerase sigma factor [Mastigocoleus testarum]
Length=388

 Score =   176 bits (446),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 108/318 (34%), Positives = 174/318 (55%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++        ++ L+E LG  PS E++A  L +
Sbjct  76    DAVGAFFKEMARYPLLKADEEVELARRVQFLEEFRNAQASLQEELGNQPSREKVAARLEM  135

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  136   SGKQLENRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  195

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK + G  P+ 
Sbjct  196   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQQLGRNPTE  255

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L+I   ++    +   +  SL+       D      L   + D     +P  ++
Sbjct  256   VEMAECLDIPAPQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  310

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  311   NEGMMRQEIWEVLSDVLTPREKDVISLRYGLTTSEPCTLEEVGNIFNLSRERVRQIQSKA  370

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  L+
Sbjct  371   MRKLRRPHIAKRLKGWLI  388



>ref|WP_013284771.1| MULTISPECIES: RNA polymerase sigma factor [Micromonospora]
 ref|YP_003834709.1| sigma-70 family RNA polymerase [Micromonospora aurantiaca ATCC 
27029]
 ref|YP_004081515.1| RpoD subfamily RNA polymerase sigma-70 subunit [Micromonospora 
sp. L5]
 gb|ADL45133.1| RNA polymerase sigma factor, sigma-70 family [Micromonospora 
aurantiaca ATCC 27029]
 gb|ADU07364.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Micromonospora 
sp. L5]
Length=328

 Score =   174 bits (441),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 170/316 (54%), Gaps = 26/316 (8%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+ GI   +LLT  + VELSK I+ GL+ EE+ +       C P   +L        
Sbjct  31    VRAYLNGIGRTKLLTAAQEVELSKRIEAGLFAEEKLA------TCTPVSAEL-------H  77

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              DL L   E   A++ L  +N+RLV+SIA+RY   G    DLIQ G +GL+R +EKFD +
Sbjct  78    ADLALIAAEGRAAKDHLLEANLRLVVSIAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYT  137

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLK-DKGITPSIDR  692
             KGYK STY  WWIRQ I+RA+   +  +R+P H+  +++ +     +L    G  P++  
Sbjct  138   KGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEQVNRMVRVRRELSVTLGREPTVSE  197

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A +L I + +V        ++ S DRE   S+D   GE   S + D     +P     +
Sbjct  198   VATALEIPEFQVI-------ELISYDREPV-SLDQAVGEDGESALGDFVAAVDPRTEPGD  249

Query  511   CALKDEVNN---LIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLV  344
              A   E+ N   ++  TL +RE+ +IRL  GL +    T +++ +  GLSRER+RQ+  V
Sbjct  250   AATNGELRNEVRIVLATLSQREQAVIRLRFGLDDGRQRTLDEVGREFGLSRERIRQIEKV  309

Query  343   AFEKLKHAARKNRLKA  296
                KL+   R NRL+A
Sbjct  310   TLLKLRDPERANRLEA  325



>ref|WP_019508255.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=369

 Score =   175 bits (444),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 111/320 (35%), Positives = 177/320 (55%), Gaps = 8/320 (3%)
 Frame = -1

Query  1240  LQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSL  1061
             L++++  + K +    LLT  E + L+  +KL L +E  + +L E     P++  L+ +L
Sbjct  54    LEDNIGAFFKEMARYPLLTAEEEITLANDVKLLLKVETTRKKLAEEQQQQPTKADLSAAL  113

Query  1060  RI-SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIE  884
              + S   L+L +    +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  E
Sbjct  114   GLESERQLELLLYRGKVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAIGLNRATE  173

Query  883   KFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GIT  707
             KFDP+KGYK STY YWWIRQ I+R +  ++  +RLP H+  +L+ ++ A+  LK K    
Sbjct  174   KFDPNKGYKFSTYAYWWIRQAITRTIANDARTIRLPIHIVEKLNKLKKAQRNLKQKLQRN  233

Query  706   PSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPW  527
             PS   +A+ L  S  ++    E   +  SL+     + D      L   + DS L+  P 
Sbjct  234   PSELELAKELKTSPTQLRQLLELRRQSLSLNHRVGKAEDT----ELVDLLEDSDLQ-LPE  288

Query  526   HRVDECALKDEVNNLIHTTLKEREREIIRLYHGLG-NECLTWEDISKRIGLSRERVRQVG  350
              R++E  ++ E+ +++   L +RE+++I L +GL  ++  T E++     LSRERVRQ+ 
Sbjct  289   ERMNETMMRQEITDVLDDVLTQREKDVICLRYGLSTSQPYTLEEVGGMFSLSRERVRQIQ  348

Query  349   LVAFEKLKHAARKNRLKAML  290
               A  KL+      RLK  L
Sbjct  349   SKAMRKLRRPQVARRLKGWL  368



>ref|WP_006098067.1| RNA polymerase sigma factor [Coleofasciculus chthonoplastes]
 gb|EDX78591.1| RNA polymerase sigma factor, cyanobacterial RpoD-like family 
[Coleofasciculus chthonoplastes PCC 7420]
Length=374

 Score =   175 bits (444),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 106/321 (33%), Positives = 177/321 (55%), Gaps = 15/321 (5%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E +EL+  ++  + ++E   RL + LG  P+  +LA +L +
Sbjct  62    DTVGAFFKEMARYPLLKPEEEIELATQVQFLVEMDEMTERLHQELGRKPTNAELAQALDL  121

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +    +  +    +++ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  122   TERQFENRLYRGQISKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGALGLNRAAEKFD  181

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P+KGYK STY YWWIRQ I+R +  ++  +RLP H+  +L+ ++  + +LK K   TP  
Sbjct  182   PAKGYKFSTYAYWWIRQAITRTIANDARTIRLPIHIVEKLNKLKKVQRELKQKLQRTPDE  241

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENN----P  530
               +AE+L+IS+  +    +   +  SL+           G+   + + D  LE+N    P
Sbjct  242   TELAEALDISRTNLRQLLQLRRRSLSLNHRV--------GKGEDTELVDL-LEDNDLHLP  292

Query  529   WHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQV  353
               ++ E  ++ E+++++   L ERE+++I L +GL   E  T E++     LSRERVRQ+
Sbjct  293   EQQMSESMMRQEISDVLSDVLTEREKDVISLRYGLATPESYTLEEVGSMFNLSRERVRQI  352

Query  352   GLVAFEKLKHAARKNRLKAML  290
                A  KL+      RL+  L
Sbjct  353   QSKAMRKLRRPQVARRLQGWL  373



>ref|WP_018785996.1| RNA polymerase sigma factor [Micromonospora sp. CNB394]
Length=328

 Score =   174 bits (440),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 171/316 (54%), Gaps = 26/316 (8%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+ GI   +LLT  + VELSK I+ GL+ EE+ +       C P   +L        
Sbjct  31    VRAYLNGIGRTKLLTAAQEVELSKRIEAGLFAEEKLA------TCTPVSAEL-------N  77

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              DL L + E   A++ L  +N+RLV+SIA+RY   G    DLIQ G +GL+R +EKFD +
Sbjct  78    ADLTLIVAEGRAAKDHLLEANLRLVVSIAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYT  137

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLK-DKGITPSIDR  692
             KGYK STY  WWIRQ I+RA+   +  +R+P H+  +++ +     +L    G  P++  
Sbjct  138   KGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEQVNRMVRVRRELSVTLGREPNVSE  197

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A +L I + +V        ++ S DRE   S+D   GE   S + D     +P     +
Sbjct  198   VAVALEIPEFQVI-------ELISYDREPV-SLDQAVGEDGESALGDFVAAVDPRAEPGD  249

Query  511   CALKDEVNN---LIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLV  344
              A   E+ N   ++  TL +RE+ +IRL  GL +    T +++ +  GLSRER+RQ+  V
Sbjct  250   AAANGELRNEVRIVLATLSQREQAVIRLRFGLDDGRQRTLDEVGREFGLSRERIRQIEKV  309

Query  343   AFEKLKHAARKNRLKA  296
                KL+   R NRL+A
Sbjct  310   TLLKLRDPERANRLEA  325



>ref|WP_015083407.1| RpoD family RNA polymerase sigma factor SigE [Anabaena sp. 90]
 ref|YP_007000909.1| RpoD family RNA polymerase sigma factor SigE [Anabaena sp. 90]
 gb|AFW96852.1| RpoD family RNA polymerase sigma factor SigE [Anabaena sp. 90]
Length=389

 Score =   176 bits (445),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 177/318 (56%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    ++E ++ L+ +LG  PS+ Q+A  L I
Sbjct  77    DAVGAFFKEMARYPLLKPDEEVELARRVRFLEEVKELQAALELQLGAQPSKVQVASQLEI  136

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  137   TEKQLESRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRASEKFD  196

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K    P+ 
Sbjct  197   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLARNPTE  256

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE+L I+  ++    +   +  SL+       D      L   + D     +P  ++
Sbjct  257   AEMAEALEITVHQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  311

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  312   NENMMRQEIWEVLGDVLTPREKDVISLRYGLTSSEPCTLEEVGNMFNLSRERVRQIQSKA  371

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  LV
Sbjct  372   MRKLRRPHIAKRLKGWLV  389



>ref|WP_017327858.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=327

 Score =   174 bits (440),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 108/308 (35%), Positives = 173/308 (56%), Gaps = 16/308 (5%)
 Frame = -1

Query  1243  QLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVS  1064
             Q Q+++  ++K I    LL   E + L+  ++  + LEEQ+           + EQ A+ 
Sbjct  6     QHQDAVGRFLKTIGRYRLLAPDEELLLAHQVQRAIALEEQRK-------PGATHEQWAID  58

Query  1063  LRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIE  884
             + +   DL+  + E  +A+ ++   N+RLV+SIA+RY N G    DLIQ G +GL R +E
Sbjct  59    MNLELADLQRQLEEGKIAKRRMVECNLRLVVSIAKRYRNRGLPFLDLIQEGTIGLTRAVE  118

Query  883   KFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLK-DKGIT  707
             KFDP++GYK STY  WWIRQ ++R +     M+RLP H++ ++S ++    +L    GI 
Sbjct  119   KFDPTRGYKFSTYATWWIRQSVNRGIQNKGRMIRLPAHMYEKVSKVKRKYRELSATSGIR  178

Query  706   PSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPW  527
             P ++ + +SL I        T  +S++ SL+      +    G  L  +I D   +++P 
Sbjct  179   PPVNDVFDSLEIGDNYRDLITRHMSEMRSLNL----VVGDEDGTELQHFIQDE--DSDPV  232

Query  526   HRVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVG  350
               +++ A ++EV+ L+   L ERERE+I   +GL G+  LT  +I + IGLSRERVRQ+ 
Sbjct  233   DYLNQVAHREEVHMLVE-HLGEREREVIVARYGLDGSNGLTLREIGEHIGLSRERVRQIE  291

Query  349   LVAFEKLK  326
               A  KLK
Sbjct  292   RRALRKLK  299



>ref|WP_015194125.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Stanieria cyanosphaera]
 ref|YP_007133424.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Stanieria cyanosphaera 
PCC 7437]
 gb|AFZ36458.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Stanieria cyanosphaera 
PCC 7437]
Length=318

 Score =   173 bits (439),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 106/303 (35%), Positives = 176/303 (58%), Gaps = 9/303 (3%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+K I    LLTH E +  +K ++  + +E+ K  L+++LG +P+E Q A +  I+ 
Sbjct  11    VRSYLKEIGRVPLLTHEEEILYAKRVQQQIKVEKIKESLQDKLGEEPTESQWADAAEITV  70

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              +L+  +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFDP+
Sbjct  71    EELRNIIQAGEAAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFDPT  130

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDR  692
             KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ +L + KG T +I  
Sbjct  131   KGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRQLAQQKGRTATISE  190

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +AE L ++ K+V    E   +  SLD     + D   G+ L    A      +P      
Sbjct  191   LAEELELTPKQVREYLEKSRQPISLDVRVGDNNDTELGDMLEDTGA------SPEDYATY  244

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFE  335
              +L+ +++ L+ T L  ++RE+I L  GL + + LT   I   + +SRERVRQ+   A  
Sbjct  245   SSLRKDLDKLM-TDLTPQQREVISLRFGLSDGKPLTLAKIGDCLNISRERVRQIEREALA  303

Query  334   KLK  326
             KL+
Sbjct  304   KLR  306



>ref|WP_008054282.1| RNA polymerase sigma factor [Arthrospira sp. PCC 8005]
 emb|CCE18810.1| group 2 RNA polymerase sigma factor SigD (RpoD family) [Arthrospira 
sp. PCC 8005]
 emb|CDM98340.1| group 2 RNA polymerase sigma factor SigD (RpoD family) [Arthrospira 
sp. PCC 8005]
Length=331

 Score =   174 bits (440),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 100/305 (33%), Positives = 179/305 (59%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +S++ Y++ I    LLTH + +   K ++    L+E+++ L ++LG +P+E Q A  + +
Sbjct  22    DSVRAYLREIGRVPLLTHEQEIVYGKQVQQATLLQEKRNELAKQLGYEPTEAQWAELVNL  81

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  + +  LA+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  82    SVAQLQHILHQGQLAKRKMVEANLRLVVSVAKKYIKRNVDLLDLIQEGTIGMQRGVEKFD  141

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ +L  + G   ++
Sbjct  142   PTKGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRQLAQQLGRAATM  201

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
             + +A  L+++ K++    E      SLD     + D      L   + D+   N+P    
Sbjct  202   NELAAELDLTPKQIREYLEKSRLPLSLDLRVGDNQDT----ELVDLLEDTS--NSPDEFA  255

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++ +L+ T L +++R+++ L  GL + + LT   I  R+ +SRERVRQ+   A
Sbjct  256   LNSSLRSDLESLM-TDLTDQQRQVLALRFGLDDGQTLTLAKIGDRLNISRERVRQIEREA  314

Query  340   FEKLK  326
               KL+
Sbjct  315   LTKLR  319



>ref|WP_016866539.1| RNA polymerase sigma factor [Fischerella muscicola]
Length=389

 Score =   175 bits (443),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 106/318 (33%), Positives = 177/318 (56%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    + E ++ L++ LG  P++  +A  L+I
Sbjct  77    DAVGAFFKEMARYPLLKPDEEVELARRVRFLEEVNEIQAALRQELGHQPTKANIAAHLQI  136

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  137   TEKQLENRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  196

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK + G  P+ 
Sbjct  197   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQRLGRNPNE  256

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE+L I  +++    +   +  SL+       D      L   + D     +P  ++
Sbjct  257   IEMAEALEIPPQQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  311

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  312   NESMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQSKA  371

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  L+
Sbjct  372   MRKLRRPHIAKRLKGWLI  389



>ref|WP_035158447.1| RNA polymerase sigma factor [Calothrix sp. 336/3]
Length=377

 Score =   174 bits (442),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 108/318 (34%), Positives = 177/318 (56%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++     +E ++ L E+LG  P++ ++AV   +
Sbjct  65    DAVGAFFKEMARYPLLKPDEEVELARRVRFIEDYKEMQAALIEQLGQTPTKAEIAVKFEL  124

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  125   TERQLETRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  184

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K G  PS 
Sbjct  185   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLGRNPSE  244

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L +   ++    +   +  SL+       D    E +     D +L  +P  ++
Sbjct  245   VEMAELLELPASQLRQLQQLRRQALSLNHRVGKEED---TELMDLLEDDDNL--SPEAKM  299

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  300   NESMMRQEIWEVLSDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQSKA  359

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  L+
Sbjct  360   MRKLRRPHIAKRLKGWLI  377



>ref|WP_012626060.1| RNA polymerase sigma factor [Cyanothece sp. PCC 7425]
 ref|YP_002481320.1| RpoD subfamily RNA polymerase sigma-70 subunit [Cyanothece sp. 
PCC 7425]
 gb|ACL42959.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Cyanothece 
sp. PCC 7425]
Length=372

 Score =   174 bits (442),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 107/310 (35%), Positives = 178/310 (57%), Gaps = 7/310 (2%)
 Frame = -1

Query  1240  LQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSL  1061
             L +++  ++K +    LL   E +EL++ +K  + L E K +L  +LG   +  ++A ++
Sbjct  58    LDDAVGAFLKDMARYPLLQPSEEIELARRVKYLVELSELKDQLGRQLGRSATLPEVAAAM  117

Query  1060  RISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEK  881
              ++   L++ +    +A+ K+  SN+RLV+SIA+RY N G    DL+Q G +GL R  EK
Sbjct  118   NLTEQQLQIRIYRGQVAKSKMIRSNLRLVVSIAKRYLNRGVPFLDLVQEGALGLNRATEK  177

Query  880   FDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITP  704
             FDP KG+K STY YWWIRQGI+RA+  +S  +RLP H+  +L+ ++  +  LK +    P
Sbjct  178   FDPEKGFKFSTYAYWWIRQGITRAIANDSRTIRLPIHIVEKLNKLKKLQRHLKKELQRNP  237

Query  703   SIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWH  524
             +   +A++L I+ +++     A  +  SL+R      D    E L    ADS    +P  
Sbjct  238   TEQELADALEITLEQLQMLQRARQQALSLNRRVGREED---TELLDLLEADST--QSPEK  292

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGL  347
             ++ E  ++ E++ L+   L ++ER++I L +GL   E  T E++S    LSRERVRQ+  
Sbjct  293   QMGEVMMRQEISQLLDLVLTKQERDVIILRYGLVSGEPNTLEEVSGLFNLSRERVRQIQN  352

Query  346   VAFEKLKHAA  317
              A  KL+ +A
Sbjct  353   KAIGKLRRSA  362



>ref|WP_006510917.1| RNA polymerase sigma factor, cyanobacterial RpoD-like family 
[Xenococcus sp. PCC 7305]
 gb|ELS01989.1| RNA polymerase sigma factor, cyanobacterial RpoD-like family 
[Xenococcus sp. PCC 7305]
Length=318

 Score =   173 bits (438),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/304 (35%), Positives = 177/304 (58%), Gaps = 9/304 (3%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+K I   +LLTH E +  +K ++  + L + K  L+E+LG +P+  Q A   ++S 
Sbjct  11    VRSYLKEIGRVDLLTHEEEIHYAKRVQREIALVKIKDSLQEKLGQEPTYSQWAKEAKLSV  70

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              +LK T+     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFDP+
Sbjct  71    KELKTTLEAGEAAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFDPT  130

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDR  692
             KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ KL + KG   +I  
Sbjct  131   KGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRKLAQQKGRMATIAE  190

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +AE L ++ K+V +  E   +  SLD +   + D   G+ L        +  +P      
Sbjct  191   LAEELELTPKQVRDYLEKSRQPISLDVKVGDNNDTELGDML------VDMGQSPEDYATS  244

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFE  335
              +L+ +++ L+ + L  +++E+I L  GL + + LT   I   + +SRERVRQ+   A  
Sbjct  245   SSLRKDLSRLM-SELTPQQQEVISLRFGLRDGKPLTLAKIGTFLSISRERVRQIEREALT  303

Query  334   KLKH  323
             KL+ 
Sbjct  304   KLRQ  307



>gb|KFB82371.1| RNA polymerase sigma factor [Calothrix sp. 336/3]
Length=386

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/318 (34%), Positives = 177/318 (56%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++     +E ++ L E+LG  P++ ++AV   +
Sbjct  74    DAVGAFFKEMARYPLLKPDEEVELARRVRFIEDYKEMQAALIEQLGQTPTKAEIAVKFEL  133

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  134   TERQLETRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  193

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K G  PS 
Sbjct  194   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLGRNPSE  253

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L +   ++    +   +  SL+       D    E +     D +L  +P  ++
Sbjct  254   VEMAELLELPASQLRQLQQLRRQALSLNHRVGKEED---TELMDLLEDDDNL--SPEAKM  308

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  309   NESMMRQEIWEVLSDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQSKA  368

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  L+
Sbjct  369   MRKLRRPHIAKRLKGWLI  386



>ref|WP_024544660.1| RNA polymerase sigma factor SigC [Synechococcus sp. NKBG15041c]
Length=398

 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/243 (39%), Positives = 156/243 (64%), Gaps = 9/243 (4%)
 Frame = -1

Query  1012  AREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWW  833
             A+E +  +N+RLV+S+A++Y N G E+ DLIQ G +GL R ++KFDP+KGY+ STY YWW
Sbjct  159   AKEHMIQANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVDKFDPTKGYRFSTYAYWW  218

Query  832   IRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDRIAESLNISKKKV  656
             IRQGI+RA+   S  +RLP H+  +L+ I+ A+ ++ + +G TPSI+ +A+SL+++ ++V
Sbjct  219   IRQGITRAIATQSRTIRLPVHVTEKLNKIKKAQRQISQTQGCTPSIEDVAQSLDMTAEQV  278

Query  655   TNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDECALKDEVNNLIH  476
                 + V +  SL+       D   G+ L +  A      +P   +   +L+ ++ NL+ 
Sbjct  279   REVLQKVPRSVSLEIRVGKDRDTELGDLLETQDA------SPEENLVRESLQRDLENLL-  331

Query  475   TTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLK  299
             T L +RERE+I+L +GLG+ +  +  +I + + LSRERVRQ+   A +KL+   R+N ++
Sbjct  332   TELTDREREVIQLRYGLGDGKTYSLAEIGRMLELSRERVRQIEAKALQKLRQPKRRNMMR  391

Query  298   AML  290
               L
Sbjct  392   DYL  394



>ref|WP_026719111.1| RNA polymerase sigma factor [Fischerella sp. PCC 9431]
Length=389

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/321 (34%), Positives = 175/321 (55%), Gaps = 7/321 (2%)
 Frame = -1

Query  1243  QLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVS  1064
             +  +++  + K +    LL   E VEL++ ++      E ++ L E LG  P++  +A  
Sbjct  74    EYDDAVGAFFKEMARYPLLKPEEEVELARRVRFLEEFNEIQAALAEELGHQPNKSNIAAH  133

Query  1063  LRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIE  884
             L I+   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  E
Sbjct  134   LEITEKQLENRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATE  193

Query  883   KFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GIT  707
             KFDP KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K G  
Sbjct  194   KFDPDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLGRN  253

Query  706   PSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPW  527
             P+   +AE+L I  +++    +   +  SL+       D      L   + D     +P 
Sbjct  254   PNEIEMAEALEIPPQQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPE  308

Query  526   HRVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVG  350
              +++E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+ 
Sbjct  309   AKMNESMMRHEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQ  368

Query  349   LVAFEKLKHAARKNRLKAMLV  287
               A  KL+      RLK  L+
Sbjct  369   SKAMRKLRRPHIAKRLKGWLI  389



>ref|WP_009454317.1| MULTISPECIES: RNA polymerase sigma factor [Fischerella]
 gb|EHC19622.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Fischerella 
sp. JSC-11]
Length=389

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/318 (33%), Positives = 177/318 (56%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    + E ++ L++ LG  P++  +A  L+I
Sbjct  77    DAVGAFFKEMARYPLLKPDEEVELARRVRFLEEVNEIQAALRQELGHQPTKASIAAHLQI  136

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  137   TEKQLENRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  196

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK + G  P+ 
Sbjct  197   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQRLGRNPNE  256

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE+L I  +++    +   +  SL+       D      L   + D     +P  ++
Sbjct  257   IEMAEALEIPPQQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  311

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  312   NESMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQSKA  371

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  L+
Sbjct  372   MRKLRRPHIAKRLKGWLI  389



>ref|WP_039739214.1| RNA polymerase sigma factor [Hassallia byssoidea]
 gb|KIF36871.1| RNA polymerase sigma factor [Hassallia byssoidea VB512170]
Length=389

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 176/318 (55%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    + E ++ L E+LG   S+E++A SL +
Sbjct  77    DAVGAFFKEMARYPLLKADEEVELARRVRFNEEVRELQASLSEKLGEQASKEKVASSLEM  136

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  137   TEKQLESRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  196

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDKGI-TPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K    P+ 
Sbjct  197   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLCRNPTE  256

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE+L I   ++    +   +  SL+       D      L   + D     +P  ++
Sbjct  257   AEMAEALEIPLPQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  311

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  312   NENMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQSKA  371

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  LV
Sbjct  372   MRKLRRPHIAKRLKGWLV  389



>ref|WP_027402234.1| RNA polymerase sigma factor [Aphanizomenon flos-aquae]
Length=389

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 177/318 (56%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    ++E ++ L+  LG  PS+ Q+A+ L +
Sbjct  77    DAVGAFFKEMARYPLLKPDEEVELARRVRFLEEVKELQAALELELGAHPSKVQVALQLEM  136

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  137   TEKQLESRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRASEKFD  196

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K    P+ 
Sbjct  197   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLSRNPTE  256

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AESL I+  ++    +   +  SL+       D      L   + D     +P  ++
Sbjct  257   AEMAESLEITVHQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  311

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  312   NENMMRQEIWEVLGDVLTPREKDVISLRYGLTSSEPCTLEEVGNMFNLSRERVRQIQSKA  371

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  LV
Sbjct  372   MRKLRRPHIAKRLKGWLV  389



>ref|WP_012305904.1| RNA polymerase sigma factor SigC [Synechococcus sp. PCC 7002]
 ref|YP_001733536.1| group 2 sigma factor [Synechococcus sp. PCC 7002]
 gb|ACA98280.1| Group 2 sigma factor [Synechococcus sp. PCC 7002]
Length=398

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 156/243 (64%), Gaps = 9/243 (4%)
 Frame = -1

Query  1012  AREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWW  833
             A+E +  +N+RLV+S+A++Y N G E+ DLIQ G +GL R ++KFDP+KGY+ STY YWW
Sbjct  159   AKEHMIQANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVDKFDPTKGYRFSTYAYWW  218

Query  832   IRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDRIAESLNISKKKV  656
             IRQGI+RA+   S  +RLP H+  +L+ I+ A+ ++ + +G TPS+D +A++L ++ ++V
Sbjct  219   IRQGITRAIATQSRTIRLPVHVTEKLNKIKKAQRQISQTQGCTPSLDDVAQALEMTPEQV  278

Query  655   TNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDECALKDEVNNLIH  476
                 + V +  SL+       D   G+ L +  A      +P   +   +L+ +++NL+ 
Sbjct  279   REVLQKVPRSVSLEIRVGKDRDTELGDLLETQDA------SPEENLVRESLQRDLHNLL-  331

Query  475   TTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLK  299
             T L +RERE+I+L +GLG+ +  +  +I + + LSRERVRQ+   A +KL+   R+N ++
Sbjct  332   TELTDREREVIQLRYGLGDGKTYSLAEIGRMLELSRERVRQIEAKALQKLRQPKRRNIMR  391

Query  298   AML  290
               L
Sbjct  392   DYL  394



>ref|WP_030006065.1| RNA polymerase sigma factor SigC [Synechococcus sp. NKBG042902]
Length=398

 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 156/243 (64%), Gaps = 9/243 (4%)
 Frame = -1

Query  1012  AREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWW  833
             A+E +  +N+RLV+S+A++Y N G E+ DLIQ G +GL R ++KFDP+KGY+ STY YWW
Sbjct  159   AKEHMIQANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVDKFDPTKGYRFSTYAYWW  218

Query  832   IRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDRIAESLNISKKKV  656
             IRQGI+RA+   S  +RLP H+  +L+ I+ A+ ++ + +G TPS+D +A++L ++ ++V
Sbjct  219   IRQGITRAIATQSRTIRLPVHVTEKLNKIKKAQRQISQTQGCTPSLDDVAQALEMTPEQV  278

Query  655   TNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDECALKDEVNNLIH  476
                 + V +  SL+       D   G+ L +  A      +P   +   +L+ +++NL+ 
Sbjct  279   REVLQKVPRSVSLEIRVGKDRDTELGDLLETQDA------SPEENLVRESLQRDLHNLL-  331

Query  475   TTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRLK  299
             T L +RERE+I+L +GLG+ +  +  +I + + LSRERVRQ+   A +KL+   R+N ++
Sbjct  332   TELTDREREVIQLRYGLGDGKTYSLAEIGRMLELSRERVRQIEAKALQKLRQPKRRNIMR  391

Query  298   AML  290
               L
Sbjct  392   DYL  394



>ref|WP_015163011.1| RpoD subfamily RNA polymerase sigma-70 subunit [Chroococcidiopsis 
thermalis]
 ref|YP_007100465.1| RpoD subfamily RNA polymerase sigma-70 subunit [Chroococcidiopsis 
thermalis PCC 7203]
 gb|AFY91074.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Chroococcidiopsis 
thermalis PCC 7203]
Length=324

 Score =   172 bits (437),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/301 (34%), Positives = 172/301 (57%), Gaps = 9/301 (3%)
 Frame = -1

Query  1219  YVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLA-VSLRISRTD  1043
             Y++ I    LLTH + +   K ++  + L+  K  L ++LG +PS ++ A  S ++  T 
Sbjct  18    YLREIGRVPLLTHEQEILFGKQVQRSIALQLVKDSLTKQLGREPSLDEWAKASGKLDNTQ  77

Query  1042  LKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKG  863
             L   + +   A+ K+  +N+RLV+SIA++Y     E+ DLIQ G +GL RG+EKFDP+KG
Sbjct  78    LTQAIADGESAKRKIVEANLRLVVSIAKKYTKRNLELLDLIQEGTIGLHRGVEKFDPTKG  137

Query  862   YKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSIDRIA  686
             Y+LSTY YWWIRQ I+RA+ +NS  +RLP H+  +L+ I+  + +L      TPSI  +A
Sbjct  138   YRLSTYAYWWIRQAITRAIAQNSRNIRLPIHVTEKLNKIKKTQRQLSQHLKRTPSISELA  197

Query  685   ESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDECA  506
              +L ++  +V +  E   +  SL+++     D   GE L    A      +P     + +
Sbjct  198   AALELTPNQVISYLEVARQPISLEKQVGEDRDTELGEMLQDPAA------SPEEFAIQSS  251

Query  505   LKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFEKL  329
             L D +  ++   L  ++++++ L  GL +   L+ ++I +R+  SRERVRQ+   A  KL
Sbjct  252   LSDNLKQVMAAVLTLQQQQVLSLRFGLEDGRALSLKNIGERLNFSRERVRQIQQEALAKL  311

Query  328   K  326
             +
Sbjct  312   R  312



>ref|WP_017319617.1| RNA polymerase sigma factor [cyanobacterium PCC 7702]
Length=394

 Score =   174 bits (442),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/320 (34%), Positives = 179/320 (56%), Gaps = 11/320 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    + E ++ L+++LG  P++E +A  L I
Sbjct  82    DAVGAFFKEMARYPLLKPDEEVELARRVRFLEEVNELQASLRKKLGQQPTKENIAADLGI  141

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  142   TEKQLEHRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  201

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK + G  P+ 
Sbjct  202   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQRLGRNPNE  261

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENN--PWH  524
               +A++L I  +++    +   +  SL+       D      L   + D   E+N  P  
Sbjct  262   AEMAQALEIPAQQLRQLQQLRRQALSLNHRVGKEEDT----ELVDLLED---EDNLSPEA  314

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGL  347
             +++E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+  
Sbjct  315   KMNESMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQS  374

Query  346   VAFEKLKHAARKNRLKAMLV  287
              A  KL+      RLK  L 
Sbjct  375   KAMRKLRRPHIAKRLKGWLA  394



>ref|WP_012413167.1| RNA polymerase sigma factor [Nostoc punctiforme]
 ref|YP_001870195.1| RpoD family RNA polymerase sigma factor [Nostoc punctiforme PCC 
73102]
 gb|ACC85154.1| RNA polymerase, sigma 70 subunit, RpoD family [Nostoc punctiforme 
PCC 73102]
Length=316

 Score =   172 bits (437),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 109/326 (33%), Positives = 186/326 (57%), Gaps = 27/326 (8%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +S++ Y+K I    LLT  + +  +++++  + +EEQ+S L  +L   P++ +LA SL  
Sbjct  7     DSVRSYLKEIGRYPLLTPDQEITNARLVQQMMAVEEQRSNLALQLNRQPTDLELATSLGQ  66

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +  +L+  + +   A++K+  +N+RLV+S+A++Y N   +  DL+Q G +GL RGIEKFD
Sbjct  67    NEAELQSVIQQGQKAKQKMVTANLRLVVSVAKKYQNYSLDFLDLLQEGALGLQRGIEKFD  126

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P+KGYKLSTYVYWWI Q I+RA+   S  +RLP H++ +L+ IR  + +L    G  P +
Sbjct  127   PNKGYKLSTYVYWWITQSITRAVADKSRTIRLPIHINEKLNKIRRVQQQLSQSLGRPPVV  186

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               IAESLN+S  ++    +    + SL++          G+   S +AD          +
Sbjct  187   AEIAESLNLSPNQIREYLQISKPLVSLEKRV--------GDEGESELAD-------ILPM  231

Query  517   DECALKDEVN--------NLIHTTLKEREREIIRLYHGLG-NECLTWEDISKRIGLSRER  365
             D  +L +++           +   LK R+RE++ L  GL  N+ LT   ++KR+ LSRE 
Sbjct  232   DGISLDEQITLESLQQDLAKLLALLKPRQREVLTLRFGLSDNQQLTLSQVAKRLNLSRET  291

Query  364   VRQVGLVAFEKLKHAARKNRLKAMLV  287
             +R+   +A   L+  + +N++K  L+
Sbjct  292   IRKTEHLALSILR--SHQNKIKDYLL  315



>ref|WP_011434275.1| RNA polymerase sigma factor SigC [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_478921.1| RNA polymerase sigma factor SigC [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD03658.1| RNA polymerase sigma-70 factor family [Synechococcus sp. JA-2-3B'a(2-13)]
Length=366

 Score =   174 bits (440),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 115/319 (36%), Positives = 184/319 (58%), Gaps = 16/319 (5%)
 Frame = -1

Query  1219  YVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPS-EEQLAVSLRISR--  1049
             Y++ I    LL   E V L++ ++  + L + + RL++ LG DP+  E +A + +     
Sbjct  51    YLQEIGRVPLLGRDEEVALAQKVQDYMKLLDLRLRLQKELGRDPTLAEWVAKANQYPEWA  110

Query  1048  --TDLKLTMIE--CSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEK  881
               T  KL  I+     A+E +  +N+RLV+S+A++Y N G E+ DLIQ G +GL R +EK
Sbjct  111   QLTPEKLQQIQRIGKRAKEHMIKANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVEK  170

Query  880   FDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITP  704
             FDP KGY+ STY YWWIRQGI+RA+   S  +RLP H+  +L+ I+ A+ KL ++KG TP
Sbjct  171   FDPKKGYRFSTYAYWWIRQGITRAIATQSRTIRLPVHITEKLNKIKKAQRKLSQEKGRTP  230

Query  703   SIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWH  524
             +I+ IA  L ++  +V      V +  SL+ +     D   G+ L +       + +P  
Sbjct  231   TIEDIASELEMTPPQVRELLVRVPRSVSLETKVGKDKDTELGDLLETD------DISPEE  284

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGL  347
              +   AL  ++  L+ + L  RER++IR+  GLG+    +  +I + + LSRERVRQ+  
Sbjct  285   TMMREALHRDLQQLL-SDLTSRERDVIRMRFGLGDGRTYSLAEIGRALDLSRERVRQIEA  343

Query  346   VAFEKLKHAARKNRLKAML  290
              A +KL+   R+NR++  L
Sbjct  344   KALQKLRQPKRRNRVRDYL  362



>ref|WP_011318042.1| RNA polymerase sigma factor [Anabaena variabilis]
 ref|YP_321717.1| sigma 28 (flagella/sporulation) [Anabaena variabilis ATCC 29413]
 gb|ABA20822.1| Sigma 28 (Flagella/Sporulation) [Anabaena variabilis ATCC 29413]
Length=378

 Score =   174 bits (440),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 178/320 (56%), Gaps = 11/320 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    + + ++ L+ +LG  P++ Q+A  L I
Sbjct  66    DAVGAFFKEMARYPLLKPDEEVELARRVRFLEEVRDLQADLQLQLGLHPTKAQVAAQLEI  125

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  126   TEKQLENRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  185

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K    PS 
Sbjct  186   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKFSRNPSE  245

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENN--PWH  524
               +AE+L IS  ++    +   +  SL+       D      L   + D   E+N  P  
Sbjct  246   AEMAEALEISVPQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLED---EDNLSPEA  298

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGL  347
             +++E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+  
Sbjct  299   KMNENMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQS  358

Query  346   VAFEKLKHAARKNRLKAMLV  287
              A  KL+      RLK  L+
Sbjct  359   KAMRKLRRPHIAKRLKGWLI  378



>ref|WP_014274110.1| group 2 RNA polymerase sigma factor SigD [Arthrospira platensis]
 ref|YP_005066753.1| group 2 RNA polymerase sigma factor SigD [Arthrospira platensis 
NIES-39]
 dbj|BAI88215.1| group 2 RNA polymerase sigma factor SigD [Arthrospira platensis 
NIES-39]
Length=331

 Score =   172 bits (436),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 178/305 (58%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +S++ Y++ I    LLTH + +   K ++    L+E+++ L ++L  +P+E Q A  + +
Sbjct  22    DSVRAYLREIGRVPLLTHEQEIVYGKQVQQATLLQEKRNELAKQLAYEPTEAQWAELVNL  81

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L+  + +  LA+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  82    SVAQLQHILHQGQLAKRKMVEANLRLVVSVAKKYIKRNVDLLDLIQEGTIGMQRGVEKFD  141

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ +L  + G   ++
Sbjct  142   PTKGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRQLAQQLGRAATM  201

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
             + +A  L+++ K++    E      SLD     + D      L   + D+   N+P    
Sbjct  202   NELAAELDLTPKQIREYLEKSRLPLSLDLRVGDNQDT----ELVDLLEDTT--NSPEQFA  255

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++ +L+ T L +++R+++ L  GL + + LT   I  R+ +SRERVRQ+   A
Sbjct  256   LNSSLRSDLESLM-TDLTDQQRQVLALRFGLDDGQTLTLAKIGDRLNISRERVRQIEREA  314

Query  340   FEKLK  326
               KL+
Sbjct  315   LTKLR  319



>ref|XP_001712214.1| rpoD [Hemiselmis andersenii]
 gb|ABW97889.1| rpoD [Hemiselmis andersenii]
Length=485

 Score =   176 bits (446),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 105/326 (32%), Positives = 190/326 (58%), Gaps = 11/326 (3%)
 Frame = -1

Query  1264  RSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPS  1085
             +++ G+++  +S++ Y++ I    LL   E ++L++ I   L+ E  K  L+E+L  +P+
Sbjct  120   QTVRGLQKADDSVRWYLQLIGRVRLLRPEEEIQLAREISQLLHWEHVKISLREKLQREPT  179

Query  1084  EEQLAVSLRISRTD-LKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  908
               +   + ++S     +  +     A+E++  +N+RLV+SIA+RY N G  + DLIQ G 
Sbjct  180   SSEWTAACKVSDVKKFRAILHNARRAKERMVAANLRLVVSIAKRYVNRGMSLQDLIQEGS  239

Query  907   VGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETK  728
             +GL+R  EKFD  KG+K STY  WW++Q ++RA+  +S  +RLP HL+  +S IR     
Sbjct  240   LGLIRAAEKFDSEKGFKFSTYATWWVKQAVTRAIADHSRTIRLPVHLYDTISAIRKTTRT  299

Query  727   LK-DKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYI-A  554
             L  + G +P+ + IAE +++S +K+ +  ++     SL+R   P  +      L  +I A
Sbjct  300   LNIEIGRSPTEEEIAEKMDMSVEKLRSVLQSAQPTLSLER---PLKNDDDASQLSDFIEA  356

Query  553   DSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGL  377
             D   + +P   V++  L+D++ N+I+ +L  RER+++R+ +GL +    T E+I +   +
Sbjct  357   D---QESPEEHVEKSMLRDDLENVIN-SLSPRERDVVRMRYGLDDGRIKTLEEIGQIFSV  412

Query  376   SRERVRQVGLVAFEKLKHAARKNRLK  299
             +RERVRQ+   A  KL+   R + L+
Sbjct  413   TRERVRQIEAKAIRKLRQPYRSSILR  438



>ref|WP_016864299.1| RNA polymerase sigma factor [Fischerella muscicola]
Length=318

 Score =   172 bits (435),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 103/305 (34%), Positives = 172/305 (56%), Gaps = 9/305 (3%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y++ I    LLTH E +   K ++  + L E +  L+ +LG +P+ E+ A +  +  
Sbjct  11    VRTYLREIGRVPLLTHEEEIFYGKQVQRAVALREVRELLEHQLGREPTLEEWATATHLEV  70

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
             T+L   + +  +A+ ++  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFDP+
Sbjct  71    TELDKAIADAEIAKRRMVEANLRLVVSVAKKYIKRNVDLLDLIQEGSIGMQRGVEKFDPT  130

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSIDR  692
             KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ +L  K G  PS+  
Sbjct  131   KGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRQLSQKLGRAPSVSE  190

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A+ L ++ K+V    E      SLD     + D   GE L    A      +P   V +
Sbjct  191   LAQELELTPKQVREYLEKARVPLSLDIRLGDNYDTELGEMLEDPGA------SPEDFVTQ  244

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFE  335
              +L  ++  L+   L  ++RE+I L  GL +   LT   I + + +SRERVRQ+   A  
Sbjct  245   SSLSGDLEVLM-ADLTPQQREVISLRFGLNDGHALTLAKIGEILNISRERVRQIEREALT  303

Query  334   KLKHA  320
             KL+ +
Sbjct  304   KLRKS  308



>ref|WP_026734798.1| RNA polymerase sigma factor [Fischerella sp. PCC 9605]
Length=389

 Score =   173 bits (439),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 109/321 (34%), Positives = 178/321 (55%), Gaps = 7/321 (2%)
 Frame = -1

Query  1243  QLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVS  1064
             +  +++  + K +    LL   E VEL++ ++    + E ++ L++ LG  P++  +A  
Sbjct  74    EYDDAVGAFFKEMARYPLLKPDEEVELARRVRFLEEVNEIQASLRDNLGYQPTKANVAEH  133

Query  1063  LRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIE  884
             L I+   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  E
Sbjct  134   LEITEKQLENRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATE  193

Query  883   KFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GIT  707
             KFDP KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K G  
Sbjct  194   KFDPDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLGRN  253

Query  706   PSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPW  527
             P+   +AE L I  +++    +   +  SL+       D    E +     D +L  +P 
Sbjct  254   PNEIEMAECLEIPPQQLRQLQQLRRQALSLNHRVGKEED---TELMDLLEDDDNL--SPE  308

Query  526   HRVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVG  350
              +++E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+ 
Sbjct  309   AKMNESMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQ  368

Query  349   LVAFEKLKHAARKNRLKAMLV  287
               A  KL+      RLK  LV
Sbjct  369   SKAMRKLRRPHIAKRLKGWLV  389



>ref|WP_033375375.1| RNA polymerase sigma factor, partial [Spirulina subsalsa]
Length=315

 Score =   171 bits (434),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 107/321 (33%), Positives = 181/321 (56%), Gaps = 15/321 (5%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL+K +K  + +EE +  L+ +L   P+  ++A +L I
Sbjct  3     DTVGAFFKEMARYPLLKPDEEVELAKCVKAVVAIEELREELEAQLDRPPTSAEVANALGI  62

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  63    TERQLEQRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAIGLNRAAEKFD  122

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P+KGYK STY YWWIRQ I+R +  ++  +RLP H+  +L+ ++ A+  LK +    P  
Sbjct  123   PNKGYKFSTYAYWWIRQAITRTIANDARTIRLPIHIVEKLNKLKKAQRILKQQLKRNPKE  182

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENN----P  530
             + +A  L+++  ++ +       +  L R++  S++   G+   + + D  LE+N    P
Sbjct  183   EELAAELDVTPSQLRH-------LLQLRRQSL-SLNHRVGKGEDTELVD-LLEDNDLQLP  233

Query  529   WHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLG-NECLTWEDISKRIGLSRERVRQV  353
               ++ E  ++ E+  ++   L ERE+++I L +GL  ++  T E++     LSRERVRQ+
Sbjct  234   EEQMSEIMMRQEIGEVLSDVLTEREKDVISLRYGLNTSQPYTLEEVGGMFNLSRERVRQI  293

Query  352   GLVAFEKLKHAARKNRLKAML  290
                A  KL+      RLK  L
Sbjct  294   QSKAMRKLRRPQVARRLKGWL  314



>ref|WP_015121468.1| RNA polymerase sigma factor, cyanobacterial RpoD-like family 
[Rivularia sp. PCC 7116]
 ref|YP_007058460.1| RNA polymerase sigma factor, cyanobacterial RpoD-like family 
[Rivularia sp. PCC 7116]
 gb|AFY57913.1| RNA polymerase sigma factor, cyanobacterial RpoD-like family 
[Rivularia sp. PCC 7116]
Length=378

 Score =   173 bits (438),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/318 (33%), Positives = 175/318 (55%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ +++   + + ++  +E+LG  P +  +A  + I
Sbjct  66    DAVGAFFKEMARYPLLKPDEEVELARRVRILEEVRQAQAAAQEKLGYFPDKAAIAKEMGI  125

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
              +  L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  126   VQKQLEHRLYQGKVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  185

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K    P+ 
Sbjct  186   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLARNPTE  245

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
             + +AE L+I   ++    +   +  SL+       D      L   + D     +P  R+
Sbjct  246   EELAEVLDIPANQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEARM  300

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  301   NESMMRQEIWEVLGDVLTPREKDVISLRYGLTSSEPCTLEEVGNMFNLSRERVRQIQSKA  360

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  L+
Sbjct  361   MRKLRRPHIAKRLKGWLI  378



>ref|WP_009456183.1| MULTISPECIES: RNA polymerase sigma factor [Fischerella]
 gb|EHC16162.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Fischerella 
sp. JSC-11]
Length=318

 Score =   171 bits (433),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 171/305 (56%), Gaps = 9/305 (3%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y++ I    LLTH E +   K ++    L E +  L  +LG +P+ E+ A + ++  
Sbjct  11    VRTYLREIGRVPLLTHEEEIFYGKQVQRATALHEVRELLATQLGREPTLEEWATATQLEL  70

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
             T+L   + +  +A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFDP+
Sbjct  71    TELNQAIADAEIAKRKMVEANLRLVVSVAKKYIKRNVDLLDLIQEGSIGMQRGVEKFDPT  130

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSIDR  692
             KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ +L  + G  PS+  
Sbjct  131   KGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRQLSQRLGRAPSVAE  190

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A+ L ++ ++V    E      SLD     + D   GE L    A      +P   V +
Sbjct  191   LAQELELTSRQVREYLEKARVPLSLDIRLGDNYDTELGEMLEDPGA------SPEEFVTQ  244

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFE  335
              +L  ++  L+   L  ++RE+I L  GL +   LT   I + + +SRERVRQ+   A  
Sbjct  245   SSLSGDLERLM-AELTPQQREVISLRFGLNDGHALTLAKIGEILNISRERVRQIEREALS  303

Query  334   KLKHA  320
             KL+ +
Sbjct  304   KLRKS  308



>ref|WP_039716965.1| RNA polymerase sigma factor [Scytonema millei]
 gb|KIF19482.1| RNA polymerase sigma factor [Scytonema millei VB511283]
Length=318

 Score =   171 bits (433),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 172/303 (57%), Gaps = 9/303 (3%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y++ I    LLTH + +   K ++    L   +  L  +LG +P+ E+ + + RI +
Sbjct  11    VRTYLREIGRVPLLTHEQEIVYGKQVQRLSILYALQEELVAKLGREPTLEEWSEAARIDK  70

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
             T L   + E  +A+ ++  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFDP+
Sbjct  71    TALSTAIAEGEIAKRRMVEANLRLVVSVAKKYIKRNVDLLDLIQEGTIGMQRGVEKFDPT  130

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDR  692
             KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ +L ++ G  PSI  
Sbjct  131   KGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRQLSQNLGRAPSIAE  190

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A +L ++ K+V    E      SLD     + D   GE L     D+ L  +P   V E
Sbjct  191   LATALELTPKQVREYLERARLPLSLDLRVGDNQDTELGELLE----DTSL--SPEEFVTE  244

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFE  335
               L  ++  L+   L  ++RE++ L  GL + + +T   I  R+ +SRERVRQ+   A  
Sbjct  245   SCLSTDIEKLM-ADLTPQQREVLSLRFGLADGQAMTLAKIGDRLNISRERVRQIEREALT  303

Query  334   KLK  326
             KL+
Sbjct  304   KLR  306



>ref|WP_030337412.1| RNA polymerase sigma factor SigB [Micromonospora parva]
Length=338

 Score =   171 bits (434),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 111/317 (35%), Positives = 178/317 (56%), Gaps = 28/317 (9%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+ GI   +LLT  + V+L++ I+ GL+ +E+ +       C P   +L       R
Sbjct  41    VRAYLNGIGRTKLLTAAQEVDLARRIEAGLFADEKLA------TCIPVSAEL-------R  87

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              DL+L + E   A++ L  +N+RLV+SIA+RY   G    DLIQ G +GL+R +EKFD +
Sbjct  88    ADLELIVAEGRAAKDHLLEANLRLVVSIAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYA  147

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLK-DKGITPSIDR  692
             KGYK STY  WWIRQ I+RA+   +  +R+P H+  +++ +  A  +L    G  P++  
Sbjct  148   KGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEQVNRMVRARRELAVTLGREPTVAE  207

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSID---GLPGES-LHSYIADSHLENNPWH  524
             +A +L I + +V        ++ S DRE   S+D   G  GES L  ++A       P  
Sbjct  208   VARALEIPEIQVI-------ELISYDREPV-SLDQAVGDDGESALGDFVASVDPRTEPGD  259

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGL  347
                +  L++EV +++ +TL +RE+ +IRL  GL +    T +++ +  GLSRER+RQ+  
Sbjct  260   AAAQGELRNEV-SIVLSTLSQREQAVIRLRFGLDDGRQRTLDEVGREFGLSRERIRQIEK  318

Query  346   VAFEKLKHAARKNRLKA  296
             V   KL+   R  RL+A
Sbjct  319   VTLLKLRAPERAQRLEA  335



>ref|WP_015178894.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Oscillatoria 
nigro-viridis]
 ref|YP_007118104.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Oscillatoria 
nigro-viridis PCC 7112]
 gb|AFZ09688.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Oscillatoria 
nigro-viridis PCC 7112]
Length=357

 Score =   172 bits (436),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 111/307 (36%), Positives = 169/307 (55%), Gaps = 15/307 (5%)
 Frame = -1

Query  1192  LLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSL  1013
             LLT  E VEL++ ++  + L+E + RL++ L   P++ +LA +L IS T L+    +C  
Sbjct  59    LLTAAEEVELARRVQELVALDELEQRLQQELDRVPTKAELAAALGISETQLQQLRHQCQS  118

Query  1012  AREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWW  833
             A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFDP KGYK STY YWW
Sbjct  119   AKRKMISSNLRLVVSIAKRYLNRGVPFLDLIQEGALGLNRAAEKFDPEKGYKFSTYAYWW  178

Query  832   IRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSIDRIAESLNISKKKV  656
             IRQGI+R +      +RLP H+  +L+ ++     LK      P+   +A  + +S + +
Sbjct  179   IRQGITRTIANQGRTIRLPVHIVEQLNKLKKVYRDLKRSLQRNPTETELAREMEVSCEHL  238

Query  655   TNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENN----PWHRVDECALKDEVN  488
                 +   +  SL+           G    S + D  LE+N    P  +++E  ++ ++ 
Sbjct  239   RYLQQVRRQSLSLNHRI--------GSEESSELLDV-LEDNATQSPEAQMNEMMMRQDIL  289

Query  487   NLIHTTLKEREREIIRLYHG-LGNECLTWEDISKRIGLSRERVRQVGLVAFEKLKHAARK  311
              ++ + L ERE+EI+ + +G L  E  T E++S    LSRERVRQ+   A  KL+     
Sbjct  290   EVLDSILTEREKEIVAMRYGLLTGEPYTLEEVSSLFNLSRERVRQIQNKAMRKLRRPQVT  349

Query  310   NRLKAML  290
              RLK  L
Sbjct  350   ERLKGWL  356



>ref|WP_039714940.1| RNA polymerase sigma factor SigC [Scytonema millei]
 gb|KIF17375.1| RNA polymerase sigma factor SigC [Scytonema millei VB511283]
Length=416

 Score =   174 bits (440),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 114/313 (36%), Positives = 174/313 (56%), Gaps = 31/313 (10%)
 Frame = -1

Query  1156  MIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMI----------------  1025
             +IK  + L E + RL   LG  PS E+ A S  IS  +LK  +                 
Sbjct  107   IIKTYITLIEAQERLTSELGHRPSLERWAASAGISVMELKPALAVGKRRWAEIAKITVEE  166

Query  1024  ------ECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKG  863
                   E   A+E +  +N+RLV+S+A++Y N G E+ DL+Q G +GL R +EKFDP+KG
Sbjct  167   LEQIQNEGIHAKEHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKFDPTKG  226

Query  862   YKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDRIA  686
             Y+ STY YWWIRQGI+RA+   S  +RLP H+  +L+ I+ A+ KL ++KG TP+I+ IA
Sbjct  227   YRFSTYAYWWIRQGITRAIATQSRTIRLPVHITEKLNKIKKAQRKLAQEKGRTPTIEDIA  286

Query  685   ESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDECA  506
               L ++  +V      V +  SL+ +     D   G+ L +   DS    +P   +   A
Sbjct  287   LELEMTAPQVREVLLRVPRSVSLETKVGKEKDTELGDLLEN---DS---ISPEELLMREA  340

Query  505   LKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFEKL  329
             L  ++  L+   L +RER++I +  GLG+  C +  +I + + LSRERVRQ+   A +KL
Sbjct  341   LHRDLQQLL-ADLTDRERDVILMRFGLGDGHCYSLAEIGRALDLSRERVRQIESKALQKL  399

Query  328   KHAARKNRLKAML  290
             +   R+NR++  L
Sbjct  400   RQPKRRNRVRDYL  412



>ref|WP_017309882.1| RNA polymerase sigma factor [Fischerella sp. PCC 9339]
Length=318

 Score =   171 bits (432),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 103/305 (34%), Positives = 171/305 (56%), Gaps = 9/305 (3%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y++ I    LLTH E +   K ++  + L E +  L+ +LG +P+ E+ A +  +  
Sbjct  11    VRTYLREIGRVPLLTHEEEIFYGKQVQRAVALREVRELLEHQLGREPTLEEWATATHLEV  70

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
             T+L   +    +A+ ++  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFDP+
Sbjct  71    TELDKAIANAEIAKRRMVEANLRLVVSVAKKYIKRNVDLLDLIQEGSIGMQRGVEKFDPT  130

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSIDR  692
             KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ +L  K G  PS+  
Sbjct  131   KGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRQLSQKLGRAPSVSE  190

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A+ L ++ K+V    E      SLD     + D   GE L    A      +P   V +
Sbjct  191   LAQELELTPKQVREYLEKARVPLSLDIRLGDNYDTELGEMLEDPGA------SPEDFVTQ  244

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFE  335
              +L  ++  L+   L  ++RE+I L  GL +   LT   I + + +SRERVRQ+   A  
Sbjct  245   SSLSGDLEVLM-ADLTPQQREVISLRFGLNDGHALTLAKIGEILNISRERVRQIEREALT  303

Query  334   KLKHA  320
             KL+ +
Sbjct  304   KLRKS  308



>ref|WP_015227673.1| RpoD subfamily RNA polymerase sigma-70 subunit [Halothece sp. 
PCC 7418]
 ref|YP_007170015.1| RpoD subfamily RNA polymerase sigma-70 subunit [Halothece sp. 
PCC 7418]
 gb|AFZ45801.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Halothece sp. 
PCC 7418]
Length=394

 Score =   173 bits (438),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 109/316 (34%), Positives = 182/316 (58%), Gaps = 11/316 (3%)
 Frame = -1

Query  1237  QNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLR  1058
             ++S++ Y++ I    LL   E +EL++ I   L LE +++ L+  +GC+P++E+ A  + 
Sbjct  82    EDSIRLYLQEIGRIRLLRADEEIELARKIADLLELERKRTELEATIGCEPTDEEWAEEVD  141

Query  1057  ISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKF  878
             +     +  ++    A+EK+  SN+RLV+SIA++Y N G    DLIQ G +GL+R  EKF
Sbjct  142   MPLQKFRRRLMLGRRAKEKMVQSNLRLVVSIAKKYMNRGLSFQDLIQEGSLGLIRAAEKF  201

Query  877   DPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL--KDKGITP  704
             D  KGYK STY  WWIRQ I+RA+   S  +RLP HL+  +S I+   TKL  ++ G  P
Sbjct  202   DHEKGYKFSTYATWWIRQAITRAIADQSRTIRLPVHLYETISRIKKT-TKLLSQELGRKP  260

Query  703   SIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWH  524
             + + IAE + ++ +K+    ++     SL+       D   G+ +    AD      P  
Sbjct  261   TEEEIAERMEMTIEKLRFIAKSAQLPISLETPIGKEEDSRLGDFIE---ADGE---TPED  314

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECL-TWEDISKRIGLSRERVRQVGL  347
              V +  L++++ +++  TL  RER+++RL +GL +  + T E+I +   ++RER+RQ+  
Sbjct  315   EVSKSLLREDLEDVLD-TLSPRERDVLRLRYGLEDGRMKTLEEIGQIFNVTRERIRQIEA  373

Query  346   VAFEKLKHAARKNRLK  299
              A  KL+H  R + LK
Sbjct  374   KALRKLRHPNRNSILK  389



>ref|WP_015364264.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Anabaena cylindrica]
 ref|YP_007378793.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Anabaena cylindrica 
PCC 7122]
 gb|AFZ61112.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Anabaena cylindrica 
PCC 7122]
Length=332

 Score =   171 bits (433),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 100/296 (34%), Positives = 168/296 (57%), Gaps = 9/296 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             ++++ Y+  I    LLTH + +  +K ++  + +   K  L E+L  +P+ ++ A  +++
Sbjct  23    DAVRIYLHKIGRIPLLTHEQEIFFAKQVQQMMVMLTAKEELSEKLQREPTRQEWADKMQL  82

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
                 L   + +  +A++K+  +N+RLV+SIA++Y     E  DLIQ G +GL RG+EKFD
Sbjct  83    EEDMLLQQLSQGQIAKQKMIQANLRLVVSIAKKYQKRNIEFLDLIQEGALGLERGVEKFD  142

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P+ GYK STY YWWIRQGI+RA+ + S  +RLP H+  +L+ I+  + +L  K G T  +
Sbjct  143   PTLGYKFSTYAYWWIRQGITRAIAQQSRTIRLPIHMADKLNKIKRVQRELSQKLGHTADV  202

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               IA++LN+  +++    +   +  SLD      I    G  L   + D  +  +P    
Sbjct  203   TEIAQALNLEPRQIRECLQFARQPVSLDM----GIGSEQGTQLQDMLKDDGM--SPERYT  256

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGNEC-LTWEDISKRIGLSRERVRQV  353
             +   L  +V+ L+   L  +++E++ L  GL   C LT   IS+RIG+ RERVRQ+
Sbjct  257   ERELLYQDVHKLL-AKLTPQQKEVLILRFGLAGGCELTLVQISQRIGICRERVRQL  311



>ref|WP_011430851.1| RNA polymerase sigma factor SigC [Synechococcus sp. JA-3-3Ab]
 ref|YP_475440.1| RNA polymerase sigma factor SigC [Synechococcus sp. JA-3-3Ab]
 gb|ABD00177.1| RNA polymerase sigma-70 factor family [Synechococcus sp. JA-3-3Ab]
Length=364

 Score =   172 bits (435),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 113/319 (35%), Positives = 181/319 (57%), Gaps = 16/319 (5%)
 Frame = -1

Query  1219  YVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLR-----I  1055
             Y++ I    LL   E V L++ ++  + L + + RL++ LG +P+  + A          
Sbjct  49    YLQEIGRVPLLGRDEEVALAQRVQDYMKLLDVRLRLQKELGREPTLAEWAARANQYPEWA  108

Query  1054  SRTDLKLTMIE--CSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEK  881
             + T  KL  I+     A+E +  +N+RLV+S+A++Y N G E+ DLIQ G +GL R +EK
Sbjct  109   NLTPEKLQQIQRIGKRAKEHMIKANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVEK  168

Query  880   FDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITP  704
             FDP KGY+ STY YWWIRQGI+RA+   S  +RLP H+  +L+ I+ A+ KL ++KG TP
Sbjct  169   FDPKKGYRFSTYAYWWIRQGITRAIATQSRTIRLPVHITEKLNKIKKAQRKLSQEKGRTP  228

Query  703   SIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWH  524
             +I+ IA  L ++  +V      V +  SL+ +     D   G+ L +       + +P  
Sbjct  229   TIEDIASELEMTVPQVRELLVRVPRSVSLETKVGKDKDTELGDLLETD------DISPEE  282

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGL  347
              +   AL  ++  L+   L  RER++IR+  GLG+    +  +I + + LSRERVRQ+  
Sbjct  283   TMMREALHRDLQQLL-ADLTSRERDVIRMRFGLGDGRTYSLAEIGRALDLSRERVRQIEA  341

Query  346   VAFEKLKHAARKNRLKAML  290
              A +KL+   R+NR++  L
Sbjct  342   KALQKLRQPKRRNRVRDYL  360



>ref|WP_015114702.1| RpoD subfamily RNA polymerase sigma-70 subunit [Nostoc sp. PCC 
7107]
 ref|YP_007051651.1| RpoD subfamily RNA polymerase sigma-70 subunit [Nostoc sp. PCC 
7107]
 gb|AFY44501.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Nostoc sp. 
PCC 7107]
Length=377

 Score =   172 bits (436),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 179/320 (56%), Gaps = 11/320 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    + E ++ L+E+LG  P++ Q+A  L +
Sbjct  65    DAVGAFFKEMARYPLLKADEEVELARRVRFLEEVREIQAALQEQLGQQPTKVQVAAQLDL  124

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  125   TEKQLESRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  184

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K G  PS 
Sbjct  185   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLGHNPSE  244

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENN--PWH  524
               +A  L ++ +++    +   +  SL+       D      L   + D   E+N  P  
Sbjct  245   AEMAAFLEMTVQQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLED---EDNLSPEA  297

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGL  347
             +++E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+  
Sbjct  298   KMNENMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQS  357

Query  346   VAFEKLKHAARKNRLKAMLV  287
              A  KL+      RLK  L+
Sbjct  358   KAMRKLRRPHIAKRLKGWLI  377



>ref|WP_015135175.1| RpoD subfamily RNA polymerase sigma-70 subunit [Leptolyngbya 
sp. PCC 7376]
 ref|YP_007072262.1| RpoD subfamily RNA polymerase sigma-70 subunit [Leptolyngbya 
sp. PCC 7376]
 gb|AFY39428.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Leptolyngbya 
sp. PCC 7376]
Length=373

 Score =   172 bits (436),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 111/319 (35%), Positives = 178/319 (56%), Gaps = 8/319 (3%)
 Frame = -1

Query  1237  QNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLR  1058
             ++++  + K +    LL   E ++L+  +K     EE++  L E LG  PS+E+ A  L+
Sbjct  59    EDTVGAFFKEMARYPLLKPDEEIQLAHSVKFLNDAEEKRLALTEELGRSPSKEEWAAVLK  118

Query  1057  ISRT-DLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEK  881
             I+   +L   + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EK
Sbjct  119   IATIRELNSQLYKGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAIGLNRAAEK  178

Query  880   FDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITP  704
             FDP+KGYK STY YWWIRQ I+R +  ++  +RLP H+  +L+ ++ A+  LK K    P
Sbjct  179   FDPNKGYKFSTYAYWWIRQAITRTIANDARTIRLPIHIVEKLNKLKKAQRTLKQKLQRNP  238

Query  703   SIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWH  524
             S   +A+ L+IS  ++ +  +   +  SL+       D      L   + D  L+  P  
Sbjct  239   SETELAQELDISADQLHHLLQLRRQSLSLNHRVGKGEDT----ELVDLLEDDGLQ-LPEE  293

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECL-TWEDISKRIGLSRERVRQVGL  347
             R+ E  ++ E+ +++   L +RE+E+I L +GL +E   T E++     LSRERVRQ+  
Sbjct  294   RMSEAMMRQELWDVLGDVLTDREKEVIALRYGLSSEQPHTLEEVGGIFNLSRERVRQIQS  353

Query  346   VAFEKLKHAARKNRLKAML  290
              A  KL+      +LK+ L
Sbjct  354   KAMRKLRRPQVARKLKSWL  372



>ref|WP_039200267.1| RNA polymerase sigma factor [Aphanizomenon flos-aquae]
 gb|KHG42696.1| RNA polymerase sigma factor [Aphanizomenon flos-aquae 2012/KM/D3]
Length=389

 Score =   172 bits (437),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 175/318 (55%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    ++E ++ L+  LG  PS+ Q+A  L +
Sbjct  77    DAVGAFFKEMARYPLLKPDEEVELARRVRFLEEVKELQAALELELGAYPSKVQVASQLEM  136

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L   + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  137   TEKQLDSRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRASEKFD  196

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K    P+ 
Sbjct  197   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLSRNPTE  256

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AESL I+  ++    +   +  SL+       D      L   + D     +P  ++
Sbjct  257   AEMAESLEITVHQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  311

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  312   NENMMRQEIWEVLGDVLTPREKDVISLRYGLTSSEPCTLEEVGNMFNLSRERVRQIQSKA  371

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  LV
Sbjct  372   MRKLRRPHIAKRLKGWLV  389



>ref|WP_026206947.1| RNA polymerase sigma factor SigB [Actinoplanes globisporus]
Length=326

 Score =   171 bits (432),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 116/316 (37%), Positives = 173/316 (55%), Gaps = 30/316 (9%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+ GI    LLT  E VELSK I+ GLY EE+     + L       QL        
Sbjct  33    VRAYLNGIGRTRLLTAVEEVELSKRIEAGLYAEEKLPEAGDDLA------QL--------  78

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
               L++ + E   A+  L  +N+RLV+SIA+RY   G    DLIQ G +GL+R +EKFD +
Sbjct  79    --LEIVIAEGKAAKNHLLEANLRLVVSIAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYT  136

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSIDR  692
             KGYK STY  WWIRQ I+RA+   +  +R+P H+  +++ +  A   L    G  PSI  
Sbjct  137   KGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEQVNRMVRARRDLAATLGREPSISE  196

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIAD---SHLENNPWHR  521
             IA+++ + + +V        ++ S DRE   S+D   GE   S + D   +   +NP + 
Sbjct  197   IAKAMGVPEFQVI-------ELISYDREPV-SLDQAVGEDGESALGDFVAAVDASNPANN  248

Query  520   VDECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLV  344
             V +  L++EV  ++  TL ERE  +IRL  GL +    T +++ +  GLSRER+RQ+  V
Sbjct  249   VGQGELRNEV-EIVLATLSERESAVIRLRFGLDDGRQRTLDEVGREFGLSRERIRQIEKV  307

Query  343   AFEKLKHAARKNRLKA  296
                KL+   R +RL+A
Sbjct  308   TMLKLRDPERASRLEA  323



>ref|WP_009148755.1| RNA polymerase sigma factor SigC [Moorea producens]
 gb|EGJ30818.1| RNA polymerase, sigma subunit, RpsC/SigC [Moorea producens 3L]
 gb|AEE81158.1| putative RNA polymerase sigma subunit [Moorea producens 3L]
Length=417

 Score =   173 bits (439),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 111/315 (35%), Positives = 175/315 (56%), Gaps = 31/315 (10%)
 Frame = -1

Query  1162  SKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSL----------  1013
              K+++  ++L E   RL  +LG  PS E+ A +  I  + LK +M    L          
Sbjct  106   DKVMERFVHLIEIHDRLASQLGHRPSLERWATAAGIDVSQLKPSMSAGKLRWAELAELTS  165

Query  1012  ------------AREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
                         A+E +  +N+RLV+S+A++Y N G E+ DLIQ G +GL R +EKFDP+
Sbjct  166   KELEQVQAEGLQAKEHMIKANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVEKFDPT  225

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDR  692
             KGY+ STY YWWIRQGI+RA+   S  +RLP H+  +L+ I+ A+ K+ +++G T +ID 
Sbjct  226   KGYRFSTYAYWWIRQGITRAIATQSRTIRLPVHITEKLNKIKKAQRKISQERGRTATIDD  285

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             IA  L ++  +V      V +  SL+ +     D   G+ L +       E +P   +  
Sbjct  286   IAVELEMTAAQVREVLLRVPRSVSLEIKVGKERDTELGDLLETE------ETSPEEVLMR  339

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGLG-NECLTWEDISKRIGLSRERVRQVGLVAFE  335
              AL+ ++  L+   L  RER++IR+  GLG N+  +  +I + + LSRERVRQ+   A +
Sbjct  340   EALQRDLQQLL-ADLTNRERDVIRMRFGLGDNQPYSLAEIGRALDLSRERVRQIEAKALQ  398

Query  334   KLKHAARKNRLKAML  290
             KL+   R+NR++  L
Sbjct  399   KLRQPKRRNRVRDYL  413



>ref|WP_016953126.1| RNA polymerase sigma factor [Anabaena sp. PCC 7108]
Length=389

 Score =   172 bits (437),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 107/318 (34%), Positives = 176/318 (55%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    +++ +  L+  LG +PS+ ++A    +
Sbjct  77    DAVGAFFKEMARYPLLKPDEEVELARRVRFLEEVKDLQDALELELGQEPSKSEVAAKFDM  136

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  137   TEKQLESRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRAAEKFD  196

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K    PS 
Sbjct  197   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLARNPSE  256

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AESL IS +++    +   +  SL+       D      L   + D     +P  ++
Sbjct  257   AEMAESLEISVQQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  311

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  312   NENMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQSKA  371

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  L+
Sbjct  372   MRKLRRPHIAKRLKGWLI  389



>ref|WP_015152358.1| RNA polymerase, sigma subunit, RpsC/SigC [Chroococcidiopsis thermalis]
 ref|YP_007089676.1| RNA polymerase, sigma subunit, RpsC/SigC [Chroococcidiopsis thermalis 
PCC 7203]
 gb|AFY85807.1| RNA polymerase, sigma subunit, RpsC/SigC [Chroococcidiopsis thermalis 
PCC 7203]
Length=416

 Score =   173 bits (438),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 115/313 (37%), Positives = 176/313 (56%), Gaps = 31/313 (10%)
 Frame = -1

Query  1156  MIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISRTDLK---------------LTMIE  1022
             +IK  + L E + RL   LG  PS E+ A S  IS  +LK               +T+ E
Sbjct  107   IIKTYITLIEAQERLTSELGHRPSLERWAASAGISVMELKPALAVGKRRWAEIAKITVEE  166

Query  1021  CSL-------AREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKG  863
                       A+E +  +N+RLV+S+A++Y N G E+ DL+Q G +GL R +EKFDP+KG
Sbjct  167   LEQIQNDGIHAKEHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKFDPTKG  226

Query  862   YKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDRIA  686
             Y+ STY YWWIRQGI+RA+   S  +RLP H+  +L+ I+ A+ KL ++KG TP+I+ IA
Sbjct  227   YRFSTYAYWWIRQGITRAIATQSRTIRLPVHITEKLNKIKKAQRKLAQEKGRTPTIEDIA  286

Query  685   ESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDECA  506
               L ++  +V      V +  SL+ +     D   G+ L +   DS    +P   +   A
Sbjct  287   LELEMTAPQVREVLLRVPRSVSLETKVGKEKDTELGDLLEN---DS---ISPEELLMREA  340

Query  505   LKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFEKL  329
             L  ++  L+   L +RER++I +  GLG+  C +  +I + + LSRERVRQ+   A +KL
Sbjct  341   LHRDLQQLL-ADLTDRERDVILMRFGLGDGHCYSLAEIGRALDLSRERVRQIESKALQKL  399

Query  328   KHAARKNRLKAML  290
             +   R+NR++  L
Sbjct  400   RQPKRRNRVRDYL  412



>ref|WP_026720446.1| RNA polymerase sigma factor [Fischerella sp. PCC 9431]
Length=318

 Score =   170 bits (431),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 172/305 (56%), Gaps = 9/305 (3%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y++ I    LLTH E +   K ++  + L E +  L+ +LG +P+ E+ A +  +  
Sbjct  11    VRTYLREIGRVPLLTHEEEIFYGKQVQRAVSLREVRELLEHQLGREPTLEEWATATHLEI  70

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
             T+L   + +  +A+ ++  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFDP+
Sbjct  71    TELDKAIADAEIAKRRMVEANLRLVVSVAKKYIKRNVDLLDLIQEGSIGMQRGVEKFDPT  130

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSIDR  692
             KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ +L  + G  PS+  
Sbjct  131   KGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRQLSQQLGRAPSVSE  190

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A+ L ++ K+V    E      SLD     + D   GE L    A      +P   V +
Sbjct  191   LAQELQLTPKQVREYLEKARVPLSLDIRLGDNYDTELGEMLEDPGA------SPEDFVTQ  244

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFE  335
              +L  ++  L+   L  ++RE+I L  GL +   LT   I + + +SRERVRQ+   A  
Sbjct  245   SSLSGDLEVLM-ADLTPQQREVISLRFGLNDGHALTLAKIGEILNISRERVRQIEREALS  303

Query  334   KLKHA  320
             KL+ +
Sbjct  304   KLRKS  308



>ref|WP_015155343.1| RpoD subfamily RNA polymerase sigma-70 subunit [Chroococcidiopsis 
thermalis]
 ref|YP_007092667.1| RpoD subfamily RNA polymerase sigma-70 subunit [Chroococcidiopsis 
thermalis PCC 7203]
 gb|AFY88798.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Chroococcidiopsis 
thermalis PCC 7203]
Length=318

 Score =   170 bits (431),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 172/303 (57%), Gaps = 9/303 (3%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y++ I    LLTH + +   K ++    L   +  L  +LG +P+ E+ + + RI +
Sbjct  11    VRTYLREIGRVPLLTHEQEIVYGKQVQRLSTLYALQEELVAKLGREPTLEEWSEAARIDK  70

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
             T L   + E  +A+ ++  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFDP+
Sbjct  71    TALSTAIAEGEIAKRRMVEANLRLVVSVAKKYIKRNVDLLDLIQEGTIGMQRGVEKFDPT  130

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDR  692
             KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ +L ++ G  PSI  
Sbjct  131   KGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRQLSQNLGRAPSIVE  190

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A +L ++ K+V    E      SLD     + D   GE L     D+ L  +P   V E
Sbjct  191   LATALELTPKQVREYLERARLPLSLDLRVGDNQDTELGELLE----DTSL--SPEEFVTE  244

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFE  335
               L  ++  L+   L  ++RE++ L  GL + + +T   I  R+ +SRERVRQ+   A  
Sbjct  245   SCLSTDIEKLM-ADLTPQQREVLSLRFGLADGQAMTLAKIGDRLNISRERVRQIEREALT  303

Query  334   KLK  326
             KL+
Sbjct  304   KLR  306



>ref|WP_026097712.1| RNA polymerase sigma factor SigC [Geitlerinema sp. PCC 7105]
Length=418

 Score =   173 bits (438),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 98/258 (38%), Positives = 154/258 (60%), Gaps = 9/258 (3%)
 Frame = -1

Query  1057  ISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKF  878
             +S  +L+    E   A+  +  +N+RLV+S+A++Y   G E+ DLIQ G +GL R +EKF
Sbjct  164   LSLEELEQVQAEGIRAKAHMIKANLRLVVSVAKKYQKRGLELLDLIQEGTIGLERAVEKF  223

Query  877   DPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPS  701
             DP++GY+ STY YWWIRQGI+RA+   S  +RLP H+  +L+ I+ A+ +  +D G TP+
Sbjct  224   DPTRGYRFSTYAYWWIRQGITRAIATQSRTIRLPVHITEKLNKIKKAQRQFAQDNGRTPT  283

Query  700   IDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHR  521
             ID IA+ L+++  ++      V +  SLD +     D   GE L +  A      +P   
Sbjct  284   IDDIAKELDMTSDQIREVMLRVPRSISLDAKVGKEKDTELGELLETDDA------SPEDL  337

Query  520   VDECALKDEVNNLIHTTLKEREREIIRLYHGLGNEC-LTWEDISKRIGLSRERVRQVGLV  344
             +   +L+ E+ +L+   L  RER++IRL  GLG E   +  +I + + LSRERVRQ+   
Sbjct  338   LMRESLQRELQHLL-ADLSSRERDVIRLRFGLGGETPYSLAEIGRALELSRERVRQIEAK  396

Query  343   AFEKLKHAARKNRLKAML  290
             A +KL+   R+NR++  L
Sbjct  397   ALQKLRQPKRRNRVRDFL  414



>ref|WP_017316251.1| RNA polymerase sigma factor [Mastigocladopsis repens]
Length=389

 Score =   172 bits (436),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 109/323 (34%), Positives = 178/323 (55%), Gaps = 11/323 (3%)
 Frame = -1

Query  1243  QLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVS  1064
             +  +++  + K +    LL   E VEL++ ++    + E +  L E+LG   S+  +A  
Sbjct  74    EYDDAVGAFFKEMARYPLLKPDEEVELARRVRFVEEIRELQVSLFEQLGDQASKATVASH  133

Query  1063  LRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIE  884
             L ++   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  E
Sbjct  134   LEMTEKQLEHRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATE  193

Query  883   KFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GIT  707
             KFDP KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK + G  
Sbjct  194   KFDPDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQRLGRN  253

Query  706   PSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENN--  533
             PS + +AE+L I   ++    +   +  SL+       D      L   + D   E+N  
Sbjct  254   PSEEEMAEALEIPAPQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLED---EDNLS  306

Query  532   PWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQ  356
             P  +++E  ++ E+ +++   L  RE+++I L +GL  +E  T E++     LSRERVRQ
Sbjct  307   PEAKMNESMMRQEIWDVLGDVLTPREKDVISLRYGLITSEPCTLEEVGTMFNLSRERVRQ  366

Query  355   VGLVAFEKLKHAARKNRLKAMLV  287
             +   A  KL+      RLK  L+
Sbjct  367   IQSKAMRKLRRPHIAKRLKGWLI  389



>ref|WP_013192486.1| RNA polymerase sigma factor [Trichormus azollae]
 ref|YP_003722597.1| RpoD subfamily RNA polymerase sigma 70 subunit ['Nostoc azollae' 
0708]
 gb|ADI65474.1| RNA polymerase, sigma 70 subunit, RpoD subfamily ['Nostoc azollae' 
0708]
Length=389

 Score =   172 bits (436),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 106/318 (33%), Positives = 175/318 (55%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    +++ ++ L+E LG  PS  ++A    +
Sbjct  77    DAVGAFFKEMARYPLLKPDEEVELARRVRFLEEVKDLQAALEEELGQQPSRSEVAAKFEM  136

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  137   TEKQLESRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  196

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K    PS 
Sbjct  197   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLARNPSE  256

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +A +L IS +++    +   +  SL+       D      L   + D     +P  ++
Sbjct  257   AEMATALEISIQQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  311

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  312   NENMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQSKA  371

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  L+
Sbjct  372   MRKLRRPHIAKRLKGWLI  389



>ref|WP_015956473.1| RNA polymerase sigma factor [Cyanothece sp. PCC 7424]
 ref|YP_002379758.1| RNA polymerase sigma factor SigD [Cyanothece sp. PCC 7424]
 gb|ACK72890.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Cyanothece 
sp. PCC 7424]
Length=318

 Score =   170 bits (431),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 105/318 (33%), Positives = 180/318 (57%), Gaps = 11/318 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             + ++ Y++ I    LLTH E + L+K ++  + L++ K  L + L  +P + + A + +I
Sbjct  9     DPVRAYLREIGRVPLLTHEEEIVLAKRVQRFMALQDIKDALTQTLKREPQDSEWASAAKI  68

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +  +L   +     A+EK+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  69    TEEELHRAIAAGKAAKEKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFD  128

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L + KG   +I
Sbjct  129   PTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLSQAKGRAATI  188

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L ++ ++V +  E   +  SLD +   + D   GE L           +P    
Sbjct  189   SELAEELELTPRQVRDYLERARQPLSLDLKVGDNQDTELGELLEDT------GTSPEDYA  242

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++  L+ + L  +++E++ L  GL   + LT   I  R+ +SRERVRQ+   A
Sbjct  243   THSSLQVDLEKLM-SDLTPQQKEVLALRFGLVDGQPLTLAKIGVRLNISRERVRQIEREA  301

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+   RK  +K  L 
Sbjct  302   LSKLRK--RKGNIKEYLA  317



>ref|WP_015212692.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Anabaena cylindrica]
 ref|YP_007154947.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Anabaena cylindrica 
PCC 7122]
 gb|AFZ56037.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Anabaena cylindrica 
PCC 7122]
Length=377

 Score =   172 bits (435),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/318 (34%), Positives = 176/318 (55%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    +++ ++ L+  LG  PS+ ++A    +
Sbjct  65    DAVGAFFKEMARYPLLKADEEVELARRVRFLEEVKDLQAALELELGQQPSKNEVASKFEM  124

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  125   TEKQLESRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  184

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K    PS 
Sbjct  185   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLARNPSE  244

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AESL IS +++    +   +  SL+       D      L   + D     +P  ++
Sbjct  245   AEMAESLEISVQQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  299

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  300   NENMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQSKA  359

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  L+
Sbjct  360   MRKLRRPHIAKRLKGWLI  377



>ref|WP_033374969.1| RNA polymerase sigma factor SigC, partial [Spirulina subsalsa]
Length=323

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 108/304 (36%), Positives = 169/304 (56%), Gaps = 31/304 (10%)
 Frame = -1

Query  1129  EQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSL---------------------  1013
             E   RL  +LG  PS E+ A +L +   DLK  +    L                     
Sbjct  23    EAHDRLAAQLGHRPSWERWAGALDLDVVDLKQALWSGKLHWAILADLSSEELEQIQKLGI  82

Query  1012  -AREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYW  836
              A+E +  +N+RLV+S+A++Y N G E+ DLIQ G +GL R +EKFDP+KGY+ STY YW
Sbjct  83    RAKEHMIKANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVEKFDPTKGYRFSTYAYW  142

Query  835   WIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDRIAESLNISKKK  659
             WIRQGI+RA+   S  +RLP H+  +L+ I+ A+ K+ ++KG T   + IA+ L+++  +
Sbjct  143   WIRQGITRAIATQSRTIRLPVHITEKLNKIKKAQRKISQEKGRTAKTEDIAKELDMTPDQ  202

Query  658   VTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDECALKDEVNNLI  479
             V      V +  SL+ +     D   G+ L +       E +P   +   AL  E+ N++
Sbjct  203   VREVLLKVPRSVSLEIKVGKEKDTELGDLLETE------EASPEDALMREALVRELQNML  256

Query  478   HTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFEKLKHAARKNRL  302
              T L  RER++I++ +GL N +  +  +I + + LSRERVRQ+   A +KL+   R+NR+
Sbjct  257   -TDLTSRERDVIQMRYGLNNGQPYSLAEIGRALELSRERVRQIEAKALQKLRQPKRRNRV  315

Query  301   KAML  290
             +  L
Sbjct  316   RDYL  319



>ref|WP_012181632.1| RNA polymerase sigma factor [Salinispora arenicola]
 ref|YP_001536315.1| RNA polymerase sigma factor SigB [Salinispora arenicola CNS-205]
 gb|ABV97324.1| RNA polymerase, sigma 70 subunit, RpoD family [Salinispora arenicola 
CNS-205]
Length=328

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/317 (35%), Positives = 173/317 (55%), Gaps = 28/317 (9%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+ GI   +LLT  + VELS+ I+ GL+ E + +       C P    L       R
Sbjct  31    VRAYLYGIGKTKLLTAAQEVELSRRIEAGLFAEAKLA------ACTPVSATL-------R  77

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              DL+L  +E   A++ L  +N+RLV+SIA+RY   G    DLIQ G +GL+R +EKFD +
Sbjct  78    ADLELVAVEGRAAKDHLLEANLRLVVSIAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYT  137

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLS-LIRNAETKLKDKGITPSIDR  692
             KGYK STY  WWIRQ I+RA+   S  +R+P H+  +++ ++R         G  P++  
Sbjct  138   KGYKFSTYATWWIRQAITRAMADQSRTIRIPVHMVEQVNRMVRTRRDLSVSLGREPTVTE  197

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSID---GLPGES-LHSYIADSHLENNPWH  524
             +A +L++ + ++        ++ S DRE   S+D   G  GES L  ++A  +    P +
Sbjct  198   VARALDVPEVQII-------ELISYDREPV-SLDQAVGEDGESPLGDFVAVVNATAAPDN  249

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGL  347
               +   L+ EV  ++  TL +RE+ +IRL  GL +    T +++ +  GLSRER+RQ+  
Sbjct  250   TAERGELRQEVRGVL-ATLSQREQAVIRLRFGLDDGRQRTLDEVGREFGLSRERIRQIEK  308

Query  346   VAFEKLKHAARKNRLKA  296
                 KL+   R  RL A
Sbjct  309   GTLRKLRAPERAQRLAA  325



>ref|WP_019506980.1| RNA polymerase sigma factor [Pleurocapsa sp. PCC 7319]
Length=318

 Score =   170 bits (430),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/303 (34%), Positives = 173/303 (57%), Gaps = 9/303 (3%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+K I    LLTH E +  +K ++  + L + K  L E LG +P++ Q AV+ + S 
Sbjct  11    VRSYLKEIGRVPLLTHEEEILYAKRVQKAIALAKVKEDLVEELGVEPTDAQWAVAAKTSL  70

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              DL   +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFDP+
Sbjct  71    ADLSAVIEAGESAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFDPT  130

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDR  692
             KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ +L + KG T +I  
Sbjct  131   KGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRQLAQKKGRTATISE  190

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A  L+++ K+V +  E   +  SLD     + D   G+ L           +P      
Sbjct  191   LANELDLTPKQVRDYLEKSRQPISLDIRVGDNNDTELGDMLE------DTGQSPEDYATS  244

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFE  335
              +L+ +++ L+   L  +++E+I L  GL + + +T   I + + +SRERVRQ+   A  
Sbjct  245   SSLRMDLDRLM-ADLTPQQKEVISLRFGLADGKPMTLARIGECLSISRERVRQIEREALS  303

Query  334   KLK  326
             KL+
Sbjct  304   KLR  306



>ref|WP_011143751.1| RNA polymerase sigma factor SigC [Gloeobacter violaceus]
 ref|NP_926708.1| RNA polymerase sigma factor SigC [Gloeobacter violaceus PCC 7421]
 dbj|BAC91703.1| group2 RNA polymerase sigma factor [Gloeobacter violaceus PCC 
7421]
Length=362

 Score =   171 bits (433),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/312 (35%), Positives = 177/312 (57%), Gaps = 9/312 (3%)
 Frame = -1

Query  1219  YVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISRTDL  1040
             Y++ I    LL   E VEL++ ++  + L   K  L+  LG + S+EQ A + ++   +L
Sbjct  54    YLQEIGRVPLLGRDEEVELAQQVQKLMKLTALKESLQTSLGSEYSDEQWAEAAKVGLFEL  113

Query  1039  KLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGY  860
             K  ++  S A++K+  +N+RLV+S+A++Y N G E+ DL+Q G +GL R +EKFDP+KGY
Sbjct  114   KRQVLAGSRAKKKMIEANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKFDPTKGY  173

Query  859   KLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDRIAE  683
             + STY YWWIRQGI+RA+   S  +RLP H+  +L+ I+  + KL ++ G TP+I  IAE
Sbjct  174   RFSTYAYWWIRQGITRAIATQSRTIRLPVHITEKLNRIKKTQRKLSQNLGRTPTISEIAE  233

Query  682   SLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDECAL  503
              L +    V      V +  SL+       D   GE L +         +P     + +L
Sbjct  234   ELEMEPAHVRELMSRVPRSVSLETRVGKDKDTELGELLEAEEV------SPEESAVQESL  287

Query  502   KDEVNNLIHTTLKEREREIIRLYHG-LGNECLTWEDISKRIGLSRERVRQVGLVAFEKLK  326
             + +V  L+   L  RER++I + +G L     +  +I + + LSRERVRQ+   A +KL+
Sbjct  288   RRDVKELLD-DLTLRERDVITMRYGLLDGRTYSLSEIGRALDLSRERVRQIESKALQKLR  346

Query  325   HAARKNRLKAML  290
                R+ +++  L
Sbjct  347   QPRRRAKVRDYL  358



>gb|EEP74122.1| sigma-70 region 2 domain-containing protein [Micromonospora sp. 
ATCC 39149]
Length=334

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 108/316 (34%), Positives = 173/316 (55%), Gaps = 26/316 (8%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+ GI   +LLT  + VEL+K I+ GL+ EE+ +       C P    L       R
Sbjct  37    VRAYLNGIGRTKLLTAEQEVELAKRIEAGLFAEEKLA------TCTPVSTVL-------R  83

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              DL++ + E   A++ L  +N+RLV+SIA+RY   G    DLIQ G +GL+R +EKFD +
Sbjct  84    ADLEIIVAEGRTAKDHLLEANLRLVVSIAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYT  143

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLK-DKGITPSIDR  692
             KG+K STY  WWIRQ I+RA+   +  +R+P H+  +++ +  A  +L    G  P++  
Sbjct  144   KGFKFSTYATWWIRQAITRAMADQARTIRIPVHMVEQVNRMVRARRELAVTLGREPTVAE  203

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A ++++ + +V        ++ S DRE   S+D   GE   S + D     +P      
Sbjct  204   VARAMDVPEFQVI-------ELISYDREPV-SLDQAVGEDGESALGDFVAAVDPAAEPGA  255

Query  511   CALKDEVNN---LIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLV  344
              A+  E+ N   ++  TL +RE+ +IRL  GL +    T +++ +  GLSRER+RQ+  V
Sbjct  256   TAVDGELRNEVRIVLATLSQREQAVIRLRFGLDDGRQRTLDEVGREFGLSRERIRQIEKV  315

Query  343   AFEKLKHAARKNRLKA  296
                KL+   R  RL+A
Sbjct  316   TLLKLRAPERAQRLEA  331



>ref|WP_017656193.1| RNA polymerase sigma factor [Microchaete sp. PCC 7126]
Length=332

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 169/297 (57%), Gaps = 11/297 (4%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             ++++ Y+  I    LLTH + +  ++ ++  + +   K  L E+L C+P+ +Q A  +++
Sbjct  23    DTVRIYLHEIGRVPLLTHEQEIFFAQQVQQMMVMFTAKEELAEKLQCEPTLQQWADKMQL  82

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
                 L   + +  +A++K+  +N+RLV+SIA++Y     E  DLIQ G +GL RG+EKFD
Sbjct  83    KEDVLLQQLSQGQIAKQKMIQANLRLVVSIAKKYQKRNIEFLDLIQEGALGLERGVEKFD  142

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P+ GYK STY YWWIRQGI+RA+ + S  +RLP H+  +L+ I+  + +L  K G    +
Sbjct  143   PTLGYKFSTYAYWWIRQGITRAIAQQSRTIRLPIHMADKLNKIKCVQRELSQKLGYIAGV  202

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLD-REAFPSIDGLPGESLHSYIADSHLENNPWHR  521
               IA++LN+   ++    + V +  SLD R  F          L   + D  +  +P   
Sbjct  203   TEIAQALNLEPSQIREYLQLVRQPVSLDMRIGFEQ-----DTQLQDLLKDDRM--SPERY  255

Query  520   VDECALKDEVNNLIHTTLKEREREIIRLYHGLGNEC-LTWEDISKRIGLSRERVRQV  353
              +      +++NL+   L  +++E++ L  GL +   LT   +S+R+G+SRERVRQV
Sbjct  256   AEREFFYQDIHNLL-AKLTPQQKEVLILRFGLADGYELTLVQVSQRMGISRERVRQV  311



>ref|WP_011613739.1| RNA polymerase sigma factor [Trichodesmium erythraeum]
 ref|YP_723887.1| RNA polymerase subunit sigma 28 [Trichodesmium erythraeum IMS101]
 gb|ABG53414.1| RNA polymerase, sigma 28 subunit [Trichodesmium erythraeum IMS101]
Length=384

 Score =   172 bits (435),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/325 (33%), Positives = 176/325 (54%), Gaps = 15/325 (5%)
 Frame = -1

Query  1246  EQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAV  1067
             + + +++    K +    LL   E +EL+K+I+  +  E+   +L   LG  P++ ++AV
Sbjct  66    QDIDDAVGALFKQMSRYPLLNQKEEIELAKLIQELVVFEKLPEKLANDLGRTPTKSEVAV  125

Query  1066  SLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGI  887
             +   + + L   + +C  A+ ++  SN+RLV+SIA+RY N G    DLIQ G +GL R  
Sbjct  126   AAGFTESQLDHRLHQCRTAKRRMISSNLRLVVSIAKRYLNRGVPFLDLIQEGALGLNRAA  185

Query  886   EKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GI  710
             EKFDP KGYK STY YWWIRQGI+R +      +RLP H+  +++ +R     L+     
Sbjct  186   EKFDPDKGYKFSTYAYWWIRQGITRTIANQGRTIRLPVHVVEQINKLRRVYRDLRRSLNR  245

Query  709   TPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENN-  533
              P+   IA+ L IS  ++ N  +   K  SL+           G   ++ + D  LE+N 
Sbjct  246   IPNDTEIAQELEISLPQLRNLQQIRRKTLSLNHRL--------GTDENTELLD-FLEDNE  296

Query  532   ---PWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRER  365
                P  ++++  ++ ++  +++  L  RE+++I L +GL   E  T +++S+ I LSRER
Sbjct  297   NSTPEAQMNDMMMRQDILEVLNHVLSNREQDVISLRYGLITGEPHTLDEVSRMINLSRER  356

Query  364   VRQVGLVAFEKLKHAARKNRLKAML  290
             VRQ+   A  KL+      RLK  L
Sbjct  357   VRQIQAKAMRKLRRPQVAERLKGWL  381



>ref|WP_017299116.1| RNA polymerase sigma factor [Nodosilinea nodulosa]
Length=327

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 108/311 (35%), Positives = 176/311 (57%), Gaps = 14/311 (5%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             ++++ Y+  I    LLTH E +   K ++  + L E+K  L E LG +P+  Q A +  +
Sbjct  18    DAVRTYLHEIGRVPLLTHEEEIIFGKQVQAYMALLERKEALTESLGHEPTPAQWAEAAEL  77

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S   L  T+ +   A+ K+  +N+RLV++IA++Y     E  DLIQ G +GL RG+EKFD
Sbjct  78    SEEKLNHTVRQGERAKRKMIEANLRLVVAIAKKYQKRNLEFLDLIQEGTLGLERGVEKFD  137

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P+KGYK STY YWWIRQ I+RA+ + +  +RLP H+  +L+ I+  + +L  + G +P+ 
Sbjct  138   PTKGYKFSTYAYWWIRQAITRAIAQQARTIRLPIHITEKLNKIKRVQRELSQQLGRSPNA  197

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
             + I E+L +  K++        +  SLD     + D      L   + D  +  +P    
Sbjct  198   NEIGEALELEPKQIREFLVLARQPISLDVRIGDNQDT----ELQELLEDDGI--SPETFT  251

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL--GNECLTWEDISKRIGLSRERVRQVGLV  344
              + +LK ++ NL+ + L  +++E+I L +GL  GNE L+   +  R+ +SRERVRQ+   
Sbjct  252   AQESLKQDIRNLL-SELTPQQKEVITLRYGLEDGNE-LSLAKVGNRMNISRERVRQLEQQ  309

Query  343   AFEKLKHAARK  311
             A   LKH  R+
Sbjct  310   A---LKHLRRR  317



>ref|WP_011934516.1| RNA polymerase sigma factor [Synechococcus sp. RCC307]
 ref|YP_001226354.1| sigma-70 family RNA polymerase sigma factor [Synechococcus sp. 
RCC307]
 emb|CAK27001.1| Alternative RNA polymerase sigma factor, sigma-70 family [Synechococcus 
sp. RCC307]
Length=324

 Score =   170 bits (430),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/308 (33%), Positives = 179/308 (58%), Gaps = 12/308 (4%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y++ I    LL+H + + L + ++  + LEE ++  K R G +PS E+LA S  IS 
Sbjct  17    VRSYLRDIGRVPLLSHEQEITLGRQVQELVRLEEAEAEFKMRQGHEPSREELASSFGISP  76

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
               L+  +I    A+E++  +N+RLV+S+A++Y     E+ DLIQ G +GL+RG+EKFDP+
Sbjct  77    AVLRRRLINGRRAKERMVAANLRLVVSVAKKYTKRNMELLDLIQEGTIGLVRGVEKFDPT  136

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDR  692
             +GYK STY YWWIRQGI+RA+ + S  +RLP H+   L+ ++  + +L ++ G TP++  
Sbjct  137   RGYKFSTYAYWWIRQGITRAIAEKSRTIRLPIHITETLNKLKKGQRELSQELGRTPTVGE  196

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +AE L + + +V +      +  SL+ +   S D    E L +   D+ +   P   VD 
Sbjct  197   LAEFLELPEPEVKDLLSRARQPVSLEMKVGDSDDTELCELLQN---DAPM---PHELVDG  250

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGLG-NECLTWEDISKRIGLSRERVRQV---GLV  344
               LK ++ +L+   L   +  ++++ +G+   E ++   I + +G+SR+RVR +   GL 
Sbjct  251   DCLKGDMRSLLE-QLPPLQGRVLKMRYGIDVEEPMSLTGIGRELGMSRDRVRNLERDGLA  309

Query  343   AFEKLKHA  320
                +L  A
Sbjct  310   GLRRLSEA  317



>ref|WP_038017230.1| RNA polymerase sigma factor, partial [Synechococcus sp. PCC 7335]
Length=370

 Score =   171 bits (433),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 104/317 (33%), Positives = 174/317 (55%), Gaps = 7/317 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E +EL++ +++ + +E+   +  E L   P+  +LA +   
Sbjct  58    DAVGAFFKEMARYPLLQPTEEIELARQVRIIVEIEDYSEKASETLKRRPTHAELATAFGY  117

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +   A+ ++  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  118   TEGQLRQKLRQARAAKRRMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGALGLNRAAEKFD  177

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P KGYK STY YWWIRQGI+R +  ++  +RLP H+  +L+ ++ A+ +L K+   TP+ 
Sbjct  178   PDKGYKFSTYAYWWIRQGITRTIANDARTIRLPIHIVEKLNKLKKAQRELRKELQRTPTE  237

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +A +L ++ +++    +   K  SL+       D      L   + D +   +P  ++
Sbjct  238   VEVAAALEMTPEQLRTLQQVQRKSLSLNHRVGKGEDT----ELMELLEDGN-SLSPESQI  292

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
              E  ++ E+++++   L ERE+EII L +GL   E  T E++     LSRERVRQ+   A
Sbjct  293   SESMMRQEISDVLTEVLTEREKEIIALRYGLTTGETHTLEEVGGIFQLSRERVRQIQTKA  352

Query  340   FEKLKHAARKNRLKAML  290
               KL+      RLK  L
Sbjct  353   MRKLRRPQVAARLKNWL  369



>ref|WP_006276735.1| RNA polymerase sigma factor [Cylindrospermopsis raciborskii]
 gb|EFA70284.1| sigD (sigma 28 (flagella/spoulation)) [Cylindrospermopsis raciborskii 
CS-505]
Length=332

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 104/304 (34%), Positives = 171/304 (56%), Gaps = 9/304 (3%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y++ I    LLTH + +   K ++    L E K  L + L   PS E+ A + ++  
Sbjct  25    VRTYLREIGKVPLLTHEQEIYYGKQVQKSTALYETKDNLAQELNRQPSLEEWAKAAQLDP  84

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              +L   + +  +A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFDPS
Sbjct  85    QELNRLLGQGEIAKRKMVEANLRLVVSVAKKYIKRNVDLLDLIQEGSIGMQRGVEKFDPS  144

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSIDR  692
             KGY+ STY YWWIRQ I+RA+ + +  +RLP H+  +L+ I+ A+  L    G +PSI  
Sbjct  145   KGYRFSTYAYWWIRQAITRAIAEKARTIRLPIHITEKLNKIKKAQRYLSQTLGRSPSIAE  204

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A+ L I+ K+V +  E      SLD     + D   GE L    A      +P   V +
Sbjct  205   LAQELEITPKQVRDCLEKARLPLSLDLRLGDNYDTELGEMLEDPGA------SPEDYVIQ  258

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVAFE  335
              +L  E++ ++ T L  ++RE+I+L  GL   + +T   I + + +SRERVRQ+   A  
Sbjct  259   SSLSSELDRMM-THLTPQQREVIKLRFGLVDGQSMTLARIGEVLNISRERVRQIEREALT  317

Query  334   KLKH  323
             +L+ 
Sbjct  318   RLRR  321



>ref|WP_036374855.1| RNA polymerase sigma factor SigB [Micromonospora sp. ATCC 39149]
Length=338

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 108/316 (34%), Positives = 173/316 (55%), Gaps = 26/316 (8%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+ GI   +LLT  + VEL+K I+ GL+ EE+ +       C P    L       R
Sbjct  41    VRAYLNGIGRTKLLTAEQEVELAKRIEAGLFAEEKLA------TCTPVSTVL-------R  87

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              DL++ + E   A++ L  +N+RLV+SIA+RY   G    DLIQ G +GL+R +EKFD +
Sbjct  88    ADLEIIVAEGRTAKDHLLEANLRLVVSIAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYT  147

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLK-DKGITPSIDR  692
             KG+K STY  WWIRQ I+RA+   +  +R+P H+  +++ +  A  +L    G  P++  
Sbjct  148   KGFKFSTYATWWIRQAITRAMADQARTIRIPVHMVEQVNRMVRARRELAVTLGREPTVAE  207

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A ++++ + +V        ++ S DRE   S+D   GE   S + D     +P      
Sbjct  208   VARAMDVPEFQVI-------ELISYDREPV-SLDQAVGEDGESALGDFVAAVDPAAEPGA  259

Query  511   CALKDEVNN---LIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLV  344
              A+  E+ N   ++  TL +RE+ +IRL  GL +    T +++ +  GLSRER+RQ+  V
Sbjct  260   TAVDGELRNEVRIVLATLSQREQAVIRLRFGLDDGRQRTLDEVGREFGLSRERIRQIEKV  319

Query  343   AFEKLKHAARKNRLKA  296
                KL+   R  RL+A
Sbjct  320   TLLKLRAPERAQRLEA  335



>ref|WP_015114783.1| RpoD subfamily RNA polymerase sigma-70 subunit [Nostoc sp. PCC 
7107]
 ref|YP_007051734.1| RpoD subfamily RNA polymerase sigma-70 subunit [Nostoc sp. PCC 
7107]
 gb|AFY44584.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Nostoc sp. 
PCC 7107]
Length=332

 Score =   170 bits (430),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 171/305 (56%), Gaps = 9/305 (3%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y++ I    LLTH E +   K ++    L+E +  L  +LG +P+ E+ A   ++  
Sbjct  25    VRTYLREIGRVPLLTHEEEIRYGKQVQRSTALQEVRESLASQLGREPTLEEWAKESKLDI  84

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              DL   + +  +A+ ++  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFDP+
Sbjct  85    ADLNDAIADGEIAKRRMVEANLRLVVSVAKKYIKRNVDLLDLIQEGSIGMQRGVEKFDPT  144

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSIDR  692
             KGY+ STY YWWIRQ I+RA+ + +  +RLP H+  +L+ I+ A+ +L  K G  PS+  
Sbjct  145   KGYRFSTYAYWWIRQAITRAIAEKARTIRLPIHITEKLNKIKKAQRQLSQKLGRAPSVGE  204

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A  L+++ K+V    E      SLD     + D   GE L    A      +P   V +
Sbjct  205   LATELDLTPKQVREYLEKARLPLSLDLRLGDNYDTELGEMLEDPGA------SPEEFVMQ  258

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVAFE  335
              +L  ++  ++   L  ++RE+I L  GL   + LT   I + + +SRERVRQ+   A  
Sbjct  259   TSLSSDLERVME-ELTPQQREVITLRFGLIDGQALTLARIGEILNISRERVRQIEREALN  317

Query  334   KLKHA  320
             KL+ +
Sbjct  318   KLRKS  322



>ref|WP_028084629.1| RNA polymerase sigma factor [Dolichospermum circinale]
Length=389

 Score =   171 bits (434),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 107/318 (34%), Positives = 175/318 (55%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    ++E ++ L+   G  PS+ +LA  L +
Sbjct  77    DAVGAFFKEMARYPLLKPDEEVELARRVRFLEEIKELQAALELESGAQPSKGELASQLEM  136

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  137   TEKQLESRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRAAEKFD  196

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K    P+ 
Sbjct  197   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLSRNPTE  256

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE+L I+  ++    +   +  SL+       D      L   + D     +P  ++
Sbjct  257   SEMAEALEITVHQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  311

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  312   NENMMRQEIWEVLGDVLTPREKDVISLRYGLTSSEPCTLEEVGNMFNLSRERVRQIQSKA  371

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  LV
Sbjct  372   MRKLRRPHIAKRLKGWLV  389



>ref|WP_006634048.1| RNA polymerase sigma factor [Microcoleus vaginatus]
 gb|EGK86432.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Microcoleus 
vaginatus FGP-2]
Length=357

 Score =   171 bits (432),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/307 (36%), Positives = 170/307 (55%), Gaps = 15/307 (5%)
 Frame = -1

Query  1192  LLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMIECSL  1013
             LLT  E VEL++ ++  + L+E + RL++ L   P++ +LA +L IS T L+    +C  
Sbjct  59    LLTATEEVELARRVQELVALDEVEQRLQQELDRVPTKAELAAALGISETQLQQLRHQCQS  118

Query  1012  AREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYVYWW  833
             A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFDP KGYK STY YWW
Sbjct  119   AKRKMISSNLRLVVSIAKRYLNRGVPFLDLIQEGALGLNRAAEKFDPEKGYKFSTYAYWW  178

Query  832   IRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSIDRIAESLNISKKKV  656
             IRQGI+R +      +RLP H+  +L+ ++     L+      P+   +A  + ++ +++
Sbjct  179   IRQGITRTIANQGRTIRLPVHIVEQLNKLKKVYRDLRRSLQRNPTETELAREMQVTCEQL  238

Query  655   TNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENN----PWHRVDECALKDEVN  488
                 +   +  SL+           G    S + D  LE+N    P  +++E  ++ ++ 
Sbjct  239   RYLQQVRRQSLSLNHRI--------GSEESSELLDV-LEDNATQSPEAQMNEMMMRQDIL  289

Query  487   NLIHTTLKEREREIIRLYHG-LGNECLTWEDISKRIGLSRERVRQVGLVAFEKLKHAARK  311
              ++ + L ERE+EI+ + +G L  E  T E++S    LSRERVRQ+   A  KL+     
Sbjct  290   EVLDSILTEREKEIVAMRYGLLTGEPYTLEEVSSLFNLSRERVRQIQNKAMRKLRRPQVT  349

Query  310   NRLKAML  290
              RLK  L
Sbjct  350   ERLKGWL  356



>ref|WP_010998387.1| RNA polymerase sigma factor [Nostoc sp. PCC 7120]
 ref|NP_488289.1| group 2 sigma 70-type sigma factor F [Nostoc sp. PCC 7120]
 gb|AAF75759.1|AF262218_1 group 2 sigma 70-type sigma factor F [Nostoc sp. PCC 7120]
 dbj|BAB75948.1| group 2 sigma 70-type sigma factor F [Nostoc sp. PCC 7120]
Length=390

 Score =   171 bits (434),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 178/320 (56%), Gaps = 11/320 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    + + ++ L+ ++G  P++ Q+A  L I
Sbjct  78    DAVGAFFKEMARYPLLKPDEEVELARRVRFLEEVRDLQADLQLQIGQHPTKAQVAGQLEI  137

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  138   TEKQLENRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  197

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K    PS 
Sbjct  198   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKFSRNPSE  257

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENN--PWH  524
               +AE+L IS  ++    +   +  SL+       D      L   + D   E+N  P  
Sbjct  258   AEMAEALEISVPQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLED---EDNLSPEA  310

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGL  347
             +++E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+  
Sbjct  311   KMNENMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQS  370

Query  346   VAFEKLKHAARKNRLKAMLV  287
              A  KL+      RLK  L+
Sbjct  371   KAMRKLRRPHIAKRLKGWLI  390



>ref|WP_038542649.1| RNA polymerase sigma70 [Synechococcus sp. KORDI-100]
 gb|AII42113.1| RNA polymerase sigma factor [Synechococcus sp. KORDI-100]
Length=334

 Score =   170 bits (430),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 176/305 (58%), Gaps = 12/305 (4%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y++ I    LLTH + + L + ++  + LE  +  L+ R G  P+ +QLA +  +S 
Sbjct  27    VRSYLRDIGRVPLLTHEQEITLGRQVQDLMGLEALEGELESRDGSTPTRDQLAKAAGLSY  86

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
               LK  +     A+E++  +N+RLV+S+A++Y     E+ DLIQ G +GL+RG+EKFDP+
Sbjct  87    LQLKRKLQHGRRAKERMVAANLRLVVSVAKKYTKRNMELLDLIQEGTIGLVRGVEKFDPT  146

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDR  692
             +GYK STY YWWIRQGI+RA+ + S  +RLP H+   L+ ++  + +L +D G TP++  
Sbjct  147   RGYKFSTYAYWWIRQGITRAIAEKSRTIRLPIHITEMLNKLKKGQRELSQDLGRTPTVTE  206

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +AE + + +  V +      +  SL+ +     DG   E L     D  L   P  +V+E
Sbjct  207   LAEFVELPEDDVKDLMCRARQPVSLEMKVG---DGDDTELLELLSGDGDL---PSDQVEE  260

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQV---GLV  344
               LK ++ NL+   L   + +++R+ +G+ G E ++   I + +G+SR+RVR +   GL 
Sbjct  261   DCLKGDLRNLLG-QLPHLQEQVLRMRYGMDGEEPMSLTGIGRILGMSRDRVRNLERDGLA  319

Query  343   AFEKL  329
                ++
Sbjct  320   GLRRI  324



>dbj|BAB87262.1| RNA polymerase sigma factor [Guillardia theta]
Length=490

 Score =   174 bits (440),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/326 (32%), Positives = 190/326 (58%), Gaps = 11/326 (3%)
 Frame = -1

Query  1264  RSIIGMEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPS  1085
             +++ G+ +  +S++ Y++ I    LL   E ++L++ I   L+ E  K  L+E+L  +P+
Sbjct  120   QTVKGLHKADDSVRWYLQLIGRVRLLRPEEEIQLAREISQLLHWEHVKISLREKLQREPT  179

Query  1084  EEQLAVSLRISRTD-LKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGL  908
               +   + ++S     +  +     A+E++  +N+RLV+SIA+RY N G  + DLIQ G 
Sbjct  180   SSEWTAACKVSDVKKFRSILHNARRAKERMVAANLRLVVSIAKRYVNRGMSLQDLIQEGS  239

Query  907   VGLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETK  728
             +GL+R  EKFD  KG+K STY  WW++Q ++RA+  +S  +RLP HL+  +S IR     
Sbjct  240   LGLIRAAEKFDSEKGFKFSTYATWWVKQAVTRAIADHSRTIRLPVHLYDTISAIRKTTRT  299

Query  727   LK-DKGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYI-A  554
             L  + G +P+ + IAE +++S +K+ +  ++     SL+R   P  +      L  +I A
Sbjct  300   LNIEIGRSPTEEEIAEKMDMSVEKLRSVLQSAQPTLSLER---PLKNDDDASQLSDFIEA  356

Query  553   DSHLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGNECL-TWEDISKRIGL  377
             D   + +P   V++  L+D++ N+I+ +L  RER+++R+ +GL +  + T E+I +   +
Sbjct  357   D---QESPEEHVEKSMLRDDLENVIN-SLSPRERDVVRMRYGLDDGRIKTLEEIGQIFSV  412

Query  376   SRERVRQVGLVAFEKLKHAARKNRLK  299
             +RERVRQ+   A  KL+   R + L+
Sbjct  413   TRERVRQIEAKAIRKLRQPYRSSILR  438



>ref|WP_023075830.1| rna polymerase sigma factor [Leptolyngbya sp. Heron Island J]
 gb|ESA33357.1| rna polymerase sigma factor [Leptolyngbya sp. Heron Island J]
Length=328

 Score =   169 bits (429),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 108/311 (35%), Positives = 175/311 (56%), Gaps = 12/311 (4%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             ++++ Y++ I    LLTH E + L K ++  + L+  K +L E LG D S  + A +  I
Sbjct  18    DTVRTYLQEIGRVPLLTHEEEIVLGKQVQCLMALQATKEKLDEDLGHDASRVEWAQAAGI  77

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S T+L   +     A+ K+  +N+RLV+++A++Y     E  DLIQ G +GL RG+EKFD
Sbjct  78    SETELAHQLRHGQRAKRKMIEANLRLVVAVAKKYQKRNLEFLDLIQEGTLGLERGVEKFD  137

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+  +  L  K G +PS+
Sbjct  138   PMKGYKFSTYAYWWIRQAITRAIAQQSRTIRLPIHITEKLNKIKREQRVLAQKLGRSPSV  197

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               I + L++S ++V        +  SLD     + D      L   + D  +  +P    
Sbjct  198   GEIGQELDLSPEQVREYLTMSRQPISLDVRIGDNQDT----ELQELLEDETV--SPEDYT  251

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGNEC-LTWEDISKRIGLSRERVRQVGLVA  341
              + +L+ ++ N++ T L  +++E+I L  GL +   L+   + +R+G+SRERVRQ+   A
Sbjct  252   VQQSLRQDIRNML-TELTPQQKEVINLRFGLIDGTQLSLAKVGQRMGISRERVRQLEQQA  310

Query  340   FEKLKHAARKN  308
                LKH  R+ 
Sbjct  311   ---LKHLRRRK  318



>ref|WP_017307580.1| RNA polymerase sigma factor [Fischerella sp. PCC 9339]
Length=332

 Score =   170 bits (430),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 175/305 (57%), Gaps = 13/305 (4%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+  I    LLTH + ++L K ++  + L   K +L  +L   P++++ A ++ IS 
Sbjct  25    VRTYLHEIGRIPLLTHEQEIDLGKQVQQMMNLLAAKEKLATQLKRQPTQKEWAENINISE  84

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
               L   + +   A++K+  +N+RLV+SIA++Y     E  DLIQ G +GL RG+EKFDPS
Sbjct  85    ALLVQQLHQGHQAKQKIIRANLRLVVSIAKKYQRRNLEFLDLIQEGSLGLERGVEKFDPS  144

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSIDR  692
             KGYK STY YWW+RQ I+RA+ +    +RLP H+  +L+ I+  + +L  K G TP+   
Sbjct  145   KGYKFSTYAYWWVRQAITRAIAQQGRAIRLPIHITEKLNKIKRTQRELAQKLGRTPTAVD  204

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGES-LHSYIADSHLENNPWHRVD  515
             IAE L++  K+V        +  SL+        G   E+ L   + D  +  +P    D
Sbjct  205   IAEELSLDPKQVREYLLIARQPVSLELRV-----GAERETELQDMLEDEGV--SPEFYTD  257

Query  514   ECALKDEVNNLIHTTLKEREREIIRLYHGL--GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +  L+  + NL+ + L  ++RE++ L  GL  GNE L+  +I +R+G+SRERVRQV L A
Sbjct  258   QKFLQQNIQNLL-SKLTPQQREMLTLRFGLVDGNE-LSLAEIGQRMGVSRERVRQVELQA  315

Query  340   FEKLK  326
                L+
Sbjct  316   LSTLR  320



>ref|WP_017294941.1| hypothetical protein [Geminocystis herdmanii]
Length=318

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/305 (34%), Positives = 183/305 (60%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             ++++ Y+K I    LL+  E + L+K I+  + LE+++  LK++L  +PS+ + A + +I
Sbjct  9     DTIRVYLKEIGRIPLLSQEEEIILAKHIQELVALEKKREALKKKLDREPSKSEWADTAKI  68

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S  +L + + +   A+ K+  +N+RLV+SIA++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  69    SEKNLDIKISQGEKAKRKMVEANLRLVVSIAKKYLKRNLDLLDLIQEGTIGMQRGVEKFD  128

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ IR  + KL ++KG   +I
Sbjct  129   PTKGYRFSTYAYWWIRQAITRAIAEKSRAIRLPLHITEKLNKIRQTQRKLSEEKGRPATI  188

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               ++E+L ++  +V        +  SLD +   + D   GE L           +P    
Sbjct  189   VELSEALELTPDQVREYLGKARQPLSLDLKVGDNNDTELGELLEDP------GQSPDDYT  242

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
             D   L+ ++N ++ + L ++++++IRL +GL + + LT   I + + +SRERVRQ+   A
Sbjct  243   DYSCLQFDLNRMM-SELTQQQQDVIRLRYGLDDGKPLTLSKIGEILSISRERVRQIEREA  301

Query  340   FEKLK  326
               KL+
Sbjct  302   LTKLR  306



>ref|WP_009342359.1| RNA polymerase sigma factor [Raphidiopsis brookii]
 gb|EFA73536.1| sigD (sigma 28 (flagella/spoulation)) [Raphidiopsis brookii D9]
Length=332

 Score =   169 bits (429),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/304 (34%), Positives = 170/304 (56%), Gaps = 9/304 (3%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y++ I    LLTH + +   K ++    L E K  L + L   PS E+ A + ++  
Sbjct  25    VRTYLREIGKVPLLTHEQEIYYGKQVQKSTALYETKDNLAQELNRQPSLEEWAKAAQLDP  84

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              +L   + +  +A+ K+  +N+RL++S+A++Y     ++ DLIQ G +G+ RG+EKFDPS
Sbjct  85    QELNRLLAQGEIAKRKMVEANLRLLVSVAKKYIKRNVDLLDLIQEGSIGMQRGVEKFDPS  144

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSIDR  692
             KGY+ STY YWWIRQ I+RA+ + +  +RLP H+  +L+ I+ A+  L    G +PSI  
Sbjct  145   KGYRFSTYAYWWIRQAITRAIAEKARTIRLPIHITEKLNKIKKAQRDLSQTLGRSPSIAE  204

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A+ L I+ K+V +  E      SLD     + D   GE L    A      +P   V +
Sbjct  205   LAQELEITPKQVRDCLEKARLPLSLDLRLGDNYDTELGEMLEDPGA------SPEDYVIQ  258

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVAFE  335
              +L  E+  ++ T L  ++RE+I+L  GL   + +T   I + + +SRERVRQ+   A  
Sbjct  259   SSLSSELERMM-THLTTQQREVIKLRFGLVDGQSMTLARIGEVLNISRERVRQIEREALT  317

Query  334   KLKH  323
             +L+ 
Sbjct  318   RLRR  321



>ref|WP_009768864.1| RNA polymerase sigma factor, cyanobacterial RpoD-like family 
[Oscillatoriales cyanobacterium JSC-12]
 gb|EKQ66597.1| RNA polymerase sigma factor, cyanobacterial RpoD-like family 
[Oscillatoriales cyanobacterium JSC-12]
Length=318

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/303 (34%), Positives = 173/303 (57%), Gaps = 9/303 (3%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y++ I    LLTH + V   K ++    L + K  L  RLG  PS E+ A + ++S 
Sbjct  11    VRTYLREIGRVPLLTHEQEVVFGKQVQRLTLLNDTKDGLANRLGRTPSFEEWAQASQLSS  70

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              +LK  + E   A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFDP+
Sbjct  71    AELKQAIAEGEYAKRKMVEANLRLVVSVAKKYTKRNVDLLDLIQEGTIGMQRGVEKFDPT  130

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSIDR  692
             KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+ +L  + G   +   
Sbjct  131   KGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRQLSQRLGRAATAAE  190

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A+ L+++ K+V +  E   +  SLD     + D   GE L     D+    +P     +
Sbjct  191   LAQELDLTPKQVRDYLEQARQPLSLDLRVGDNQDTELGELLE----DTG--TSPEEFALQ  244

Query  511   CALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVAFE  335
              +L+ ++ +L+   L  ++R+++ L  GL + + LT   I  ++ +SRERVRQ+   A  
Sbjct  245   SSLRTDLESLM-ADLTPQQRQVLTLRFGLEDGQALTLAKIGDQLNISRERVRQIEREALS  303

Query  334   KLK  326
             KL+
Sbjct  304   KLR  306



>ref|WP_018587510.1| RNA polymerase sigma factor [Salinispora arenicola]
Length=328

 Score =   169 bits (429),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 109/317 (34%), Positives = 173/317 (55%), Gaps = 28/317 (9%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y+ GI   +LLT  + VELS+ I+ GL+ E + +       C P    L       R
Sbjct  31    VRAYLYGIGKTKLLTAAQEVELSRRIEAGLFAEAKLA------ACTPVSATL-------R  77

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              DL+L  +E   A++ L  +N+RLV+SIA+RY   G    DLIQ G +GL+R +EKFD +
Sbjct  78    ADLELVAVEGRAAKDHLLEANLRLVVSIAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYT  137

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLS-LIRNAETKLKDKGITPSIDR  692
             KGYK STY  WWIRQ I+RA+   +  +R+P H+  +++ ++R         G  P++  
Sbjct  138   KGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEQVNRMVRTRRDLSVSLGREPTVTE  197

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSID---GLPGES-LHSYIADSHLENNPWH  524
             +A +L++ + ++        ++ S DRE   S+D   G  GES L  ++A  +    P +
Sbjct  198   VARALDVPEVQII-------ELISYDREPV-SLDQAVGEDGESPLGDFVAVVNATAAPDN  249

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGL  347
               +   L+ EV  ++  TL +RE+ +IRL  GL +    T +++ +  GLSRER+RQ+  
Sbjct  250   TAERGELRQEVRGVL-ATLSQREQAVIRLRFGLDDGRQRTLDEVGREFGLSRERIRQIEK  308

Query  346   VAFEKLKHAARKNRLKA  296
                 KL+   R  RL A
Sbjct  309   GTLRKLRAPERAQRLAA  325



>ref|WP_008276791.1| RNA polymerase sigma factor [Cyanothece sp. CCY0110]
 gb|EAZ90150.1| RNA polymerase sigma factor SigD [Cyanothece sp. CCY0110]
Length=318

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 107/306 (35%), Positives = 178/306 (58%), Gaps = 11/306 (4%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             + ++ Y+K I    LLTH E +  +K ++  + LE+ +  + E  G +P+E Q A + +I
Sbjct  9     DPVRAYLKEIGRVPLLTHEEEILYAKRVQRLVNLEKLRDDIIEETGQEPTEIQWAKTAKI  68

Query  1054  SRTDLKLTMIEC-SLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKF  878
             SR +L+ ++IE    A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKF
Sbjct  69    SRKELQ-SIIEIGEAAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKF  127

Query  877   DPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPS  701
             DP+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L + KG   +
Sbjct  128   DPTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRELSQQKGRAAT  187

Query  700   IDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHR  521
             +  +AE L+++ K+V    E   +  SLD     + D   G+ L     D     +P   
Sbjct  188   VVELAEELDLTPKQVREYLERARQPLSLDLRVGDNQDTELGDLLED---DGQ---SPEDF  241

Query  520   VDECALKDEVNNLIHTTLKEREREIIRLYHG-LGNECLTWEDISKRIGLSRERVRQVGLV  344
                 +L+ ++  L+   L  +++E+I L  G L  + LT   I  R+ +SRERVRQ+   
Sbjct  242   ATHSSLQFDLERLME-DLTSQQKEVIALRFGLLDGQPLTLAKIGSRLNISRERVRQIERE  300

Query  343   AFEKLK  326
             A  KL+
Sbjct  301   ALSKLR  306



>dbj|BAA11832.1| chloroplast RNA polymerase sigma subunit [Cyanidium caldarium]
Length=591

 Score =   175 bits (443),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 114/331 (34%), Positives = 184/331 (56%), Gaps = 24/331 (7%)
 Frame = -1

Query  1249  MEQLQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLA  1070
             +E   ++++ Y++ I   +LL  GE +ELSK + + + LE+ +   +E  G  P+E + A
Sbjct  271   VEAKDDTIRSYLREIGRYQLLHPGEEIELSKQVCILMDLEQFQRSFREEHGKSPTESEWA  330

Query  1069  VSLRISRTDLKLT--MIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLL  896
                       KL   + +   A+E++  +N+RLV+SIA+RY N G  + DLIQ G +GL+
Sbjct  331   QGCGYGDDVEKLREHIRDGRKAKERMVTANLRLVVSIAKRYSNRGVALQDLIQEGSIGLI  390

Query  895   RGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLK-D  719
             RG+EKFD  +G++ STY  WWIRQ I+RA+  +S  +RLP H+H  +SLIR     L+ +
Sbjct  391   RGVEKFDAERGFRFSTYATWWIRQSITRAISDSSRSIRLPVHVHDTISLIRKQTKALQVE  450

Query  718   KGITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLP---GESLHSYIADS  548
              G  PS + I ES+ I + K     E    + SL+          P   G+ +H ++ +S
Sbjct  451   LGRPPSEEEICESVGIDRAKYRLVMECSRNIVSLE---------TPLRSGDDVH-FLGES  500

Query  547   HLENNPWHRVDE-CA---LKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRI  383
              +   P  R +E C+   L++ +  ++H  L  RERE+IR+  GL +    T E++  R 
Sbjct  501   LI--APEERAEENCSRDTLRESIEKVLH-CLSTREREVIRMRFGLTDGRPRTLEEVGSRF  557

Query  382   GLSRERVRQVGLVAFEKLKHAARKNRLKAML  290
              ++RER+RQ+   A +KL+  A  N L   L
Sbjct  558   NVTRERIRQIESKALKKLRTPAENNFLDEYL  588



>ref|WP_015200470.1| RpoD subfamily RNA polymerase sigma-70 subunit [Calothrix parietina]
 ref|YP_007139831.1| RpoD subfamily RNA polymerase sigma-70 subunit [Calothrix sp. 
PCC 6303]
 gb|AFZ03859.1| RNA polymerase, sigma 70 subunit, RpoD subfamily [Calothrix sp. 
PCC 6303]
Length=387

 Score =   171 bits (432),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 174/318 (55%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++      E ++ LKE+ G  PS+ ++A    +
Sbjct  75    DAVGAFFKEMARYPLLKADEEVELARRVRFLEEWREAQAALKEKSGNQPSKAEVAAEFSL  134

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  135   TERQLENRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRASEKFD  194

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK + G  PS 
Sbjct  195   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQQLGRNPSE  254

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AESL I   ++    +   +  SL+       D      L   + D     +P  ++
Sbjct  255   IELAESLEIPPSQLRQLQQLRRQSLSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  309

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  310   NESMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQSKA  369

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  LV
Sbjct  370   MRKLRRPHIAKRLKGWLV  387



>ref|WP_013190087.1| RNA polymerase sigma factor [Trichormus azollae]
 ref|YP_003720191.1| RpoD subfamily RNA polymerase sigma 70 subunit ['Nostoc azollae' 
0708]
 gb|ADI63068.1| RNA polymerase, sigma 70 subunit, RpoD subfamily ['Nostoc azollae' 
0708]
Length=332

 Score =   169 bits (428),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/317 (33%), Positives = 174/317 (55%), Gaps = 12/317 (4%)
 Frame = -1

Query  1255  IGMEQLQNS---LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPS  1085
             I M+  Q +   ++ Y++ I    LLTH E +   K ++    L E +  L  +LG  P+
Sbjct  13    IAMKTAQTATDLVRTYLREIGRVPLLTHEEEIHYGKQVQRCTTLYEVRENLATQLGYQPT  72

Query  1084  EEQLAVSLRISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLV  905
              E+ A S ++   +L   + E  +A+ ++  +N+RLV+S+A++Y     ++ DLIQ G +
Sbjct  73    LEEWAASAQVEPVELNTAIAEGEIAKRRMVEANLRLVVSVAKKYIKRNIDLLDLIQEGSI  132

Query  904   GLLRGIEKFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL  725
             G+ RG+EKFDP+KGY+ STY YWWIRQ I+RA+ + +  +RLP H+  +L+ I+ A+ +L
Sbjct  133   GMQRGVEKFDPTKGYRFSTYAYWWIRQAITRAIAEKARTIRLPIHITEKLNKIKKAQRQL  192

Query  724   KDK-GITPSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADS  548
               K G  P+   +A+ L ++ ++V    E      SLD     + D   GE L    A  
Sbjct  193   SQKLGRAPTAIELADELELTPRQVRECLEKARLPLSLDLRLGDNYDTELGEMLEDTGA--  250

Query  547   HLENNPWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSR  371
                  P   V + +L  ++  L+   L  +++E+I+L  GL   + LT   I + + +SR
Sbjct  251   ----TPEDFVIQSSLSSDIERLMK-ELTPQQKEVIKLRFGLIDGQALTLSKIGEILNISR  305

Query  370   ERVRQVGLVAFEKLKHA  320
             ERVRQ+   A  KL+ +
Sbjct  306   ERVRQIEREALTKLRKS  322



>ref|WP_009545244.1| MULTISPECIES: RNA polymerase sigma factor [Cyanothece]
 ref|YP_001805008.1| RNA polymerase sigma factor SigD [Cyanothece sp. ATCC 51142]
 gb|ACB52942.1| group 2 sigma-70 RNA polymerase sigma factor D [Cyanothece sp. 
ATCC 51142]
Length=318

 Score =   169 bits (427),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 174/305 (57%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             + ++ Y+K I    LLTH E +  +K ++  + LE+ +  + E  G +P+E Q A + ++
Sbjct  9     DPVRAYLKEIGRVPLLTHEEEILYAKRVQRLVNLEKLREEIIEETGQEPTESQWAKAAKL  68

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S+ + +  +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  69    SKREFRSIVESGEAAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFD  128

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L + KG   ++
Sbjct  129   PTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRELSQQKGRAATV  188

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L+++ K+V    E   +  SLD     + D   G+ L     D     +P    
Sbjct  189   TELAEELDLTPKQVREYLERARQPLSLDLRVGDNQDTELGDLLED---DGQ---SPEDFA  242

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHG-LGNECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ ++  L+   L  +++E+I L  G L  + LT   I  R+ +SRERVRQ+   A
Sbjct  243   THSSLQFDLERLME-DLTSQQKEVIALRFGLLDGQPLTLAKIGSRLNISRERVRQIEREA  301

Query  340   FEKLK  326
               KL+
Sbjct  302   LSKLR  306



>dbj|BAP17692.1| RNA polymerase sigma factor SigD [cyanobacterium endosymbiont 
of Epithemia turgida isolate EtSB Lake Yunoko]
Length=318

 Score =   169 bits (427),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/305 (34%), Positives = 176/305 (58%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             + ++ Y++ I    LLTH E +  +K ++  + LE  +  L E LG +P+  Q A + RI
Sbjct  9     DPVRAYLREIGRVPLLTHEEEILYAKRVQQLVNLENIQESLAEELGQEPTVAQWAKTARI  68

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             ++ +L+  +     A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  69    TQKELRSVIAAGEAAKRKMVEANLRLVVSVAKKYLKRNLDLLDLIQEGTIGMQRGVEKFD  128

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ + S  +RLP H+  +L+ I+ A+ +L ++KG   +I
Sbjct  129   PTKGYRFSTYAYWWIRQAITRAIAEKSRTIRLPIHITEKLNKIKKAQRQLAQEKGRAATI  188

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE L ++ K+V    E   +  SLD     + D   G+ L     DS    +P    
Sbjct  189   QELAEELELTPKQVREYLERARQPLSLDLRVGDNQDTELGDLLE----DSG--PSPEDYA  242

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
                +L+ +++ L+   L  +++E++ L  GL + + LT   I   + +SRERVRQ+   A
Sbjct  243   TYSSLQLDLDKLME-DLTPQQKEVLALRFGLADGKPLTLAKIGTILNISRERVRQIEREA  301

Query  340   FEKLK  326
               KL+
Sbjct  302   LAKLR  306



>ref|XP_003079732.1| SigA (ISS) [Ostreococcus tauri]
Length=525

 Score =   174 bits (440),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 112/323 (35%), Positives = 180/323 (56%), Gaps = 15/323 (5%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLG--CDPSEEQLAVSL  1061
             +S++ Y+K I S  LL  G+ VEL+K I+  ++LE  +  L E  G   + SE Q A + 
Sbjct  201   DSMRSYLKDIGSVTLLNAGQEVELAKRIQDLMHLESIRENLIEETGPGVELSESQWAAAA  260

Query  1060  RISRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEK  881
              ++ + L+  + +   A+ ++  +N+RLV+SIA++Y N      DLIQ G VGL+RG EK
Sbjct  261   GLNVSALRQRLHDGKAAKNEMIQANLRLVVSIAKKYANTNMSFQDLIQEGCVGLIRGAEK  320

Query  880   FDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLK-DKGITP  704
             FD  +GYK STY +WWIRQ ++R++   S  +RLP HL   +S I   E K     G  P
Sbjct  321   FDFQRGYKFSTYAHWWIRQAVTRSISDQSRTIRLPVHLFEIISRISKMEQKFALYNGRPP  380

Query  703   SIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENN---  533
             +++ IA  + +S +K+T   +A     SL +        + GE+    I D+ ++ N   
Sbjct  381   TLEEIASEMEMSVEKITQIKKAAQAPVSLAQ-------TMGGENKGRTIEDTLIDANAEG  433

Query  532   PWHRVDECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQ  356
             P     +  LK+++ N+++ TL  RER+++RL +GL +    T E+I     ++RER+RQ
Sbjct  434   PEKVSGKSLLKEDLENVLN-TLNPRERDVLRLRYGLDDGRVKTLEEIGTVFSVTRERIRQ  492

Query  355   VGLVAFEKLKHAARKNRLKAMLV  287
             +   A  KLK  +R   L+   V
Sbjct  493   IEAKALRKLKQPSRNQVLQEYFV  515



>ref|WP_033665690.1| RNA polymerase sigma factor SigB [Salinispora pacifica]
Length=332

 Score =   169 bits (428),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/317 (35%), Positives = 176/317 (56%), Gaps = 28/317 (9%)
 Frame = -1

Query  1228  LKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRISR  1049
             ++ Y++GI   +LLT  + VELS+ I+ GL+   + +       C P    ++V+LR   
Sbjct  35    VRAYLQGIGRTKLLTAAQEVELSRRIEAGLFATTKLA------TCTP----VSVALR---  81

Query  1048  TDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPS  869
              DL+L   E   A++ L  +N+RLV+SIA+RY   G    DLIQ G +GL+R +EKFD +
Sbjct  82    ADLELVAAEGRAAKDHLLEANLRLVVSIAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYT  141

Query  868   KGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLS-LIRNAETKLKDKGITPSIDR  692
             KGYK STY  WWIRQ I+RA+   +  +R+P H+  +++ ++R         G  P++  
Sbjct  142   KGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEQVNRMVRTRRELSVTLGREPTVAE  201

Query  691   IAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDE  512
             +A +L+I + +V        ++ S DRE   S+D   GE   S + D     +   R+DE
Sbjct  202   VARTLDIPEIQVI-------ELISYDREPV-SLDQTVGEDGESPLGDFVAAVDSTARIDE  253

Query  511   CA----LKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGL  347
              A    L+ E+  ++  TL +RE+ +IRL  GL +    T +++ +  GLSRER+RQ+  
Sbjct  254   TASCGELRQEMRGVL-ATLSQREQAVIRLRFGLDDGRQRTLDEVGREFGLSRERIRQIEK  312

Query  346   VAFEKLKHAARKNRLKA  296
                 KL+   R  RL+A
Sbjct  313   GTLHKLRAPERAQRLEA  329



>ref|WP_009785765.1| RNA polymerase sigma factor [Lyngbya sp. PCC 8106]
 gb|EAW35638.1| RNA polymerase sigma factor [Lyngbya sp. PCC 8106]
Length=319

 Score =   169 bits (427),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 175/305 (57%), Gaps = 9/305 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +S++ Y++ I    LLTH + +   K ++    L+E K +L +RLG +PS  + A +  +
Sbjct  10    DSVRTYLREIGRVPLLTHEQEILYGKQVQQSAILQEGKEKLAKRLGREPSYAEWAENAGV  69

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             S  +LK  + +   A+ K+  +N+RLV+S+A++Y     ++ DLIQ G +G+ RG+EKFD
Sbjct  70    SLKELKQALEDGQTAKRKMVEANLRLVVSVAKKYIKRNVDLLDLIQEGTIGMQRGVEKFD  129

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSI  698
             P+KGY+ STY YWWIRQ I+RA+ +    +RLP H+  +L+ I+ A+  L +D G   +I
Sbjct  130   PTKGYRFSTYAYWWIRQAITRAIAEKGRTIRLPIHITEKLNKIKKAQRSLAQDLGRAATI  189

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +A+ L+++ K++    E      SLD     + D   G+ L    A      +P    
Sbjct  190   AELADELDLNPKQIREYLERARLPLSLDLRVGDNQDTELGDLLEDDGA------SPEDYA  243

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGLGN-ECLTWEDISKRIGLSRERVRQVGLVA  341
              + +++ ++  L+   L +++R+++ L  GL N + +T   I  R+ +SRERVRQ+   A
Sbjct  244   LQSSMRSDLEVLM-ADLTDQQRQVLALRFGLENGQTMTLAKIGDRLNISRERVRQIEREA  302

Query  340   FEKLK  326
               KL+
Sbjct  303   LTKLR  307



>ref|WP_006510827.1| RNA polymerase sigma factor, cyanobacterial RpoD-like family 
[Xenococcus sp. PCC 7305]
 gb|ELS02014.1| RNA polymerase sigma factor, cyanobacterial RpoD-like family 
[Xenococcus sp. PCC 7305]
Length=375

 Score =   170 bits (431),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 106/320 (33%), Positives = 174/320 (54%), Gaps = 8/320 (3%)
 Frame = -1

Query  1240  LQNSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSL  1061
             L++++  + K +    LL   E V L+  +KL +  E  +  L E+L  +PS E+ A ++
Sbjct  60    LEDNVGAFFKEMARYPLLNTDEEVVLANEVKLMVEAEAIRQDLIEQLDRNPSREEWAQAI  119

Query  1060  RISRT-DLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIE  884
              +S T +L+  +    +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  E
Sbjct  120   GLSSTRELEKFLYRGKVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAIGLNRATE  179

Query  883   KFDPSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GIT  707
             KFDP+KGYK STY YWWIRQ I+R +  ++  +RLP H+  +L+ ++ A+  LK K    
Sbjct  180   KFDPNKGYKFSTYAYWWIRQAITRTIANDARTIRLPIHIVEKLNKLKKAQRNLKQKLQRN  239

Query  706   PSIDRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPW  527
             PS   +A+ L I   ++    E   +  SL+        G   ++    + +      P 
Sbjct  240   PSEQELADELKIPPAQLRQLLELRRQSLSLNHRV-----GKAEDTELVDLLEDDDLQLPE  294

Query  526   HRVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVG  350
              ++ E  ++ E+ +++   L +RE+++I L +GL  ++  T E++     +SRERVRQ+ 
Sbjct  295   EKMSEAMMRQEITDVLDDVLTQREKDVISLRYGLFTSQPYTLEEVGGMFNISRERVRQIQ  354

Query  349   LVAFEKLKHAARKNRLKAML  290
               A  KL+      RLK  L
Sbjct  355   SKAMRKLRRPQVARRLKGWL  374



>ref|WP_012407118.1| RNA polymerase sigma factor [Nostoc punctiforme]
 ref|YP_001864035.1| RpoD family RNA polymerase sigma factor [Nostoc punctiforme PCC 
73102]
 gb|ACC79092.1| RNA polymerase, sigma 70 subunit, RpoD family [Nostoc punctiforme 
PCC 73102]
Length=378

 Score =   170 bits (431),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 108/320 (34%), Positives = 180/320 (56%), Gaps = 11/320 (3%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    + E ++ L  +LG +P++ ++A  L +
Sbjct  66    DAVGAFFKEMARYPLLKADEEVELARRVRFLEEIRELQAALNLKLGQEPTKLEIASELEM  125

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  126   TEKQLESRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  185

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDKGI-TPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K    P+ 
Sbjct  186   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLCRNPTE  245

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENN--PWH  524
               +AE+L+IS +++    +   +  SL+       D      L   + D   E+N  P  
Sbjct  246   GEMAEALDISVQQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLED---EDNLSPEA  298

Query  523   RVDECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGL  347
             +++E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+  
Sbjct  299   KMNENMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQS  358

Query  346   VAFEKLKHAARKNRLKAMLV  287
              A  KL+      RLK  L+
Sbjct  359   KAMRKLRRPHIAKRLKGWLI  378



>ref|WP_017651329.1| RNA polymerase sigma factor [Microchaete sp. PCC 7126]
Length=389

 Score =   171 bits (432),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 107/318 (34%), Positives = 175/318 (55%), Gaps = 7/318 (2%)
 Frame = -1

Query  1234  NSLKGYVKGIVSEELLTHGEVVELSKMIKLGLYLEEQKSRLKERLGCDPSEEQLAVSLRI  1055
             +++  + K +    LL   E VEL++ ++    + E ++ L   LG  P++ Q+A  L +
Sbjct  77    DAVGAFFKEMARYPLLKPDEEVELARRVRFIEEVRELQASLHSDLGQYPTKLQVAAQLDM  136

Query  1054  SRTDLKLTMIECSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFD  875
             +   L+  + +  +A+ K+  SN+RLV+SIA+RY N G    DLIQ G +GL R  EKFD
Sbjct  137   TEKQLESRLYQGRVAKRKMIRSNLRLVVSIAKRYLNRGVPFLDLIQEGAMGLNRATEKFD  196

Query  874   PSKGYKLSTYVYWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKLKDK-GITPSI  698
             P KGYK STY YWWIRQ I+RA+  ++  +RLP H+  +L+ ++ A+ +LK K    PS 
Sbjct  197   PDKGYKFSTYAYWWIRQAITRAIANDARTIRLPIHIVEKLNKLKKAQRELKQKLSRNPSE  256

Query  697   DRIAESLNISKKKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRV  518
               +AE+L I+ +++    +   +  SL+       D      L   + D     +P  ++
Sbjct  257   AEMAEALEITVQQLRQLQQLRRQALSLNHRVGKEEDT----ELMDLLEDED-NQSPEAKM  311

Query  517   DECALKDEVNNLIHTTLKEREREIIRLYHGL-GNECLTWEDISKRIGLSRERVRQVGLVA  341
             +E  ++ E+  ++   L  RE+++I L +GL  +E  T E++     LSRERVRQ+   A
Sbjct  312   NENMMRQEIWEVLGDVLTPREKDVISLRYGLTTSEPCTLEEVGNMFNLSRERVRQIQSKA  371

Query  340   FEKLKHAARKNRLKAMLV  287
               KL+      RLK  L+
Sbjct  372   MRKLRRPHIAKRLKGWLI  389



>ref|WP_031291900.1| RNA polymerase sigma factor SigC [Leptolyngbya sp. Heron Island 
J]
Length=423

 Score =   171 bits (434),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 110/309 (36%), Positives = 170/309 (55%), Gaps = 37/309 (12%)
 Frame = -1

Query  1135  LEEQKSRLKERLGCDPSEEQLAVSLRISRTDLKLTMI----------------------E  1022
             L E + R+  +LG  PS E+LA    I+  DLK T+                       E
Sbjct  121   LLETRDRMAAQLGHRPSLERLAKECDIASADLKPTLQAGKRQWAELVGMSVQALDEACHE  180

Query  1021  CSLAREKLAMSNVRLVMSIAQRYDNMGAEMADLIQGGLVGLLRGIEKFDPSKGYKLSTYV  842
                A+E +  +N+RLV+S+A++Y N G E+ DLIQ G +GL R +EKFDP+KGY+ STY 
Sbjct  181   GIRAKEHMIKANLRLVVSVAKKYQNRGLELLDLIQEGTLGLERAVEKFDPTKGYRFSTYA  240

Query  841   YWWIRQGISRALVKNSSMLRLPKHLHGRLSLIRNAETKL-KDKGITPSIDRIAESLNISK  665
             YWWIRQGI+RA+   S  +RLP H+  +L+ I+ A+ K+ + KG T +++ IA  L ++ 
Sbjct  241   YWWIRQGITRAIATQSRTIRLPVHITEKLNKIKKAQRKISQTKGRTATVEDIARELKMTA  300

Query  664   KKVTNATEAVSKVFSLDREAFPSIDGLPGESLHSYIADSHLENNPWHRVDECALKDEVNN  485
              +V      V +  SL+ +     D   G+ L +         +P    +E A++D +  
Sbjct  301   PQVREVLLKVPRSISLETKVGKERDTELGDLLETDAL------SP----EELAVRDALRR  350

Query  484   LIHTTLKE---REREIIRLYHGLGNEC-LTWEDISKRIGLSRERVRQVGLVAFEKLKHAA  317
              +H  L +   RE+E+IRL  GLG+    +  +I + + LSRERVRQ+   A +KL+   
Sbjct  351   DLHQLLADLTTREQEVIRLRFGLGDGVPYSLAEIGRTLELSRERVRQIESKALQKLRQPK  410

Query  316   RKNRLKAML  290
             R+NR++  L
Sbjct  411   RRNRIRDYL  419



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6726315549818