BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23634_g2_i2 len=819 path=[40:0-59 100:60-107 9272:108-122
163:123-123 164:124-131 172:132-159 200:160-320 361:321-382
423:383-628 8966:629-668 9364:669-683 721:684-709 747:710-755
793:756-758 793:759-761 793:762-764 793:765-767 793:768-770
793:771-773 793:774-776 793:777-779 793:780-782 793:783-785
793:786-788 793:789-791 793:792-794 793:795-797 793:798-800
793:801-803 793:804-806 793:807-809 793:810-812 793:813-815
793:816-818]

Length=819
                                                                      Score     E

ref|XP_010536414.1|  PREDICTED: miraculin-like                        65.5    2e-09   
gb|ABB97547.1|  sporamin A precursor                                  62.4    3e-08   Ipomoea batatas [batate]
gb|AAD40288.1|  sporamin A precursor                                  62.0    3e-08   Ipomoea batatas [batate]
sp|P10917.1|SPORA_IPOBA  RecName: Full=Sporamin A; Flags: Precursor   60.8    1e-07   Ipomoea batatas [batate]
ref|XP_010416122.1|  PREDICTED: trypsin inhibitor BvTI-like           60.1    1e-07   
emb|CDY11118.1|  BnaC06g23700D                                        59.7    2e-07   
sp|P14715.1|SPOR1_IPOBA  RecName: Full=Sporamin A; AltName: Full=...  59.7    2e-07   Ipomoea batatas [batate]
gb|AFR60852.1|  sporamin                                              59.7    2e-07   
gb|AAD05567.1|  sporamin A                                            59.3    4e-07   Ipomoea batatas [batate]
ref|XP_010918417.1|  PREDICTED: miraculin-like                        58.2    6e-07   
gb|AAB52547.1|  sporamin precursor                                    58.5    7e-07   Ipomoea batatas [batate]
gb|ABG26230.1|  sporamin A                                            58.2    7e-07   Ipomoea trifida
gb|AAA86670.1|  preprosporamin                                        57.8    1e-06   Ipomoea batatas [batate]
gb|ABG26232.1|  sporamin A                                            57.8    1e-06   Ipomoea trifida
gb|ABB97545.1|  sporamin A precursor                                  57.8    1e-06   Ipomoea batatas [batate]
ref|XP_009777240.1|  PREDICTED: miraculin-like                        57.4    1e-06   
gb|AFR60856.1|  sporamin A                                            57.4    1e-06   
ref|XP_010428249.1|  PREDICTED: trypsin inhibitor BvTI-like           57.4    1e-06   
gb|AAA33391.1|  sporamin A precursor                                  57.4    1e-06   Ipomoea batatas [batate]
gb|ABB97544.1|  sporamin A precursor                                  57.4    1e-06   Ipomoea batatas [batate]
gb|ABG26224.1|  sporamin A                                            57.4    1e-06   Ipomoea leucantha
gb|ABB97549.1|  sporamin A precursor                                  57.4    2e-06   Ipomoea batatas [batate]
ref|XP_008238584.1|  PREDICTED: miraculin-like                        57.0    2e-06   
ref|XP_006390572.1|  hypothetical protein EUTSA_v10019151mg           57.0    2e-06   
gb|ABY19576.1|  sporamin A precursor                                  57.0    2e-06   Ipomoea batatas [batate]
gb|AAB52548.1|  sporamin precursor                                    56.6    3e-06   Ipomoea batatas [batate]
gb|ABG26236.1|  sporamin A                                            56.2    4e-06   Ipomoea trifida
ref|XP_010428237.1|  PREDICTED: miraculin-like                        55.8    4e-06   
gb|AFR60855.1|  sporamin A                                            55.8    5e-06   
gb|ABG26222.1|  sporamin A                                            55.8    5e-06   Ipomoea leucantha
gb|AAL55800.1|AF289060_1  sporamin                                    55.8    6e-06   Ipomoea batatas [batate]
ref|XP_010428238.1|  PREDICTED: trypsin inhibitor BvTI-like           55.5    6e-06   
gb|ABG26231.1|  sporamin A                                            55.5    6e-06   Ipomoea trifida
gb|ABB97543.1|  sporamin A precursor                                  55.1    7e-06   Ipomoea batatas [batate]
gb|ABG26235.1|  sporamin A                                            55.1    9e-06   Ipomoea trifida
gb|ABB97542.1|  sporamin A precursor                                  54.7    2e-05   Ipomoea batatas [batate]
gb|ABG26227.1|  sporamin A                                            54.3    2e-05   Ipomoea leucantha
sp|P14716.1|SPOR2_IPOBA  RecName: Full=Sporamin B; AltName: Full=...  54.3    2e-05   Ipomoea batatas [batate]
ref|XP_010428240.1|  PREDICTED: trypsin inhibitor BvTI-like           53.9    2e-05   
gb|AFR60858.1|  sporamin A                                            53.9    2e-05   
sp|P10965.1|SPORB_IPOBA  RecName: Full=Sporamin B; Flags: Precursor   53.9    3e-05   Ipomoea batatas [batate]
ref|XP_006441439.1|  hypothetical protein CICLE_v10022282mg           53.5    3e-05   
ref|XP_009608866.1|  PREDICTED: miraculin-like                        53.1    4e-05   
ref|XP_010416116.1|  PREDICTED: miraculin-like                        53.1    5e-05   
gb|ABG26238.1|  sporamin A                                            53.1    5e-05   Ipomoea trifida
gb|AFR60864.1|  sporamin B                                            53.1    5e-05   
gb|AFR60865.1|  sporamin B                                            52.8    6e-05   
ref|XP_003532233.1|  PREDICTED: kunitz-type trypsin inhibitor KTI...  52.8    6e-05   
emb|CAA44005.1|  aspartic proteinase inhibitor homologue              52.8    6e-05   Solanum tuberosum [potatoes]
sp|Q43645.2|API4_SOLTU  RecName: Full=Aspartic protease inhibitor...  52.8    7e-05   Solanum tuberosum [potatoes]
gb|ABG26229.1|  sporamin A                                            52.8    7e-05   Ipomoea trifida
ref|XP_011035401.1|  PREDICTED: miraculin-like                        52.4    8e-05   
ref|XP_007211211.1|  hypothetical protein PRUPE_ppa011496mg           52.4    8e-05   
gb|AFR60863.1|  sporamin B                                            52.4    9e-05   
gb|AAA33390.1|  sporamin B                                            52.4    9e-05   Ipomoea batatas [batate]
gb|AFR60862.1|  sporamin B                                            52.4    9e-05   
gb|AFR60859.1|  sporamin B                                            52.0    1e-04   
gb|ABB90968.1|  sporamin B precursor                                  52.0    1e-04   Ipomoea batatas [batate]
gb|AFR60867.1|  sporamin B                                            52.0    1e-04   
ref|XP_006495064.1|  PREDICTED: miraculin-like                        51.6    1e-04   
gb|AIT42164.1|  Kunitz-type inhibitor A                               52.0    1e-04   
ref|XP_010471385.1|  PREDICTED: trypsin inhibitor BvTI-like           51.6    1e-04   
ref|XP_006493430.1|  PREDICTED: miraculin-like                        51.6    1e-04   
gb|AIT42157.1|  Kunitz-type inhibitor A                               51.6    1e-04   
ref|XP_009615974.1|  PREDICTED: miraculin-like                        51.2    2e-04   
ref|XP_006495063.1|  PREDICTED: miraculin-like                        51.2    2e-04   
emb|CDY59714.1|  BnaC02g46470D                                        51.6    2e-04   
gb|AFL91226.1|  Kunitz-like protease inhibitor                        50.4    2e-04   
gb|AIT42166.1|  Kunitz-type inhibitor A                               51.2    2e-04   
ref|XP_006347377.1|  PREDICTED: miraculin-like                        50.8    3e-04   
ref|NP_001274866.1|  Kunitz-type enzyme inhibitor P4E1 precursor      50.8    3e-04   
ref|XP_010539167.1|  PREDICTED: bark lectin isoform 2-like            50.4    3e-04   
sp|P13087.3|MIRA_SYNDU  RecName: Full=Miraculin; Short=MIR; Flags...  50.8    3e-04   Synsepalum dulcificum [miracle fruit]
ref|XP_006441441.1|  hypothetical protein CICLE_v10023320mg           50.1    4e-04   
gb|AFR60860.1|  sporamin B                                            50.1    5e-04   
ref|XP_009803614.1|  PREDICTED: miraculin-like                        49.7    6e-04   
ref|XP_004241480.1|  PREDICTED: miraculin-like                        49.3    9e-04   



>ref|XP_010536414.1| PREDICTED: miraculin-like [Tarenaya hassleriana]
Length=212

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 84/190 (44%), Gaps = 28/190 (15%)
 Frame = +3

Query  135  GTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPEDN  314
            GTAV D DGD L+PG  Y +       V+ GH   + L  RGS   CP +++  ++  D+
Sbjct  23   GTAVRDVDGDLLRPGVGYYVLP-----VLRGHGGGLTLAGRGS-ELCPLDIVQENSEVDD  76

Query  315  VRSVKFIPEDATATSILESTRLAVRFD--SPVCVDFSNWHISAGYDPS----FVTT----  464
               VKF    +    + ES  L ++ D  + +C+  + W I   +D      FVTT    
Sbjct  77   GIPVKFSGWTSRVGFVPESEDLNIKTDVAATICIQSTYWWIDE-FDKQRKQWFVTTGNAL  135

Query  465  ---TQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPL---GIAHLAIS  626
                + S    F I KS   N Y+  FCP D   C  +   C   G  +   GI  LA+S
Sbjct  136  RRSGKESLRSFFKIVKSR--NDYKFVFCPRDCEFCRPI---CGDVGIFVDENGIRRLALS  190

Query  627  YSPITVQFLK  656
              P  V F K
Sbjct  191  DQPFVVMFKK  200



>gb|ABB97547.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97548.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 89/203 (44%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +  +G   +G   P  L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEIRAGGNYYMVSAIWG---VGGGGP-RL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELV---DANLNSYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDHM---LRTTRLALSNSPF  210



>gb|AAD40288.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 89/201 (44%), Gaps = 25/201 (12%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +   G    G    + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAILGACGGG----LRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  AT ++ ST    RF+   + +CV+
Sbjct  74   AHLDLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVN  133

Query  414  FSNWHISAGYDPSFVTTTQPSFSY------NFMIHK-SAKDNHYQLAFCPSDSTMCYTVG  572
              NW I   YD + V +   +  +       F I    A  N Y+L +C   S  CY VG
Sbjct  134  NVNWGIQ--YDSASVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVG  191

Query  573  TLCTQTGCPLGIAHLAISYSP  635
                     L    LAISY P
Sbjct  192  RFNDPM---LRTTRLAISYYP  209



>sp|P10917.1|SPORA_IPOBA RecName: Full=Sporamin A; Flags: Precursor [Ipomoea batatas]
 emb|CAA31862.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 88/209 (42%), Gaps = 39/209 (19%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPG----TLYKITAPGYGDVILGHAF  236
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G     +Y I     G + L H  
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVYAILGACGGGLRLAHL-  76

Query  237  PVGLQERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SP  401
                     +  C ++V++  N  DN   +   P   D  AT ++ ST    RF+   + 
Sbjct  77   -------DLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNK  129

Query  402  VCVDFSNWHISAGYDPS----------FVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDS  551
            +CV+  NW I   YD +          FV+     F    +    A  N Y+L +C   S
Sbjct  130  LCVNNVNWGIQ--YDSASGQSLLKAGEFVSDNSNQFKIEVV---DANLNFYKLTYCLFGS  184

Query  552  TMCYTVGTLCTQTGCPLGIAHLAISYSPI  638
              CY VG         L    LA+SY P 
Sbjct  185  DKCYNVGRFKDPM---LRTTRLALSYYPF  210



>ref|XP_010416122.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=207

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 84/196 (43%), Gaps = 23/196 (12%)
 Frame = +3

Query  144  VLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPEDNVRS  323
            VLD DGD +  G+ Y +       VI G    + L  RG  P CP +++  S+  D    
Sbjct  25   VLDIDGDIIFDGSYYVLP------VIRGQGGGLTLAGRGDQP-CPLDIVQESSEVDEGIP  77

Query  324  VKFIPEDATATSILESTRLAVRFD--SPVCVDFSNWHISAGYDPSFVTTTQPSFS----Y  485
            VKF    +    + ES  L +  D  + +CV  + W +       F  T  P        
Sbjct  78   VKFSNWRSRVGFVPESENLNIETDVAATICVQSTYWWVDT--KAKFRVTAGPKPEEESLL  135

Query  486  NFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPLGIAHLAISY----SPITVQFL  653
            +F   ++  D++YQ AFCPS    CY VG    +     G+  LA++     +P  V F 
Sbjct  136  SFFQIQNVYDHYYQFAFCPSGPKGCYDVGIFVDEN----GVRRLALTKRSDNTPFLVMFK  191

Query  654  KTN*N*INNASPARYL  701
            K N   I++ +   ++
Sbjct  192  KANVQEISSKTKTMFI  207



>emb|CDY11118.1| BnaC06g23700D [Brassica napus]
Length=201

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 75/185 (41%), Gaps = 25/185 (14%)
 Frame = +3

Query  141  AVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPEDNVR  320
            AVLD DGD +  G+ Y +       VI G    V LQ RG    CP +++  S+  D   
Sbjct  22   AVLDIDGDIIFRGSYYVLP------VIRGRGGGVTLQGRGG-ELCPYDIVQESSEVDEGI  74

Query  321  SVKFIPEDATATSILESTRLAVRFDSPV--CVDFSNWHISAGYDPS-----FVTTTQPSF  479
             VKF         + ES  L +  D  V  C+  + W +   +D        V   Q S 
Sbjct  75   PVKFSNWRPRVAFVPESQDLNIEMDVEVTICIQSTYWRVGE-FDEERKEYFVVAGRQDSP  133

Query  480  SYNFMIHKSAKDNHYQLAFCP----SDSTMCYTVGTLCTQTGCPLGIAHLAISYSPITVQ  647
               F I KS  D  Y+  FCP    S    C  VG    +    +G+  LA+S  P  V 
Sbjct  134  KSFFQIEKSGDD--YKFVFCPPACDSGRPRCRNVGIFVDE----IGVRRLALSSEPFLVM  187

Query  648  FLKTN  662
            F K N
Sbjct  188  FKKAN  192



>sp|P14715.1|SPOR1_IPOBA RecName: Full=Sporamin A; AltName: Full=Clone PIM0335; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33197.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 86/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C T+V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCATDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELV---DANLNSYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDHM---LRTTRLALSNSPF  210



>gb|AFR60852.1| sporamin [Ipomoea batatas]
Length=219

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 87/205 (42%), Gaps = 31/205 (15%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPPSSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  AT ++ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCASDVIVSPNDLDNGDPITITPATADPEATVVMTSTYQTFRFNIATNKLCVN  133

Query  414  FSNWHISAGYDPS----------FVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCY  563
              NW I   YD +          FV+     F    +    A  N Y+L +C   S  CY
Sbjct  134  NVNWGIQ--YDSASVQSLLKAGEFVSDNSNQFKIEVV---DANLNFYKLTYCLFGSDKCY  188

Query  564  TVGTLCTQTGCPLGIAHLAISYSPI  638
             VG         L    LA+SY P 
Sbjct  189  NVGRFNDPM---LRTTRLALSYYPF  210



>gb|AAD05567.1| sporamin A [Ipomoea batatas]
Length=219

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 89/201 (44%), Gaps = 25/201 (12%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +   G    G    + L
Sbjct  19   NPAHS-GFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYLVSAILGACGGG----LRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  AT ++ ST    RF+   + +CV+
Sbjct  74   AHLDLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVN  133

Query  414  FSNWHISAGYDPSFVTTTQPS------FSYNFMIHK-SAKDNHYQLAFCPSDSTMCYTVG  572
              NW I   YD + V +   +       +  F I    A  N Y+L +C   S  CY VG
Sbjct  134  NVNWGIQ--YDSASVQSLLKAGESVSDKTNQFKIEVVDANLNFYKLTYCLFGSDKCYNVG  191

Query  573  TLCTQTGCPLGIAHLAISYSP  635
                     L    LA+SY P
Sbjct  192  RFNDPM---LRTTRLALSYYP  209



>ref|XP_010918417.1| PREDICTED: miraculin-like [Elaeis guineensis]
Length=199

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 85/190 (45%), Gaps = 27/190 (14%)
 Frame = +3

Query  132  AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPED  311
            AG  VLD DG+ L+ G  Y I  PG  DV  G    + L  R     CP +V L  +P +
Sbjct  21   AGEVVLDTDGNELRRGVEYYI-YPGITDVAGG----LTLASRNH--SCPLDVTLAISPTN  73

Query  312  NVRSVKFIPEDATATSILESTRLAVRFDS-PVCVDFSNWHISAGYDPS----FVTT----  464
            N   V F+P D    +I  ST L + F +  +C+  + W +   +D +    +VTT    
Sbjct  74   NGLPVTFLPADPEEDTINTSTDLNIVFSAFTICLQSTAWKLD--FDNTTRRFYVTTGGVT  131

Query  465  ---TQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPL--GIAHLAISY  629
                + +    F I  ++  + Y L FCPS   +C  V   C   G     G   L IS 
Sbjct  132  GNPGRETLDNWFKIQSASGRSGYNLVFCPSVCNICRPV---CGSLGVVREDGRLRLGISS  188

Query  630  -SPITVQFLK  656
             +P+ V+F +
Sbjct  189  DAPLPVEFRR  198



>gb|AAB52547.1| sporamin precursor [Ipomoea batatas]
 gb|ABB97540.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97541.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97546.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 86/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELV---DANLNSYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDHM---LRTTRLALSNSPF  210



>gb|ABG26230.1| sporamin A [Ipomoea trifida]
 gb|AFR60857.1| sporamin A [Ipomoea batatas]
Length=219

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 87/203 (43%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                ++  C ++V++  N  DN   +   P   D  +T +L ST    RF+   + +CV+
Sbjct  74   AHLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVV---DANLNFYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDPM---LRTTRLALSNSPF  210



>gb|AAA86670.1| preprosporamin [Ipomoea batatas]
Length=219

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 86/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                ++  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV 
Sbjct  74   AHLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIANNKLCVK  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y   D  FV+     F    +    A  N Y+L +C   S  CY  
Sbjct  134  NVNWGIQHDSASGQYFLKDGEFVSDNSNQFKIEVV---DANLNFYKLTYCQFGSDKCYNC  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDPM---LRTTRLALSNSPF  210



>gb|ABG26232.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 87/203 (43%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                ++  C ++V++  N  DN   +   P   D  +T +L ST    RF+   + +CV+
Sbjct  74   AHLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVV---DANLNFYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDPM---LRTTRLALSDSPF  210



>gb|ABB97545.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 86/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCASDVIISPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELV---DANLNFYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDPM---LRTTRLALSNSPF  210



>ref|XP_009777240.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 85/202 (42%), Gaps = 29/202 (14%)
 Frame = +3

Query  102  NPIRLPTDDDAGTAVLDADGDPLKPGTLYKI--TAPGYGDVILGHAFPVGLQERGSLPGC  275
            NP  L +   + + VLD +GD ++ G+ Y +     G G    G   P  +++  S   C
Sbjct  20   NPSELVSAGPSPSPVLDTNGDKIRAGSNYFVLPVIRGRG----GGLLPSNVKQNNS---C  72

Query  276  PTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFDSP-VCVDFSNWHISAGYDPS  452
            P +++  SN       V F P D     I  ST L VRF +P +C   + W +   YD  
Sbjct  73   PRDIIQNSNEVQEGLPVVFTPVDPKKGVIRLSTDLNVRFFTPTICARETIWKLGT-YDEK  131

Query  453  ----FVTTTQP-------SFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGC-  596
                F+ T          + S  F I K   D  Y+  FCPS  T C  +   C   G  
Sbjct  132  LKQYFIVTGGVEGNPGPLTVSNWFKIEKLGTD--YKFVFCPSVCTFCKVI---CKDVGIY  186

Query  597  -PLGIAHLAISYSPITVQFLKT  659
               G+  LA+S +P  V F +T
Sbjct  187  NKDGVRFLALSDTPFRVMFKRT  208



>gb|AFR60856.1| sporamin A [Ipomoea batatas]
Length=219

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 86/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQQDSASGQYFLKAGEFVSDNSNQFKIEVV---DANLNFYKLTYCLFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+SY P 
Sbjct  191  GRFKDPM---LRTTRLALSYYPF  210



>ref|XP_010428249.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
 ref|XP_010428250.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=208

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 75/181 (41%), Gaps = 19/181 (10%)
 Frame = +3

Query  144  VLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPEDNVRS  323
            VLD DGD +  G+ Y +       VI G    + L  RG  P CP +++  S+  D    
Sbjct  26   VLDIDGDIIFRGSYYVLP------VISGQGGGLTLAGRGDQP-CPLDIVQESSEVDEGIP  78

Query  324  VKFIPEDATATSILESTRLAVRFD--SPVCVDFSNWHISAGYDPSFVTTTQPSFS--YNF  491
            VKF    +    + ES  L +  D  + +CV  + W +            +P      +F
Sbjct  79   VKFSNWRSRVGFVPESENLNIETDVKATICVQSTYWWVDTKAKFRVTAGPKPEEESLLSF  138

Query  492  MIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPLGIAHLAISY----SPITVQFLKT  659
               +   D+ YQ AFCPS    CY VG    +     G+  LA++     +P  V F K 
Sbjct  139  FQIQHVYDHFYQFAFCPSGPKGCYDVGIFVDEN----GVRRLALTKRTDDTPFLVMFKKA  194

Query  660  N  662
            N
Sbjct  195  N  195



>gb|AAA33391.1| sporamin A precursor [Ipomoea batatas]
 gb|ABG26237.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 87/203 (43%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                ++  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+
Sbjct  74   AHLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVV---DANLNFYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDPM---LRTTRLALSNSPF  210



>gb|ABB97544.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 86/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQQDSASGQYFLKAGEFVSDNSNQFKIELV---DANLNSYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    +A+S SP 
Sbjct  191  GRFHDHM---LRTTRIALSNSPF  210



>gb|ABG26224.1| sporamin A [Ipomoea leucantha]
 gb|ABG26226.1| sporamin A [Ipomoea leucantha]
 gb|ABG26228.1| sporamin A [Ipomoea leucantha]
 gb|ABG26233.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 87/203 (43%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPPSSQTPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                ++  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+
Sbjct  74   AHLDTMSKCASDVIVSPNDLDNGDPITITPAAADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVV---DANLNFYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDPM---LRTTRLALSNSPF  210



>gb|ABB97549.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97550.1| sporamin A precursor [Ipomoea batatas]
 gb|AFR60854.1| sporamin [Ipomoea batatas]
Length=219

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 86/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELV---DANLNFYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDPM---LRTTRLALSNSPF  210



>ref|XP_008238584.1| PREDICTED: miraculin-like [Prunus mume]
Length=208

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 81/191 (42%), Gaps = 25/191 (13%)
 Frame = +3

Query  126  DDAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNP  305
            D A + VLD  G+ L+ G  Y I       VI G    + L    +   CP +V+   N 
Sbjct  28   DAAPSPVLDITGNKLQTGVNYYILP-----VIRGRGGGLTLASTSNKTSCPLDVVQEQNE  82

Query  306  EDNVRSVKFIPEDATATSILESTRLAVRFDS-PVCVDFSNWHISAGYDPS----FVTT--  464
              N  S+KF P + T   +L ST L ++F +  +CV  + W +   +D      FVT+  
Sbjct  83   VSNGLSLKFSPVNVTKGVVLVSTDLNIKFSATTICVQSTVWKLGK-FDEQTGQWFVTSGG  141

Query  465  -----TQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPL--GIAHLAI  623
                  + + S  F I K   D  Y+L FCP   T+C     +C   G     G   LA+
Sbjct  142  VEGNPGRQTTSNWFKIEKFGDD--YKLVFCP---TVCNFCKVICRDVGIFFQDGKRRLAL  196

Query  624  SYSPITVQFLK  656
            S  P    F K
Sbjct  197  SDVPFRAMFKK  207



>ref|XP_006390572.1| hypothetical protein EUTSA_v10019151mg [Eutrema salsugineum]
 gb|ESQ27858.1| hypothetical protein EUTSA_v10019151mg [Eutrema salsugineum]
Length=202

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 82/187 (44%), Gaps = 20/187 (11%)
 Frame = +3

Query  129  DAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPE  308
            +A  AVLD DGD +  G+ Y +       VI G    + L  RG  P CP +++  S+  
Sbjct  18   NAYGAVLDIDGDSMFDGSYYVLP------VIRGQGGGLSLGGRGGQP-CPLDIVQESSEV  70

Query  309  DNVRSVKFIPEDATATSILESTRLAVRFD--SPVCVDFSNWHISAGYDPS----FVTTTQ  470
            D+   VKF         + ES RL +  D  + +C+  + W +    D       V   Q
Sbjct  71   DDGIPVKFSNWSLKVAFVPESARLNIETDVAATICIQSTYWRVGEFDDERKQYFVVAGPQ  130

Query  471  PSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPL---GIAHLAISYSPIT  641
             SF   F I KS  D+ Y+  FCP     C + G  C+  G  +   G+  LA+S  P  
Sbjct  131  DSFKSFFTIEKSG-DDAYKFRFCPR---TCESGGPKCSDVGIFVDETGVRRLALSDEPFL  186

Query  642  VQFLKTN  662
            V F K N
Sbjct  187  VMFKKAN  193



>gb|ABY19576.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 86/202 (43%), Gaps = 27/202 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQQDSASGQYFLKAGEFVSDNSNQFKIELV---DANLNSYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSP  635
            G         L    +A+S SP
Sbjct  191  GRFHDHM---LRTTRIALSNSP  209



>gb|AAB52548.1| sporamin precursor [Ipomoea batatas]
Length=219

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 86/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVV---DANLNFYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDPM---LRTTRLALSNSPF  210



>gb|ABG26236.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 83/196 (42%), Gaps = 26/196 (13%)
 Frame = +3

Query  99   YNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLP  269
            +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L    ++ 
Sbjct  25   FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRLAHLDTMS  80

Query  270  GCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVDFSNWHI-  431
             C ++V++  N  DN   +   P   D  +T +L ST    RF+   + +CV+  NW I 
Sbjct  81   KCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNVNWRIQ  140

Query  432  ----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQT  590
                S  Y      FV+     F    +    A  N Y+L +C   S  CY VG      
Sbjct  141  HDSASGQYFLKAGEFVSDNSNQFKIEVV---DANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  591  GCPLGIAHLAISYSPI  638
               L    LA+S SP 
Sbjct  198  ---LRTTRLALSDSPF  210



>ref|XP_010428237.1| PREDICTED: miraculin-like [Camelina sativa]
Length=208

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 80/197 (41%), Gaps = 34/197 (17%)
 Frame = +3

Query  129  DAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPE  308
            +A  AVLD DG+ +  G+ Y +       VI G    + L  RG    CP +++  S   
Sbjct  18   NAYGAVLDIDGNIIFRGSYYVLP------VIRGRGGGLTLSGRGG-ELCPLDIVQESQEV  70

Query  309  DNVRSVKFIPEDATATSILESTRLAVRFD--SPVCVDFSNWH------------ISAGYD  446
            D    VKF         + ES  L ++ D  + +C   + W             I AG  
Sbjct  71   DEGNPVKFSNWRPRVAFVPESQDLNIKTDVEATICFQSTYWRVGEFDEERKQYFIVAGLK  130

Query  447  PS-FVTTTQPSFSYNFMIHKSAKDNHYQLAFCP----SDSTMCYTVGTLCTQTGCPLGIA  611
            P  F   +  SF   F I KS  D+ Y+  FCP    SD   C  VG    +    LG+ 
Sbjct  131  PEGFGQDSSKSF---FKIEKSG-DDAYKFVFCPSTCDSDCPKCSDVGIFVDE----LGVR  182

Query  612  HLAISYSPITVQFLKTN  662
             LA+S  P  V F K N
Sbjct  183  RLALSDDPFLVMFKKAN  199



>gb|AFR60855.1| sporamin A [Ipomoea batatas]
Length=219

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 85/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVV---DANLNSYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G              LA+S SP 
Sbjct  191  GRFHDHMS---RTTRLALSNSPF  210



>gb|ABG26222.1| sporamin A [Ipomoea leucantha]
 gb|ABG26223.1| sporamin A [Ipomoea leucantha]
 gb|ABG26225.1| sporamin A [Ipomoea leucantha]
 gb|ABG26234.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 86/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPPSSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  ++ I+ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCASDVIVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVV---DANLNFYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDPM---LRTTRLALSNSPF  210



>gb|AAL55800.1|AF289060_1 sporamin [Ipomoea batatas]
Length=219

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 86/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVV---DANLNFYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         +    LA+S SP 
Sbjct  191  GRFHDPL---MRTTRLALSNSPF  210



>ref|XP_010428238.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=209

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 75/182 (41%), Gaps = 18/182 (10%)
 Frame = +3

Query  144  VLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPEDNVRS  323
            VLD DGD +  G+ Y +       VI G    + L  RG  P CP +++  S+  D    
Sbjct  25   VLDTDGDIIFDGSYYVLP------VIRGQGGGLTLAGRGDQP-CPLDIVQESSEVDEGIP  77

Query  324  VKFIPEDATATSILESTRLAVRFD--SPVCVDFSNWHISAGYDPSFVTTTQPS------F  479
            VKF    +    + ES  L +  +  + +CV  + W +    +  F  T  P        
Sbjct  78   VKFSNWRSKVGFVPESENLNIETEVAATICVQLAYWWVDE--NAKFRVTAGPKPDELVKE  135

Query  480  SY-NFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPLGIAHLAISYSPITVQFLK  656
            SY +F   ++  D+ YQ AFCP+    C  VG    + G    +       +P  V F K
Sbjct  136  SYLSFFQIQNVYDHFYQFAFCPTGPKSCSDVGVFVDENGVRRLVLTKRSDNTPFLVMFKK  195

Query  657  TN  662
             N
Sbjct  196  AN  197



>gb|ABG26231.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 86/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                ++  C ++V++  N  DN   +   P   D  +T +L ST    RF+   + +CV+
Sbjct  74   AHLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F         A  N Y+L +C   S  C+ V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEV---DDANLNFYKLTYCQFGSDKCHNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDPM---LRTTRLALSNSPF  210



>gb|ABB97543.1| sporamin A precursor [Ipomoea batatas]
Length=199

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 82/196 (42%), Gaps = 26/196 (13%)
 Frame = +3

Query  99   YNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLP  269
            +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L     + 
Sbjct  5    FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRLAHLDMMS  60

Query  270  GCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVDFSNWHI-  431
             C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+  NW I 
Sbjct  61   KCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNWGIQ  120

Query  432  ----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQT  590
                S  Y      FV+     F    +    A  N Y+L +C   S  CY VG      
Sbjct  121  HDSASGQYFLKAGEFVSDNSNQFKIELV---DANLNFYKLTYCQFGSDKCYNVGRFHDPM  177

Query  591  GCPLGIAHLAISYSPI  638
               L    LA+S SP 
Sbjct  178  ---LRTTRLALSNSPF  190



>gb|ABG26235.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 86/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPSSSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  ++ I+ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESSVIMTSTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIRHDSASGQYFLKAGEFVSDNSNQFKIEVV---DANLNSYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         +    LA+S SP 
Sbjct  191  GRFHDPM---MRTTRLALSNSPF  210



>gb|ABB97542.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 86/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + +CV+
Sbjct  74   GHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   +  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELV---DANLNSYKLTYCQFGADKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDHM---LRTTRLALSNSPF  210



>gb|ABG26227.1| sporamin A [Ipomoea leucantha]
Length=219

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 85/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPPPSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V +  N  DN   +   P   D  ++ I+ ST    RF+   + +CV+
Sbjct  74   AHLDMMSKCASDVTVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVV---DANLNFYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDPM---LRTTRLALSNSPF  210



>sp|P14716.1|SPOR2_IPOBA RecName: Full=Sporamin B; AltName: Full=Clone PIM0535; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33198.1| unnamed protein product [Ipomoea batatas]
Length=216

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 80/176 (45%), Gaps = 15/176 (9%)
 Frame = +3

Query  78   HPTHSFTYNPIRL-PTDDDAG--TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +PTHS  +NPIRL P  + A   T VLD +GD ++ G  Y + +  +G    G      +
Sbjct  17   NPTHS-KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYMVSAIWG---AGGGGLRLV  72

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFD---SPVCVDFS  419
            +   S   C ++V++  +  DN   +   P D  AT ++ ST    RF+   + +CV+  
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNIATNKLCVNNV  132

Query  420  NWHISAGYDPSFVTTTQPSF----SYNFMIHKSAKD-NHYQLAFCPSDSTMCYTVG  572
            NW I    +          F    S  F I     + N Y++++C   +  C+ VG
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVG  188



>ref|XP_010428240.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=210

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 79/186 (42%), Gaps = 26/186 (14%)
 Frame = +3

Query  144  VLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPEDNVRS  323
            VLD DGD +  G+ Y +       VI G    + L  RG  P CP +++  S+  D    
Sbjct  26   VLDTDGDIIFGGSYYVLP------VIRGQGGGLTLAGRGDQP-CPLDIVQESSEVDEGIP  78

Query  324  VKFIPEDATATSILESTRLAVRFD--SPVCVDFSNWHISAGYDPSFVTTTQPS------F  479
            VKF    +    + ES  L +  +  + +CV  + W +    +  F  T  P        
Sbjct  79   VKFSNWRSKVGFVPESANLNIETEVAATICVQSAYWWVDE--NAKFRVTAGPKPDELVKE  136

Query  480  SY-NFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPLGIAHLAISY----SPITV  644
            SY +F   ++  D+ YQ AFCP+    C  VG    +     G+  LA++     +P  V
Sbjct  137  SYLSFFQIQNVYDHFYQFAFCPTGPKSCSDVGVFVDEN----GVRRLALTKRADNTPFLV  192

Query  645  QFLKTN  662
             F K N
Sbjct  193  MFKKAN  198



>gb|AFR60858.1| sporamin A [Ipomoea batatas]
Length=216

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 79/176 (45%), Gaps = 15/176 (9%)
 Frame = +3

Query  78   HPTHSFTYNPIRL-PTDDDAG--TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRL P  + A   T VLD +GD ++ G  Y I +  +G    G      +
Sbjct  17   NPAHS-KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG---AGGGGLRLV  72

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFD---SPVCVDFS  419
            +   S   C ++V++  +  DN   +   P D  AT ++ ST    RF+   + +CV+  
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNIATNKLCVNNV  132

Query  420  NWHISAGYDPSFVTTTQPSF----SYNFMIHKSAKD-NHYQLAFCPSDSTMCYTVG  572
            NW I    +          F    S  F I     + N Y++++C   +  C+ VG
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVG  188



>sp|P10965.1|SPORB_IPOBA RecName: Full=Sporamin B; Flags: Precursor [Ipomoea batatas]
 emb|CAA31863.1| unnamed protein product [Ipomoea batatas]
 gb|AFR60861.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 79/176 (45%), Gaps = 15/176 (9%)
 Frame = +3

Query  78   HPTHSFTYNPIRL-PTDDDAG--TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRL P  + A   T VLD +GD ++ G  Y I +  +G    G      +
Sbjct  17   NPAHS-KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG---AGGGGLRLV  72

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFD---SPVCVDFS  419
            +   S   C ++V++  +  DN   +   P D  AT ++ ST    RF+   + +CV+  
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNIATNKLCVNNV  132

Query  420  NWHISAGYDPSFVTTTQPSF----SYNFMIHKSAKD-NHYQLAFCPSDSTMCYTVG  572
            NW I    +          F    S  F I     + N Y++++C   +  C+ VG
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVG  188



>ref|XP_006441439.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
 gb|ESR54679.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
Length=206

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 81/203 (40%), Gaps = 24/203 (12%)
 Frame = +3

Query  93   FTYNPIRLPTDDDAG-TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLP  269
            F +    LP   +A    VLD  G  L+ G+ Y I       V  G    + L  RG+  
Sbjct  14   FAFTATPLPVKGNAQPDPVLDIAGKQLRAGSKYYILP-----VTKGRGGGLTLAGRGNNK  68

Query  270  GCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFDSPV-CVDFSNWHI---SA  437
             CP +V+   +   N   V F P +     + EST L ++FD+   C   + W +    A
Sbjct  69   TCPLDVVQEQHSFKNGLPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLDNFDA  128

Query  438  GYDPSFVTTT------QPSFSYN-FMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGC  596
             +    VTT        P    N F I K   D  Y+L +CPS    C     LC   G 
Sbjct  129  AFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGD--YKLVYCPSVCNFCR---GLCRDVGI  183

Query  597  PL--GIAHLAISYSPITVQFLKT  659
             +  G+  LA+S  P  V F K 
Sbjct  184  FINGGVRRLALSDIPFKVVFKKV  206



>ref|XP_009608866.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 88/210 (42%), Gaps = 32/210 (15%)
 Frame = +3

Query  87   HSFTY---NPIRLPTDDDAGTAVLDADGDPLKPGTLYKI--TAPGYGDVILGHAFPVGLQ  251
             SF +   NP  L +   + + VLD +GD ++ G+ Y +     G G    G  FP  ++
Sbjct  12   QSFAFSLANPSELLSAGPSPSPVLDTNGDKIRTGSNYFVLPVIRGRG----GGLFPSNVK  67

Query  252  ERGSLPGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFDSP-VCVDFSNWH  428
            +  +   CP +++  S        V F P D     I  S+ L VRF +P +C   + W 
Sbjct  68   QNNT---CPRDIIQESLDVQQGLPVVFTPVDPKKGVIRLSSDLNVRFFTPTICARETIWK  124

Query  429  ISAGYDPS----FVTTTQ-------PSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGT  575
            +   +D      FV T          + S  F I K   D  Y+  FCPS  + C  +  
Sbjct  125  V-GDFDEKLKQYFVVTGGVEGNPGPQTVSNWFKIEKLGTD--YKFVFCPSVCSFCKVI--  179

Query  576  LCTQTGC--PLGIAHLAISYSPITVQFLKT  659
             C   G     G+  LA+S +P  V F KT
Sbjct  180  -CKDVGIFTKNGVRFLALSDTPFRVMFKKT  208



>ref|XP_010416116.1| PREDICTED: miraculin-like [Camelina sativa]
Length=208

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 80/196 (41%), Gaps = 32/196 (16%)
 Frame = +3

Query  129  DAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPE  308
            +A  AVLD DG+ +  G+ Y +       VI G    + L  RG    CP +++  S   
Sbjct  18   NAYGAVLDIDGNIIFRGSYYVLP------VIRGRGGGLTLSGRGG-ELCPLDIVQESQEL  70

Query  309  DNVRSVKFIPEDATATSILESTRLAVRFD--SPVCVDFSNWH------------ISAGYD  446
            D    VKF         + ES  L ++ D  + +C   + W             I AG  
Sbjct  71   DEGNPVKFSNWRPRVAFVPESQDLNIQTDVEATICFQSTYWRVGEFDEERKQYFIVAGLK  130

Query  447  PS-FVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGC---PLGIAH  614
            P  F   +  SF   F I KS  D+ Y+  FCPS    C +    C+  G     LG+  
Sbjct  131  PEGFGQDSSKSF---FKIEKSG-DDAYKFVFCPS---TCDSGCPKCSDVGIFEDELGVRR  183

Query  615  LAISYSPITVQFLKTN  662
            LA+S  P  V F K N
Sbjct  184  LALSDEPFLVMFKKAN  199



>gb|ABG26238.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 86/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                ++  C ++V++  N  D+   +   P   D  +T ++  T    RF+   + +CV+
Sbjct  74   AHLDTMSKCASDVIVSPNDLDDGDPITITPAAADPESTVVMALTYQTFRFNIATNKLCVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVV---DANLNFYKLTYCRFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDPM---LRTTRLALSNSPF  210



>gb|AFR60864.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 78/176 (44%), Gaps = 15/176 (9%)
 Frame = +3

Query  78   HPTHSFTYNPIRL-PTDDDAG--TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRL P  + A   T VLD +GD ++ G  Y I +  +G    G      +
Sbjct  17   NPAHS-KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG---AGGGGLRLV  72

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFD---SPVCVDFS  419
            +   S   C ++V++  +  DN       P D  AT ++ ST    RF+   + +CV+  
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPTTITPADPEATVVMPSTYQTFRFNIATNKLCVNNV  132

Query  420  NWHISAGYDPSFVTTTQPSF----SYNFMIHKSAKD-NHYQLAFCPSDSTMCYTVG  572
            NW I    +          F    S  F I     + N Y++++C   +  C+ VG
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEAVNDNLNAYKISYCQFGTEKCFNVG  188



>gb|AFR60865.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 15/176 (9%)
 Frame = +3

Query  78   HPTHSFTYNPIRL-PTDDDAG--TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +PTHS  +NPIRL P  + A   T VLD +GD ++ G  Y + +  +G    G      +
Sbjct  17   NPTHS-KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYMVSAIWG---AGGGGLRLV  72

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFD---SPVCVDFS  419
            +   S   C ++V++  +  DN   +   P D  +T ++ ST    RF+   + +CV+  
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTYQTFRFNIATNKLCVNNV  132

Query  420  NWHISAGYDPSFVTTTQPSF----SYNFMIHKSAKD-NHYQLAFCPSDSTMCYTVG  572
            NW I    +          F    S  F I     + N Y++++C   +  C+ VG
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVG  188



>ref|XP_003532233.1| PREDICTED: kunitz-type trypsin inhibitor KTI1-like [Glycine max]
 gb|KHN01852.1| Kunitz-type trypsin inhibitor KTI1 [Glycine soja]
 gb|KHN01855.1| Kunitz-type trypsin inhibitor KTI1 [Glycine soja]
Length=203

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 79/188 (42%), Gaps = 34/188 (18%)
 Frame = +3

Query  144  VLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPG--CPTEVLLVSNPEDNV  317
            VLD DGDP++ G +Y +        I G+    G  ER +L    CP  V+   NP    
Sbjct  27   VLDVDGDPIRNGFIYYVLP-----AIRGNG---GGIERAALGKDTCPITVVQSPNPNSKG  78

Query  318  RSVKFIPEDAT-ATSILESTRLAVRFDSPVCVDFSN--WHISAGYDPSFVTTTQPSFSYN  488
              +KF  E A  A  I E+  L ++F  P   +  N  W IS       ++   P+   +
Sbjct  79   LEIKF--ESAYPAYYINETLILQIKFSYPQQCERKNPWWAISKD-----ISEGPPAIKLS  131

Query  489  ---------FMIHKSAKD---NHYQLAFCPSDSTMCYTVGTLCTQTGCPLGIAHLAISYS  632
                     F I K++K    N Y+L FC  D T C  VG    + G    +  LA++  
Sbjct  132  GFHGTELGWFKIQKASKSCDSNDYKLVFCQYDETWCLDVGIYVDRQGNRRLV--LAVTGE  189

Query  633  PITVQFLK  656
            P  V F K
Sbjct  190  PFLVHFHK  197



>emb|CAA44005.1| aspartic proteinase inhibitor homologue [Solanum tuberosum]
Length=216

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 86/205 (42%), Gaps = 35/205 (17%)
 Frame = +3

Query  102  NPIRLPTDDDAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPT  281
            NPI LP++      VLD +G  L P + Y+I + G G   LG    +G       P CP 
Sbjct  22   NPINLPSESPVPKPVLDTNGKELNPNSSYRIISIGRG--ALGGDVYLGKSPNSDAP-CPD  78

Query  282  EVLLV-SNPEDNVRSVKFIPEDATATSILESTRLAVRFDSP---VCVDFSNW-------H  428
             V    S+   +   V+FIP    +T+I E   L ++F+ P   +CV + NW       H
Sbjct  79   GVFRYNSDVGPSGTPVRFIP---LSTNIFEDQLLNIQFNIPTVKLCVSYRNWKVGNLNAH  135

Query  429  ISAGYDPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCP----------SDSTMCYTVGTL  578
            +      +  T  Q   SY F I KS+K   Y L +CP           D   C  VG  
Sbjct  136  LWTMLLETGGTIGQADSSY-FKIVKSSKFG-YNLLYCPITRHFLCPFCRDDNFCAKVGVD  193

Query  579  CTQTGCPLGIAHLA-ISYSPITVQF  650
                    G   LA +S +P+ V F
Sbjct  194  IQN-----GKRRLALVSENPLDVLF  213



>sp|Q43645.2|API4_SOLTU RecName: Full=Aspartic protease inhibitor 4; AltName: Full=API-13; 
Short=PI13; Flags: Precursor [Solanum tuberosum]
 gb|AIT42156.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 86/205 (42%), Gaps = 35/205 (17%)
 Frame = +3

Query  102  NPIRLPTDDDAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPT  281
            NPI LP++      VLD +G  L P + Y+I + G G   LG    +G       P CP 
Sbjct  26   NPINLPSESPVPKPVLDTNGKELNPNSSYRIISIGRG--ALGGDVYLGKSPNSDAP-CPD  82

Query  282  EVLLV-SNPEDNVRSVKFIPEDATATSILESTRLAVRFDSP---VCVDFSNW-------H  428
             V    S+   +   V+FIP    +T+I E   L ++F+ P   +CV + NW       H
Sbjct  83   GVFRYNSDVGPSGTPVRFIP---LSTNIFEDQLLNIQFNIPTVKLCVSYRNWKVGNLNAH  139

Query  429  ISAGYDPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCP----------SDSTMCYTVGTL  578
            +      +  T  Q   SY F I KS+K   Y L +CP           D   C  VG  
Sbjct  140  LWTMLLETGGTIGQADSSY-FKIVKSSKFG-YNLLYCPITRHFLCPFCRDDNFCAKVGVD  197

Query  579  CTQTGCPLGIAHLA-ISYSPITVQF  650
                    G   LA +S +P+ V F
Sbjct  198  IQN-----GKRRLALVSENPLDVLF  217



>gb|ABG26229.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 85/203 (42%), Gaps = 27/203 (13%)
 Frame = +3

Query  78   HPTHSFTYNPIRLPTDDD---AGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRLPT  +   + T VLD +GD ++ G  Y + +     +       + L
Sbjct  19   NPAHS-RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSA----IWGAGGGGLRL  73

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPE--DATATSILESTRLAVRFD---SPVCVD  413
                 +  C ++V++  N  DN   +   P   D  +T ++ ST    RF+   + + V+
Sbjct  74   AHLDMMSKCASDVIVSPNGLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLRVN  133

Query  414  FSNWHI-----SAGY---DPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTV  569
              NW I     S  Y      FV+     F    +    A  N Y+L +C   S  CY V
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELV---DANLNFYKLTYCQFGSDKCYNV  190

Query  570  GTLCTQTGCPLGIAHLAISYSPI  638
            G         L    LA+S SP 
Sbjct  191  GRFHDPM---LRTTRLALSNSPF  210



>ref|XP_011035401.1| PREDICTED: miraculin-like [Populus euphratica]
Length=215

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 84/197 (43%), Gaps = 32/197 (16%)
 Frame = +3

Query  123  DDDAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSN  302
            D DA  AVLD DG+ L+ GT Y I       V  G    + +   G    CP +V  V +
Sbjct  26   DLDATEAVLDTDGEKLRAGTEYYILP-----VFRGRGGGLTMASTGD-EACPLDV--VQD  77

Query  303  PEDNVRS--VKFIPEDATATSILESTRLAVRFD-SPVCVDFSNWHISAGYDPS---FVTT  464
            P +  +   + F P +     I  ST L ++F  S +CV  + W I    +     FVTT
Sbjct  78   PLEISKGLPLTFTPVNPKKGVIRVSTDLNIKFSASSICVQSTVWKIQKSVNSEIQWFVTT  137

Query  465  TQ-------PSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPL---GIAH  614
                      + +  F I K+  D  Y+L FCP   T+C   G LC   G  +   G+  
Sbjct  138  GGVEGNPGIETITNWFKIEKAGDD--YKLVFCP---TVC-DCGALCRDIGIYIHDNGVRT  191

Query  615  LAIS--YSPITVQFLKT  659
            L++S    P  V F K 
Sbjct  192  LSLSDALQPFLVNFKKV  208



>ref|XP_007211211.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
 gb|EMJ12410.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
Length=208

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 81/198 (41%), Gaps = 25/198 (13%)
 Frame = +3

Query  108  IRLPTDDDAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEV  287
            +R    D A + VLD  G+ L+ G  Y I       VI G    + L    +   CP +V
Sbjct  22   LRSVAADAAPSPVLDITGNKLQTGVDYYILP-----VIRGRGGGLTLASTSNKTSCPLDV  76

Query  288  LLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFDS-PVCVDFSNWHISAGYDPS----  452
            +   N   N   +KF P + T   +  ST L ++F +  +CV  + W +   +D      
Sbjct  77   VQEQNEVSNGLPLKFSPVNVTKGVVRVSTDLNIKFSATTICVQSTVWKLGK-FDEQTGQW  135

Query  453  FVTT-------TQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPL--G  605
            FVT+        + + S  F I K   D  Y+L FCP   T+C     +C   G     G
Sbjct  136  FVTSGGVEGNPGRQTTSNWFKIEKFGDD--YKLVFCP---TVCNFCKVICGDVGIFFQDG  190

Query  606  IAHLAISYSPITVQFLKT  659
               LA+S  P    F K 
Sbjct  191  KRRLALSDVPFRAMFKKV  208



>gb|AFR60863.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 78/176 (44%), Gaps = 15/176 (9%)
 Frame = +3

Query  78   HPTHSFTYNPIRL-PTDDDAG--TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRL P  + A   T VLD +GD ++ G  Y I +  +G    G      +
Sbjct  17   NPAHS-KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG---AGGGGLRLV  72

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFDSP---VCVDFS  419
            +   S   C ++V++  +  DN   +   P D  +T ++ ST    RF  P   +CV+  
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITIRPADPESTVVMPSTFQTFRFSIPTNKLCVNNV  132

Query  420  NWHISAGYDPSFVTTTQPSF----SYNFMIHKSAKD-NHYQLAFCPSDSTMCYTVG  572
            NW I    +          F    S  F I     + N Y++++C   +  C+ VG
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVG  188



>gb|AAA33390.1| sporamin B [Ipomoea batatas]
 gb|AFR60866.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 79/176 (45%), Gaps = 15/176 (9%)
 Frame = +3

Query  78   HPTHSFTYNPIRL-PTDDDAG--TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRL P  + A   T VLD +GD ++ G  Y I +  +G    G      +
Sbjct  17   NPAHS-KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG---AGGGGLRLV  72

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFD---SPVCVDFS  419
            +   S   C ++V++  +  DN   +   P D  +T ++ ST    RF+   + +CV+  
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  420  NWHISAGYDPSFVTTTQPSF----SYNFMIHKSAKD-NHYQLAFCPSDSTMCYTVG  572
            NW I    +          F    S  F I     + N Y++++C   +  C+ VG
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVG  188



>gb|AFR60862.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 79/176 (45%), Gaps = 15/176 (9%)
 Frame = +3

Query  78   HPTHSFTYNPIRL-PTDDDAG--TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRL P  + A   T VLD +GD ++ G  Y I +  +G    G      +
Sbjct  17   NPAHS-KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG---AGGGGLRLV  72

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFD---SPVCVDFS  419
            +   S   C ++V++  +  DN   +   P D  +T ++ ST    RF+   + +CV+  
Sbjct  73   RLDSSSNECASDVMVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  420  NWHISAGYDPSFVTTTQPSF----SYNFMIHKSAKD-NHYQLAFCPSDSTMCYTVG  572
            NW I    +          F    S  F I     + N Y++++C   +  C+ VG
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVG  188



>gb|AFR60859.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 79/176 (45%), Gaps = 15/176 (9%)
 Frame = +3

Query  78   HPTHSFTYNPIRL-PTDDDAG--TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRL P  + A   T VLD +GD ++ G  Y I +  +G    G      +
Sbjct  17   NPAHS-KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG---AGGGGLRLV  72

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFD---SPVCVDFS  419
            +   S   C ++V++  +  DN   +   P D  +T ++ ST    RF+   + +CV+  
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  420  NWHISAGYDPSFVTTTQPSF----SYNFMIHKSAKD-NHYQLAFCPSDSTMCYTVG  572
            NW I    +          F    S  F I     + N Y++++C   +  C+ VG
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVG  188



>gb|ABB90968.1| sporamin B precursor [Ipomoea batatas]
Length=216

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 79/176 (45%), Gaps = 15/176 (9%)
 Frame = +3

Query  78   HPTHSFTYNPIRL-PTDDDAG--TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRL P  + A   T VLD +GD ++ G  Y I +  +G    G      +
Sbjct  17   NPAHS-KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG---AGGGGLRLV  72

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFD---SPVCVDFS  419
            +   S   C ++V++  +  DN   +   P D  +T ++ ST    RF+   + +CV+  
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  420  NWHISAGYDPSFVTTTQPSF----SYNFMIHKSAKD-NHYQLAFCPSDSTMCYTVG  572
            NW I    +          F    S  F I     + N Y++++C   +  C+ VG
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVG  188



>gb|AFR60867.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 79/176 (45%), Gaps = 15/176 (9%)
 Frame = +3

Query  78   HPTHSFTYNPIRL-PTDDDAG--TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P HS  +NPIRL P  + A   T VLD +GD ++ G  Y I +  +G    G      +
Sbjct  17   NPAHS-KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWG---AGGGGLRLV  72

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFD---SPVCVDFS  419
            +   S   C ++V++  +  DN   +   P D  +T ++ ST    RF+   + +CV+  
Sbjct  73   RLDSSSNECASDVVVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  420  NWHISAGYDPSFVTTTQPSF----SYNFMIHKSAKD-NHYQLAFCPSDSTMCYTVG  572
            NW I    +          F    S  F I     + N Y++++C   +  C+ VG
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVG  188



>ref|XP_006495064.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 82/203 (40%), Gaps = 26/203 (13%)
 Frame = +3

Query  90   SFTYNPIRLPTDDDAG-TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSL  266
            +FT  P  LP   +A    VLD  G  L+ G+ Y I       V  G    + L  R + 
Sbjct  15   AFTATP--LPVKGNAQPDPVLDISGKQLRAGSKYYILP-----VTKGRGGGLTLAGRSNN  67

Query  267  PGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFDSPV-CVDFSNWHI---S  434
              CP +V+   +   N   V F P +     + EST L ++FD+   C   + W +    
Sbjct  68   KTCPVDVVQEQHSFKNGFPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLDNFD  127

Query  435  AGYDPSFVTTT------QPSFSYN-FMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTG  593
            A +    VTT        P    N F I K   D  Y+L +CPS    C     LC   G
Sbjct  128  AAFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGD--YKLVYCPSVCNFCR---GLCRDVG  182

Query  594  CPL--GIAHLAISYSPITVQFLK  656
              +  G+  LA+S  P  V F K
Sbjct  183  IFINGGVRRLALSDVPFKVVFKK  205



>gb|AIT42164.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 87/205 (42%), Gaps = 35/205 (17%)
 Frame = +3

Query  102  NPIRLPTDDDAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPT  281
            NPI LP++      VLD +G  L P + Y+I +  +G   LG    +G       P CP 
Sbjct  26   NPINLPSESPVPKPVLDTNGKKLNPNSSYRIISTFWG--ALGGDVYLGKSPNSDAP-CPD  82

Query  282  EVLLV-SNPEDNVRSVKFIPEDATATSILESTRLAVRFDSP---VCVDFSNW-------H  428
             V    S+   N   V+FIP    +T+I E   L ++F+ P   +CV ++ W       H
Sbjct  83   GVFRYNSDVGPNGTPVRFIP---LSTNIFEDQLLNIQFNIPTVKLCVSYTIWKVGNLNAH  139

Query  429  ISAGYDPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCP----------SDSTMCYTVGTL  578
            +      +  T  Q   SY F I KS+K   Y L +CP           D   C  VG +
Sbjct  140  LRTMLLETGGTIGQADSSY-FKIVKSSKLG-YNLLYCPISRHFLCPFCRDDNFCAEVGVV  197

Query  579  CTQTGCPLGIAHLA-ISYSPITVQF  650
                    G   LA ++ +P+ V F
Sbjct  198  IQN-----GKRRLALVNENPLDVLF  217



>ref|XP_010471385.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=208

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 79/196 (40%), Gaps = 32/196 (16%)
 Frame = +3

Query  129  DAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPE  308
            +A  AVLD DG+ +  G+ Y +       VI G    + L  RG    CP +++  S   
Sbjct  18   NAYGAVLDIDGNIIFRGSYYVLP------VIRGRGGGLTLSGRGG-ELCPLDIVQESQEV  70

Query  309  DNVRSVKFIPEDATATSILESTRLAVRFD--SPVCVDFSNWH------------ISAGYD  446
            D    VKF         + ES  L ++ D  + +C   + W             I AG  
Sbjct  71   DEGNPVKFSNWRPRVAFVPESQDLNIQTDVEATICFQSTYWRVGEFDEERKQYFIVAGLK  130

Query  447  PS-FVTTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGC---PLGIAH  614
            P  F   +  SF   F I KS  D+ Y+  FCPS    C +    C+  G     LG+  
Sbjct  131  PEGFRQDSSKSF---FKIEKSG-DDAYKFVFCPS---TCDSGCPKCSDIGIFEDELGVRR  183

Query  615  LAISYSPITVQFLKTN  662
            LA+   P  V F K N
Sbjct  184  LALRDEPFLVMFKKAN  199



>ref|XP_006493430.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 84/204 (41%), Gaps = 28/204 (14%)
 Frame = +3

Query  90   SFTYNPIRLPTDDDAG-TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSL  266
            +FT  P  LP   +A    VLD  G  L+ G+ Y I       V  G    + L  R + 
Sbjct  15   AFTATP--LPVKGNAQPDPVLDISGKQLRAGSKYYILP-----VTKGRGGGLTLAGRSNN  67

Query  267  PGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFDSPV-CVDFSNWHISAGY  443
              CP +V+   +   N   V F P +     + EST L ++FD+   C   + W +   +
Sbjct  68   KTCPVDVVQEQHSFRNGLPVTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLD-NF  126

Query  444  DPSF---VTTT-------QPSFSYN-FMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQT  590
            D +F   V TT        P    N F I K   D  Y+L +CPS    C     LC   
Sbjct  127  DAAFGQWVVTTGGVEGNPGPRTMRNWFKIEKFFGD--YKLVYCPSVCNFCR---GLCRDV  181

Query  591  GCPL--GIAHLAISYSPITVQFLK  656
            G  +  G+  LA+S  P  V F K
Sbjct  182  GIFINGGVRRLALSDVPFKVVFKK  205



>gb|AIT42157.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 86/205 (42%), Gaps = 35/205 (17%)
 Frame = +3

Query  102  NPIRLPTDDDAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPT  281
            NPI LP++      VLD +G  L P + Y+I +  +G   LG    +G       P CP 
Sbjct  26   NPINLPSESPVPKPVLDTNGKKLNPNSSYRIISTFWG--ALGGDVYLGKSPNSDAP-CPD  82

Query  282  EVLLV-SNPEDNVRSVKFIPEDATATSILESTRLAVRFDSP---VCVDFSNW-------H  428
             V    S+   N   V+FIP    +T+I E   L ++F+ P   +CV ++ W       H
Sbjct  83   GVFRYNSDVGPNGTPVRFIP---LSTNIFEDQLLNIQFNIPTVKLCVSYTIWKVGNLNAH  139

Query  429  ISAGYDPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCP----------SDSTMCYTVGTL  578
            +      +  T  Q   SY F I KS+K   Y L +CP           D   C  VG +
Sbjct  140  LRTMLLETGGTIGQADSSY-FKIVKSSKLG-YNLLYCPISRHFLCPFCRDDNFCAEVGVV  197

Query  579  CTQTGCPLGIAHLAI-SYSPITVQF  650
                    G   LA+   +P+ V F
Sbjct  198  IQN-----GKRRLALGQQNPLDVLF  217



>ref|XP_009615974.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 80/188 (43%), Gaps = 29/188 (15%)
 Frame = +3

Query  144  VLDADGDPLKPGTLYKI--TAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPEDNV  317
            VLD +GD ++ G+ Y +     G G    G   P  +++  +   CP +++  S+     
Sbjct  34   VLDINGDKVRVGSNYFVLPVIRGRG----GGLLPSNVKQINT---CPRDIIQNSDEVQQG  86

Query  318  RSVKFIPEDATATSILESTRLAVRFDSP-VCVDFSNWHISAGYDPS----FVTTTQ----  470
              V F P DA    +  ST L VRF +P +C   + W +   YD      F+ T      
Sbjct  87   LPVVFTPFDAKKGVVRLSTDLNVRFYTPTICARETIWKLGT-YDDKLKQYFIVTGGVEGN  145

Query  471  ---PSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGC--PLGIAHLAISYSP  635
                + S  F I K   D  Y+  FCPS   +C  +   C   G     G+  LA+S +P
Sbjct  146  PGPQTVSSWFKIEKLGTD--YKFLFCPSVCKICKVI---CKDVGIYTKDGVRFLALSDTP  200

Query  636  ITVQFLKT  659
              V F KT
Sbjct  201  FRVMFKKT  208



>ref|XP_006495063.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 77/186 (41%), Gaps = 25/186 (13%)
 Frame = +3

Query  144  VLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPEDNVRS  323
            VLD  G  L+ G+ Y I       V  G    + L  R +   CP +V+   +   N   
Sbjct  32   VLDIAGKQLRAGSKYYILP-----VTKGRGGGLTLAGRSNNKTCPLDVVQEQHSFRNGLP  86

Query  324  VKFIPEDATATSILESTRLAVRFDSPV-CVDFSNWHISAGYDPSF----VTTT------Q  470
            V F P +     + EST L ++FD+   C   + W +   +D +F    VTT        
Sbjct  87   VTFSPVNPKKGVVRESTDLNIKFDAATSCAQSTVWKLD-NFDTAFGQWLVTTGGVEGNPG  145

Query  471  PSFSYN-FMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPL--GIAHLAISYSPIT  641
            P    N F I K   D  Y+L FCPS    C     LC   G  +  G+  LA+S  P+ 
Sbjct  146  PRTMRNWFKIEKFYGD--YKLVFCPSVCNFCR---GLCRDVGIFINGGVRRLALSDVPLK  200

Query  642  VQFLKT  659
            V F K 
Sbjct  201  VVFKKV  206



>emb|CDY59714.1| BnaC02g46470D [Brassica napus]
Length=232

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 83/190 (44%), Gaps = 25/190 (13%)
 Frame = +3

Query  129  DAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHA-FPVGLQERGSLPGCPTEVLLVSNP  305
            +A   VLD DGD +  G+ Y + A      I G A   + L  RGS   CP  V    + 
Sbjct  41   NAAKPVLDTDGDFIFDGSYYVLPA------IFGAAGGGLNLASRGS-NQCPLFVGQEISE  93

Query  306  EDNVRSVKFIPEDATATSILESTRLAVRFD--SPVCVDFSNWHISA---GYDPSFVT---  461
             D    VKF         + ES +L ++ D  + +CV  + W ++A   G+  SF+T   
Sbjct  94   VDRGIPVKFSNWRLKVGFVPESEKLNIKMDVEATICVQSTYWWVTAAPSGFRTSFITAGP  153

Query  462  ---TTQPSFSYNFMIHKSAK-DNHYQLAFCPSDSTMCYTVGTLCTQTGCPLGIAHLAISY  629
                 + S    F I K+    + Y + FCP+D+  C  VG +  +     G+  LA+S 
Sbjct  154  NPEAGEDSSRSFFQIEKAKGFPDGYHIMFCPNDND-CINVGIVVDE----YGVRRLALSS  208

Query  630  SPITVQFLKT  659
             P    F+K 
Sbjct  209  MPFPFVFMKA  218



>gb|AFL91226.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 75/183 (41%), Gaps = 22/183 (12%)
 Frame = +3

Query  141  AVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPEDNVR  320
            AV D DG+ L+ GT Y I       V  G    V L    +   CP +V+      DN  
Sbjct  3    AVRDIDGNLLRSGTEYYILP-----VFRGRGGGVTLAPTRN-ESCPLDVVQEGFELDNGL  56

Query  321  SVKFIPEDATATSILESTRLAVRFD-SPVCVDFSNWHISAGYDPSFV----TTTQP---S  476
             + F P D     I EST L + F  S +C+  + W +        +    T+  P   +
Sbjct  57   PLTFTPVDPKKGVIRESTDLNIIFSASSICIQSNVWMLEEYEGQRIISGRGTSGNPGGET  116

Query  477  FSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPL---GIAHLAISYSPITVQ  647
             S  F I K   +N Y+L +CP+   +C  V   C   G      G   LAIS  P  ++
Sbjct  117  ISNWFKIEKY--ENGYKLVYCPTVCDLCRPV---CGDIGVVFAENGSRRLAISDVPFKIK  171

Query  648  FLK  656
            F K
Sbjct  172  FRK  174



>gb|AIT42166.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 86/205 (42%), Gaps = 35/205 (17%)
 Frame = +3

Query  102  NPIRLPTDDDAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPT  281
            NPI LP +      VLD +G  L P + Y+I +  +G   LG    +G       P CP 
Sbjct  26   NPINLPRESPVPKPVLDTNGKKLNPNSSYRIISTFWGA--LGGDVYLGKSPNSDAP-CPD  82

Query  282  EVLLV-SNPEDNVRSVKFIPEDATATSILESTRLAVRFDSP---VCVDFSNW-------H  428
             V    S+   N   V+FIP    +T+I E   L ++F+ P   +CV ++ W       H
Sbjct  83   GVFRYNSHVGPNGTPVRFIP---LSTNIFEDQLLNIQFNIPTVKLCVSYTIWKVGNLNAH  139

Query  429  ISAGYDPSFVTTTQPSFSYNFMIHKSAKDNHYQLAFCP----------SDSTMCYTVGTL  578
            +      +  T  Q   SY F I KS+K   Y L +CP           D   C  VG +
Sbjct  140  LRTMLLETGGTIGQADSSY-FKIVKSSKLG-YNLLYCPISRHFLCPFCRDDNFCAEVGVV  197

Query  579  CTQTGCPLGIAHLA-ISYSPITVQF  650
                    G   LA ++ +P+ V F
Sbjct  198  IQN-----GKRRLALVNENPLDVLF  217



>ref|XP_006347377.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=210

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 88/202 (44%), Gaps = 31/202 (15%)
 Frame = +3

Query  102  NPIRLPTDDDAGTAVLDADGDPLKPGTLYKI--TAPGYGDVILGHAFPVGLQERGSLPGC  275
            NP R+ +   + + VLD +GD ++ G  Y I     G G    G  +P  +++  S   C
Sbjct  23   NPSRILS---SSSPVLDINGDKVQAGPNYFILPVIRGKG----GGLYPSNVKQHNST--C  73

Query  276  PTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFDSP-VCVDFSNWHISAGYDPS  452
            P +++  ++       V F   DA    +  ST + VRF +P +C   + W + A YD  
Sbjct  74   PRDIVQETDEVQQGLPVVFTRLDAKKGVVRVSTDVNVRFYTPTICARETIWKLGA-YDDK  132

Query  453  ----FVTTT------QPSFSYN-FMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCP  599
                FV T        P    N F I K   D  Y+  FCPS   +C     +C   G  
Sbjct  133  LKQYFVVTGGVEGNPGPQTVGNWFKIEKFGSD--YKFVFCPS---VCEFYKVICKDVGVF  187

Query  600  L--GIAHLAISYSPITVQFLKT  659
            +  G+  LA+S +P  V F KT
Sbjct  188  MKDGVRFLALSDTPFKVMFKKT  209



>ref|NP_001274866.1| Kunitz-type enzyme inhibitor P4E1 precursor [Solanum tuberosum]
 gb|AAL99260.1| Kunitz-type enzyme inhibitor P4E1 precursor [Solanum tuberosum]
 dbj|BAC23032.1| cathepsin D inhibitor [Solanum tuberosum]
 gb|AIT42154.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 77/165 (47%), Gaps = 20/165 (12%)
 Frame = +3

Query  102  NPIRLPTDDDAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPT  281
            NPI LPTD    T VLD +G+ L P + Y+I +  +G   LG    +G       P CP 
Sbjct  26   NPIDLPTDTTPCTPVLDTNGNELNPNSSYRIISTFWG--ALGGDVYLGKSPNSDAP-CPD  82

Query  282  EVLLVSNPEDNVRS--VKFIPEDATATSILESTRLAVRFDSP---VCVDFSNW---HISA  437
             V    N +   R   V+FIP   +  +I E   L ++F+ P   +CV ++ W   +++A
Sbjct  83   GVFRY-NSDVGPRGTPVRFIP--LSGANICEDQLLNIQFNIPTPKLCVSYTIWKVGNLNA  139

Query  438  GYDPSFV----TTTQPSFSYNFMIHKSAKDNHYQLAFCPSDSTMC  560
                  +    T  Q   SY F I KS+K   Y L +CP    +C
Sbjct  140  LLRTMLLETGGTIGQADSSY-FKIVKSSKIG-YNLLYCPLTPIIC  182



>ref|XP_010539167.1| PREDICTED: bark lectin isoform 2-like [Tarenaya hassleriana]
Length=205

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 74/174 (43%), Gaps = 16/174 (9%)
 Frame = +3

Query  141  AVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPEDNVR  320
            AV D +G+PL+PG  Y I     G+   G   P   Q R     C  +V+    P     
Sbjct  23   AVSDTNGEPLRPGAEYFIVPDSGGN--FGGLVP---QSRDVFHICTLDVVQTLLPFQPGL  77

Query  321  SVKFIPEDATATSILESTRLAVRFDSP--VCVDFSNWHISAGYDPSFVTTTQPSFSYN--  488
             V F+  + T   +  ST ++++F+SP  +C     W +        +TT   + S    
Sbjct  78   PVSFVLSEET---VRLSTDISIQFESPIWICRSSKVWKVDYSTSEDLITTDGKTGSEESL  134

Query  489  FMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPLGIAHLAISYSPITVQF  650
            F I K    N Y+L    S S+    VG +  + G P     LA++   ++V+F
Sbjct  135  FRIEKLESGNDYKLVHLDSRSSKIRNVGLIMGEFGIP----RLALTDEALSVKF  184



>sp|P13087.3|MIRA_SYNDU RecName: Full=Miraculin; Short=MIR; Flags: Precursor [Synsepalum 
dulcificum]
 dbj|BAA07603.1| miraculin precursor [Synsepalum dulcificum]
 dbj|BAH84844.1| miraculin [Synsepalum dulcificum]
Length=220

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 80/199 (40%), Gaps = 32/199 (16%)
 Frame = +3

Query  126  DDAGTAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLPG----CPTEVLL  293
            D A   VLD DG+ L+ GT Y I       V+  H    GL    + P     CP  V+ 
Sbjct  30   DSAPNPVLDIDGEKLRTGTNYYIVP-----VLRDHG--GGLTVSATTPNGTFVCPPRVVQ  82

Query  294  VSNPEDNVRSVKFIPEDATATSILESTRLAVRFDSPVCVDFSN---WHISAGYDPS----  452
                 D+ R + F PE+     +  ST L + F + +   +++   W +   YD S    
Sbjct  83   TRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDK-YDESTGQY  141

Query  453  FVTTTQ-------PSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPL---  602
            FVT           + S  F I +      Y+L FCP   T+C +    C   G  +   
Sbjct  142  FVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCP---TVCGSCKVKCGDVGIYIDQK  198

Query  603  GIAHLAISYSPITVQFLKT  659
            G   LA+S  P   +F KT
Sbjct  199  GRRRLALSDKPFAFEFNKT  217



>ref|XP_006441441.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
 gb|ESR54681.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
Length=206

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 80/203 (39%), Gaps = 24/203 (12%)
 Frame = +3

Query  93   FTYNPIRLPTDDDAG-TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGLQERGSLP  269
            F +    LP   +A    VLD  G  L+ G+ Y I       V  G    + L  RG+  
Sbjct  14   FAFTATPLPVKGNAQPDPVLDIAGKQLRAGSKYYILP-----VTKGRGGGLTLAGRGNNK  68

Query  270  GCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFDSPV-CVDFSNWHI---SA  437
             CP +V+   +   N   V F P +     + EST + ++ D+   C   + W +    A
Sbjct  69   TCPLDVVQEQHSFKNGLPVTFSPVNPKKGVVRESTDINIKLDAATSCAQSTVWKLDNFDA  128

Query  438  GYDPSFVTTT------QPSFSYN-FMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGC  596
             +    VTT        P    N F I K   D  Y+L +CPS    C     LC   G 
Sbjct  129  AFGQWLVTTGGVEGNPGPRTMRNWFKIEKFFGD--YKLVYCPSVCNFCR---GLCRDVGI  183

Query  597  PL--GIAHLAISYSPITVQFLKT  659
             +  G+  LA+S  P  V F K 
Sbjct  184  FINGGVRRLALSDIPFKVVFKKV  206



>gb|AFR60860.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 79/176 (45%), Gaps = 15/176 (9%)
 Frame = +3

Query  78   HPTHSFTYNPIRL-PTDDDAG--TAVLDADGDPLKPGTLYKITAPGYGDVILGHAFPVGL  248
            +P +S  +NPIRL P  + A   T VLD +GD ++ G  Y I +  +G    G      +
Sbjct  17   NPAYS-KFNPIRLRPARETASSETPVLDINGDEVRAGENYYIVSAIWG---AGGGGLRLV  72

Query  249  QERGSLPGCPTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFD---SPVCVDFS  419
            +   S   C ++V++  +  DN   +   P D  +T ++ ST    RF+   + +CV+  
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  420  NWHISAGYDPSFVTTTQPSF----SYNFMIHKSAKD-NHYQLAFCPSDSTMCYTVG  572
            NW I    +          F    S  F I     + N Y++++C   +  C+ VG
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVG  188



>ref|XP_009803614.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=210

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 85/203 (42%), Gaps = 31/203 (15%)
 Frame = +3

Query  102  NPIRLPTDDDAGTAVLDADGDPLKPGTLYKI--TAPGYGDVILGHAFPVGLQERGSLPGC  275
            NP RL     + + VLD +GD ++ G  Y +     G G    G  +P  +++  +   C
Sbjct  21   NPSRL-LAGSSPSPVLDINGDKVQVGLNYFVLPVIRGRG----GGLYPSNVKQNNT---C  72

Query  276  PTEVLLVSNPEDNVRSVKFIPEDATATSILESTRLAVRFDSP-VCVDFSNWHISAGYDPS  452
            P +++   +       V F P DA    +  ST L VRF +P +C   + W +   YD  
Sbjct  73   PRDIIQEVDEVQQGLPVVFTPFDAKKGVVRLSTDLNVRFFTPTICARETIWKLGT-YDDK  131

Query  453  ----FVTTTQ-------PSFSYNFMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGC-  596
                F+ T          + S  F I K   D  Y+  FCPS   +C  +   C   G  
Sbjct  132  LKQYFMVTGGVEGNPGPQTLSSWFKIEKLGTD--YKFVFCPSVCKICKVI---CKDVGIY  186

Query  597  --PLGIAHLAISYSPITVQFLKT  659
                G+  +A+S +P  V F KT
Sbjct  187  STKDGVRFMALSDTPFRVMFKKT  209



>ref|XP_004241480.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=211

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 81/188 (43%), Gaps = 28/188 (15%)
 Frame = +3

Query  144  VLDADGDPLKPGTLYKI--TAPGYGDVILGHAFPVGLQERGSLPGCPTEVLLVSNPEDNV  317
            VLD +GD +K G  Y I     G G    G  +P  +++  S   CP +++  ++     
Sbjct  35   VLDINGDKVKAGPNYFILPVIQGKG----GGLYPSNVKQHNST--CPRDIIQETDDVQEG  88

Query  318  RSVKFIPEDATATSILESTRLAVRFDSP-VCVDFSNWHISAGYDPS----FVTTT-----  467
              V F   DA    +  ST + VRF +P +C   + W + A YD      FV T      
Sbjct  89   LPVVFTRLDAKKGVVRVSTDVNVRFFTPTICARETIWKLGA-YDDKLKQYFVVTGGVEGN  147

Query  468  -QPSFSYN-FMIHKSAKDNHYQLAFCPSDSTMCYTVGTLCTQTGCPL--GIAHLAISYSP  635
              P    N F I K    + Y+  FCPS    C  +   C   G  +  G+  LA+S +P
Sbjct  148  PGPKTVGNWFKIVKFG--SGYKFVFCPSVCKFCKVI---CKDVGVFMKDGVRFLALSDTP  202

Query  636  ITVQFLKT  659
              V+F KT
Sbjct  203  FEVKFKKT  210



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561306781368