BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23630_g5_i1 len=571 path=[18215:0-19 24601:20-20 18235:21-277
18492:278-301 9892:302-339 18553:340-570]

Length=571
                                                                      Score     E

emb|CDO99525.1|  unnamed protein product                              79.0    3e-15   
ref|XP_007212761.1|  hypothetical protein PRUPE_ppa026481mg           65.1    3e-10   
gb|EYU44954.1|  hypothetical protein MIMGU_mgv1a023845mg              64.7    3e-10   
ref|XP_010108173.1|  hypothetical protein L484_014498                 64.7    3e-10   
ref|XP_008349249.1|  PREDICTED: protein RALF-like 4                   63.5    8e-10   
ref|XP_008390661.1|  PREDICTED: rapid alkalinization factor-like      63.5    8e-10   
ref|XP_008225111.1|  PREDICTED: protein RALF-like 22                  63.5    8e-10   
ref|XP_008360280.1|  PREDICTED: protein RALF-like 33                  63.2    1e-09   
ref|XP_009352252.1|  PREDICTED: protein RALF-like 33                  62.8    2e-09   
ref|XP_009623267.1|  PREDICTED: protein RALF-like 22                  62.0    3e-09   
ref|XP_009352900.1|  PREDICTED: protein RALF-like 19                  61.6    3e-09   
ref|XP_004295624.1|  PREDICTED: rapid alkalinization factor-like      60.8    6e-09   
ref|XP_009784377.1|  PREDICTED: protein RALF-like 19                  61.2    6e-09   
gb|EPS72954.1|  rapid alkalinization factor                           60.5    6e-09   
ref|XP_003637105.1|  RALF                                             60.5    7e-09   
ref|XP_006279280.1|  hypothetical protein CARUB_v10016532mg           60.1    7e-09   
ref|XP_011027816.1|  PREDICTED: protein RALF-like 19                  60.5    9e-09   
ref|XP_006444286.1|  hypothetical protein CICLE_v10023750mg           60.5    9e-09   
ref|XP_009387647.1|  PREDICTED: protein RALF-like 19                  60.1    1e-08   
ref|XP_003554646.1|  PREDICTED: protein RALF-like 1-like              60.1    1e-08   
ref|XP_002305130.2|  hypothetical protein POPTR_0004s04470g           59.7    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_009111178.1|  PREDICTED: protein RALF-like 1                   60.1    1e-08   
ref|XP_006304742.1|  hypothetical protein CARUB_v10012118mg           60.1    1e-08   
ref|XP_006414444.1|  hypothetical protein EUTSA_v10026579mg           59.7    2e-08   
ref|XP_007025592.1|  Ralf-like 4, putative                            59.7    2e-08   
emb|CDX86697.1|  BnaC08g00060D                                        59.7    2e-08   
ref|XP_010098288.1|  hypothetical protein L484_023536                 59.7    2e-08   
ref|XP_010481344.1|  PREDICTED: protein RALF-like 1                   59.3    2e-08   
ref|XP_010474880.1|  PREDICTED: protein RALF-like 1                   59.3    2e-08   
emb|CDP05933.1|  unnamed protein product                              59.3    2e-08   
gb|AAO27367.1|  rapid alkalinization factor 2 precursor               59.3    3e-08   Populus trichocarpa x Populus deltoides
ref|XP_002870208.1|  hypothetical protein ARALYDRAFT_493304           58.9    3e-08   
gb|AFK33323.1|  unknown                                               59.3    3e-08   
ref|XP_002319521.1|  RALF-LIKE 23 family protein                      59.3    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_008349218.1|  PREDICTED: protein RALF-like 19                  58.9    3e-08   
gb|AES91867.2|  RALF                                                  58.9    3e-08   
emb|CDY15442.1|  BnaA08g27260D                                        58.9    3e-08   
ref|XP_003609670.1|  Rapid alkalinization factor                      59.3    3e-08   
ref|XP_002512426.1|  RALFL33, putative                                58.9    3e-08   Ricinus communis
ref|XP_008458453.1|  PREDICTED: protein RALF-like 33                  58.9    3e-08   
ref|XP_002280202.1|  PREDICTED: protein RALF-like 19                  58.9    4e-08   Vitis vinifera
gb|KFK44989.1|  hypothetical protein AALP_AA1G329500                  58.5    4e-08   
ref|XP_010457289.1|  PREDICTED: protein RALF-like 1                   58.5    4e-08   
gb|KDP23480.1|  hypothetical protein JCGZ_23313                       58.5    4e-08   
ref|XP_003542740.1|  PREDICTED: protein RALF-like 19-like             58.2    5e-08   
ref|XP_004485791.1|  PREDICTED: protein RALF-like 19-like             58.2    5e-08   
ref|XP_006295275.1|  hypothetical protein CARUB_v10024364mg           58.2    5e-08   
ref|XP_007147024.1|  hypothetical protein PHAVU_006G089900g           58.2    5e-08   
emb|CDY18130.1|  BnaC05g01530D                                        58.2    5e-08   
ref|XP_007154282.1|  hypothetical protein PHAVU_003G105300g           58.2    5e-08   
ref|NP_171789.1|  rapid alkalinization factor 1                       58.2    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011023680.1|  PREDICTED: rapid alkalinization factor-like      58.2    6e-08   
gb|AAO27366.1|  rapid alkalinization factor 1 precursor               58.2    6e-08   Populus trichocarpa x Populus deltoides
ref|XP_003521695.2|  PREDICTED: protein RALF-like 1-like isoform 1    58.9    6e-08   
emb|CDX89932.1|  BnaA10g01500D                                        58.2    6e-08   
ref|XP_006382486.1|  RALF-LIKE 23 family protein                      58.2    6e-08   
ref|XP_008340810.1|  PREDICTED: protein RALF-like 33                  57.0    6e-08   
ref|XP_010549330.1|  PREDICTED: protein RALF-like 19                  57.8    7e-08   
ref|XP_004508218.1|  PREDICTED: rapid alkalinization factor 23-like   58.2    7e-08   
ref|XP_009143830.1|  PREDICTED: protein RALF-like 19                  57.8    7e-08   
emb|CDY27943.1|  BnaCnng05280D                                        57.8    7e-08   
ref|XP_006389381.1|  hypothetical protein POPTR_0026s00240g           57.8    7e-08   
gb|ABK96369.1|  unknown                                               57.4    8e-08   Populus trichocarpa x Populus deltoides
ref|XP_006285957.1|  hypothetical protein CARUB_v10007476mg           57.8    8e-08   
ref|XP_011087422.1|  PREDICTED: rapid alkalinization factor           57.4    9e-08   
gb|KHN03976.1|  hypothetical protein glysoja_022662                   56.6    9e-08   
ref|XP_004504245.1|  PREDICTED: protein RALF-like 19-like             57.4    9e-08   
ref|XP_010921813.1|  PREDICTED: protein RALF-like 33                  57.8    9e-08   
ref|XP_007159334.1|  hypothetical protein PHAVU_002G229400g           57.4    9e-08   
ref|XP_006424193.1|  hypothetical protein CICLE_v10030160mg           57.4    1e-07   
ref|XP_004505070.1|  PREDICTED: protein RALF-like 19-like             57.0    1e-07   
emb|CDX99974.1|  BnaC09g03270D                                        57.0    1e-07   
ref|XP_010313004.1|  PREDICTED: rapid alkalinization factor           57.0    1e-07   
gb|AAR00326.1|  rapid alkalinization factor 2                         57.0    1e-07   Solanum chacoense
ref|XP_006840509.1|  hypothetical protein AMTR_s00045p00202280        57.0    1e-07   
ref|XP_009119598.1|  PREDICTED: protein RALF-like 1                   57.4    1e-07   
ref|XP_009111745.1|  PREDICTED: protein RALF-like 22                  57.0    1e-07   
emb|CDY09740.1|  BnaC07g33210D                                        57.0    1e-07   
ref|XP_009418953.1|  PREDICTED: protein RALF-like 33                  57.0    1e-07   
emb|CDY19732.1|  BnaA09g03850D                                        57.0    1e-07   
ref|XP_008246129.1|  PREDICTED: rapid alkalinization factor-like      57.0    1e-07   
ref|XP_010105661.1|  hypothetical protein L484_010825                 57.0    2e-07   
ref|XP_008370433.1|  PREDICTED: rapid alkalinization factor-like      57.0    2e-07   
ref|XP_007227502.1|  hypothetical protein PRUPE_ppa013419mg           57.0    2e-07   
gb|EPS64947.1|  rapid alkalinization factor 2                         56.6    2e-07   
ref|XP_002892134.1|  hypothetical protein ARALYDRAFT_470261           56.6    2e-07   
ref|NP_567476.1|  protein ralf-like 33                                56.6    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010097623.1|  hypothetical protein L484_001106                 57.4    2e-07   
gb|ABS72341.1|  rapid alkalinization factor precursor                 56.6    2e-07   Litchi chinensis [litchi]
ref|XP_008786719.1|  PREDICTED: protein RALF-like 33                  56.6    2e-07   
gb|AFK46281.1|  unknown                                               56.2    2e-07   
ref|XP_010052296.1|  PREDICTED: protein RALF-like 19                  56.2    2e-07   
ref|XP_007030995.1|  Rapid alkalinization factor 1, putative          56.6    2e-07   
gb|KHN15225.1|  hypothetical protein glysoja_042499                   56.2    2e-07   
ref|XP_006359396.1|  PREDICTED: rapid alkalinization factor-like      56.2    2e-07   
ref|XP_003550267.1|  PREDICTED: rapid alkalinization factor 23-like   56.2    2e-07   
gb|AAS13437.1|  rapid alkalinization factor preproprotein             56.2    2e-07   Nicotiana attenuata
ref|XP_006344656.1|  PREDICTED: rapid alkalinization factor-like      56.2    2e-07   
gb|KFK31007.1|  hypothetical protein AALP_AA6G056400                  56.2    2e-07   
gb|EPS59172.1|  rapid alkalinization factor 2                         56.2    3e-07   
ref|XP_010504445.1|  PREDICTED: rapid alkalinization factor 23-like   56.6    3e-07   
gb|KHN16254.1|  hypothetical protein glysoja_046571                   56.2    3e-07   
ref|XP_010314082.1|  PREDICTED: protein RALF-like 22                  56.2    3e-07   
ref|XP_010487517.1|  PREDICTED: rapid alkalinization factor 23-like   56.2    3e-07   
ref|XP_002516916.1|  RALFL33, putative                                56.2    3e-07   Ricinus communis
ref|XP_009136714.1|  PREDICTED: protein RALF-like 33                  55.8    3e-07   
ref|XP_010465683.1|  PREDICTED: rapid alkalinization factor 23-like   56.2    3e-07   
emb|CAN78122.1|  hypothetical protein VITISV_041547                   55.1    3e-07   Vitis vinifera
ref|XP_010326583.1|  PREDICTED: rapid alkalinization factor           55.8    3e-07   
ref|XP_010469431.1|  PREDICTED: protein RALF-like 19                  55.8    3e-07   
ref|XP_010043059.1|  PREDICTED: rapid alkalinization factor           55.8    3e-07   
ref|XP_011036862.1|  PREDICTED: protein RALF-like 33                  55.8    3e-07   
ref|XP_010522782.1|  PREDICTED: protein RALF-like 1                   55.8    4e-07   
ref|XP_009381039.1|  PREDICTED: rapid alkalinization factor-like      55.8    4e-07   
gb|KHN24772.1|  hypothetical protein glysoja_045891                   55.8    4e-07   
ref|XP_004495709.1|  PREDICTED: rapid alkalinization factor-like      55.8    4e-07   
ref|XP_010434917.1|  PREDICTED: protein RALF-like 33                  55.8    4e-07   
ref|XP_002528254.1|  RALFL33, putative                                55.5    4e-07   Ricinus communis
ref|XP_004143090.1|  PREDICTED: protein RALF-like 33-like             55.8    4e-07   
gb|ABK25798.1|  unknown                                               55.8    4e-07   Picea sitchensis
gb|KFK39677.1|  protein ralf-like 24                                  55.5    4e-07   
ref|XP_008454184.1|  PREDICTED: protein RALF-like 33                  55.8    4e-07   
ref|XP_009102923.1|  PREDICTED: protein RALF-like 4                   55.5    4e-07   
gb|EYU42176.1|  hypothetical protein MIMGU_mgv1a016421mg              55.8    4e-07   
ref|XP_006410523.1|  hypothetical protein EUTSA_v10017458mg           55.5    4e-07   
ref|XP_009113682.1|  PREDICTED: protein RALF-like 4                   55.5    4e-07   
ref|XP_006415678.1|  hypothetical protein EUTSA_v10009158mg           55.5    5e-07   
emb|CDX92081.1|  BnaA05g23260D                                        55.5    5e-07   
gb|KFK42648.1|  rapid alkalinization factor 1                         55.5    5e-07   
ref|XP_010509833.1|  PREDICTED: protein RALF-like 19                  55.1    6e-07   
ref|XP_006421017.1|  hypothetical protein CICLE_v10006214mg           55.5    6e-07   
ref|XP_003619621.1|  Rapid alkalinization factor                      55.1    6e-07   
gb|KDO50663.1|  hypothetical protein CISIN_1g033245mg                 55.1    6e-07   
ref|XP_004172589.1|  PREDICTED: protein RALF-like 33-like             55.1    6e-07   
ref|XP_006489845.1|  PREDICTED: protein RALF-like 31-like             55.1    6e-07   
ref|XP_009384171.1|  PREDICTED: protein RALF-like 33                  55.1    6e-07   
gb|ABK22709.1|  unknown                                               55.1    6e-07   Picea sitchensis
ref|XP_002283709.1|  PREDICTED: protein RALF-like 33                  55.1    7e-07   Vitis vinifera
gb|KHN16104.1|  hypothetical protein glysoja_012080                   54.7    7e-07   
ref|XP_006306243.1|  hypothetical protein CARUB_v10012072mg           55.1    7e-07   
ref|XP_007144948.1|  hypothetical protein PHAVU_007G197000g           55.1    7e-07   
ref|XP_010413812.1|  PREDICTED: protein RALF-like 19                  54.7    7e-07   
emb|CDX94598.1|  BnaC07g10600D                                        54.7    7e-07   
ref|XP_003601688.1|  Rapid alkalinization factor preproprotein        55.1    7e-07   
ref|XP_010259629.1|  PREDICTED: rapid alkalinization factor           55.1    7e-07   
ref|XP_003529566.1|  PREDICTED: rapid alkalinization factor 23-like   55.1    8e-07   
ref|NP_001235167.1|  uncharacterized protein LOC100306190 precursor   55.1    8e-07   
ref|XP_009135493.1|  PREDICTED: rapid alkalinization factor 23-like   55.1    8e-07   
gb|KFK39006.1|  hypothetical protein AALP_AA3G188700                  55.1    8e-07   
emb|CDY35727.1|  BnaC03g58480D                                        54.7    8e-07   
gb|KFK32572.1|  hypothetical protein AALP_AA6G260700                  54.7    9e-07   
ref|XP_010538170.1|  PREDICTED: protein RALF-like 19                  54.7    9e-07   
ref|XP_009109739.1|  PREDICTED: protein RALF-like 4                   54.7    9e-07   
gb|KDP39325.1|  hypothetical protein JCGZ_01082                       54.7    9e-07   
emb|CDX75886.1|  BnaC03g39690D                                        55.1    9e-07   
gb|KDP38641.1|  hypothetical protein JCGZ_03994                       54.7    9e-07   
gb|KFK44698.1|  hypothetical protein AALP_AA1G291600                  54.7    9e-07   
ref|XP_003536069.1|  PREDICTED: protein RALF-like 1-like              54.7    1e-06   
emb|CDY43109.1|  BnaC05g36680D                                        54.7    1e-06   
gb|EYU46690.1|  hypothetical protein MIMGU_mgv1a016538mg              54.7    1e-06   
ref|XP_010499341.1|  PREDICTED: protein RALF-like 4                   54.3    1e-06   
ref|NP_174148.1|  protein ralf-like 4                                 54.3    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004229189.1|  PREDICTED: rapid alkalinization factor-like      54.7    1e-06   
gb|ACN40381.1|  unknown                                               54.7    1e-06   Picea sitchensis
ref|XP_009604381.1|  PREDICTED: rapid alkalinization factor-like      54.3    1e-06   
ref|XP_004295623.1|  PREDICTED: protein RALF-like 19-like             54.3    1e-06   
ref|XP_009376626.1|  PREDICTED: protein RALF-like 33                  54.3    1e-06   
ref|XP_010931638.1|  PREDICTED: rapid alkalinization factor-like      54.3    1e-06   
ref|XP_010675511.1|  PREDICTED: protein RALF-like 19                  54.7    1e-06   
ref|XP_009342123.1|  PREDICTED: protein RALF-like 33                  54.3    1e-06   
ref|XP_011069491.1|  PREDICTED: protein RALF-like 24                  54.3    1e-06   
ref|XP_009775621.1|  PREDICTED: rapid alkalinization factor-like      54.3    1e-06   
gb|KHN20242.1|  hypothetical protein glysoja_023805                   53.5    1e-06   
ref|XP_009781864.1|  PREDICTED: rapid alkalinization factor-like      54.3    2e-06   
ref|XP_011033568.1|  PREDICTED: protein RALF-like 1                   53.9    2e-06   
ref|NP_001241351.1|  uncharacterized protein LOC100801740 precursor   54.3    2e-06   
ref|NP_001237097.1|  uncharacterized protein LOC100306584 precursor   53.9    2e-06   
ref|XP_007035581.1|  Rapid alkalinization factor 1, putative          54.3    2e-06   
ref|XP_006406825.1|  hypothetical protein EUTSA_v10021739mg           54.3    2e-06   
ref|XP_009778264.1|  PREDICTED: rapid alkalinization factor           53.9    2e-06   
emb|CDY15684.1|  BnaA07g08550D                                        54.7    2e-06   
ref|XP_006356972.1|  PREDICTED: rapid alkalinization factor-like      54.3    2e-06   
ref|XP_003626248.1|  hypothetical protein MTR_7g113080                53.9    2e-06   
gb|KFK36285.1|  hypothetical protein AALP_AA4G102800                  53.5    2e-06   
ref|XP_009629090.1|  PREDICTED: rapid alkalinization factor           53.5    2e-06   
ref|XP_010025230.1|  PREDICTED: rapid alkalinization factor-like      53.9    2e-06   
ref|XP_006468214.1|  PREDICTED: rapid alkalinization factor-like      53.5    2e-06   
ref|XP_002883013.1|  hypothetical protein ARALYDRAFT_897975           53.9    2e-06   
gb|KDP27792.1|  hypothetical protein JCGZ_18872                       53.5    2e-06   
gb|KHN31786.1|  hypothetical protein glysoja_050399                   53.1    2e-06   
ref|XP_006299574.1|  hypothetical protein CARUB_v10015749mg           53.5    3e-06   
ref|XP_010097951.1|  hypothetical protein L484_026842                 52.8    3e-06   
emb|CAN83593.1|  hypothetical protein VITISV_037723                   53.5    3e-06   Vitis vinifera
ref|XP_002273386.1|  PREDICTED: protein RALF-like 33                  53.5    3e-06   Vitis vinifera
ref|XP_009412092.1|  PREDICTED: protein RALF-like 33                  53.5    3e-06   
ref|XP_010691694.1|  PREDICTED: protein RALF-like 33                  53.5    3e-06   
ref|XP_011082482.1|  PREDICTED: rapid alkalinization factor-like      53.1    3e-06   
ref|XP_009615222.1|  PREDICTED: rapid alkalinization factor-like      53.5    3e-06   
ref|XP_004244368.1|  PREDICTED: protein RALF-like 22                  53.5    3e-06   
ref|XP_006288916.1|  hypothetical protein CARUB_v10002279mg           53.1    3e-06   
ref|XP_003625906.1|  RALF                                             53.1    3e-06   
ref|XP_010037445.1|  PREDICTED: rapid alkalinization factor           53.5    3e-06   
gb|KDP28133.1|  hypothetical protein JCGZ_13904                       53.1    3e-06   
emb|CDY40711.1|  BnaC03g34270D                                        53.1    4e-06   
ref|XP_010526512.1|  PREDICTED: protein RALF-like 4                   52.8    4e-06   
ref|XP_006419584.1|  hypothetical protein CICLE_v10006201mg           53.1    4e-06   
ref|XP_004302396.1|  PREDICTED: protein RALF-like 33-like isoform 2   52.8    4e-06   
gb|KDO77604.1|  hypothetical protein CISIN_1g044503mg                 52.8    4e-06   
ref|XP_002263387.1|  PREDICTED: rapid alkalinization factor           52.8    4e-06   Vitis vinifera
emb|CBI26076.3|  unnamed protein product                              53.5    4e-06   
ref|XP_008775576.1|  PREDICTED: protein RALF-like 33                  52.8    5e-06   
ref|XP_010931639.1|  PREDICTED: protein RALF-like 33                  52.8    5e-06   
ref|XP_010914425.1|  PREDICTED: protein RALF-like 33                  52.8    5e-06   
ref|XP_004302395.1|  PREDICTED: protein RALF-like 33-like isoform 1   52.4    5e-06   
ref|XP_011092082.1|  PREDICTED: rapid alkalinization factor-like      52.8    5e-06   
ref|XP_002321018.2|  hypothetical protein POPTR_0014s12630g           52.4    5e-06   Populus trichocarpa [western balsam poplar]
ref|XP_009146075.1|  PREDICTED: rapid alkalinization factor 23-like   52.8    5e-06   
ref|XP_006433408.1|  hypothetical protein CICLE_v10002897mg           52.4    5e-06   
ref|XP_008359858.1|  PREDICTED: rapid alkalinization factor-like      52.8    5e-06   
gb|EPS62616.1|  hypothetical protein M569_12176                       52.4    5e-06   
ref|NP_850219.1|  protein RALF-like 19                                52.4    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002531878.1|  RALFL33, putative                                52.4    6e-06   Ricinus communis
ref|XP_004494597.1|  PREDICTED: protein RALF-like 33-like             52.4    6e-06   
ref|XP_009373554.1|  PREDICTED: LOW QUALITY PROTEIN: protein RALF...  53.1    6e-06   
ref|XP_006606531.1|  PREDICTED: protein RALF-like 1-like              52.4    6e-06   
ref|XP_004290774.1|  PREDICTED: protein RALF-like 33-like isoform 1   52.4    6e-06   
ref|XP_002879470.1|  hypothetical protein ARALYDRAFT_902453           52.4    6e-06   
gb|EPS64652.1|  rapid alkalinization factor                           51.2    7e-06   
ref|XP_006408069.1|  hypothetical protein EUTSA_v10021783mg           52.4    7e-06   
ref|XP_010938417.1|  PREDICTED: protein RALF-like 33                  52.4    7e-06   
ref|XP_008368985.1|  PREDICTED: rapid alkalinization factor-like      52.0    7e-06   
ref|XP_002882418.1|  hypothetical protein ARALYDRAFT_477838           52.0    8e-06   
ref|XP_004979239.1|  PREDICTED: rapid alkalinization factor 23-like   52.0    8e-06   
ref|XP_008246447.1|  PREDICTED: rapid alkalinization factor           52.0    9e-06   
ref|XP_004494362.1|  PREDICTED: rapid alkalinization factor-like      52.0    9e-06   
ref|XP_007206150.1|  hypothetical protein PRUPE_ppa013461mg           52.0    1e-05   
gb|AFB73770.1|  rapid alkalinization factor                           52.0    1e-05   
gb|EMS45535.1|  hypothetical protein TRIUR3_16964                     52.0    1e-05   
ref|XP_010532737.1|  PREDICTED: protein RALF-like 24                  51.6    1e-05   
emb|CDO98876.1|  unnamed protein product                              52.0    1e-05   
ref|XP_007034215.1|  RALFL33, putative                                52.0    1e-05   
ref|XP_009392644.1|  PREDICTED: rapid alkalinization factor-like      51.6    1e-05   
ref|NP_566555.1|  rapid alkalinization factor 23                      52.0    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102578.1|  PREDICTED: protein RALF-like 24                  51.6    1e-05   
emb|CDX77484.1|  BnaA07g06220D                                        51.6    1e-05   
ref|XP_009393214.1|  PREDICTED: rapid alkalinization factor-like      51.6    1e-05   
emb|CDX85126.1|  BnaC07g07800D                                        51.6    1e-05   
ref|XP_008222806.1|  PREDICTED: protein RALF-like 24                  52.4    1e-05   
emb|CBI39521.3|  unnamed protein product                              52.0    1e-05   
ref|XP_010038196.1|  PREDICTED: rapid alkalinization factor-like      51.6    1e-05   
emb|CDY50107.1|  BnaC01g43550D                                        51.2    1e-05   
ref|XP_009134826.1|  PREDICTED: protein RALF-like 22                  51.2    2e-05   
ref|XP_007050868.1|  Ralf-like 33, putative                           51.2    2e-05   
emb|CDY53781.1|  BnaC04g44150D                                        51.2    2e-05   
ref|XP_002874355.1|  hypothetical protein ARALYDRAFT_910810           51.2    2e-05   
ref|XP_003521558.1|  PREDICTED: rapid alkalinization factor-like      51.2    2e-05   
gb|KFK37938.1|  hypothetical protein AALP_AA3G049600                  51.2    2e-05   
gb|KHN20413.1|  hypothetical protein glysoja_039711                   50.1    2e-05   
ref|XP_010428004.1|  PREDICTED: protein RALF-like 22                  51.2    2e-05   
ref|XP_010644182.1|  PREDICTED: protein RALF-like 19                  51.2    2e-05   
ref|XP_006298819.1|  hypothetical protein CARUB_v10014925mg           51.2    2e-05   
ref|XP_010485998.1|  PREDICTED: protein RALF-like 22                  51.2    2e-05   
ref|XP_010464074.1|  PREDICTED: protein RALF-like 22                  51.2    2e-05   
ref|XP_009106333.1|  PREDICTED: protein RALF-like 24                  51.6    2e-05   
ref|XP_010269500.1|  PREDICTED: rapid alkalinization factor-like      51.2    2e-05   
ref|XP_008338587.1|  PREDICTED: protein RALF-like 24                  51.6    2e-05   
ref|XP_004308256.1|  PREDICTED: protein RALF-like 19-like             50.8    2e-05   
ref|XP_008451660.1|  PREDICTED: rapid alkalinization factor-like      50.8    2e-05   
emb|CDY18779.1|  BnaAnng02440D                                        50.8    2e-05   
emb|CDP03512.1|  unnamed protein product                              50.8    2e-05   
ref|XP_009124021.1|  PREDICTED: protein RALF-like 22                  50.8    2e-05   
ref|XP_008789920.1|  PREDICTED: protein RALF-like 33                  50.8    2e-05   
gb|KDP39326.1|  hypothetical protein JCGZ_01083                       50.8    3e-05   
ref|NP_566253.1|  protein RALF-like 22                                50.8    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006849879.1|  hypothetical protein AMTR_s00022p00078480        50.8    3e-05   
emb|CDY18799.1|  BnaAnng02640D                                        50.8    3e-05   
ref|XP_009385018.1|  PREDICTED: protein RALF-like 33                  50.8    3e-05   
ref|XP_008813275.1|  PREDICTED: protein RALF-like 33                  50.4    3e-05   
gb|AFK34833.1|  unknown                                               50.8    3e-05   
ref|XP_007223934.1|  hypothetical protein PRUPE_ppa013295mg           50.8    3e-05   
gb|KGN44918.1|  hypothetical protein Csa_7G396340                     50.4    3e-05   
ref|XP_011012491.1|  PREDICTED: protein RALF-like 31                  50.4    3e-05   
ref|XP_010550987.1|  PREDICTED: protein RALF-like 22                  50.4    3e-05   
gb|KDO77605.1|  hypothetical protein CISIN_1g034223mg                 50.1    4e-05   
ref|XP_008800838.1|  PREDICTED: rapid alkalinization factor-like      50.4    4e-05   
ref|NP_001235444.1|  uncharacterized protein LOC100500513 precursor   50.1    4e-05   
ref|XP_006373091.1|  hypothetical protein POPTR_0017s08620g           50.4    4e-05   
ref|XP_002454987.1|  hypothetical protein SORBIDRAFT_03g002560        50.4    4e-05   
ref|XP_010546717.1|  PREDICTED: protein RALF-like 22                  50.1    5e-05   
ref|XP_002442268.1|  hypothetical protein SORBIDRAFT_08g017280        50.1    5e-05   
ref|XP_008235043.1|  PREDICTED: protein RALF-like 33                  50.1    5e-05   
ref|XP_004298210.1|  PREDICTED: protein RALF-like 24-like             49.7    6e-05   
ref|XP_004152366.1|  PREDICTED: protein RALF-like 33-like             49.7    6e-05   
gb|EYU32711.1|  hypothetical protein MIMGU_mgv1a016289mg              49.3    8e-05   
ref|XP_002885594.1|  hypothetical protein ARALYDRAFT_898918           49.3    8e-05   
dbj|BAD94374.1|  hypothetical protein                                 48.9    9e-05   
gb|KHN02967.1|  hypothetical protein glysoja_009833                   48.1    9e-05   
ref|XP_010241287.1|  PREDICTED: protein RALF-like 19                  49.3    1e-04   
ref|XP_010247579.1|  PREDICTED: protein RALF-like 24                  49.3    1e-04   
ref|XP_007140560.1|  hypothetical protein PHAVU_008G122900g           48.9    1e-04   
gb|EAY83408.1|  hypothetical protein OsI_38624                        49.3    1e-04   
ref|NP_001066957.1|  Os12g0541700                                     49.3    1e-04   
ref|XP_009612980.1|  PREDICTED: protein RALF-like 24                  49.3    1e-04   
gb|EMT00251.1|  hypothetical protein F775_01891                       48.1    1e-04   
ref|XP_007199089.1|  hypothetical protein PRUPE_ppa020353mg           48.5    1e-04   
ref|XP_003632038.1|  PREDICTED: protein RALF-like 24                  48.9    1e-04   
ref|XP_009766091.1|  PREDICTED: protein RALF-like 24                  49.3    1e-04   
gb|ACU19560.1|  unknown                                               48.9    1e-04   
ref|XP_003524928.1|  PREDICTED: protein RALF-like 24-like             48.9    1e-04   
ref|XP_006296636.1|  hypothetical protein CARUB_v10014939mg           48.5    1e-04   
ref|NP_001152442.1|  RALF precursor                                   48.9    2e-04   
gb|AAR00325.2|  rapid alkalinization factor 1                         49.3    2e-04   
ref|XP_006414843.1|  hypothetical protein EUTSA_v10026600mg           48.5    2e-04   
ref|XP_009147231.1|  PREDICTED: LOW QUALITY PROTEIN: protein RALF...  48.5    2e-04   
ref|XP_010023649.1|  PREDICTED: protein RALF-like 24                  48.9    2e-04   
ref|XP_010090810.1|  hypothetical protein L484_009088                 48.5    2e-04   
ref|XP_010488459.1|  PREDICTED: protein RALF-like 24                  48.5    2e-04   
ref|NP_001067847.1|  Os11g0456000                                     48.1    2e-04   
gb|AGT16384.1|  hypothetical protein SHCRBa_052_I12_R_250             49.7    2e-04   
ref|XP_010524867.1|  PREDICTED: protein RALF-like 22                  48.5    2e-04   
ref|NP_001150677.1|  RALFL33 precursor                                48.1    2e-04   
ref|XP_006349913.1|  PREDICTED: protein RALF-like 33-like             48.9    2e-04   
ref|XP_010466739.1|  PREDICTED: protein RALF-like 24                  48.5    2e-04   
ref|XP_008386646.1|  PREDICTED: rapid alkalinization factor-like      48.1    2e-04   
ref|XP_010512928.1|  PREDICTED: protein RALF-like 24                  48.5    2e-04   
ref|XP_009415108.1|  PREDICTED: protein RALF-like 19                  48.5    2e-04   
ref|XP_007163812.1|  hypothetical protein PHAVU_001G266400g           48.5    2e-04   
ref|XP_008229078.1|  PREDICTED: rapid alkalinization factor-like      48.5    2e-04   
gb|EYU42214.1|  hypothetical protein MIMGU_mgv1a016660mg              47.8    3e-04   
ref|XP_009402519.1|  PREDICTED: rapid alkalinization factor-like      47.8    3e-04   
dbj|BAK08263.1|  predicted protein                                    48.1    3e-04   
ref|XP_003538529.1|  PREDICTED: protein RALF-like 24-like             47.8    3e-04   
emb|CDP03492.1|  unnamed protein product                              47.0    3e-04   
ref|NP_001241215.1|  uncharacterized protein LOC100793523 precursor   47.8    3e-04   
ref|XP_010314746.1|  PREDICTED: uncharacterized protein LOC101258931  49.7    3e-04   
ref|XP_004502245.1|  PREDICTED: protein RALF-like 24-like             47.8    3e-04   
ref|XP_002522804.1|  RALFL33, putative                                47.8    3e-04   
ref|NP_001150599.1|  LOC100284232 precursor                           47.4    4e-04   
ref|XP_009409606.1|  PREDICTED: protein RALF-like 22                  47.8    4e-04   
gb|AGT16909.1|  ralf-like protein                                     47.4    4e-04   
ref|XP_011003629.1|  PREDICTED: protein RALF-like 24                  47.4    4e-04   
ref|XP_010524533.1|  PREDICTED: rapid alkalinization factor 23-like   47.8    5e-04   
ref|XP_007198968.1|  hypothetical protein PRUPE_ppa015429mg           46.6    5e-04   
gb|AGT16640.1|  rapid alkalinization factor 1                         47.0    6e-04   
gb|AGT15906.1|  RALFL33 precursor                                     47.0    6e-04   
ref|XP_003575694.1|  PREDICTED: rapid alkalinization factor-like      47.4    6e-04   
ref|XP_010038087.1|  PREDICTED: rapid alkalinization factor-like      47.0    6e-04   
ref|NP_566740.1|  protein ralf-like 24                                47.0    6e-04   
ref|XP_006412966.1|  hypothetical protein EUTSA_v10026612mg           47.0    6e-04   
ref|NP_001149391.1|  LOC100283017 precursor                           47.0    7e-04   
ref|XP_010449887.1|  PREDICTED: protein RALF-like 33                  47.0    7e-04   
emb|CAN69272.1|  hypothetical protein VITISV_001680                   45.8    8e-04   
ref|XP_006418836.1|  hypothetical protein EUTSA_v10002729mg           46.6    8e-04   
ref|XP_006284794.1|  hypothetical protein CARUB_v10006063mg           46.6    8e-04   
emb|CDY58804.1|  BnaC08g46770D                                        46.6    9e-04   
ref|XP_010493984.1|  PREDICTED: protein RALF-like 22                  46.6    9e-04   
ref|XP_009107494.1|  PREDICTED: protein RALF-like 31                  46.2    9e-04   
ref|NP_001278545.1|  Rapid alkalinization factor 1 precursor          46.6    9e-04   
ref|XP_006418288.1|  hypothetical protein EUTSA_v10009124mg           46.6    9e-04   



>emb|CDO99525.1| unnamed protein product [Coffea canephora]
Length=124

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             D+AEEMMLDSE+SRR+L +TRY+SY  LR+  IPC ++G SYY C SH  I PY
Sbjct  55   IDEAEEMMLDSEASRRVLAQTRYISYDALRRGNIPCSRRGSSYYNCGSHQKINPY  109



>ref|XP_007212761.1| hypothetical protein PRUPE_ppa026481mg [Prunus persica]
 gb|EMJ13960.1| hypothetical protein PRUPE_ppa026481mg [Prunus persica]
Length=122

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +3

Query  114  TMYSDPASVGAASSGIMDFDDAE-EMMLDSESSRRML--FRTRYLSYSVLRKDQIPCGKK  284
            T + D + +  A+S + D    E EMM+DSESSRR L   + RY++Y  LR++ +PCG++
Sbjct  34   TAHDDESLIDRANSKVGDMIGEENEMMMDSESSRRTLRGAQGRYIAYGALRRNAVPCGRR  93

Query  285  GPSYYFCHSHHPIRPY  332
            G SYY C +     PY
Sbjct  94   GQSYYNCQNRQRANPY  109



>gb|EYU44954.1| hypothetical protein MIMGU_mgv1a023845mg [Erythranthe guttata]
Length=118

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 44/59 (75%), Gaps = 4/59 (7%)
 Frame = +3

Query  162  MDFDDAEEMMLDSESSRRMLF-RTR-YLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +DFD  EE+M++SES+RR L+ R R ++SY+ LR++ +PC K+G SYY C  HHP  PY
Sbjct  47   LDFD--EELMMESESARRQLWGRHRGHISYAALRRNNVPCNKRGHSYYNCLGHHPAHPY  103



>ref|XP_010108173.1| hypothetical protein L484_014498 [Morus notabilis]
 gb|EXC18098.1| hypothetical protein L484_014498 [Morus notabilis]
Length=120

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 2/67 (3%)
 Frame = +3

Query  138  VGAASSGIMDF-DDAEEMMLDSESSRRMLFRTR-YLSYSVLRKDQIPCGKKGPSYYFCHS  311
            V   +  I DF  D  EM+LDSE+SRR L R R Y+ Y  L+ +Q+PCG++G SYY C  
Sbjct  39   VAGGAGAIGDFIGDDNEMLLDSEASRRSLARGRSYIGYDALKANQVPCGRRGHSYYNCQK  98

Query  312  HHPIRPY  332
                 PY
Sbjct  99   RQRANPY  105



>ref|XP_008349249.1| PREDICTED: protein RALF-like 4 [Malus domestica]
Length=122

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +3

Query  120  YSDPASVGAASSGIMDF-DDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPS  293
            + D + + +A+S + DF  D  EMM++SES+RR L    R++ YS L+++ +PCG++G S
Sbjct  37   HDDESLINSANSKVGDFIGDENEMMMESESTRRTLIGNGRFIGYSALKQNAVPCGRRGQS  96

Query  294  YYFCHSHHPIRPY  332
            YY C       PY
Sbjct  97   YYDCQKRDGANPY  109



>ref|XP_008390661.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=126

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  144  AASSGIMDFDDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHP  320
            AA   I D D+  EM++DSE +RR+L +R RY+SY  LR++ +PC ++G SYY C     
Sbjct  51   AAGGLIADEDEXAEMLMDSEINRRILAWRRRYISYGALRRNTVPCSRRGASYYNCRPGAQ  110

Query  321  IRPY  332
              PY
Sbjct  111  ANPY  114



>ref|XP_008225111.1| PREDICTED: protein RALF-like 22 [Prunus mume]
Length=122

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +3

Query  114  TMYSDPASVGAASSGIMD-FDDAEEMMLDSESSRRMLF--RTRYLSYSVLRKDQIPCGKK  284
            T + D + +  A+  + D   +  EMM+DSESSRR L   + RY++Y  LR++ +PCG++
Sbjct  34   TTHDDESLIDRANGKVGDMIGEENEMMMDSESSRRTLRGSQGRYIAYGALRRNAVPCGRR  93

Query  285  GPSYYFCHSHHPIRPY  332
            G SYY C +     PY
Sbjct  94   GQSYYNCQNRQRANPY  109



>ref|XP_008360280.1| PREDICTED: protein RALF-like 33 [Malus domestica]
Length=126

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  144  AASSGIMDFDDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHP  320
            AA   I D D+  EM++DSE +RR+L +R RY+SY  LR++ +PC ++G SYY C     
Sbjct  51   AAGGLIADEDEEAEMLMDSEINRRILAWRRRYISYGALRRNTVPCSRRGASYYNCRPGAQ  110

Query  321  IRPY  332
              PY
Sbjct  111  ANPY  114



>ref|XP_009352252.1| PREDICTED: protein RALF-like 33 [Pyrus x bretschneideri]
Length=126

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = +3

Query  144  AASSGIMDFDDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHP  320
            AA   I D D+  EM++DSE +RR+L +R RY+SY  LR++ +PC ++G SYY C     
Sbjct  51   AAGGLIADEDEDAEMLMDSEINRRILAWRRRYISYGALRRNTVPCSRRGASYYNCRPGAQ  110

Query  321  IRPY  332
              PY
Sbjct  111  ANPY  114



>ref|XP_009623267.1| PREDICTED: protein RALF-like 22 [Nicotiana tomentosiformis]
Length=131

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 4/58 (7%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRML---FRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            F+D EEMM+ SES+RR L   +R RY+SY  +R++ IPC ++G SYY C     IRPY
Sbjct  61   FED-EEMMMPSESARRTLWSSYRERYISYQAMRRNSIPCNRRGQSYYQCTRMQRIRPY  117



>ref|XP_009352900.1| PREDICTED: protein RALF-like 19 [Pyrus x bretschneideri]
Length=121

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +3

Query  120  YSDPASVGAASSGIMDFDDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSY  296
            + D + + + +S I D  +  E+++DS S RR L   TRY+ Y  LR++ +PCG++G SY
Sbjct  37   HDDESLIDSTNSKIGDVGEENELLMDSNSGRRTLQGTTRYIGYGALRRNAVPCGRRGQSY  96

Query  297  YFCHSHHPIRPY  332
            Y C       PY
Sbjct  97   YNCQRKEGANPY  108



>ref|XP_004295624.1| PREDICTED: rapid alkalinization factor-like [Fragaria vesca subsp. 
vesca]
Length=118

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 2/63 (3%)
 Frame = +3

Query  120  YSDPASVGAASSGIMDFDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSY  296
            YS  +S+  A+ G +  +D  EMMLDSESSRR L  RTRY+SY  L++++IPC ++G SY
Sbjct  33   YSRDSSLVQANVGDVIGED-NEMMLDSESSRRTLAGRTRYISYGALKRNRIPCRRRGASY  91

Query  297  YFC  305
            Y C
Sbjct  92   YNC  94



>ref|XP_009784377.1| PREDICTED: protein RALF-like 19 [Nicotiana sylvestris]
Length=131

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 6/72 (8%)
 Frame = +3

Query  126  DPASVGAASSGIMDFDDAEEMMLDSESSRRML---FRTRYLSYSVLRKDQIPCGKKGPSY  296
            D  +VG     +  F D EEMM+ SES+RR L   +R RY+SY  +R++ IPC ++G SY
Sbjct  49   DDLTVGHVGDSL--FGD-EEMMMPSESARRTLWSSYRERYISYQAMRRNSIPCNRRGQSY  105

Query  297  YFCHSHHPIRPY  332
            Y C     IRPY
Sbjct  106  YQCTRMQRIRPY  117



>gb|EPS72954.1| rapid alkalinization factor [Genlisea aurea]
Length=100

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 2/57 (4%)
 Frame = +3

Query  162  MDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +D D  EE+M+DSE+SRR L    Y+SY  LR++++PC ++G SYY C +     PY
Sbjct  31   LDLD--EELMMDSEASRRQLAAGNYISYGALRRNRVPCSRRGHSYYNCRASGRANPY  85



>ref|XP_003637105.1| RALF [Medicago truncatula]
 gb|KEH31048.1| RALF [Medicago truncatula]
Length=111

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 45/80 (56%), Gaps = 13/80 (16%)
 Frame = +3

Query  132  ASVGAASSGIMDFD-----------DAEEMMLDSESSRRMLF--RTRYLSYSVLRKDQIP  272
            A V A +S + DF            D  EM++DSES+RR L   + RY+SY  L+ + IP
Sbjct  18   AMVSAEASKVHDFTFASVRVGDLIGDDNEMLMDSESNRRTLAGRKRRYISYGALKANNIP  77

Query  273  CGKKGPSYYFCHSHHPIRPY  332
            CG+KG SYY C++     PY
Sbjct  78   CGQKGQSYYDCNARGQANPY  97



>ref|XP_006279280.1| hypothetical protein CARUB_v10016532mg, partial [Capsella rubella]
 gb|EOA12178.1| hypothetical protein CARUB_v10016532mg, partial [Capsella rubella]
Length=85

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +   AEE  +DSE SRR+L  T+Y+SY  L+K+ +PC ++G SYY C +     PY
Sbjct  16   IAECIGAEEEEMDSEISRRVLATTKYISYQSLKKNSVPCSRRGASYYNCQNGAQANPY  73



>ref|XP_011027816.1| PREDICTED: protein RALF-like 19 [Populus euphratica]
Length=115

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 4/79 (5%)
 Frame = +3

Query  108  ESTMYSDPASVGAASSGIMD---FDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPC  275
            EST + D A +   S+   D   F+ + EMM+DSE + R+L  +TRY+SY  LR + +PC
Sbjct  22   ESTTFMDDADLWGLSTLGHDNNGFEFSTEMMMDSEINHRLLAQKTRYISYGALRANSVPC  81

Query  276  GKKGPSYYFCHSHHPIRPY  332
             ++G SYY C+      PY
Sbjct  82   NRRGRSYYNCNRRQRANPY  100



>ref|XP_006444286.1| hypothetical protein CICLE_v10023750mg [Citrus clementina]
 ref|XP_006479916.1| PREDICTED: protein RALF-like 33-like [Citrus sinensis]
 gb|ESR57526.1| hypothetical protein CICLE_v10023750mg [Citrus clementina]
 gb|KDO87300.1| hypothetical protein CISIN_1g033577mg [Citrus sinensis]
Length=116

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            EE  +DSE +RR+L  T+Y+SY  L++D +PC ++G SYY CH+     PY
Sbjct  54   EEFGMDSEINRRILATTKYISYGALQRDSVPCSQRGASYYNCHAGAQANPY  104



>ref|XP_009387647.1| PREDICTED: protein RALF-like 19 [Musa acuminata subsp. malaccensis]
Length=121

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
              D EEM ++S S+RR L  RT+++SY  L K+++PC ++G SYY CH    + PY
Sbjct  51   VGDEEEMTMESVSARRSLASRTKFVSYGALTKNRVPCNRRGQSYYNCHRQKKVNPY  106



>ref|XP_003554646.1| PREDICTED: protein RALF-like 1-like [Glycine max]
 gb|KHN43298.1| hypothetical protein glysoja_001881 [Glycine soja]
Length=129

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +3

Query  123  SDPASVGAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYF  302
            +D  ++G   + I      EE  LDSE SRR+L  T+Y+SY  L+++ +PC ++G SYY 
Sbjct  48   ADAGALGMEMTWIPSMPMEEEFQLDSEISRRILATTKYISYGALQRNTVPCSRRGASYYN  107

Query  303  CHSHHPIRPY  332
            C       PY
Sbjct  108  CQPGAQANPY  117



>ref|XP_002305130.2| hypothetical protein POPTR_0004s04470g [Populus trichocarpa]
 ref|XP_002305131.2| hypothetical protein POPTR_0004s04480g [Populus trichocarpa]
 gb|EEE85641.2| hypothetical protein POPTR_0004s04470g [Populus trichocarpa]
 gb|EEE85642.2| hypothetical protein POPTR_0004s04480g [Populus trichocarpa]
Length=112

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 4/79 (5%)
 Frame = +3

Query  108  ESTMYSDPASVGAASSGIMD---FDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPC  275
            EST   D A +   S+   D   F+ + EMM+DSE + R+L  +TRY+SY  LR + +PC
Sbjct  19   ESTTLMDDADLWGLSTLGHDNNGFEFSTEMMMDSEINHRLLAQKTRYISYGALRANSVPC  78

Query  276  GKKGPSYYFCHSHHPIRPY  332
             ++G SYY C+      PY
Sbjct  79   NRRGSSYYNCNKRQRANPY  97



>ref|XP_009111178.1| PREDICTED: protein RALF-like 1 [Brassica rapa]
Length=121

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I D   AEE  +DSE SRR+L  T+Y+SY  L+++ +PC ++G SYY C +     PY
Sbjct  52   IADCIGAEEEEMDSEISRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPY  109



>ref|XP_006304742.1| hypothetical protein CARUB_v10012118mg [Capsella rubella]
 gb|EOA37640.1| hypothetical protein CARUB_v10012118mg [Capsella rubella]
Length=123

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +   AEE  +DSE SRR+L  T+Y+SY  L+K+ +PC ++G SYY C +     PY
Sbjct  54   IAECIGAEEEEMDSEISRRVLATTKYISYQSLKKNSVPCSRRGASYYNCQNGAQANPY  111



>ref|XP_006414444.1| hypothetical protein EUTSA_v10026579mg [Eutrema salsugineum]
 gb|ESQ55897.1| hypothetical protein EUTSA_v10026579mg [Eutrema salsugineum]
Length=122

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +3

Query  177  AEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            AEE  +DSE +RR+L  TRY+SY  LR++ +PC ++G SYY C       PY
Sbjct  59   AEEFEMDSEINRRILATTRYISYGALRRNTVPCSRRGASYYNCRRGAQANPY  110



>ref|XP_007025592.1| Ralf-like 4, putative [Theobroma cacao]
 gb|EOY28214.1| Ralf-like 4, putative [Theobroma cacao]
Length=117

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G  D +D  + ++DSE +RR L + RY+SY  L+ + +PC ++G SYY C +     PY
Sbjct  44   GQCDVEDVSQTLMDSEINRRQLAQKRYISYGALKANSVPCNRRGNSYYNCQNRKRANPY  102



>emb|CDX86697.1| BnaC08g00060D [Brassica napus]
Length=121

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I D   AEE  +DSE SRR+L  T+Y+SY  L+++ +PC ++G SYY C +     PY
Sbjct  52   IADCIGAEEEEMDSEISRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPY  109



>ref|XP_010098288.1| hypothetical protein L484_023536 [Morus notabilis]
 gb|EXB74792.1| hypothetical protein L484_023536 [Morus notabilis]
Length=125

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I D D   EM +DSE  RR+L + RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  56   IADVDSELEMEMDSEGHRRILAQRRYISYGALRRNTVPCSRRGSSYYNCRPGGQANPY  113



>ref|XP_010481344.1| PREDICTED: protein RALF-like 1 [Camelina sativa]
Length=122

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 47/84 (56%), Gaps = 9/84 (11%)
 Frame = +3

Query  108  ESTMYSDPASVGAASSG---------IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRK  260
            ++   +D   +G A+SG         I +   AEE  +DSE +RR+L  T+Y+SY  LR+
Sbjct  27   QAGFTNDLDGLGWATSGVHGSGCHGSIAECIGAEEEEMDSEINRRILATTKYISYQSLRR  86

Query  261  DQIPCGKKGPSYYFCHSHHPIRPY  332
            + +PC ++G SYY C +     PY
Sbjct  87   NSVPCSRRGASYYNCQNGAQANPY  110



>ref|XP_010474880.1| PREDICTED: protein RALF-like 1 [Camelina sativa]
Length=119

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 47/84 (56%), Gaps = 9/84 (11%)
 Frame = +3

Query  108  ESTMYSDPASVGAASSG---------IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRK  260
            ++   +D   +G A+SG         I +   AEE  +DSE +RR+L  T+Y+SY  LR+
Sbjct  24   QAGFTNDLDGLGWATSGVHGSGCHGSIAECIGAEEEEMDSEINRRILATTKYISYQSLRR  83

Query  261  DQIPCGKKGPSYYFCHSHHPIRPY  332
            + +PC ++G SYY C +     PY
Sbjct  84   NSVPCSRRGASYYNCQNGAQANPY  107



>emb|CDP05933.1| unnamed protein product [Coffea canephora]
Length=124

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = +3

Query  159  IMDF-DDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            + DF D+ EEM ++SE++RR L  R RY+SY  +R+  +PC ++G SYY C++H    PY
Sbjct  50   VADFIDEDEEMSVESETARRTLAGRPRYISYDAMRRGNVPCSRRGNSYYACNAHGRANPY  109



>gb|AAO27367.1| rapid alkalinization factor 2 precursor [Populus trichocarpa 
x Populus deltoides]
Length=128

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  162  MDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            M  +D EE  +D+E +RR+L  +RY+SY  L+K+ +PC ++G SYY C +     PY
Sbjct  60   MAEEDGEEFGMDTEINRRILATSRYVSYGALQKNNVPCSRRGASYYNCKNGAQANPY  116



>ref|XP_002870208.1| hypothetical protein ARALYDRAFT_493304 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46467.1| hypothetical protein ARALYDRAFT_493304 [Arabidopsis lyrata subsp. 
lyrata]
Length=118

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
               AEE  +DSE +RR+L  T+Y+SY  LR++ +PC ++G SYY C       PY
Sbjct  52   LSTAEEFEMDSEINRRILATTKYISYGALRRNTVPCSRRGASYYNCRRGAQANPY  106



>gb|AFK33323.1| unknown [Medicago truncatula]
Length=126

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +D  E M+DSES+RR+L   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  61   EDDSEFMMDSESNRRILAARRYISYGALRRNTVPCSRRGASYYNCRPGAQANPY  114



>ref|XP_002319521.1| RALF-LIKE 23 family protein [Populus trichocarpa]
 gb|ABK95616.1| unknown [Populus trichocarpa]
 gb|EEE95444.1| RALF-LIKE 23 family protein [Populus trichocarpa]
Length=128

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  162  MDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            M  +D EE  +D+E +RR+L  +RY+SY  L+K+ +PC ++G SYY C +     PY
Sbjct  60   MAEEDGEEFGMDTEINRRILATSRYVSYGALQKNNVPCSRRGASYYNCKNGAQANPY  116



>ref|XP_008349218.1| PREDICTED: protein RALF-like 19 [Malus domestica]
Length=121

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 42/72 (58%), Gaps = 1/72 (1%)
 Frame = +3

Query  120  YSDPASVGAASSGIMDFDDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSY  296
            + D + + +A+S   D  +  E+++DS+S RR L    R++ Y  LR++ +PCG++G SY
Sbjct  37   HDDESLIDSANSKTGDVGEENELLMDSDSGRRTLKGNGRFIGYGALRRNAVPCGRRGQSY  96

Query  297  YFCHSHHPIRPY  332
            Y C       PY
Sbjct  97   YNCQKREGANPY  108



>gb|AES91867.2| RALF [Medicago truncatula]
Length=126

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +D  E M+DSES+RR+L   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  61   EDDSEFMMDSESNRRILAARRYISYGALRRNTVPCSRRGASYYNCRPGAQANPY  114



>emb|CDY15442.1| BnaA08g27260D [Brassica napus]
Length=121

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I D   AEE  +DSE +RR+L  T+Y+SY  L+++ +PC ++G SYY C +     PY
Sbjct  52   IADCIGAEEEEMDSEINRRILATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPY  109



>ref|XP_003609670.1| Rapid alkalinization factor [Medicago truncatula]
Length=139

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +D  E M+DSES+RR+L   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  61   EDDSEFMMDSESNRRILAARRYISYGALRRNTVPCSRRGASYYNCRPGAQANPY  114



>ref|XP_002512426.1| RALFL33, putative [Ricinus communis]
 gb|EEF49878.1| RALFL33, putative [Ricinus communis]
Length=121

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             + EE  +DSE+SRR+L  T+Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  56   SNGEEFEMDSETSRRILATTKYISYGALQRNSVPCSRRGASYYNCQPGAQANPY  109



>ref|XP_008458453.1| PREDICTED: protein RALF-like 33 [Cucumis melo]
Length=119

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  165  DFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            DF    E  +DSE +RR+L  TRY+SY  LR++ +PC ++G SYY C       PY
Sbjct  52   DFGFGMEFQMDSEINRRILATTRYISYGALRRNNVPCSRRGASYYNCRPGAQANPY  107



>ref|XP_002280202.1| PREDICTED: protein RALF-like 19 [Vitis vinifera]
Length=128

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             ++ +EMM+DSE++RR L  R RY+SY  LR++Q+PC ++G SYY C       PY
Sbjct  58   INEDDEMMMDSETNRRSLAQRRRYISYGALRRNQVPCNRRGRSYYNCRRGGRANPY  113



>gb|KFK44989.1| hypothetical protein AALP_AA1G329500 [Arabis alpina]
Length=105

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +3

Query  177  AEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             EE  +DSE +RR+L  TRY+SY  LR++ IPC ++G SYY C       PY
Sbjct  42   TEEFEMDSEINRRILATTRYISYGALRRNTIPCSRRGASYYNCRRGAQANPY  93



>ref|XP_010457289.1| PREDICTED: protein RALF-like 1 [Camelina sativa]
Length=119

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 42/71 (59%), Gaps = 4/71 (6%)
 Frame = +3

Query  132  ASVGAASSG----IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYY  299
            A+ G   SG    I +   AEE  +DSE +RR+L  T+Y+SY  LR++ +PC ++G SYY
Sbjct  37   ATSGVHGSGCHGSIAECIGAEEEEMDSEINRRILATTKYISYQSLRRNSVPCSRRGASYY  96

Query  300  FCHSHHPIRPY  332
             C +     PY
Sbjct  97   NCQNGAQANPY  107



>gb|KDP23480.1| hypothetical protein JCGZ_23313 [Jatropha curcas]
Length=125

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            D  EE  LDSE SRR+L  + Y+SY  L+++ +PC ++G SYY C +     PY
Sbjct  60   DGGEEFELDSEISRRILATSNYISYGALQRNTVPCSRRGASYYNCQNGAQANPY  113



>ref|XP_003542740.1| PREDICTED: protein RALF-like 19-like [Glycine max]
 gb|KHN09995.1| hypothetical protein glysoja_026895 [Glycine soja]
Length=111

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            D  EM+LDSES+RR L  R RY+SY  L  + +PCG +G SYY C       PY
Sbjct  43   DDNEMLLDSESNRRTLTGRQRYISYGALNANNVPCGNRGRSYYNCQQRGRANPY  96



>ref|XP_004485791.1| PREDICTED: protein RALF-like 19-like [Cicer arietinum]
Length=112

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             +D  E ++ SE+S R+L  R RY+SY  LR +Q+PCGK+G SYY C       PY
Sbjct  42   IEDDNEFLMSSEASHRILAGRGRYISYGALRANQVPCGKRGRSYYNCQKRGKANPY  97



>ref|XP_006295275.1| hypothetical protein CARUB_v10024364mg [Capsella rubella]
 gb|EOA28173.1| hypothetical protein CARUB_v10024364mg [Capsella rubella]
Length=110

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G +  DD  E ++DSE++RR L  R  Y+SY  L+K+ +PCG++G SYY C       PY
Sbjct  36   GCIGEDDELESLMDSEANRRQLAARRSYISYGALKKNNVPCGRRGRSYYDCKKRKRANPY  95



>ref|XP_007147024.1| hypothetical protein PHAVU_006G089900g [Phaseolus vulgaris]
 gb|ESW19018.1| hypothetical protein PHAVU_006G089900g [Phaseolus vulgaris]
Length=104

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            EE  LDSE SRR+L  T+Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  42   EEFQLDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCQPGAQANPY  92



>emb|CDY18130.1| BnaC05g01530D [Brassica napus]
Length=122

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I D    EE  +DSE +RR+L  T+Y+SY  L+++ +PC ++G SYY C +     PY
Sbjct  53   IADCIGTEEEEMDSEINRRILATTKYISYQALKRNSVPCSRRGASYYNCQNGAQANPY  110



>ref|XP_007154282.1| hypothetical protein PHAVU_003G105300g [Phaseolus vulgaris]
 gb|ESW26276.1| hypothetical protein PHAVU_003G105300g [Phaseolus vulgaris]
Length=122

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            DD  E ++DSE+SRR+L    Y+SY  LR++ +PC ++G SYY C       PY
Sbjct  57   DDDAEFLMDSETSRRILAGKTYISYGALRRNTVPCSRRGASYYNCRPGAQANPY  110



>ref|NP_171789.1| rapid alkalinization factor 1 [Arabidopsis thaliana]
 sp|Q9SRY3.1|RLF1_ARATH RecName: Full=Protein RALF-like 1; AltName: Full=Rapid alkalinization 
factor 1; Short=AtRALF1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF02876.1|AC009525_10 Unknown protein [Arabidopsis thaliana]
 gb|AAQ22643.1| At1g02900 [Arabidopsis thaliana]
 gb|AEE27494.1| rapid alkalinization factor 1 [Arabidopsis thaliana]
Length=120

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 4/71 (6%)
 Frame = +3

Query  132  ASVGAASSG----IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYY  299
            A+ G   SG    I +   AEE  +DSE +RR+L  T+Y+SY  L+++ +PC ++G SYY
Sbjct  38   ATTGDNGSGCHGSIAECIGAEEEEMDSEINRRILATTKYISYQSLKRNSVPCSRRGASYY  97

Query  300  FCHSHHPIRPY  332
             C +     PY
Sbjct  98   NCQNGAQANPY  108



>ref|XP_011023680.1| PREDICTED: rapid alkalinization factor-like [Populus euphratica]
Length=126

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +3

Query  162  MDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            M  +D EE  +D+E +RR+L  ++Y+SY  L+K+ +PC ++G SYY C +     PY
Sbjct  58   MAEEDGEEFEMDTEINRRILATSKYVSYGALQKNNVPCSRRGASYYNCKNGAQANPY  114



>gb|AAO27366.1| rapid alkalinization factor 1 precursor [Populus trichocarpa 
x Populus deltoides]
Length=120

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +D EE  +D+E +RR+L  T+Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  55   EDGEEFEMDTEINRRILATTKYVSYGALQRNNVPCSRRGASYYNCQRGAQANPY  108



>ref|XP_003521695.2| PREDICTED: protein RALF-like 1-like isoform 1 [Glycine max]
Length=174

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +3

Query  123  SDPASVGAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYF  302
            ++  ++G   + I      EE  LDSE SRR+L  T+Y+SY  L+++ +PC ++G SYY 
Sbjct  93   ANAGALGMEMTWIPSMPMEEEFQLDSEISRRILATTKYISYGALQRNTVPCSRRGASYYN  152

Query  303  CHSHHPIRPY  332
            C       PY
Sbjct  153  CQPGAQANPY  162



>emb|CDX89932.1| BnaA10g01500D [Brassica napus]
Length=122

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I D    EE  +DSE +RR+L  T+Y+SY  L+++ +PC ++G SYY C +     PY
Sbjct  53   IADCIGTEEEEMDSEINRRILATTKYISYQALKRNSVPCSRRGASYYNCQNGAQANPY  110



>ref|XP_006382486.1| RALF-LIKE 23 family protein [Populus trichocarpa]
 gb|ABK94089.1| unknown [Populus trichocarpa]
 gb|ERP60283.1| RALF-LIKE 23 family protein [Populus trichocarpa]
Length=120

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +D EE  +D+E +RR+L  T+Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  55   EDGEEFEMDTEINRRILATTKYVSYGALQRNNVPCSRRGASYYNCQRGAQANPY  108



>ref|XP_008340810.1| PREDICTED: protein RALF-like 33 [Malus domestica]
Length=61

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  186  MMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            M +DSE +RR+L  +RY+SY  LR++ IPC ++G SYY C    P  PY
Sbjct  1    MQMDSEINRRILATSRYISYGALRRNTIPCSRRGASYYNCRPGAPANPY  49



>ref|XP_010549330.1| PREDICTED: protein RALF-like 19 [Tarenaya hassleriana]
Length=110

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLFR-TRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G +  +D  E ++DSE++RR L +  RY+SY  LRK+ +PC ++G SYY C     + PY
Sbjct  36   GCIGDEDGVETLMDSETNRRQLAQGRRYISYGALRKNNVPCSRRGRSYYDCRRRKRVNPY  95



>ref|XP_004508218.1| PREDICTED: rapid alkalinization factor 23-like [Cicer arietinum]
Length=127

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +D  E ++DSE+SRR+L   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  62   EDDTEFLMDSENSRRILAGRRYISYGALRRNTVPCSRRGASYYNCRPGAQANPY  115



>ref|XP_009143830.1| PREDICTED: protein RALF-like 19 [Brassica rapa]
 emb|CDY17200.1| BnaA05g09880D [Brassica napus]
Length=110

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G +  DD  E ++DSE++RR L  R RY+SY  L+K+ +PC ++G SYY C       PY
Sbjct  36   GCIGDDDGLESLMDSETNRRQLAARRRYISYGALKKNNVPCSRRGRSYYDCTKRKRANPY  95



>emb|CDY27943.1| BnaCnng05280D [Brassica napus]
Length=110

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G +  DD  E ++DSE++RR L  R RY+SY  L+K+ +PC ++G SYY C       PY
Sbjct  36   GCIGDDDGLESLMDSETNRRQLAARRRYISYGALKKNNVPCSRRGRSYYDCTKRKRANPY  95



>ref|XP_006389381.1| hypothetical protein POPTR_0026s00240g [Populus trichocarpa]
 gb|ERP48295.1| hypothetical protein POPTR_0026s00240g [Populus trichocarpa]
Length=112

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 40/64 (63%), Gaps = 4/64 (6%)
 Frame = +3

Query  141  GAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHP  320
            G+ +  +MD    EE  +D+ES+RR+L  +RY+SY  LR++ +PC ++G SYY C     
Sbjct  41   GSIAECLMD----EEFGMDTESNRRILATSRYVSYGALRRNTVPCSRRGASYYNCRPGAQ  96

Query  321  IRPY  332
              PY
Sbjct  97   ANPY  100



>gb|ABK96369.1| unknown [Populus trichocarpa x Populus deltoides]
Length=112

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 40/64 (63%), Gaps = 4/64 (6%)
 Frame = +3

Query  141  GAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHP  320
            G+ +  +MD    EE  +D+ES+RR+L  +RY+SY  LR++ +PC ++G SYY C     
Sbjct  41   GSIAECLMD----EEFGMDTESNRRILATSRYVSYGALRRNTVPCSRRGASYYNCRPGAQ  96

Query  321  IRPY  332
              PY
Sbjct  97   ANPY  100



>ref|XP_006285957.1| hypothetical protein CARUB_v10007476mg [Capsella rubella]
 gb|EOA18855.1| hypothetical protein CARUB_v10007476mg [Capsella rubella]
Length=116

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
              EE  +DSE SRR+L  T+Y+SY  LR++ +PC ++G SYY C       PY
Sbjct  52   SVEEFEMDSEISRRILATTKYISYGALRRNTVPCSRRGASYYNCRRGAQANPY  104



>ref|XP_011087422.1| PREDICTED: rapid alkalinization factor [Sesamum indicum]
Length=117

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +3

Query  129  PASVGAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCH  308
            P   G  +  + + D  EE  LDSES+RR+L   RY+SY  L+++ +PC ++G SYY C 
Sbjct  40   PGCRGTVAECLANED--EEFELDSESNRRILATRRYISYGALQRNSVPCSRRGASYYNCR  97

Query  309  SHHPIRPY  332
                  PY
Sbjct  98   PGAQANPY  105



>gb|KHN03976.1| hypothetical protein glysoja_022662 [Glycine soja]
Length=75

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            EE  LDSE SRR+L  T+Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  13   EEFQLDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCQPGAQANPY  63



>ref|XP_004504245.1| PREDICTED: protein RALF-like 19-like [Cicer arietinum]
Length=112

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 1/56 (2%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             +D  E ++ SE+S R+L  R RY+ Y  LR +Q+PCG++G SYY CH      PY
Sbjct  42   IEDDNEFLMSSEASHRVLAGRRRYIGYGALRANQVPCGRRGRSYYNCHRRGRANPY  97



>ref|XP_010921813.1| PREDICTED: protein RALF-like 33 [Elaeis guineensis]
Length=123

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +3

Query  144  AASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPI  323
            A    I +    EE  LDSE SRR+L  +RY+SY  LR+D  PC ++G SYY C      
Sbjct  49   ACQGTIAECLAGEEFELDSEISRRILATSRYISYDALRRDSTPCSRRGASYYNCRPGAHA  108

Query  324  RPY  332
             PY
Sbjct  109  NPY  111



>ref|XP_007159334.1| hypothetical protein PHAVU_002G229400g [Phaseolus vulgaris]
 gb|ESW31328.1| hypothetical protein PHAVU_002G229400g [Phaseolus vulgaris]
Length=108

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 36/65 (55%), Gaps = 1/65 (2%)
 Frame = +3

Query  141  GAASSGIMDFDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHH  317
            G   +G+    D  EM LDSES+RR L  R +Y+SY  L  +Q PCG +G SYY C    
Sbjct  29   GFPGAGMDLVGDDNEMQLDSESNRRTLAGREQYISYGALNANQAPCGNRGNSYYNCQDRG  88

Query  318  PIRPY  332
               PY
Sbjct  89   RANPY  93



>ref|XP_006424193.1| hypothetical protein CICLE_v10030160mg [Citrus clementina]
 gb|ESR37433.1| hypothetical protein CICLE_v10030160mg [Citrus clementina]
 gb|KDO39727.1| hypothetical protein CISIN_1g037899mg [Citrus sinensis]
Length=113

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFC-HSHHPIRPY  332
            D  EM++ +E SRR L+   ++SY  LR + +PC ++G SYY C H   P+ PY
Sbjct  45   DENEMLMPTEESRRQLWGGGFISYGALRANSVPCNRRGTSYYNCNHGGGPVNPY  98



>ref|XP_004505070.1| PREDICTED: protein RALF-like 19-like [Cicer arietinum]
Length=112

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
              +  EM+++SE++RR L  + RY+SY  L+ +Q+PCG++G SYY C       PY
Sbjct  42   IGEENEMLMESETNRRTLEGQQRYISYGSLQANQVPCGRRGQSYYNCQQRGQANPY  97



>emb|CDX99974.1| BnaC09g03270D [Brassica napus]
Length=116

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            + EE  LDSE SRR+L   +Y+SY  +RK+ +PC ++G SYY C       PY
Sbjct  52   EEEEFGLDSEISRRILASKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPY  104



>ref|XP_010313004.1| PREDICTED: rapid alkalinization factor [Solanum lycopersicum]
Length=114

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (57%), Gaps = 1/69 (1%)
 Frame = +3

Query  129  PASVGAASSGIMD-FDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFC  305
            PA  G     I +   + +E  LDSES+RR+L   +Y+SY  L+K+ +PC ++G SYY C
Sbjct  34   PARSGECKGSIAECMAEEDEFALDSESNRRILATKKYISYGALQKNSVPCSRRGASYYNC  93

Query  306  HSHHPIRPY  332
                   PY
Sbjct  94   KPGAQANPY  102



>gb|AAR00326.1| rapid alkalinization factor 2 [Solanum chacoense]
Length=114

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 39/69 (57%), Gaps = 1/69 (1%)
 Frame = +3

Query  129  PASVGAASSGIMD-FDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFC  305
            PA  G     I +   + +E  LDSES+RR+L   +Y+SY  L+K+ +PC ++G SYY C
Sbjct  34   PARSGECKGSIAECMAEEDEFALDSESNRRILATKKYISYGALQKNSVPCSRRGASYYNC  93

Query  306  HSHHPIRPY  332
                   PY
Sbjct  94   KPGAQANPY  102



>ref|XP_006840509.1| hypothetical protein AMTR_s00045p00202280 [Amborella trichopoda]
 gb|ERN02184.1| hypothetical protein AMTR_s00045p00202280 [Amborella trichopoda]
Length=119

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +3

Query  177  AEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             EE  +DSE +RR+L   +Y+SY+ L+K+ +PC KKG SYY C +     PY
Sbjct  53   GEEFAMDSEINRRILATDQYISYNALKKNIVPCSKKGQSYYNCRAGGQANPY  104



>ref|XP_009119598.1| PREDICTED: protein RALF-like 1 [Brassica rapa]
Length=146

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I D    EE  +DSE +RR+L  T+Y+SY  L+++ +PC ++G SYY C +     PY
Sbjct  77   IADCIGTEEEEMDSEINRRILATTKYISYQALKRNSVPCSRRGASYYNCQNGAQANPY  134



>ref|XP_009111745.1| PREDICTED: protein RALF-like 22 [Brassica rapa]
Length=116

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            EE  LDSE SRR+L   +Y+SY  +RK+ +PC ++G SYY C       PY
Sbjct  54   EEFGLDSEISRRILASKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPY  104



>emb|CDY09740.1| BnaC07g33210D [Brassica napus]
Length=111

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +DSE SRR+L  TRY+SY  LR++ +PC ++G SYY C       PY
Sbjct  50   EFEMDSEISRRILATTRYISYGALRRNTVPCSRRGASYYNCRRGAQANPY  99



>ref|XP_009418953.1| PREDICTED: protein RALF-like 33 [Musa acuminata subsp. malaccensis]
Length=117

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = +3

Query  150  SSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRP  329
            S  + +    EE  L SE +RR+L R+ Y+SY+ LR+D +PC ++G SYY C       P
Sbjct  45   SGSVAECVAGEEFELGSEVTRRILARSYYISYAALRRDSVPCSRRGASYYNCRPGARANP  104

Query  330  Y  332
            Y
Sbjct  105  Y  105



>emb|CDY19732.1| BnaA09g03850D [Brassica napus]
Length=116

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            EE  LDSE SRR+L   +Y+SY  +RK+ +PC ++G SYY C       PY
Sbjct  54   EEFGLDSEISRRILASKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPY  104



>ref|XP_008246129.1| PREDICTED: rapid alkalinization factor-like [Prunus mume]
Length=124

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +3

Query  147  ASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
            ++ G++  D+  E+ ++SE SRR+L   RY+SY  LR++ +PC ++G SYY C       
Sbjct  51   SAGGLIAEDEDLELPMESEISRRILATNRYISYGALRRNTVPCSRRGASYYNCRPGAQAN  110

Query  327  PY  332
            PY
Sbjct  111  PY  112



>ref|XP_010105661.1| hypothetical protein L484_010825 [Morus notabilis]
 gb|EXC05642.1| hypothetical protein L484_010825 [Morus notabilis]
Length=119

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            EE  +DSE SRR+L  T+Y+SY  L+++ +PC ++G SYY C +     PY
Sbjct  57   EEFEMDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCKTGAQANPY  107



>ref|XP_008370433.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=120

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +3

Query  141  GAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHP  320
            G+ +   +   D EE  +DSE SRR+L  T+Y+SY  L+++ +PC ++G SYY C     
Sbjct  45   GSIAECALAAGDDEEFDMDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCKPGAQ  104

Query  321  IRPY  332
              PY
Sbjct  105  ANPY  108



>ref|XP_007227502.1| hypothetical protein PRUPE_ppa013419mg [Prunus persica]
 gb|EMJ28701.1| hypothetical protein PRUPE_ppa013419mg [Prunus persica]
Length=124

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = +3

Query  147  ASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
            ++ G++  D+  E+ ++SE SRR+L   RY+SY  LR++ +PC ++G SYY C       
Sbjct  51   SAGGLIAEDEDLELPMESEISRRILATNRYISYGALRRNTVPCSRRGASYYNCRPGAQAN  110

Query  327  PY  332
            PY
Sbjct  111  PY  112



>gb|EPS64947.1| rapid alkalinization factor 2, partial [Genlisea aurea]
Length=101

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 5/67 (7%)
 Frame = +3

Query  132  ASVGAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHS  311
             +VG   +G  +F+     +L SES RR+LF  RY+SY  L++D +PC ++G SYY C  
Sbjct  29   GTVGECLAGGDEFE-----LLRSESERRILFARRYISYGALQRDAVPCSRRGASYYNCRP  83

Query  312  HHPIRPY  332
                 PY
Sbjct  84   GAQANPY  90



>ref|XP_002892134.1| hypothetical protein ARALYDRAFT_470261 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68393.1| hypothetical protein ARALYDRAFT_470261 [Arabidopsis lyrata subsp. 
lyrata]
Length=119

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +   AEE  +DSE +RR+L  T+Y+SY  L+++ +PC ++G SYY C +     PY
Sbjct  51   IAECIGAEEEEMDSEINRRILATTKYISYQSLKRNSVPCSRRGASYYNCRNGAQANPY  108



>ref|NP_567476.1| protein ralf-like 33 [Arabidopsis thaliana]
 sp|Q8L9P8.1|RLF33_ARATH RecName: Full=Protein RALF-like 33; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAM65845.1| RALF precursor [Arabidopsis thaliana]
 gb|ABF59010.1| At4g15800 [Arabidopsis thaliana]
 dbj|BAE99025.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83653.1| protein ralf-like 33 [Arabidopsis thaliana]
Length=116

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            EE  +DSE +RR+L  T+Y+SY  LR++ +PC ++G SYY C       PY
Sbjct  54   EEFEMDSEINRRILATTKYISYGALRRNTVPCSRRGASYYNCRRGAQANPY  104



>ref|XP_010097623.1| hypothetical protein L484_001106 [Morus notabilis]
 gb|EXB69889.1| hypothetical protein L484_001106 [Morus notabilis]
Length=164

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            EE  +DSE SRR+L  T+Y+SY  L+++ +PC ++G SYY C +     PY
Sbjct  57   EEFEMDSEISRRILATTKYISYGALQRNTVPCSRRGASYYNCKTGAQANPY  107



>gb|ABS72341.1| rapid alkalinization factor precursor [Litchi chinensis]
Length=126

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +DSES+RR+L  ++Y+SY  LR++ +PC ++G SYY C +     PY
Sbjct  65   EFEMDSESNRRILATSQYISYGALRRNSVPCSRRGASYYNCQTGAQANPY  114



>ref|XP_008786719.1| PREDICTED: protein RALF-like 33 [Phoenix dactylifera]
Length=119

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +3

Query  144  AASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPI  323
            A    I +    +E  LDSE SRR+L  +RY+SY  LR+D++PC ++G SYY C      
Sbjct  45   ACRGTIAECLAGDEFELDSEISRRILASSRYISYDSLRRDRVPCSRRGASYYNCRPGAHA  104

Query  324  RPY  332
             PY
Sbjct  105  NPY  107



>gb|AFK46281.1| unknown [Lotus japonicus]
Length=110

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +3

Query  180  EEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             EM+LDSE+SRR L  R  Y+SY  L+  Q+PCG++G SYY C       PY
Sbjct  43   NEMLLDSEASRRTLRGRRGYISYGALKAGQVPCGRRGRSYYNCQQRGRANPY  94



>ref|XP_010052296.1| PREDICTED: protein RALF-like 19 [Eucalyptus grandis]
 gb|KCW76229.1| hypothetical protein EUGRSUZ_D00610 [Eucalyptus grandis]
Length=111

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 43/77 (56%), Gaps = 7/77 (9%)
 Frame = +3

Query  123  SDPASVGAASSG--IMDFDDA----EEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGK  281
            S P S G   +G   M   D+     EMMLDSE +RR L  R R++SY+ L+K+ +PC +
Sbjct  20   SSPYSFGFVGAGDLSMSVGDSIGAFNEMMLDSEINRRQLAGRGRHISYNALKKNNVPCSR  79

Query  282  KGPSYYFCHSHHPIRPY  332
            +G SYY C       PY
Sbjct  80   RGQSYYNCKKMKKANPY  96



>ref|XP_007030995.1| Rapid alkalinization factor 1, putative [Theobroma cacao]
 gb|EOY11497.1| Rapid alkalinization factor 1, putative [Theobroma cacao]
Length=118

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +    EE  LDSE SRR+L   +Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  49   IAECLAGEEFQLDSEISRRILATAQYISYGALQRNTVPCSRRGASYYNCQPGAQANPY  106



>gb|KHN15225.1| hypothetical protein glysoja_042499 [Glycine soja]
Length=114

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            EE MLD+E +RRML  TRY+SY  + +  +PC  +G SYY C       PY
Sbjct  52   EEFMLDNEINRRMLASTRYISYCAIHRGSVPCSHRGASYYHCQPGAQANPY  102



>ref|XP_006359396.1| PREDICTED: rapid alkalinization factor-like [Solanum tuberosum]
Length=118

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +3

Query  177  AEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            A E  +DSES+RR+L  T Y+SY  L+ + +PC ++G SYY C +     PY
Sbjct  55   AGEFEMDSESNRRILATTDYISYGALQSNSVPCSRRGASYYNCKTGAEANPY  106



>ref|XP_003550267.1| PREDICTED: rapid alkalinization factor 23-like [Glycine max]
Length=120

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +3

Query  147  ASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
            A   ++  DD  E +++SES+RR+L    Y+SY  LR++ +PC ++G SYY C       
Sbjct  47   AECSLLAGDDDTEFLMESESNRRILAGRSYISYGALRRNTVPCSRRGASYYNCRPGAQAN  106

Query  327  PY  332
            PY
Sbjct  107  PY  108



>gb|AAS13437.1| rapid alkalinization factor preproprotein [Nicotiana attenuata]
Length=115

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +3

Query  129  PASVGAASSGIMDFDDAEE--MMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYF  302
            PA  G   +G +    AEE    LDSES+RR+L   +Y+SY  L+K+ +PC ++G SYY 
Sbjct  34   PARSGRGCNGSIGECMAEEDEFELDSESNRRILATKKYISYGALQKNSVPCSRRGASYYN  93

Query  303  CHSHHPIRPY  332
            C       PY
Sbjct  94   CKPGAQANPY  103



>ref|XP_006344656.1| PREDICTED: rapid alkalinization factor-like [Solanum tuberosum]
Length=114

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = +3

Query  129  PASVGAASSGIMD-FDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFC  305
            PA  G     I +   + +E  LDSES+RR+L    Y+SY  L+K+ +PC ++G SYY C
Sbjct  34   PARSGECKGSIAECMAEEDEFALDSESNRRILATKNYISYGALQKNSVPCSRRGASYYNC  93

Query  306  HSHHPIRPY  332
                   PY
Sbjct  94   KPGAQANPY  102



>gb|KFK31007.1| hypothetical protein AALP_AA6G056400 [Arabis alpina]
Length=110

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G +  DD  E ++DSE++RR L  R  Y+SY  L+K+ +PC ++G SYY C+      PY
Sbjct  36   GCIGDDDGLESLMDSETNRRQLAARRTYISYGALKKNNVPCSRRGRSYYDCNKRKRANPY  95



>gb|EPS59172.1| rapid alkalinization factor 2, partial [Genlisea aurea]
Length=106

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +E+ +DSE +RR+L  TRY+SY  L+   +PC ++G SYY C    P  PY
Sbjct  45   DEIRMDSEVNRRILATTRYISYGALQAGIVPCPRRGASYYNCRPGAPANPY  95



>ref|XP_010504445.1| PREDICTED: rapid alkalinization factor 23-like [Camelina sativa]
Length=130

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +DSE SRRML   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  69   EFEMDSEISRRMLAARRYISYGALRRNTVPCSRRGASYYNCRRGAQANPY  118



>gb|KHN16254.1| hypothetical protein glysoja_046571 [Glycine soja]
Length=111

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            D  EM+LDSE++RR L  R +Y+SY  L  + +PCG +G SYY C       PY
Sbjct  43   DDNEMLLDSETNRRTLAGRQQYISYGALNANNVPCGNRGRSYYNCQQRGRANPY  96



>ref|XP_010314082.1| PREDICTED: protein RALF-like 22 [Solanum lycopersicum]
Length=121

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 1/59 (2%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G M F+D EEMM+ SES+RR L    ++ Y  LR + IPC ++G SYY C+    I PY
Sbjct  49   GDMLFED-EEMMMPSESARRTLDERDHIGYRALRANNIPCDQRGASYYECNRMSKINPY  106



>ref|XP_010487517.1| PREDICTED: rapid alkalinization factor 23-like [Camelina sativa]
 ref|XP_010487519.1| PREDICTED: rapid alkalinization factor 23-like [Camelina sativa]
Length=129

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            F    E  +DSE +RRML   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  63   FYGGAEFEMDSEINRRMLAARRYISYGALRRNTVPCSRRGASYYNCRRGAQANPY  117



>ref|XP_002516916.1| RALFL33, putative [Ricinus communis]
 gb|EEF45530.1| RALFL33, putative [Ricinus communis]
Length=117

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +3

Query  141  GAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHP  320
            G+ +  +M  +D  E  +D+E +RR+L   +Y+SY  LR++ +PC ++G SYY C     
Sbjct  42   GSIAECLMSGEDDLEFAMDTEINRRILATNKYISYGALRRNTVPCSRRGASYYNCRPGAQ  101

Query  321  IRPY  332
              PY
Sbjct  102  ANPY  105



>ref|XP_009136714.1| PREDICTED: protein RALF-like 33 [Brassica rapa]
 emb|CDX90567.1| BnaA03g42140D [Brassica napus]
Length=111

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +DSE +RR+L  TRY+SY  LR++ +PC ++G SYY C       PY
Sbjct  50   EFEMDSEINRRILATTRYISYGALRRNTVPCSRRGASYYNCRRGAQANPY  99



>ref|XP_010465683.1| PREDICTED: rapid alkalinization factor 23-like [Camelina sativa]
Length=128

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 32/55 (58%), Gaps = 0/55 (0%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            F    E  +DSE +RRML   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  62   FYGGAEFEMDSEINRRMLAARRYISYGALRRNTVPCSRRGASYYNCRRGAQANPY  116



>emb|CAN78122.1| hypothetical protein VITISV_041547 [Vitis vinifera]
Length=65

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +3

Query  186  MMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            MM+DSE++RR L  R RY+SY  LR++Q+PC ++G SYY C       PY
Sbjct  1    MMMDSETNRRSLAQRRRYISYGALRRNQVPCNRRGRSYYNCRRGGRANPY  50



>ref|XP_010326583.1| PREDICTED: rapid alkalinization factor [Solanum lycopersicum]
Length=118

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +3

Query  177  AEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            A E  +DSES+RR+L  T Y+SY  L+ + +PC ++G SYY C +     PY
Sbjct  55   AGEFEMDSESNRRILATTDYISYGALQSNSVPCSRRGASYYNCKTGAEANPY  106



>ref|XP_010469431.1| PREDICTED: protein RALF-like 19 [Camelina sativa]
Length=110

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G +  DD  E ++DSE++RR L  R  Y+SY  L+K+ +PC ++G SYY C       PY
Sbjct  36   GCIGEDDELESLMDSETNRRQLAARRSYISYGALKKNNVPCSRRGRSYYDCKKRKKANPY  95



>ref|XP_010043059.1| PREDICTED: rapid alkalinization factor [Eucalyptus grandis]
 gb|KCW85083.1| hypothetical protein EUGRSUZ_B01916 [Eucalyptus grandis]
Length=117

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (64%), Gaps = 0/55 (0%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
              + EE  +DSES+RR+L  ++Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  51   MSEEEEFAMDSESNRRILASSKYISYGALQRNSVPCSRRGASYYNCKPGASSNPY  105



>ref|XP_011036862.1| PREDICTED: protein RALF-like 33 [Populus euphratica]
Length=120

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +D EE  +D+E +RR+L  ++Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  55   EDGEEFEMDTEINRRILATSKYVSYGALQRNNVPCSRRGASYYNCRRGAQANPY  108



>ref|XP_010522782.1| PREDICTED: protein RALF-like 1 [Tarenaya hassleriana]
Length=111

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = +3

Query  135  SVGAASSGIMDFDDAE---EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFC  305
            S+G A++G      AE   E  +DSE +RR+L  T Y+SY  L+++ IPC ++G SYY C
Sbjct  31   SLGWATAGGCHGSTAECDGEFEMDSEINRRILATTDYISYQALQRNSIPCSRRGASYYNC  90

Query  306  HSHHPIRPY  332
             +     PY
Sbjct  91   RAGAQANPY  99



>ref|XP_009381039.1| PREDICTED: rapid alkalinization factor-like [Musa acuminata subsp. 
malaccensis]
Length=115

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 37/68 (54%), Gaps = 0/68 (0%)
 Frame = +3

Query  129  PASVGAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCH  308
            P+S+      I +    EE  L SE+ RR+L  + Y+SY  L++D +PC ++G SYY C 
Sbjct  35   PSSLSGCRGTIAECLAGEEFDLGSEAGRRILATSSYISYGALKRDTVPCSRRGASYYNCR  94

Query  309  SHHPIRPY  332
                  PY
Sbjct  95   PGAQANPY  102



>gb|KHN24772.1| hypothetical protein glysoja_045891 [Glycine soja]
Length=124

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (58%), Gaps = 9/62 (15%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLF---------RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
            D  E ++ SES+RR L          R RY+SY+ LR +Q+PCG++G SYY C+      
Sbjct  48   DDNEFLMSSESTRRSLMHGHPGKGRGRARYISYAALRSNQVPCGRRGRSYYNCNQRGRAN  107

Query  327  PY  332
            PY
Sbjct  108  PY  109



>ref|XP_004495709.1| PREDICTED: rapid alkalinization factor-like [Cicer arietinum]
Length=120

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = +3

Query  129  PASVGAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCH  308
            P +       I +  + +E  LDSE +RR+L  T+Y+SY  L+++ +PC ++G SYY C 
Sbjct  41   PLTKAVCEGSIAECLEDDEFELDSEINRRILANTKYISYGALQRNTVPCSRRGASYYNCR  100

Query  309  SHHPIRPY  332
                  PY
Sbjct  101  PGAKANPY  108



>ref|XP_010434917.1| PREDICTED: protein RALF-like 33 [Camelina sativa]
Length=119

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             +EE  +DSE +RR+L  T+Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  55   SSEEFEMDSEINRRILATTKYISYGALKRNTVPCSRRGASYYNCRRGAQANPY  107



>ref|XP_002528254.1| RALFL33, putative [Ricinus communis]
 gb|EEF34139.1| RALFL33, putative [Ricinus communis]
Length=112

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 5/66 (8%)
 Frame = +3

Query  150  SSGIMDFDDA--EEMMLDSESSRRMLFR-TRYLSYSVLRKDQIPCGKKGPSYYFCH--SH  314
            S+G +  D+   EE+MLDSE+SRR+L    RYLSY+ L+ +  PC K+G SYY+C   + 
Sbjct  29   STGRLVGDEVGEEEVMLDSEASRRVLASGKRYLSYAALKANMTPCMKRGRSYYYCKQLAR  88

Query  315  HPIRPY  332
              + PY
Sbjct  89   KKVNPY  94



>ref|XP_004143090.1| PREDICTED: protein RALF-like 33-like [Cucumis sativus]
 ref|XP_004163235.1| PREDICTED: protein RALF-like 33-like [Cucumis sativus]
 gb|KGN47180.1| hypothetical protein Csa_6G194150 [Cucumis sativus]
Length=118

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +DSE +RR+L  TRY+SY  LR++ +PC ++G SYY C       PY
Sbjct  57   EFQMDSEINRRILATTRYISYGALRRNNVPCSRRGASYYNCRPGAQANPY  106



>gb|ABK25798.1| unknown [Picea sitchensis]
 gb|ACN41181.1| unknown [Picea sitchensis]
Length=121

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            + +EM +DSE +RR L    Y+SY+ LR + +PC K+G SYY C S     PY
Sbjct  54   EEDEMQMDSEINRRFLAGRTYISYAALRANSVPCSKRGSSYYNCRSTSQANPY  106



>gb|KFK39677.1| protein ralf-like 24 [Arabis alpina]
Length=112

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +3

Query  180  EEMMLDSESSRR-MLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHH  317
            EEMM+ SE SRR M+ R +Y+SY+ LR+D +PC K G SYY C S  
Sbjct  43   EEMMMPSEISRRVMMMRKQYISYATLRRDMVPCQKPGASYYACRSGQ  89



>ref|XP_008454184.1| PREDICTED: protein RALF-like 33 [Cucumis melo]
Length=121

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +    EE   DSE +RR+L  ++Y+SY  LR++ +PC ++G SYY C       PY
Sbjct  52   IAECFGGEEFEFDSEINRRILATSQYISYGALRRNNVPCSRRGASYYNCQPGAQANPY  109



>ref|XP_009102923.1| PREDICTED: protein RALF-like 4 [Brassica rapa]
Length=111

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +3

Query  150  SSGIMDFDDAEEMMLDSESSRRMLFR-TRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
              G +  DD  E ++DSE++RR L R  RY+ Y  L+K+ +PC ++G SYY C       
Sbjct  35   GQGCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRRNN  94

Query  327  PY  332
            PY
Sbjct  95   PY  96



>gb|EYU42176.1| hypothetical protein MIMGU_mgv1a016421mg [Erythranthe guttata]
Length=122

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            ++ EE  +DSES+RR+L   R++SY  L  D +PC ++G SYY C       PY
Sbjct  57   NEDEEFEMDSESNRRILATRRFISYGALESDSVPCSRRGASYYNCRPGAQANPY  110



>ref|XP_006410523.1| hypothetical protein EUTSA_v10017458mg [Eutrema salsugineum]
 gb|ESQ51976.1| hypothetical protein EUTSA_v10017458mg [Eutrema salsugineum]
Length=110

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G +  DD  E ++DSE++RR L  R  Y+SY  L+K+ +PC ++G SYY C       PY
Sbjct  36   GCIGDDDGLESLMDSETNRRQLAARRSYISYGALKKNNVPCSRRGRSYYDCKKRKRANPY  95



>ref|XP_009113682.1| PREDICTED: protein RALF-like 4 [Brassica rapa]
 emb|CDY46613.1| BnaA09g27400D [Brassica napus]
 emb|CDY46282.1| BnaC05g21740D [Brassica napus]
Length=111

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +3

Query  150  SSGIMDFDDAEEMMLDSESSRRMLFR-TRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
              G +  DD  E ++DSE++RR L R  RY+ Y  L+K+ +PC ++G SYY C       
Sbjct  35   GQGCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRRNN  94

Query  327  PY  332
            PY
Sbjct  95   PY  96



>ref|XP_006415678.1| hypothetical protein EUTSA_v10009158mg [Eutrema salsugineum]
 gb|ESQ34031.1| hypothetical protein EUTSA_v10009158mg [Eutrema salsugineum]
Length=110

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +3

Query  150  SSGIMDFDDAEEMMLDSESSRRMLFR-TRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
              G +  DD  E ++DSE++RR L R  RY+ Y  L+K+ +PC ++G SYY C       
Sbjct  34   GQGCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRRNN  93

Query  327  PY  332
            PY
Sbjct  94   PY  95



>emb|CDX92081.1| BnaA05g23260D [Brassica napus]
Length=127

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +DSE +RRML   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  66   EFEMDSEINRRMLANRRYISYGALRRNSVPCSRRGASYYNCRRGAQANPY  115



>gb|KFK42648.1| rapid alkalinization factor 1 [Arabis alpina]
Length=123

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (58%), Gaps = 4/71 (6%)
 Frame = +3

Query  132  ASVGAASSG----IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYY  299
            A  G   SG    I +   +EE  +DSE +RR+L  T+Y+SY  L+++ +PC ++G SYY
Sbjct  41   AKTGVHGSGCHGSIAECIGSEEEEMDSEINRRILATTKYISYQSLKRNSVPCSRRGASYY  100

Query  300  FCHSHHPIRPY  332
             C +     PY
Sbjct  101  NCQNGAQANPY  111



>ref|XP_010509833.1| PREDICTED: protein RALF-like 19 [Camelina sativa]
Length=110

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G +  DD  E ++DSE++RR L  R  Y+SY  L+K+ +PC ++G SYY C       PY
Sbjct  36   GCIGEDDELESLMDSEANRRQLAARRSYISYGALKKNNVPCSRRGRSYYDCKKRKRANPY  95



>ref|XP_006421017.1| hypothetical protein CICLE_v10006214mg [Citrus clementina]
 gb|ESR34257.1| hypothetical protein CICLE_v10006214mg [Citrus clementina]
Length=125

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHP  320
            F DAE  +++SESSRR+L  + +Y+SY  LR+D +PC K G SYY CHS   
Sbjct  57   FTDAE--LMESESSRRVLVMQKKYISYDTLRRDMVPCDKPGASYYECHSGQA  106



>ref|XP_003619621.1| Rapid alkalinization factor [Medicago truncatula]
 gb|AES75839.1| RALF [Medicago truncatula]
Length=105

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 41/79 (52%), Gaps = 17/79 (22%)
 Frame = +3

Query  132  ASVGAASSGIMDFD------------DAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPC  275
            A V A +S + DF             +  EM++DSES+RR     RY+SY  L  D IPC
Sbjct  18   AMVSAKASKVHDFSFPSPVLVGDLIREENEMLMDSESNRR-----RYISYDALLADSIPC  72

Query  276  GKKGPSYYFCHSHHPIRPY  332
            G KG SYY C+    + PY
Sbjct  73   GLKGQSYYDCNHRDQVNPY  91



>gb|KDO50663.1| hypothetical protein CISIN_1g033245mg [Citrus sinensis]
Length=123

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHP  320
            F DAE  +++SESSRR+L  + +Y+SY  LR+D +PC K G SYY CHS   
Sbjct  55   FTDAE--LMESESSRRVLVMQKKYISYDTLRRDMVPCDKPGASYYECHSGQA  104



>ref|XP_004172589.1| PREDICTED: protein RALF-like 33-like [Cucumis sativus]
 gb|KGN60955.1| hypothetical protein Csa_2G031140 [Cucumis sativus]
Length=121

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +    EE   DSE +RR+L  ++Y+SY  LR++ +PC ++G SYY C       PY
Sbjct  52   IAECFGGEEFEFDSEINRRILATSQYISYGALRRNNVPCSRRGASYYNCQPGAQANPY  109



>ref|XP_006489845.1| PREDICTED: protein RALF-like 31-like [Citrus sinensis]
Length=123

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHP  320
            F DAE  +++SESSRR+L  + +Y+SY  LR+D +PC K G SYY CHS   
Sbjct  55   FTDAE--LMESESSRRVLVMQKKYISYDTLRRDMVPCDKPGASYYECHSGQA  104



>ref|XP_009384171.1| PREDICTED: protein RALF-like 33 [Musa acuminata subsp. malaccensis]
Length=118

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            + +    +E  L SE +RR+L  +RY+SY+ LR+D +PC ++G SYY C       PY
Sbjct  49   VAECVAGDEFDLGSEVTRRILATSRYISYNALRRDTVPCSRRGASYYNCRPGAQANPY  106



>gb|ABK22709.1| unknown [Picea sitchensis]
Length=122

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 1/55 (2%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            F+D EEM +DSE +RR L    Y+SY  LR + +PC ++G SYY C S     PY
Sbjct  54   FED-EEMQMDSEINRRFLAGRTYVSYGALRSNSVPCSRRGSSYYNCGSTSQANPY  107



>ref|XP_002283709.1| PREDICTED: protein RALF-like 33 [Vitis vinifera]
 emb|CAN61144.1| hypothetical protein VITISV_043554 [Vitis vinifera]
Length=124

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +3

Query  144  AASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPI  323
            A + G  +F    E  +DSE +RR+L  ++Y+SY  L+++ +PC ++G SYY C      
Sbjct  50   ALAGGEDEFGLTSEFAMDSEINRRILATSKYISYGALQRNSVPCSRRGASYYNCQPGAQA  109

Query  324  RPY  332
             PY
Sbjct  110  NPY  112



>gb|KHN16104.1| hypothetical protein glysoja_012080 [Glycine soja]
Length=103

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +    EE  LDSE +RR+L   +Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  28   IAECLGGEEYELDSEINRRILATNKYISYGALQRNTVPCSRRGASYYNCQPGAQANPY  85



>ref|XP_006306243.1| hypothetical protein CARUB_v10012072mg [Capsella rubella]
 gb|EOA39141.1| hypothetical protein CARUB_v10012072mg [Capsella rubella]
Length=110

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +3

Query  150  SSGIMDFDDAEEMMLDSESSRRMLFR-TRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
              G +  DD  E ++DSE++RR L R  RY+ Y  L+K+ +PC ++G SYY C       
Sbjct  34   GQGCIGEDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRKRNN  93

Query  327  PY  332
            PY
Sbjct  94   PY  95



>ref|XP_007144948.1| hypothetical protein PHAVU_007G197000g [Phaseolus vulgaris]
 gb|ESW16942.1| hypothetical protein PHAVU_007G197000g [Phaseolus vulgaris]
Length=116

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +    EE  LDSE +RR+L   +Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  47   IAECLGGEEYELDSEINRRILATNKYISYGALQRNTVPCSRRGASYYNCQPGAQANPY  104



>ref|XP_010413812.1| PREDICTED: protein RALF-like 19 [Camelina sativa]
Length=110

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G +  DD  E ++DSE++RR L  R  Y+SY  L+K+ +PC ++G SYY C       PY
Sbjct  36   GCIGEDDELESLMDSETNRRQLAARRSYISYDALKKNNVPCSRRGRSYYDCKKRKRANPY  95



>emb|CDX94598.1| BnaC07g10600D [Brassica napus]
Length=111

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +3

Query  150  SSGIMDFDDAEEMMLDSESSRRMLFR-TRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
              G +  DD  E ++DSE++RR L R  RY+ Y  L+K+ +PC ++G SYY C       
Sbjct  35   GQGCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRRNN  94

Query  327  PY  332
            PY
Sbjct  95   PY  96



>ref|XP_003601688.1| Rapid alkalinization factor preproprotein [Medicago truncatula]
 gb|AES71939.1| RALF [Medicago truncatula]
Length=135

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
              D E MM+DSES+RR+L  + +Y+SY  L++D +PC + G SYY CH      PY
Sbjct  62   LTDPEMMMMDSESNRRVLAMQKKYISYDTLKRDMVPCDRPGASYYNCHRRQA-NPY  116



>ref|XP_010259629.1| PREDICTED: rapid alkalinization factor [Nelumbo nucifera]
Length=116

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = +3

Query  162  MDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            MD DD  E  +DSE SRR+L   +Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  50   MDADD--EFGMDSEISRRILATNQYISYGALQRNTVPCSRRGASYYNCKPGAQANPY  104



>ref|XP_003529566.1| PREDICTED: rapid alkalinization factor 23-like [Glycine max]
Length=118

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = +3

Query  147  ASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
            A   ++  DDAE +M +SES+RR+L    Y+SY  LR++ +PC ++G SYY C       
Sbjct  46   AECSLLAGDDAEFLM-ESESNRRILAGRSYISYGALRRNTVPCSRRGASYYNCRPGAQAN  104

Query  327  PY  332
            PY
Sbjct  105  PY  106



>ref|NP_001235167.1| uncharacterized protein LOC100306190 precursor [Glycine max]
 gb|ACU14252.1| unknown [Glycine max]
Length=124

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 35/62 (56%), Gaps = 9/62 (15%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLF---------RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
            D  E +  SES+RR L          R RY+SY+ LR +Q+PCG++G SYY C+      
Sbjct  48   DDNEFLTSSESTRRSLMHGHPGKGRGRARYISYAALRSNQVPCGRRGRSYYNCNQRGRAN  107

Query  327  PY  332
            PY
Sbjct  108  PY  109



>ref|XP_009135493.1| PREDICTED: rapid alkalinization factor 23-like [Brassica rapa]
 emb|CDX82397.1| BnaA03g34240D [Brassica napus]
Length=133

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +DSE +RRML   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  72   EFEMDSEINRRMLATRRYISYGALRRNTVPCSRRGASYYNCRRGAQANPY  121



>gb|KFK39006.1| hypothetical protein AALP_AA3G188700 [Arabis alpina]
Length=124

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +3

Query  177  AEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             +E  +DSE +RR+L   RY+SY  LR++ IPC ++G SYY C       PY
Sbjct  60   GDEFEMDSEINRRILATQRYISYGALRRNTIPCSRRGASYYNCRRGAQANPY  111



>emb|CDY35727.1| BnaC03g58480D [Brassica napus]
Length=111

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +3

Query  150  SSGIMDFDDAEEMMLDSESSRRMLFR-TRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
              G +  DD  E ++DSE++RR L R  RY+ Y  L+K+ +PC ++G SYY C       
Sbjct  35   GQGCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRRNN  94

Query  327  PY  332
            PY
Sbjct  95   PY  96



>gb|KFK32572.1| hypothetical protein AALP_AA6G260700 [Arabis alpina]
Length=124

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +3

Query  177  AEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             +E  +DSE +RR+L   RY+SY  LR++ IPC ++G SYY C       PY
Sbjct  60   GDEFEMDSEINRRILATQRYISYGALRRNTIPCSRRGASYYNCRRGAQANPY  111



>ref|XP_010538170.1| PREDICTED: protein RALF-like 19 [Tarenaya hassleriana]
Length=110

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTR-YLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I D DD E +M DSE++RR L + R Y+SY  L+K+ +PC ++G SYY C       PY
Sbjct  38   IGDEDDLESLM-DSETNRRQLAQGRRYISYGALKKNNVPCNRRGRSYYDCTRRKRANPY  95



>ref|XP_009109739.1| PREDICTED: protein RALF-like 4 [Brassica rapa]
 emb|CDX90140.1| BnaA08g18440D [Brassica napus]
Length=111

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +3

Query  150  SSGIMDFDDAEEMMLDSESSRRMLFR-TRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
              G +  DD  E ++DSE++RR L R  RY+ Y  L+K+ +PC ++G SYY C       
Sbjct  35   GQGCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRRNN  94

Query  327  PY  332
            PY
Sbjct  95   PY  96



>gb|KDP39325.1| hypothetical protein JCGZ_01082 [Jatropha curcas]
Length=110

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHS  311
             D  EE  ++SE SRR+L   +Y+SY  L++D +PC K G SYY CH+
Sbjct  44   VDWLEEAEMESEISRRVLLMQKYISYETLKRDMVPCAKPGASYYDCHA  91



>emb|CDX75886.1| BnaC03g39690D [Brassica napus]
Length=133

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +DSE +RRML   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  72   EFEMDSEINRRMLATRRYISYGALRRNTVPCSRRGASYYNCRRGAQANPY  121



>gb|KDP38641.1| hypothetical protein JCGZ_03994 [Jatropha curcas]
Length=114

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 45/77 (58%), Gaps = 7/77 (9%)
 Frame = +3

Query  123  SDPASVGAASSGIM---DFDDAEEMMLDSESSRRMLFRTR----YLSYSVLRKDQIPCGK  281
            ++PA  G+ S+  +   + ++ EEMM+DSE++ R+L   R    +LSY VL+ +  PC K
Sbjct  23   AEPAVNGSNSTRKLVGDEINEDEEMMVDSEATHRLLAGRRKFKKFLSYDVLKANATPCKK  82

Query  282  KGPSYYFCHSHHPIRPY  332
            +G SYY C       PY
Sbjct  83   RGNSYYGCRVKTKANPY  99



>gb|KFK44698.1| hypothetical protein AALP_AA1G291600 [Arabis alpina]
Length=110

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLFR-TRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G +  DD  E ++DSE++RR L R  RY+ Y  L+K+ +PC ++G SYY C       PY
Sbjct  36   GCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRRNNPY  95



>ref|XP_003536069.1| PREDICTED: protein RALF-like 1-like [Glycine max]
Length=117

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +    EE  LDSE +RR+L   +Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  48   IAECLGGEEYELDSEINRRILATNKYISYGALQRNTVPCSRRGASYYNCRPGAQANPY  105



>emb|CDY43109.1| BnaC05g36680D [Brassica napus]
Length=127

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +DSE +RRML   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  66   EFEMDSEINRRMLANRRYISYGALRRNSVPCSRRGASYYNCRRGAHANPY  115



>gb|EYU46690.1| hypothetical protein MIMGU_mgv1a016538mg [Erythranthe guttata]
Length=117

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            + A E  LDSES+RR+L  + Y+SY  L+ + +PC ++G SYY C       PY
Sbjct  52   EGAGEFELDSESNRRILATSNYISYGALQANSVPCSRRGASYYNCRPGAQANPY  105



>ref|XP_010499341.1| PREDICTED: protein RALF-like 4 [Camelina sativa]
 ref|XP_010460611.1| PREDICTED: protein RALF-like 4 [Camelina sativa]
Length=110

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +3

Query  150  SSGIMDFDDAEEMMLDSESSRRMLFR-TRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
              G +  DD  E ++DSE++RR L R  RY+ Y  L+K+ +PC ++G SYY C       
Sbjct  34   GQGCIGEDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCSRRGRSYYDCKKRRRNN  93

Query  327  PY  332
            PY
Sbjct  94   PY  95



>ref|NP_174148.1| protein ralf-like 4 [Arabidopsis thaliana]
 ref|XP_002890767.1| hypothetical protein ARALYDRAFT_473036 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q9FZA0.1|RLF4_ARATH RecName: Full=Protein RALF-like 4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF98428.1|AC021044_7 Hypothetical protein [Arabidopsis thaliana]
 gb|AAO64155.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00491.1| hypothetical protein [Arabidopsis thaliana]
 gb|EFH67026.1| hypothetical protein ARALYDRAFT_473036 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE30939.1| protein ralf-like 4 [Arabidopsis thaliana]
Length=110

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +3

Query  150  SSGIMDFDDAEEMMLDSESSRRMLFR-TRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIR  326
              G +  DD  E ++DSE++RR L R  RY+ Y  L+K+ +PC ++G SYY C       
Sbjct  34   GQGCIGEDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCSRRGRSYYDCKKRRRNN  93

Query  327  PY  332
            PY
Sbjct  94   PY  95



>ref|XP_004229189.1| PREDICTED: rapid alkalinization factor-like [Solanum lycopersicum]
Length=135

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 9/77 (12%)
 Frame = +3

Query  129  PASVGAASSGIMDF--------DDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGK  281
            P ++ ++SS I D         +D  E  ++SESSRRML +R RY+SY  L  +++PC +
Sbjct  47   PMTLSSSSSPICDGSIGDCLAEEDENEFGMESESSRRMLAYRRRYISYGALSSNRVPCSR  106

Query  282  KGPSYYFCHSHHPIRPY  332
            +G SYY C       PY
Sbjct  107  RGASYYNCRPGAQANPY  123



>gb|ACN40381.1| unknown [Picea sitchensis]
Length=121

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            + +EM +DSE +RR L    Y+SY+ LR + +PC ++G SYY C S     PY
Sbjct  54   EEDEMQMDSEINRRFLAGRTYISYAALRANSVPCSRRGSSYYNCRSTSQANPY  106



>ref|XP_009604381.1| PREDICTED: rapid alkalinization factor-like [Nicotiana tomentosiformis]
Length=117

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +3

Query  177  AEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            A E  +DSES+RR+L    Y+SY  L+++ +PC ++G SYY C +     PY
Sbjct  54   AGEFEMDSESNRRILATDDYISYGALQRNTVPCSRRGASYYNCQTGAEANPY  105



>ref|XP_004295623.1| PREDICTED: protein RALF-like 19-like [Fragaria vesca subsp. vesca]
Length=117

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 2/48 (4%)
 Frame = +3

Query  180  EEMMLDSESSRRMLF--RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHH  317
             EM+LDSE  RR L     RY+SY  L+K+++PCG+ G SYY C+  +
Sbjct  49   NEMLLDSEVGRRQLMANNVRYISYGALKKNKVPCGQPGASYYNCNRQN  96



>ref|XP_009376626.1| PREDICTED: protein RALF-like 33 [Pyrus x bretschneideri]
Length=120

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +3

Query  123  SDPASVGAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYF  302
            S P     A   +   DD E  M DSE SRR+L  T+Y+SY  L+++ +PC ++G SYY 
Sbjct  40   SAPCKGSIAECALAAGDDGEFDM-DSEISRRILATTKYISYGALQRNTVPCSRRGASYYN  98

Query  303  CHSHHPIRPY  332
            C       PY
Sbjct  99   CKPGAQANPY  108



>ref|XP_010931638.1| PREDICTED: rapid alkalinization factor-like [Elaeis guineensis]
Length=115

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +    EE  L SE +RR+L  + Y+SY+ L++D +PC ++G SYY C       PY
Sbjct  46   IAECLGGEEFDLSSEVARRILADSNYVSYNALKQDSVPCSRRGASYYNCQPGAEANPY  103



>ref|XP_010675511.1| PREDICTED: protein RALF-like 19 [Beta vulgaris subsp. vulgaris]
 ref|XP_010696047.1| PREDICTED: protein RALF-like 19 [Beta vulgaris subsp. vulgaris]
Length=128

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            D EE  +D + +RR L  R RY+SY  L+K+ +PC ++G SYY C S+    PY
Sbjct  60   DEEEEAMDVDDARRQLAGRRRYISYDALKKNNVPCNRRGQSYYNCRSNARANPY  113



>ref|XP_009342123.1| PREDICTED: protein RALF-like 33 [Pyrus x bretschneideri]
 ref|XP_009342133.1| PREDICTED: protein RALF-like 33 [Pyrus x bretschneideri]
Length=113

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +3

Query  129  PASVGAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCH  308
            P   G+ +  + D DD  E  +DSE SRR+L  ++Y+SY  L+++ +PC  +G SYY C 
Sbjct  36   PRCEGSVAECMDDHDD--EFGMDSEISRRILATSQYISYGALQRNTVPCSHRGASYYNCK  93

Query  309  SHHPIRPY  332
            S     PY
Sbjct  94   SGAQSNPY  101



>ref|XP_011069491.1| PREDICTED: protein RALF-like 24 [Sesamum indicum]
Length=131

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +3

Query  177  AEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHS  311
             EE M+DSES+RR+LF + RY+SY  LR+D +PC + G SYY C  
Sbjct  65   VEEEMMDSESNRRVLFMQKRYISYDTLRRDLVPCDRPGASYYNCKG  110



>ref|XP_009775621.1| PREDICTED: rapid alkalinization factor-like [Nicotiana sylvestris]
Length=116

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +3

Query  177  AEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            A E  +DSES+RR+L    Y+SY  L+++ +PC ++G SYY C +     PY
Sbjct  53   AGEFEMDSESNRRILATDDYISYGALQRNTVPCSRRGASYYNCQTGAEANPY  104



>gb|KHN20242.1| hypothetical protein glysoja_023805 [Glycine soja]
Length=81

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I D    EE  LDSE +RR+L   +Y+SY  L+++  PC ++G SYY C       PY
Sbjct  12   IADCLGGEEYELDSEINRRILATNKYISYVALQRNTAPCSRRGASYYNCRPGAQANPY  69



>ref|XP_009781864.1| PREDICTED: rapid alkalinization factor-like [Nicotiana sylvestris]
Length=128

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = +3

Query  114  TMYSDPASVGAASSGIMDFDDA--EEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKK  284
            +M S  +S+   S G +  ++   EE  ++SES+RR+L +R RY+SY  L ++++PC ++
Sbjct  41   SMTSSASSIYEGSIGELLAENGSDEEFSMESESTRRILAYRRRYISYGALSRNRVPCSRR  100

Query  285  GPSYYFCHSHHPIRPY  332
            G SYY C       PY
Sbjct  101  GASYYNCRPGAQANPY  116



>ref|XP_011033568.1| PREDICTED: protein RALF-like 1 [Populus euphratica]
Length=115

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +E  +DSE +RR+L  + Y+SY  L KD +PC ++G SYY C +     PY
Sbjct  53   DEFEMDSEINRRILATSDYISYDALEKDNVPCSQRGASYYNCKTGAEANPY  103



>ref|NP_001241351.1| uncharacterized protein LOC100801740 precursor [Glycine max]
 gb|ACU23956.1| unknown [Glycine max]
 gb|KHN08513.1| hypothetical protein glysoja_014278 [Glycine soja]
Length=123

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 42/81 (52%), Gaps = 19/81 (23%)
 Frame = +3

Query  147  ASSGIMDFD------------DAEEMMLDSESSRRMLF-------RTRYLSYSVLRKDQI  269
            AS+ I +FD            D  E ++ SES+ R L        R RY+SY+ LR +QI
Sbjct  28   ASTTIEEFDSIISNGDADLIVDDNEFLMSSESTPRSLMHGHPGKGRARYISYAALRSNQI  87

Query  270  PCGKKGPSYYFCHSHHPIRPY  332
            PCG++G SYY C+      PY
Sbjct  88   PCGRRGRSYYNCNERGRANPY  108



>ref|NP_001237097.1| uncharacterized protein LOC100306584 precursor [Glycine max]
 gb|ACU14827.1| unknown [Glycine max]
Length=111

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            D  EM+LDS+++RR L  R +Y+SY  L  + +PCG +G SYY C       PY
Sbjct  43   DDNEMLLDSKTNRRTLAGRRQYISYGALNANNVPCGNRGRSYYNCQQRGRANPY  96



>ref|XP_007035581.1| Rapid alkalinization factor 1, putative [Theobroma cacao]
 gb|EOY06507.1| Rapid alkalinization factor 1, putative [Theobroma cacao]
Length=128

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 2/56 (4%)
 Frame = +3

Query  165  DFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            DFD   E  + SE  RR+L  TRY+SY  LR++ +PC ++G SYY C       PY
Sbjct  63   DFD--AEFAMGSEIYRRILATTRYISYGALRRNTVPCSRRGASYYNCQPGAQANPY  116



>ref|XP_006406825.1| hypothetical protein EUTSA_v10021739mg [Eutrema salsugineum]
 gb|ESQ48278.1| hypothetical protein EUTSA_v10021739mg [Eutrema salsugineum]
Length=136

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +DSE +RR+L   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  75   EFEMDSEINRRILANRRYISYGALRRNSVPCSRRGASYYNCRRGAQANPY  124



>ref|XP_009778264.1| PREDICTED: rapid alkalinization factor [Nicotiana sylvestris]
Length=115

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  192  LDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            LDSES+RR+L   +Y+SY  L+K+ +PC ++G SYY C       PY
Sbjct  57   LDSESNRRILATKKYISYGALQKNSVPCSRRGASYYNCKPGAQANPY  103



>emb|CDY15684.1| BnaA07g08550D [Brassica napus]
Length=163

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 1/60 (2%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLFR-TRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G +  DD  E ++DSE++RR L R  RY+ Y  L+K+ +PC ++G SYY C       PY
Sbjct  37   GCIGDDDELESLMDSETNRRQLARGRRYIGYDALKKNNVPCNRRGRSYYDCKKRRRNNPY  96



>ref|XP_006356972.1| PREDICTED: rapid alkalinization factor-like [Solanum tuberosum]
Length=134

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +D +E  ++SESSRRML +R RY+SY  L  +++PC ++G SYY C       PY
Sbjct  68   EDEDEFGMESESSRRMLAYRRRYISYGALSSNRVPCSRRGASYYNCRPGAQANPY  122



>ref|XP_003626248.1| hypothetical protein MTR_7g113080 [Medicago truncatula]
 gb|ABN08027.1| Rapid ALkalinization Factor [Medicago truncatula]
 gb|AES82466.1| RALF [Medicago truncatula]
 gb|AFK41182.1| unknown [Medicago truncatula]
Length=127

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            EE   D+E +RR+L  T+Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  65   EEFQFDNEINRRILATTKYISYGALQRNTVPCSRRGASYYNCRPGAQANPY  115



>gb|KFK36285.1| hypothetical protein AALP_AA4G102800 [Arabis alpina]
Length=108

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHS  311
            +D EE+M+ SE SRR+L  + RY+ Y  LR+D +PC K G SYY C S
Sbjct  36   EDEEELMMPSEISRRLLMAQKRYIGYETLRRDMVPCQKPGASYYDCRS  83



>ref|XP_009629090.1| PREDICTED: rapid alkalinization factor [Nicotiana tomentosiformis]
 sp|Q945T0.1|RALF_TOBAC RecName: Full=Rapid alkalinization factor; Short=NtRALF; Flags: 
Precursor [Nicotiana tabacum]
 gb|AAL26478.1|AF407278_1 RALF precursor [Nicotiana tabacum]
Length=115

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  192  LDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            LDSES+RR+L   +Y+SY  L+K+ +PC ++G SYY C       PY
Sbjct  57   LDSESNRRILATKKYISYGALQKNSVPCSRRGASYYNCKPGAQANPY  103



>ref|XP_010025230.1| PREDICTED: rapid alkalinization factor-like [Eucalyptus grandis]
 gb|KCW61837.1| hypothetical protein EUGRSUZ_H04532 [Eucalyptus grandis]
Length=130

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            D   E  LDSES+RR+L  + Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  65   DGEGEFDLDSESNRRILATSSYISYGALKRNTVPCSRRGASYYNCRPGASSNPY  118



>ref|XP_006468214.1| PREDICTED: rapid alkalinization factor-like [Citrus sinensis]
Length=113

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +3

Query  153  SGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            + I   +D  E+++ +E SRR L    ++SY  L+ + +PC ++G SYY C+   P  PY
Sbjct  39   TNIGRIEDDTEVLMPTEDSRRHLNAAGFISYGALQGNSVPCNRRGASYYNCNGGGPTNPY  98



>ref|XP_002883013.1| hypothetical protein ARALYDRAFT_897975 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59272.1| hypothetical protein ARALYDRAFT_897975 [Arabidopsis lyrata subsp. 
lyrata]
Length=137

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +DSE +RR+L   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  76   EFEMDSEINRRILATRRYISYGALRRNTVPCSRRGASYYNCRRGAQANPY  125



>gb|KDP27792.1| hypothetical protein JCGZ_18872 [Jatropha curcas]
Length=118

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  165  DFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            D D   E  +DSE +RR+L    Y+SY  LR++ +PC ++G SYY C +     PY
Sbjct  51   DEDFETEFAMDSEINRRILATRTYISYGALRRNSVPCSRRGASYYNCRAGAQANPY  106



>gb|KHN31786.1| hypothetical protein glysoja_050399, partial [Glycine soja]
Length=86

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I D    EE  LDSE +RR+L   +Y+SY  L+++  PC ++G SYY C       PY
Sbjct  17   IADCLGGEEYELDSEINRRILATNKYISYVALQRNTAPCSRRGASYYNCRPGAQANPY  74



>ref|XP_006299574.1| hypothetical protein CARUB_v10015749mg [Capsella rubella]
 gb|EOA32472.1| hypothetical protein CARUB_v10015749mg [Capsella rubella]
Length=131

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +DSE +RR+L   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  70   EFEMDSEINRRILATRRYISYGALRRNTVPCSRRGASYYNCRRGAQANPY  119



>ref|XP_010097951.1| hypothetical protein L484_026842 [Morus notabilis]
 gb|EXB73681.1| hypothetical protein L484_026842 [Morus notabilis]
Length=86

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = +3

Query  144  AASSGIMDFDDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHP  320
             +SS I D     EMM DSE SRR+L  + +Y+SY  L++D +PCG+ G  YY CH   P
Sbjct  6    CSSSKIGDCLTEMEMM-DSEISRRLLAMQKKYISYETLKRDMVPCGRPGAPYYNCHV-GP  63

Query  321  IRPY  332
              PY
Sbjct  64   ANPY  67



>emb|CAN83593.1| hypothetical protein VITISV_037723 [Vitis vinifera]
Length=118

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (54%), Gaps = 0/63 (0%)
 Frame = +3

Query  144  AASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPI  323
            A    I +    EE  +DSE +RR+L   RY+SY  L ++ +PC ++G SYY C      
Sbjct  44   ACQGSIAECLAGEEFEMDSEINRRILASKRYISYGALSRNSVPCSRRGASYYNCRPGAQA  103

Query  324  RPY  332
             PY
Sbjct  104  NPY  106



>ref|XP_002273386.1| PREDICTED: protein RALF-like 33 [Vitis vinifera]
Length=118

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (54%), Gaps = 0/63 (0%)
 Frame = +3

Query  144  AASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPI  323
            A    I +    EE  +DSE +RR+L   RY+SY  L ++ +PC ++G SYY C      
Sbjct  44   ACQGSIAECLAGEEFEMDSEINRRILASKRYISYGALSRNSVPCSRRGASYYNCRPGAQA  103

Query  324  RPY  332
             PY
Sbjct  104  NPY  106



>ref|XP_009412092.1| PREDICTED: protein RALF-like 33 [Musa acuminata subsp. malaccensis]
Length=119

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 1/68 (1%)
 Frame = +3

Query  129  PASVGAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCH  308
            PA  G   + I +    EE  L SE +RR+L  + Y+SY  L++D +PC ++G SYY C 
Sbjct  41   PALAGCRGT-IAECLAGEEFDLGSEVTRRILATSSYISYGALKRDTVPCSRRGASYYNCR  99

Query  309  SHHPIRPY  332
                  PY
Sbjct  100  PGAQANPY  107



>ref|XP_010691694.1| PREDICTED: protein RALF-like 33 [Beta vulgaris subsp. vulgaris]
Length=119

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            D +E  +DSE +RR+L  + Y+SY+ L ++++PC ++G SYY C       PY
Sbjct  54   DEDEFEMDSEINRRILATSNYISYAALNRNRVPCSRRGASYYNCRPGASANPY  106



>ref|XP_011082482.1| PREDICTED: rapid alkalinization factor-like [Sesamum indicum]
Length=115

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            D  E  +DSE +RR+L  T Y+SY  L+ + +PC ++G SYY C       PY
Sbjct  51   DGGEFDMDSEINRRILATTSYISYGALQANNVPCSQRGASYYNCQPGAEANPY  103



>ref|XP_009615222.1| PREDICTED: rapid alkalinization factor-like [Nicotiana tomentosiformis]
Length=128

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 45/76 (59%), Gaps = 3/76 (4%)
 Frame = +3

Query  114  TMYSDPASVGAASSG--IMDFDDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKK  284
            +M S  +S+   S G  + +    EE  ++SES+RR+L +R RY+SY  L ++++PC ++
Sbjct  41   SMTSSASSIYEGSIGEFLAENGSDEEFSMESESTRRILAYRRRYISYGALSRNRVPCSRR  100

Query  285  GPSYYFCHSHHPIRPY  332
            G SYY C       PY
Sbjct  101  GASYYNCRPGAQANPY  116



>ref|XP_004244368.1| PREDICTED: protein RALF-like 22 [Solanum lycopersicum]
Length=128

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            EEMM+ +ES+RR L    ++SY  + K+ IPC + G SYY C     IRPY
Sbjct  65   EEMMMPTESARRALNNQDHISYRAMSKNAIPCDRHGASYYQCTRMQKIRPY  115



>ref|XP_006288916.1| hypothetical protein CARUB_v10002279mg [Capsella rubella]
 gb|EOA21814.1| hypothetical protein CARUB_v10002279mg [Capsella rubella]
Length=117

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  192  LDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            LDSE SRR+L   +Y+SY  +RK+ +PC ++G SYY C       PY
Sbjct  59   LDSEISRRILASKKYVSYGAMRKNNVPCSRRGASYYNCKRGAQANPY  105



>ref|XP_003625906.1| RALF [Medicago truncatula]
 gb|AES82124.1| RALF [Medicago truncatula]
Length=118

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 37/71 (52%), Gaps = 0/71 (0%)
 Frame = +3

Query  120  YSDPASVGAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYY  299
            +  P +       I +  +  E  ++SES RR+L  T Y+SY  L+++ +PC  KG SYY
Sbjct  35   WVAPMTTPTCQGSIEECIEEGEFGMNSESHRRILATTHYISYRALQRNTVPCSHKGASYY  94

Query  300  FCHSHHPIRPY  332
             C +     PY
Sbjct  95   NCQTGAEANPY  105



>ref|XP_010037445.1| PREDICTED: rapid alkalinization factor [Eucalyptus grandis]
 gb|KCW84482.1| hypothetical protein EUGRSUZ_B01311 [Eucalyptus grandis]
Length=135

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  186  MMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            + +DSE++RR+L   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  75   LAMDSETNRRILAGRRYISYGALRRNVVPCSRRGASYYNCRPGAAANPY  123



>gb|KDP28133.1| hypothetical protein JCGZ_13904 [Jatropha curcas]
Length=128

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = +3

Query  108  ESTMYSDPASVGAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKG  287
            ES +   P   G     I +    EE+ +DSE  RR+L  TRY+SY+ L++  +PC  +G
Sbjct  41   ESKLSWIPTRRGQWEGSIAECIGEEELDMDSEIHRRILQTTRYISYAALQRGSVPCSHRG  100

Query  288  PSYYFCH  308
             +YY C 
Sbjct  101  ATYYNCQ  107



>emb|CDY40711.1| BnaC03g34270D [Brassica napus]
Length=118

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  192  LDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             DSE SRR+L + +Y+SY  +RK+ +PC ++G SYY C       PY
Sbjct  60   FDSEISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCQRGAQANPY  106



>ref|XP_010526512.1| PREDICTED: protein RALF-like 4 [Tarenaya hassleriana]
Length=102

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  198  SESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +E SRR+L  TRY+SY  L+++ IPC ++G SYY C    P+ PY
Sbjct  43   TEMSRRILKGTRYISYDALKRNNIPCNRRGRSYYNCGPGGPVNPY  87



>ref|XP_006419584.1| hypothetical protein CICLE_v10006201mg [Citrus clementina]
 ref|XP_006489088.1| PREDICTED: rapid alkalinization factor 23-like [Citrus sinensis]
 gb|ESR32824.1| hypothetical protein CICLE_v10006201mg [Citrus clementina]
 gb|KDO71637.1| hypothetical protein CISIN_1g032876mg [Citrus sinensis]
Length=131

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +D E +RR+L   RY+SY  LR++ +PC ++G SYY C +     PY
Sbjct  70   EFAMDGEINRRILAMRRYISYGALRRNSVPCSRRGASYYNCRAGGQANPY  119



>ref|XP_004302396.1| PREDICTED: protein RALF-like 33-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=106

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = +3

Query  153  SGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            SG++  D+ E   LDSE +RR+L  + Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  40   SGLVSDDEFE---LDSEINRRILATSNYISYGALQRNTVPCSRRGASYYNCKPGAQANPY  96



>gb|KDO77604.1| hypothetical protein CISIN_1g044503mg [Citrus sinensis]
Length=113

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +3

Query  153  SGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            + I   +D  E+++ +E SRR L    ++SY  L+ + +PC ++G SYY C+   P  PY
Sbjct  39   TNIGRIEDDTEVLMPTEDSRRHLNAAGFISYRALQGNSVPCNRRGASYYNCNGGGPTNPY  98



>ref|XP_002263387.1| PREDICTED: rapid alkalinization factor [Vitis vinifera]
 emb|CAN77387.1| hypothetical protein VITISV_033365 [Vitis vinifera]
 emb|CBI36827.3| unnamed protein product [Vitis vinifera]
Length=118

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +E  +D+E +RR+L  T+Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  56   DEFEMDTEINRRILATTQYISYGALQRNTVPCSQRGASYYNCKPGAEANPY  106



>emb|CBI26076.3| unnamed protein product [Vitis vinifera]
Length=152

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (54%), Gaps = 0/63 (0%)
 Frame = +3

Query  144  AASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPI  323
            A    I +    EE  +DSE +RR+L   RY+SY  L ++ +PC ++G SYY C      
Sbjct  78   ACQGSIAECLAGEEFEMDSEINRRILASKRYISYGALSRNSVPCSRRGASYYNCRPGAQA  137

Query  324  RPY  332
             PY
Sbjct  138  NPY  140



>ref|XP_008775576.1| PREDICTED: protein RALF-like 33 [Phoenix dactylifera]
Length=119

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +    EE  L S+ +RRML  + Y+SY+ L+++ +PC ++G SYY C       PY
Sbjct  50   IAECLAGEEFDLSSDVARRMLATSNYISYNALKRNNVPCSRRGASYYNCRPGAQANPY  107



>ref|XP_010931639.1| PREDICTED: protein RALF-like 33 [Elaeis guineensis]
Length=117

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +    EE  L SE +RR+L  + Y+SY+ L++D +PC ++G SYY C       PY
Sbjct  48   IAECLAGEEFDLSSEVARRILATSDYISYNALKRDSVPCSRRGASYYNCRPGAQANPY  105



>ref|XP_010914425.1| PREDICTED: protein RALF-like 33 [Elaeis guineensis]
Length=122

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +    EE  L SE +RR+L  + Y+SY+ L++D +PC ++G SYY C       PY
Sbjct  53   IAECLAGEEFDLSSEVARRILATSDYISYNALKRDNVPCSRRGASYYNCRPGAQANPY  110



>ref|XP_004302395.1| PREDICTED: protein RALF-like 33-like isoform 1 [Fragaria vesca 
subsp. vesca]
Length=108

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = +3

Query  153  SGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            SG++  D+ E   LDSE +RR+L  + Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  40   SGLVSDDEFE---LDSEINRRILATSNYISYGALQRNTVPCSRRGASYYNCKPGAQANPY  96



>ref|XP_011092082.1| PREDICTED: rapid alkalinization factor-like [Sesamum indicum]
Length=121

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = +3

Query  162  MDFDDAEEMMLDSESSRRMLFRTR-YLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +D +D +E  LDSES+RR+L   R Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  53   LDNED-QEFELDSESNRRILATARRYISYGALQRNSVPCSRRGASYYNCRPGAQANPY  109



>ref|XP_002321018.2| hypothetical protein POPTR_0014s12630g [Populus trichocarpa]
 gb|EEE99333.2| hypothetical protein POPTR_0014s12630g [Populus trichocarpa]
Length=115

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +E  +DSE +RR+L  + Y+SY  L K+ +PC ++G SYY C +     PY
Sbjct  53   DEFEMDSEINRRILATSNYISYDALGKNNVPCSQRGASYYNCKTGAEANPY  103



>ref|XP_009146075.1| PREDICTED: rapid alkalinization factor 23-like [Brassica rapa]
Length=127

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +DSE +R ML   RY+SY  LR++ +PC ++G SYY C       PY
Sbjct  66   EFEMDSEINRHMLANRRYISYGALRRNSVPCSRRGASYYNCRRGAQANPY  115



>ref|XP_006433408.1| hypothetical protein CICLE_v10002897mg [Citrus clementina]
 ref|XP_006472087.1| PREDICTED: protein RALF-like 33-like [Citrus sinensis]
 gb|ESR46648.1| hypothetical protein CICLE_v10002897mg [Citrus clementina]
Length=112

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  192  LDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            LDSE +RR+L   +Y+SY  L+++ +PC ++G SYY C +     PY
Sbjct  54   LDSEINRRILATNKYISYGALQRNTVPCSRRGASYYNCQNGGQANPY  100



>ref|XP_008359858.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=120

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +D  E  +DSE SRR+L  + Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  55   NDEVEFDMDSEISRRILATSNYISYGALQRNTVPCSRRGASYYNCQPGAQSNPY  108



>gb|EPS62616.1| hypothetical protein M569_12176, partial [Genlisea aurea]
Length=112

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 35/69 (51%), Gaps = 1/69 (1%)
 Frame = +3

Query  129  PASVGAASSGIMDFDDAEEMMLDSESSRR-MLFRTRYLSYSVLRKDQIPCGKKGPSYYFC  305
            P + G     + +     E  LDSE++RR +LF  RY+ Y  L+KD +PC  +G  YY C
Sbjct  33   PLNSGGCKGTVGECLGGGEFELDSETNRRRVLFTRRYIGYDALQKDAVPCALRGAPYYNC  92

Query  306  HSHHPIRPY  332
                   PY
Sbjct  93   RQGGQANPY  101



>ref|NP_850219.1| protein RALF-like 19 [Arabidopsis thaliana]
 sp|Q6NME6.1|RLF19_ARATH RecName: Full=Protein RALF-like 19; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAS49077.1| At2g33775 [Arabidopsis thaliana]
 gb|AEC08883.1| protein RALF-like 19 [Arabidopsis thaliana]
Length=110

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G +  D   + ++DSE++RR L  R  Y+SY  LRK+ +PC ++G SYY C       PY
Sbjct  36   GCIGEDGELDYLMDSETNRRQLAARRSYISYGALRKNNVPCSRRGRSYYDCKKRKRANPY  95



>ref|XP_002531878.1| RALFL33, putative [Ricinus communis]
 gb|EEF30515.1| RALFL33, putative [Ricinus communis]
Length=116

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            + D    +E  +DSE +RR+L  T Y+SY  L+++ IPC ++G SYY C       PY
Sbjct  47   LADCMQEDEFDMDSEINRRILATTNYISYGALQRNTIPCSQRGASYYNCQPGAEANPY  104



>ref|XP_004494597.1| PREDICTED: protein RALF-like 33-like [Cicer arietinum]
Length=127

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            EE   D+E +RR+L  T+Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  65   EEFEFDNEINRRILATTKYISYGALQRNTVPCSRRGASYYNCRPGAQANPY  115



>ref|XP_009373554.1| PREDICTED: LOW QUALITY PROTEIN: protein RALF-like 24 [Pyrus x 
bretschneideri]
Length=152

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +3

Query  183  EMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSYYFCHS  311
            E  ++SESSRR+L  +T+Y+SY  L++D +PCG  G SYY CH+
Sbjct  89   EPEMESESSRRILAMQTKYISYGTLKRDSVPCGTPGASYYNCHA  132



>ref|XP_006606531.1| PREDICTED: protein RALF-like 1-like [Glycine max]
Length=117

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +    EE  LDSE +RR+L   +Y+SY  L+++  PC ++G SYY C       PY
Sbjct  48   IAECLGGEEYELDSEINRRILATNKYISYVALQRNTAPCSRRGASYYNCRPGAQANPY  105



>ref|XP_004290774.1| PREDICTED: protein RALF-like 33-like isoform 1 [Fragaria vesca 
subsp. vesca]
 ref|XP_004290775.1| PREDICTED: protein RALF-like 33-like isoform 2 [Fragaria vesca 
subsp. vesca]
Length=114

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +E  +DSE +RR+L  T+Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  52   DEFDMDSEINRRILATTKYISYGALQRNTVPCSQRGASYYNCKPGAQANPY  102



>ref|XP_002879470.1| hypothetical protein ARALYDRAFT_902453 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55729.1| hypothetical protein ARALYDRAFT_902453 [Arabidopsis lyrata subsp. 
lyrata]
Length=110

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = +3

Query  156  GIMDFDDAEEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            G +  D   + ++DSE++RR L  R  Y+SY  LRK+ +PC ++G SYY C       PY
Sbjct  36   GCIGEDGELDYLMDSETNRRQLAARRSYISYGALRKNNVPCSRRGRSYYDCKKRKRANPY  95



>gb|EPS64652.1| rapid alkalinization factor, partial [Genlisea aurea]
Length=67

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 30/56 (54%), Gaps = 2/56 (4%)
 Frame = +3

Query  165  DFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            D D   E  + SES RR L    Y+SY  L +D+IPC ++G SYY C       PY
Sbjct  1    DLD--REFAMGSESDRRQLAAGNYISYGALNRDRIPCSRRGSSYYNCRGGRKANPY  54



>ref|XP_006408069.1| hypothetical protein EUTSA_v10021783mg [Eutrema salsugineum]
 gb|ESQ49522.1| hypothetical protein EUTSA_v10021783mg [Eutrema salsugineum]
Length=119

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  192  LDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             DSE SRR+L + +Y+SY  +RK+ +PC ++G SYY C       PY
Sbjct  61   FDSEISRRILAQKKYVSYGAMRKNSVPCSRRGASYYNCRRGAQANPY  107



>ref|XP_010938417.1| PREDICTED: protein RALF-like 33 [Elaeis guineensis]
Length=126

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (56%), Gaps = 0/63 (0%)
 Frame = +3

Query  144  AASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPI  323
            A    + +    +E   +SE SRR+L   RY+SY+ LR+D +PC ++G SYY C      
Sbjct  52   ACRGTVAECIAGDEFDFESEISRRILASWRYISYNALRRDSVPCSRRGASYYNCRPGAYA  111

Query  324  RPY  332
             PY
Sbjct  112  NPY  114



>ref|XP_008368985.1| PREDICTED: rapid alkalinization factor-like [Malus domestica]
Length=113

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +3

Query  129  PASVGAASSGIMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCH  308
            P   G+ +  + D D   E  +DSE SRR+L  ++Y+SY  L+++ +PC  +G SYY C 
Sbjct  36   PGCEGSVAECMDDHD--VEFGMDSEISRRILATSQYISYGALQRNTVPCSHRGASYYNCK  93

Query  309  SHHPIRPY  332
            S     PY
Sbjct  94   SGAQSNPY  101



>ref|XP_002882418.1| hypothetical protein ARALYDRAFT_477838 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58677.1| hypothetical protein ARALYDRAFT_477838 [Arabidopsis lyrata subsp. 
lyrata]
Length=118

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  192  LDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             DSE SRR+L + +Y+SY  +R++ +PC ++G SYY C       PY
Sbjct  60   FDSEISRRILAQKKYISYGAMRRNSVPCSRRGASYYNCQRGAQANPY  106



>ref|XP_004979239.1| PREDICTED: rapid alkalinization factor 23-like [Setaria italica]
Length=111

 Score = 52.0 bits (123),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 32/57 (56%), Gaps = 4/57 (7%)
 Frame = +3

Query  174  DAEEMMLDSESSRRMLFRT----RYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            DA EM +DSE+ RR+L+      RY+SY  LR D +PC + G  YY C       PY
Sbjct  40   DAAEMEMDSEAHRRLLWEATGGRRYISYDALRGDVVPCSRTGVPYYNCRVSTTANPY  96



>ref|XP_008246447.1| PREDICTED: rapid alkalinization factor [Prunus mume]
Length=121

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            EE  LDSE +RR+L  ++Y+SY  ++++ +PC ++G SYY C       PY
Sbjct  59   EEFDLDSEINRRILATSKYISYGAMQRNTVPCSRRGASYYNCQPGAQSNPY  109



>ref|XP_004494362.1| PREDICTED: rapid alkalinization factor-like [Cicer arietinum]
Length=118

 Score = 52.0 bits (123),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  183  EMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            E  +DSES RR+L  ++Y+SY  L+++ +PC  KG SYY C       PY
Sbjct  56   EFGMDSESHRRILATSQYISYRALQRNTVPCSHKGASYYNCQKGAEANPY  105



>ref|XP_007206150.1| hypothetical protein PRUPE_ppa013461mg [Prunus persica]
 gb|EMJ07349.1| hypothetical protein PRUPE_ppa013461mg [Prunus persica]
Length=121

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +3

Query  180  EEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            EE  LDSE +RR+L  ++Y+SY  ++++ +PC ++G SYY C       PY
Sbjct  59   EEFDLDSEINRRILATSKYISYGAMQRNTVPCSRRGASYYNCQPGAQSNPY  109



>gb|AFB73770.1| rapid alkalinization factor [Chimonanthus praecox]
Length=127

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 1/45 (2%)
 Frame = +3

Query  180  EEMMLDSESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHS  311
            EEM +DSE SRR+L  + +Y+SY  L++D++PC K G SYY C +
Sbjct  59   EEMEMDSEISRRILAAQKKYISYEALKRDEVPCSKPGASYYNCQA  103



>gb|EMS45535.1| hypothetical protein TRIUR3_16964 [Triticum urartu]
Length=124

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 41/74 (55%), Gaps = 8/74 (11%)
 Frame = +3

Query  135  SVGAASSGIMD---FDDAEEMMLDS-ESSRRMLFR---TRYLSYSVLRKDQIPCGKKGPS  293
            S  AA  GI+     D+ EEM   + E+ RR L R    RY+SY+ LR DQIPC K+G S
Sbjct  36   SRAAACDGIIGECGVDEDEEMAPGAGEALRRSLARKSTARYISYAALRADQIPCDKRGAS  95

Query  294  YYF-CHSHHPIRPY  332
            YY  C S     PY
Sbjct  96   YYINCGSMQQANPY  109



>ref|XP_010532737.1| PREDICTED: protein RALF-like 24 [Tarenaya hassleriana]
Length=120

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +3

Query  171  DDAEEMMLDSESSRR-MLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHS  311
            +D E M+L SE SRR M  + RY+SY  LR+D +PC K G SYY C S
Sbjct  48   EDEEMMVLPSEISRRVMAMQRRYISYGTLRRDMVPCQKPGASYYECRS  95



>emb|CDO98876.1| unnamed protein product [Coffea canephora]
Length=138

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +3

Query  198  SESSRRMLF-RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            SE++RR+L+ R RY+SY  L +D++PC ++G SYY C    P+ PY
Sbjct  81   SETNRRILYWRRRYISYGALTRDRVPCSRRGYSYYNCRPGRPVNPY  126



>ref|XP_007034215.1| RALFL33, putative [Theobroma cacao]
 gb|EOY05141.1| RALFL33, putative [Theobroma cacao]
Length=124

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            D  EE  ++SES+RR+L  + RY+SY  LR+D +PC K G SYY C++     PY
Sbjct  52   DCLEEQEMESESNRRVLVMQRRYISYETLRRDMVPCAKPGASYYDCNAGQA-NPY  105



>ref|XP_009392644.1| PREDICTED: rapid alkalinization factor-like [Musa acuminata subsp. 
malaccensis]
Length=122

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 3/58 (5%)
 Frame = +3

Query  168  FDDAEEMMLDSESSRRMLF---RTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
             +D  E+ ++SE +RR+L+     +Y+SY  L+ D +PC K G  YY CHS     PY
Sbjct  50   LEDGVELEMNSEENRRLLWAVTEKKYISYEALKGDVVPCSKPGVPYYNCHSFPKANPY  107



>ref|NP_566555.1| rapid alkalinization factor 23 [Arabidopsis thaliana]
 sp|Q9LUS7.1|RLF23_ARATH RecName: Full=Rapid alkalinization factor 23; Short=AtRALF23; 
AltName: Full=Protein RALF-like 23; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB02748.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK82563.1| AT3g16570/MGL6_2 [Arabidopsis thaliana]
 gb|AAL62021.1| AT3g16570/MGL6_2 [Arabidopsis thaliana]
 gb|AAM61153.1| unknown [Arabidopsis thaliana]
 gb|AEE75839.1| rapid alkalinization factor 23 [Arabidopsis thaliana]
Length=138

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  195  DSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            DSE +RR+L   RY+SY  LR++ IPC ++G SYY C       PY
Sbjct  80   DSEINRRILATRRYISYGALRRNTIPCSRRGASYYNCRRGAQANPY  125



>ref|XP_009102578.1| PREDICTED: protein RALF-like 24 [Brassica rapa]
Length=117

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHH  317
            ++ EEMM    S R M+ R +Y+SY+ LR+D +PC + G SYY C S  
Sbjct  46   EEGEEMMPSDISRRVMMMRKQYISYATLRRDMVPCQRPGASYYACRSGQ  94



>emb|CDX77484.1| BnaA07g06220D [Brassica napus]
Length=117

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHH  317
            ++ EEMM    S R M+ R +Y+SY+ LR+D +PC + G SYY C S  
Sbjct  46   EEGEEMMPSDISRRVMMMRKQYISYATLRRDMVPCQRPGASYYACRSGQ  94



>ref|XP_009393214.1| PREDICTED: rapid alkalinization factor-like [Musa acuminata subsp. 
malaccensis]
Length=123

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 0/58 (0%)
 Frame = +3

Query  159  IMDFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            I +    EE  L SE SRR L  + Y+SY  L+ D +PC ++G SYY C       PY
Sbjct  53   IAECLAGEEFDLGSEVSRRFLATSSYISYGALKSDTVPCSRRGASYYNCRPGAQANPY  110



>emb|CDX85126.1| BnaC07g07800D [Brassica napus]
Length=117

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHH  317
            ++ EEMM    S R M+ R +Y+SY+ LR+D +PC + G SYY C S  
Sbjct  46   EEGEEMMPSDISRRVMMMRKQYISYATLRRDMVPCQRPGASYYACRSGQ  94



>ref|XP_008222806.1| PREDICTED: protein RALF-like 24 [Prunus mume]
Length=170

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = +3

Query  138  VGAASSGIMDFDDA-EEMMLDSESSRRML-FRTRYLSYSVLRKDQIPCGKKGPSYYFCHS  311
            VGA  +      +   E  ++SE+SRR+L  + +Y+SY  LR+D +PCGK G SYY CH+
Sbjct  91   VGAGRACNQKIGECLTEPEMESETSRRVLAMQKKYISYETLRRDLVPCGKPGASYYNCHA  150



>emb|CBI39521.3| unnamed protein product [Vitis vinifera]
Length=147

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  165  DFDDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +F    E  +DSE +RR+L  ++Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  80   EFGLTSEFAMDSEINRRILATSKYISYGALQRNSVPCSRRGASYYNCQPGAQANPY  135



>ref|XP_010038196.1| PREDICTED: rapid alkalinization factor-like [Eucalyptus grandis]
 gb|KCW50015.1| hypothetical protein EUGRSUZ_K03464 [Eucalyptus grandis]
Length=127

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +3

Query  171  DDAEEMMLDSESSRRMLFRTRYLSYSVLRKDQIPCGKKGPSYYFCHSHHPIRPY  332
            +   E  +D+E SRR+L  ++Y+SY  L+++ +PC ++G SYY C       PY
Sbjct  62   EQGSEFDMDTEVSRRVLATSQYISYGALQRNTVPCSQRGASYYNCQPGAQSNPY  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 632043024200