BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2361_g1_i1 len=1585 path=[1563:0-848 2412:849-1584]

Length=1585
                                                                      Score     E

ref|XP_002514352.1|  transferase, putative                              452   6e-151   Ricinus communis
emb|CDP04825.1|  unnamed protein product                                448   3e-149   
ref|XP_007223985.1|  hypothetical protein PRUPE_ppa014744mg             433   2e-143   
ref|XP_002282283.1|  PREDICTED: protein ECERIFERUM 26-like              430   2e-142   Vitis vinifera
ref|XP_011081909.1|  PREDICTED: protein ECERIFERUM 26-like              421   1e-138   
ref|XP_008219914.1|  PREDICTED: protein ECERIFERUM 26-like              419   5e-138   
ref|XP_011026508.1|  PREDICTED: protein ECERIFERUM 26                   417   2e-137   
ref|XP_004498644.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    416   5e-137   
ref|XP_008392130.1|  PREDICTED: protein ECERIFERUM 26-like              415   1e-136   
ref|XP_003588700.1|  Taxadien-5-alpha-ol O-acetyltransferase            414   6e-136   
ref|XP_007161246.1|  hypothetical protein PHAVU_001G054300g             406   4e-133   
ref|XP_010102806.1|  Vinorine synthase                                  398   5e-130   
ref|XP_006450533.1|  hypothetical protein CICLE_v10008314mg             397   1e-129   
ref|XP_003549253.1|  PREDICTED: protein ECERIFERUM 1-like               396   3e-129   
gb|KDO79585.1|  hypothetical protein CISIN_1g045312mg                   395   1e-128   
ref|XP_006476225.1|  PREDICTED: protein ECERIFERUM 26-like              394   1e-128   
emb|CAN80953.1|  hypothetical protein VITISV_032203                     391   2e-127   Vitis vinifera
ref|XP_007013792.1|  Transferase, putative                              385   5e-125   
ref|XP_004293014.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    378   3e-122   
gb|EYU21930.1|  hypothetical protein MIMGU_mgv1a026668mg                375   9e-121   
ref|XP_002869444.1|  hypothetical protein ARALYDRAFT_491831             360   3e-115   
ref|XP_010051199.1|  PREDICTED: protein ECERIFERUM 26-like              360   4e-115   
ref|NP_567826.1|  HXXXD-type acyl-transferase-like protein              357   9e-114   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29862.1|  hypothetical protein AALP_AA7G188600                    355   4e-113   
emb|CDX68855.1|  BnaC01g05980D                                          353   3e-112   
gb|AAM61611.1|  unknown                                                 352   7e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433114.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    352   8e-112   
ref|XP_006285422.1|  hypothetical protein CARUB_v10006839mg             347   5e-110   
ref|XP_010447873.1|  PREDICTED: rosmarinate synthase-like               347   9e-110   
ref|XP_010670732.1|  PREDICTED: protein ECERIFERUM 26-like              343   2e-108   
ref|XP_010438318.1|  PREDICTED: rosmarinate synthase-like               343   2e-108   
ref|XP_009125885.1|  PREDICTED: protein ECERIFERUM 26                   341   8e-108   
emb|CDX75252.1|  BnaA01g04500D                                          339   4e-107   
ref|XP_006412466.1|  hypothetical protein EUTSA_v10025128mg             335   3e-105   
ref|XP_002324841.2|  hypothetical protein POPTR_0018s01250g             330   3e-104   Populus trichocarpa [western balsam poplar]
ref|XP_010525926.1|  PREDICTED: protein ECERIFERUM 26-like              316   8e-98    
gb|EYU21934.1|  hypothetical protein MIMGU_mgv1a008485mg                275   2e-83    
emb|CAB79683.1|  hypothetical protein                                   276   5e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006829665.1|  hypothetical protein AMTR_s00122p00127100          271   1e-80    
ref|XP_009393051.1|  PREDICTED: protein ECERIFERUM 26-like              229   6e-65    
ref|XP_006838953.1|  hypothetical protein AMTR_s00002p00270800          224   8e-63    
ref|XP_010256176.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    221   6e-62    
ref|XP_010917798.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...    211   2e-58    
ref|XP_011091952.1|  PREDICTED: protein ECERIFERUM 1-like               208   5e-57    
ref|XP_011032417.1|  PREDICTED: protein ECERIFERUM 26-like              207   9e-57    
ref|XP_007030599.1|  HXXXD-type acyl-transferase family protein, ...    206   3e-56    
ref|XP_010695055.1|  PREDICTED: protein ECERIFERUM 26-like              206   5e-56    
ref|XP_006382783.1|  hypothetical protein POPTR_0005s05380g             204   1e-55    
ref|XP_011004269.1|  PREDICTED: protein ECERIFERUM 26-like              204   2e-55    
ref|XP_008811612.1|  PREDICTED: protein ECERIFERUM 26-like              202   4e-55    
ref|XP_002273086.1|  PREDICTED: protein ECERIFERUM 26-like              197   3e-53    Vitis vinifera
ref|XP_008388670.1|  PREDICTED: protein ECERIFERUM 26-like              197   6e-53    
ref|XP_010102303.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    196   1e-52    
ref|XP_004494691.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    194   4e-52    
ref|NP_001140499.1|  transferase                                        194   6e-52    Zea mays [maize]
gb|ACG37219.1|  transferase                                             194   7e-52    Zea mays [maize]
ref|XP_009364516.1|  PREDICTED: protein ECERIFERUM 26-like              193   1e-51    
ref|XP_006432968.1|  hypothetical protein CICLE_v10001131mg             191   6e-51    
ref|XP_007205176.1|  hypothetical protein PRUPE_ppa005581mg             191   6e-51    
ref|XP_002463889.1|  hypothetical protein SORBIDRAFT_01g008360          191   1e-50    Sorghum bicolor [broomcorn]
emb|CAN70576.1|  hypothetical protein VITISV_018974                     189   2e-50    Vitis vinifera
ref|XP_006395015.1|  hypothetical protein EUTSA_v10004237mg             189   4e-50    
ref|XP_006604843.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    187   2e-49    
gb|KHN43198.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    186   3e-49    
ref|XP_008218251.1|  PREDICTED: protein ECERIFERUM 26-like              184   2e-48    
gb|KFK26566.1|  hypothetical protein AALP_AA8G265500                    182   8e-48    
ref|XP_006577283.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    181   5e-47    
gb|KHN31456.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    180   5e-47    
ref|XP_003626431.1|  Omega-hydroxypalmitate O-feruloyl transferase      180   1e-46    
emb|CDP06790.1|  unnamed protein product                                176   3e-46    
ref|XP_010546595.1|  PREDICTED: protein ECERIFERUM 26-like isofor...    177   7e-46    
emb|CDY52503.1|  BnaAnng11500D                                          175   4e-45    
ref|XP_007147162.1|  hypothetical protein PHAVU_006G101000g             175   4e-45    
emb|CDY05591.1|  BnaC02g39460D                                          174   1e-44    
ref|XP_006286502.1|  hypothetical protein CARUB_v10001016mg             172   3e-44    
ref|XP_008455878.1|  PREDICTED: protein ECERIFERUM 26                   173   4e-44    
ref|XP_010455172.1|  PREDICTED: protein ECERIFERUM 26-like              171   8e-44    
ref|XP_009129839.1|  PREDICTED: protein ECERIFERUM 26-like              170   2e-43    
ref|XP_004302041.1|  PREDICTED: vinorine synthase-like                  168   6e-43    
ref|XP_010421688.1|  PREDICTED: protein ECERIFERUM 26-like              169   7e-43    
ref|XP_010494090.1|  PREDICTED: protein ECERIFERUM 26-like              168   1e-42    
ref|XP_004156459.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    167   4e-42    
gb|KGN60817.1|  hypothetical protein Csa_2G011500                       167   6e-42    
gb|EAY91836.1|  hypothetical protein OsI_13481                          164   5e-41    Oryza sativa Indica Group [Indian rice]
ref|NP_001051243.1|  Os03g0745200                                       163   1e-40    Oryza sativa Japonica Group [Japonica rice]
gb|ABF98834.1|  Transferase family protein, expressed                   162   2e-40    Oryza sativa Japonica Group [Japonica rice]
gb|ACF78901.1|  unknown                                                 157   3e-39    Zea mays [maize]
gb|EYU30520.1|  hypothetical protein MIMGU_mgv1a006319mg                158   5e-39    
ref|XP_004139230.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    147   3e-36    
ref|XP_004981805.1|  PREDICTED: uncharacterized protein LOC101779453    152   3e-36    
ref|XP_003559747.1|  PREDICTED: protein ECERIFERUM 26-like              149   8e-36    
emb|CBI34184.3|  unnamed protein product                                145   4e-35    
dbj|BAK06476.1|  predicted protein                                      144   3e-34    
gb|EMT30805.1|  hypothetical protein F775_21434                         135   5e-32    
gb|EEE59916.1|  hypothetical protein OsJ_12543                          126   2e-28    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA51299.1|  TPA: hypothetical protein ZEAMMB73_720390              119   8e-28    
ref|XP_006387736.1|  hypothetical protein POPTR_0633s00210g             106   2e-23    
ref|XP_002319620.2|  hypothetical protein POPTR_0013s03730g             107   2e-22    Populus trichocarpa [western balsam poplar]
gb|EMS49281.1|  hypothetical protein TRIUR3_27392                       101   1e-21    
ref|XP_006297739.1|  hypothetical protein CARUB_v10013773mg             105   3e-21    
gb|EPS70649.1|  hypothetical protein M569_04114                         100   8e-21    
ref|XP_010933592.1|  PREDICTED: uncharacterized protein LOC105053945    103   9e-21    
ref|XP_011003614.1|  PREDICTED: protein ECERIFERUM 26-like              104   1e-20    
gb|KDO45042.1|  hypothetical protein CISIN_1g0140001mg                  102   1e-20    
ref|XP_010421841.1|  PREDICTED: protein ECERIFERUM 26-like              103   2e-20    
ref|NP_001241338.1|  uncharacterized protein LOC100819144               102   3e-20    
ref|XP_010466747.1|  PREDICTED: protein ECERIFERUM 26-like              102   4e-20    
ref|XP_011074277.1|  PREDICTED: protein ECERIFERUM 1                    100   3e-19    
ref|XP_010933591.1|  PREDICTED: uncharacterized protein LOC105053944  99.0    3e-19    
ref|XP_009400234.1|  PREDICTED: uncharacterized protein LOC103984463  97.4    8e-19    
ref|XP_003531221.1|  PREDICTED: protein ECERIFERUM 26-like            98.2    1e-18    
gb|KHN12341.1|  Omega-hydroxypalmitate O-feruloyl transferase         98.2    1e-18    
ref|XP_010512967.1|  PREDICTED: protein ECERIFERUM 26-like            97.4    2e-18    
ref|XP_006297755.1|  hypothetical protein CARUB_v10013790mg           97.1    3e-18    
ref|XP_008802334.1|  PREDICTED: protein ECERIFERUM 26-like            97.1    3e-18    
ref|XP_004136254.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  96.7    4e-18    
ref|XP_006432967.1|  hypothetical protein CICLE_v10001131mg           94.7    2e-17    
emb|CDX85135.1|  BnaC07g07710D                                        94.4    2e-17    
ref|XP_006852920.1|  hypothetical protein AMTR_s00033p00231280        94.7    2e-17    
ref|XP_008466157.1|  PREDICTED: protein ECERIFERUM 1                  94.0    3e-17    
ref|XP_002445495.1|  hypothetical protein SORBIDRAFT_07g020400        93.2    4e-17    Sorghum bicolor [broomcorn]
dbj|BAJ84920.1|  predicted protein                                    92.4    4e-17    
emb|CDX77480.1|  BnaA07g06180D                                        93.6    5e-17    
ref|XP_002883466.1|  hypothetical protein ARALYDRAFT_479896           93.2    5e-17    
ref|XP_009102573.1|  PREDICTED: protein ECERIFERUM 26-like            92.4    9e-17    
ref|XP_010919745.1|  PREDICTED: uncharacterized protein LOC105043757  91.3    1e-16    
ref|XP_011083578.1|  PREDICTED: uncharacterized protein LOC105166055  90.9    2e-16    
ref|XP_002862408.1|  hypothetical protein ARALYDRAFT_497463           91.7    2e-16    
gb|KFK39684.1|  hypothetical protein AALP_AA3G275800                  91.3    2e-16    
emb|CDP11510.1|  unnamed protein product                              91.3    2e-16    
ref|XP_010527461.1|  PREDICTED: protein ECERIFERUM 26-like            90.9    4e-16    
ref|XP_002283781.1|  PREDICTED: protein ECERIFERUM 1                  90.5    4e-16    Vitis vinifera
ref|XP_003570002.1|  PREDICTED: uncharacterized protein LOC100841639  89.7    4e-16    
ref|XP_010060100.1|  PREDICTED: protein ECERIFERUM 1-like             90.5    5e-16    
ref|XP_009412065.1|  PREDICTED: protein ECERIFERUM 26-like            90.5    5e-16    
emb|CBI19276.3|  unnamed protein product                              90.5    6e-16    
gb|AAM65391.1|  fatty acid elongase-like protein (cer2-like)          90.1    6e-16    Arabidopsis thaliana [mouse-ear cress]
gb|KHG00208.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  90.1    6e-16    
ref|XP_009389695.1|  PREDICTED: vinorine synthase-like                88.6    9e-16    
ref|XP_009397930.1|  PREDICTED: uncharacterized protein LOC103982667  88.6    1e-15    
ref|NP_566741.1|  HXXXD-type acyl-transferase-like protein            89.0    1e-15    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007153617.1|  hypothetical protein PHAVU_003G050600g           88.6    2e-15    
gb|KFK24737.1|  hypothetical protein AALP_AA8G018000                  87.4    2e-15    
ref|XP_002990807.1|  BAHD family acyltransferase, clade I             89.0    2e-15    
ref|XP_009138132.1|  PREDICTED: protein ECERIFERUM 1                  88.2    2e-15    
ref|XP_002514050.1|  Anthranilate N-benzoyltransferase protein, p...  88.6    2e-15    Ricinus communis
gb|KDP39334.1|  hypothetical protein JCGZ_01091                       88.6    2e-15    
gb|AAM61705.1|  unknown                                               87.0    3e-15    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009785032.1|  PREDICTED: protein ECERIFERUM 26-like            87.8    3e-15    
ref|XP_010433760.1|  PREDICTED: protein ECERIFERUM 1-like             87.8    3e-15    
ref|XP_010439020.1|  PREDICTED: protein ECERIFERUM 1-like             87.8    3e-15    
ref|NP_195909.1|  HXXXD-type acyl-transferase-like protein            86.7    4e-15    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288039.1|  hypothetical protein CARUB_v10001270mg           86.7    4e-15    
ref|XP_010532758.1|  PREDICTED: protein ECERIFERUM 26-like            87.4    5e-15    
ref|XP_010490761.1|  PREDICTED: uncharacterized protein LOC104768462  85.9    6e-15    
ref|XP_010086662.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...  87.0    7e-15    
ref|XP_006413420.1|  hypothetical protein EUTSA_v10025274mg           86.7    8e-15    
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1            86.7    8e-15    
ref|XP_009125468.1|  PREDICTED: uncharacterized protein LOC103850465  85.5    9e-15    
ref|XP_004297015.1|  PREDICTED: anthranilate N-benzoyltransferase...  86.3    1e-14    
ref|XP_010910676.1|  PREDICTED: protein ECERIFERUM 26-like            86.3    1e-14    
gb|KFK39682.1|  hypothetical protein AALP_AA3G275600                  85.9    1e-14    
ref|XP_007034236.1|  HXXXD-type acyl-transferase family protein, ...  85.9    1e-14    
ref|XP_002978805.1|  BAHD family acyltransferase                      86.3    1e-14    
emb|CDY04872.1|  BnaAnng00540D                                        85.1    1e-14    
ref|XP_009621285.1|  PREDICTED: protein ECERIFERUM 1                  85.9    2e-14    
ref|XP_004973445.1|  PREDICTED: uncharacterized protein LOC101772604  85.5    2e-14    
ref|XP_002984719.1|  BAHD family acyltransferase                      85.9    2e-14    
ref|XP_007018238.1|  HXXXD-type acyl-transferase family protein, ...  85.5    2e-14    
emb|CDY55691.1|  BnaC02g03450D                                        84.3    2e-14    
ref|XP_006360967.1|  PREDICTED: protein ECERIFERUM 26-like            85.1    2e-14    
ref|NP_001130509.1|  hypothetical protein                             84.7    2e-14    Zea mays [maize]
ref|XP_009408243.1|  PREDICTED: protein ECERIFERUM 26-like            85.1    3e-14    
emb|CBI17286.3|  unnamed protein product                              84.7    3e-14    
tpg|DAA51298.1|  TPA: hypothetical protein ZEAMMB73_720390            83.2    3e-14    
ref|XP_002264429.1|  PREDICTED: protein ECERIFERUM 26                 84.7    3e-14    Vitis vinifera
ref|XP_006398747.1|  hypothetical protein EUTSA_v10013950mg           83.6    4e-14    
ref|XP_010538356.1|  PREDICTED: uncharacterized protein LOC104812733  84.0    4e-14    
ref|XP_002298682.2|  transferase family protein                       84.0    4e-14    Populus trichocarpa [western balsam poplar]
gb|EPS64444.1|  hypothetical protein M569_10336                       84.0    5e-14    
emb|CDY65534.1|  BnaC01g41490D                                        84.7    7e-14    
gb|EYU32707.1|  hypothetical protein MIMGU_mgv1a006596mg              83.6    8e-14    
ref|XP_002306532.2|  ECERIFERUM 2 family protein                      83.6    9e-14    Populus trichocarpa [western balsam poplar]
emb|CDP08351.1|  unnamed protein product                              82.8    1e-13    
ref|XP_004299741.1|  PREDICTED: vinorine synthase-like                83.2    1e-13    
gb|EAY86925.1|  hypothetical protein OsI_08310                        82.8    1e-13    Oryza sativa Indica Group [Indian rice]
ref|XP_004299742.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  83.2    1e-13    
ref|XP_006286038.1|  hypothetical protein CARUB_v10007574mg           82.8    1e-13    
ref|XP_008798819.1|  PREDICTED: uncharacterized protein LOC103713604  82.4    1e-13    
ref|XP_009602892.1|  PREDICTED: protein ECERIFERUM 26-like            82.8    1e-13    
ref|XP_002869713.1|  hypothetical protein ARALYDRAFT_492392           82.8    1e-13    
ref|NP_001047605.2|  Os02g0653400                                     82.4    1e-13    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009786945.1|  PREDICTED: LOW QUALITY PROTEIN: protein ECER...  82.8    1e-13    
ref|XP_010452154.1|  PREDICTED: uncharacterized protein LOC104734305  82.0    1e-13    
emb|CAC39046.1|  putative protein                                     82.4    1e-13    Oryza sativa [red rice]
ref|NP_001053836.1|  Os04g0611200                                     82.4    2e-13    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002873068.1|  hypothetical protein ARALYDRAFT_324948           81.6    2e-13    
ref|XP_002974492.1|  BAHD family acyltransferase, clade I             82.4    2e-13    
gb|KDP41488.1|  hypothetical protein JCGZ_15895                       82.4    2e-13    
ref|XP_010042795.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  80.9    2e-13    
ref|XP_007039716.1|  HXXXD-type acyl-transferase family protein, ...  81.6    2e-13    
ref|XP_002972181.1|  hypothetical protein SELMODRAFT_441723           82.4    2e-13    
ref|XP_010042686.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  80.9    2e-13    
gb|AFG59486.1|  hypothetical protein 2_4399_01                        78.2    3e-13    
ref|XP_010423797.1|  PREDICTED: uncharacterized protein LOC104708853  81.3    3e-13    
ref|XP_010068486.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  80.1    3e-13    
ref|XP_006283805.1|  hypothetical protein CARUB_v10004904mg           81.6    3e-13    
ref|XP_008439396.1|  PREDICTED: vinorine synthase-like                79.7    3e-13    
ref|XP_006648896.1|  PREDICTED: uncharacterized protein LOC102705051  79.3    3e-13    
ref|XP_002977492.1|  hypothetical protein SELMODRAFT_443493           81.6    4e-13    
emb|CBI29522.3|  unnamed protein product                              79.7    4e-13    
ref|XP_010277517.1|  PREDICTED: protein ECERIFERUM 1-like             81.3    4e-13    
gb|ACF84244.1|  unknown                                               79.7    5e-13    Zea mays [maize]
ref|XP_011084205.1|  PREDICTED: protein ECERIFERUM 26-like            81.3    5e-13    
gb|AEW08258.1|  hypothetical protein 2_4399_01                        77.4    5e-13    
ref|XP_006370897.1|  hypothetical protein POPTR_0019s01520g           81.3    5e-13    
ref|XP_006418831.1|  hypothetical protein EUTSA_v10002536mg           80.9    5e-13    
gb|AFG59491.1|  hypothetical protein 2_4399_01                        77.4    6e-13    
gb|KCW63861.1|  hypothetical protein EUGRSUZ_G01530                   80.9    6e-13    
ref|XP_004247878.1|  PREDICTED: protein ECERIFERUM 26-like            80.9    7e-13    
ref|XP_010448555.1|  PREDICTED: protein ECERIFERUM 1-like             80.5    7e-13    
gb|ADL62855.1|  hydroxycinnamoyl-CoA transferase 2                    80.5    7e-13    
gb|EMS63107.1|  Agmatine coumaroyltransferase-1                       79.7    8e-13    
ref|XP_010068488.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  80.5    8e-13    
gb|EPS62865.1|  hypothetical protein M569_11925                       80.1    9e-13    
gb|KHF97666.1|  Taxadien-5-alpha-ol O-acetyltransferase               79.7    9e-13    
ref|XP_010068494.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  80.5    9e-13    
ref|XP_010677119.1|  PREDICTED: protein ECERIFERUM 26-like            79.7    1e-12    
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase            80.1    1e-12    
ref|XP_008668901.1|  PREDICTED: protein ECERIFERUM 26-like            80.1    1e-12    
ref|XP_010023659.1|  PREDICTED: protein ECERIFERUM 26-like            80.1    1e-12    
gb|AFG59487.1|  hypothetical protein 2_4399_01                        76.6    1e-12    
ref|XP_010243469.1|  PREDICTED: protein ECERIFERUM 26-like            80.1    1e-12    
gb|KCW63851.1|  hypothetical protein EUGRSUZ_G01520                   79.7    1e-12    
gb|EMT21936.1|  Taxadien-5-alpha-ol O-acetyltransferase               79.7    1e-12    
emb|CDX80844.1|  BnaC03g00980D                                        79.0    1e-12    
ref|NP_001169239.1|  hypothetical protein                             79.7    1e-12    Zea mays [maize]
emb|CAA61258.1|  orf                                                  79.7    2e-12    Zea mays [maize]
ref|XP_004252810.1|  PREDICTED: protein ECERIFERUM 1                  79.7    2e-12    
ref|XP_008457218.1|  PREDICTED: protein ECERIFERUM 26-like            79.7    2e-12    
ref|XP_010053525.1|  PREDICTED: uncharacterized protein LOC104441955  79.0    2e-12    
ref|XP_008238389.1|  PREDICTED: anthranilate N-benzoyltransferase...  78.6    2e-12    
gb|ACJ23164.1|  hydroxycinnamoyl CoA quinate transferase 2            79.3    2e-12    
ref|NP_194182.1|  fatty acid elongation machinery component ECERI...  79.3    2e-12    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006366422.1|  PREDICTED: protein ECERIFERUM 1-like             79.0    3e-12    
ref|XP_006477570.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...  78.2    3e-12    
sp|A0PDV5.1|RAS_PLESU  RecName: Full=Rosmarinate synthase; Short=...  78.6    3e-12    Solenostemon scutellarioides
gb|KDO45041.1|  hypothetical protein CISIN_1g0140002mg                74.3    3e-12    
ref|XP_011011265.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...  78.6    3e-12    
ref|XP_006414850.1|  hypothetical protein EUTSA_v10025273mg           78.2    4e-12    
ref|XP_009130735.1|  PREDICTED: uncharacterized protein LOC103855500  77.8    4e-12    
emb|CAR92145.1|  hydroxycinnamoyl CoA quinate transferase 2           78.2    4e-12    
ref|NP_193120.1|  HXXXD-type acyl-transferase-like protein            78.2    4e-12    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006486096.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  78.2    5e-12    
emb|CAN80163.1|  hypothetical protein VITISV_034111                   78.2    5e-12    Vitis vinifera
gb|KFK36272.1|  hypothetical protein AALP_AA4G100900                  77.8    5e-12    
ref|XP_010060103.1|  PREDICTED: protein ECERIFERUM 1-like             77.8    5e-12    
ref|XP_004953311.1|  PREDICTED: uncharacterized protein LOC101773410  77.4    5e-12    
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...  77.8    6e-12    
ref|XP_002531784.1|  transferase, putative                            77.0    6e-12    Ricinus communis
ref|XP_004976772.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.4    7e-12    
ref|XP_003526552.1|  PREDICTED: protein ECERIFERUM 1-like             77.8    7e-12    
ref|XP_010065678.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  77.4    8e-12    
ref|XP_010541075.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  77.8    8e-12    
ref|XP_003594968.1|  Taxadien-5-alpha-ol O-acetyltransferase          77.4    8e-12    
ref|XP_004139014.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  77.4    9e-12    
ref|XP_003611373.1|  Omega-hydroxypalmitate O-feruloyl transferase    76.6    9e-12    
ref|XP_006440196.1|  hypothetical protein CICLE_v10020680mg           76.6    9e-12    
ref|XP_008352717.1|  PREDICTED: protein ECERIFERUM 1-like isoform X2  77.0    9e-12    
ref|XP_008797275.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...  77.0    1e-11    
gb|EMT26505.1|  hypothetical protein F775_11000                       74.3    1e-11    
ref|XP_007210231.1|  hypothetical protein PRUPE_ppa015574mg           76.3    1e-11    
gb|EPS67739.1|  hypothetical protein M569_07035                       76.6    1e-11    
gb|KCW63288.1|  hypothetical protein EUGRSUZ_G00918                   75.5    1e-11    
ref|XP_006351852.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  76.6    1e-11    
gb|KCW63291.1|  hypothetical protein EUGRSUZ_G00924                   74.3    2e-11    
emb|CDY11234.1|  BnaA03g00700D                                        75.9    2e-11    
ref|XP_006421010.1|  hypothetical protein CICLE_v10005028mg           76.3    2e-11    
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase             76.3    2e-11    
gb|KDP39935.1|  hypothetical protein JCGZ_03466                       75.5    2e-11    
ref|XP_002452819.1|  hypothetical protein SORBIDRAFT_04g033170        75.5    2e-11    
gb|EMS59012.1|  Agmatine coumaroyltransferase-2                       73.9    2e-11    
ref|XP_010068284.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  75.9    2e-11    
ref|XP_010460459.1|  PREDICTED: vinorine synthase-like                75.9    2e-11    
ref|XP_008439406.1|  PREDICTED: vinorine synthase-like                75.1    3e-11    
ref|XP_008446186.1|  PREDICTED: vinorine synthase-like                75.5    3e-11    
emb|CDP11175.1|  unnamed protein product                              75.5    3e-11    
ref|XP_010068282.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  75.5    3e-11    
gb|KDO46444.1|  hypothetical protein CISIN_1g037811mg                 75.5    3e-11    
ref|XP_009139584.1|  PREDICTED: protein ECERIFERUM 26                 75.5    3e-11    
ref|XP_006443122.1|  hypothetical protein CICLE_v10020052mg           75.5    4e-11    
ref|XP_010068137.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  75.1    4e-11    
ref|XP_006489852.1|  PREDICTED: protein ECERIFERUM 26-like            75.1    4e-11    
ref|XP_006472451.1|  PREDICTED: protein ECERIFERUM 1-like             75.1    5e-11    
ref|XP_006370899.1|  hypothetical protein POPTR_0019s01540g           75.1    5e-11    
ref|XP_002447077.1|  hypothetical protein SORBIDRAFT_06g028160        74.7    5e-11    
ref|XP_006433815.1|  hypothetical protein CICLE_v10001068mg           75.1    5e-11    
gb|ADN33960.1|  anthranilate N-benzoyltransferase                     75.1    5e-11    
ref|XP_004972581.1|  PREDICTED: rosmarinate synthase-like             74.7    6e-11    
emb|CDX70338.1|  BnaA10g26870D                                        73.9    6e-11    
ref|XP_002868333.1|  transferase family protein                       74.7    6e-11    
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                    74.7    6e-11    
ref|XP_010325516.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  74.3    6e-11    
ref|XP_009122745.1|  PREDICTED: uncharacterized protein LOC103847416  73.9    6e-11    
emb|CDY10417.1|  BnaCnng03180D                                        73.9    6e-11    
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...  74.7    7e-11    
ref|XP_004501655.1|  PREDICTED: anthranilate N-benzoyltransferase...  74.3    7e-11    
ref|XP_003602897.1|  Omega-hydroxypalmitate O-feruloyl transferase    74.7    7e-11    
ref|XP_008352716.1|  PREDICTED: protein ECERIFERUM 1-like isoform X1  74.3    7e-11    
emb|CAH67256.1|  OSIGBa0101C23.8                                      73.9    7e-11    
ref|XP_011010199.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  74.3    8e-11    
ref|XP_010104833.1|  Taxadien-5-alpha-ol O-acetyltransferase          74.7    8e-11    
ref|XP_010435220.1|  PREDICTED: protein ECERIFERUM 26-like            74.3    8e-11    
ref|NP_001053469.2|  Os04g0545700                                     73.9    9e-11    
ref|NP_173852.4|  HXXXD-type acyl-transferase-like protein            73.9    1e-10    
ref|XP_008222816.1|  PREDICTED: protein ECERIFERUM 26-like            73.9    1e-10    
gb|EAZ31524.1|  hypothetical protein OsJ_15664                        73.2    1e-10    
ref|XP_009407632.1|  PREDICTED: 3'-N-debenzoyl-2'-deoxytaxol N-be...  73.9    1e-10    
gb|KCW63277.1|  hypothetical protein EUGRSUZ_G00905                   73.6    1e-10    
ref|XP_010544488.1|  PREDICTED: protein ECERIFERUM 1                  73.6    1e-10    
ref|XP_006853006.1|  hypothetical protein AMTR_s00174p00025490        73.6    1e-10    
ref|XP_010450155.1|  PREDICTED: protein ECERIFERUM 26-like            73.6    1e-10    
ref|XP_009773619.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...  70.9    1e-10    
ref|XP_007222434.1|  hypothetical protein PRUPE_ppa006117mg           73.6    1e-10    
ref|XP_002448274.1|  hypothetical protein SORBIDRAFT_06g024280        73.2    1e-10    
gb|KDP26742.1|  hypothetical protein JCGZ_17900                       73.6    2e-10    
ref|XP_010495840.1|  PREDICTED: protein ECERIFERUM 26                 73.2    2e-10    
ref|XP_006653755.1|  PREDICTED: protein ECERIFERUM 26-like            73.2    2e-10    
ref|XP_010273688.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  73.2    2e-10    
ref|XP_004301736.1|  PREDICTED: uncharacterized protein LOC101299593  72.4    2e-10    
ref|XP_002975782.1|  BAHD acyltransferase                             72.8    2e-10    
ref|XP_007227614.1|  hypothetical protein PRUPE_ppa022307mg           72.8    2e-10    
ref|XP_006415694.1|  hypothetical protein EUTSA_v10007649mg           72.8    2e-10    
ref|XP_006474074.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  72.8    2e-10    
ref|XP_004511728.1|  PREDICTED: uncharacterized protein LOC101514421  72.4    3e-10    
ref|XP_010068292.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  72.4    3e-10    
dbj|BAK07552.1|  predicted protein                                    72.0    3e-10    
ref|XP_007029093.1|  HXXXD-type acyl-transferase family protein, ...  72.8    3e-10    
ref|XP_004244558.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  71.6    4e-10    
ref|XP_008369211.1|  PREDICTED: taxadien-5-alpha-ol O-acetyltrans...  72.0    4e-10    
ref|XP_003538755.1|  PREDICTED: uncharacterized protein LOC100776361  71.6    4e-10    
ref|XP_002311734.1|  hypothetical protein POPTR_0008s18070g           72.0    4e-10    
gb|AFW63239.1|  transferase family protein                            71.2    5e-10    
ref|XP_010525616.1|  PREDICTED: BAHD acyltransferase At5g47980-like   71.6    5e-10    
dbj|BAJ87520.1|  predicted protein                                    71.6    5e-10    
ref|XP_007141275.1|  hypothetical protein PHAVU_008G182300g           71.6    5e-10    
ref|NP_001151321.1|  transferase                                      71.6    6e-10    
gb|KCW63292.1|  hypothetical protein EUGRSUZ_G00928                   71.2    6e-10    
ref|XP_002320517.1|  hypothetical protein POPTR_0014s16460g           71.6    6e-10    
emb|CDP12986.1|  unnamed protein product                              71.2    7e-10    
ref|XP_002314561.1|  transferase family protein                       71.2    7e-10    
ref|XP_010104832.1|  Taxadien-5-alpha-ol O-acetyltransferase          70.9    7e-10    
ref|XP_010068289.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  71.2    8e-10    
ref|XP_006582966.1|  PREDICTED: vinorine synthase-like                70.9    8e-10    
ref|XP_009613634.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  70.5    9e-10    
gb|EYU21745.1|  hypothetical protein MIMGU_mgv1a006579mg              70.9    9e-10    
emb|CDY04870.1|  BnaAnng00520D                                        70.5    9e-10    
gb|KDO46443.1|  hypothetical protein CISIN_1g043811mg                 70.9    9e-10    
ref|XP_010499177.1|  PREDICTED: vinorine synthase-like                70.9    1e-09    
ref|XP_006415801.1|  hypothetical protein EUTSA_v10007650mg           70.9    1e-09    
ref|NP_001266200.1|  AT3 protein                                      70.9    1e-09    
ref|XP_008338959.1|  PREDICTED: protein ECERIFERUM 1                  70.9    1e-09    
ref|XP_004956415.1|  PREDICTED: uncharacterized protein LOC101786783  70.1    1e-09    
ref|XP_010240397.1|  PREDICTED: protein ECERIFERUM 26-like            70.5    1e-09    
gb|KGN64382.1|  hypothetical protein Csa_1G050210                     70.5    1e-09    
ref|XP_010065677.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  70.1    1e-09    
ref|XP_006351755.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  70.5    1e-09    
emb|CDY01163.1|  BnaA04g06560D                                        70.5    1e-09    
gb|AAQ62868.1|  At3g48720                                             70.1    1e-09    
ref|XP_010031391.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  70.1    2e-09    
dbj|BAJ92272.1|  predicted protein                                    70.1    2e-09    
ref|XP_009610046.1|  PREDICTED: uncharacterized protein LOC104103818  69.7    2e-09    
ref|XP_008353036.1|  PREDICTED: vinorine synthase-like                70.1    2e-09    
ref|NP_190441.1|  HXXXD-type acyl-transferase family protein          70.1    2e-09    
gb|EYU44113.1|  hypothetical protein MIMGU_mgv1a020207mg              69.7    2e-09    
ref|XP_004152370.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...  67.8    2e-09    
ref|XP_009125467.1|  PREDICTED: uncharacterized protein LOC103850464  69.7    2e-09    
gb|EPS62582.1|  hypothetical protein M569_12210                       70.1    2e-09    
ref|XP_002993165.1|  hypothetical protein SELMODRAFT_431276           70.1    2e-09    
gb|KFK44501.1|  hypothetical protein AALP_AA1G265200                  70.1    2e-09    
ref|XP_010531736.1|  PREDICTED: uncharacterized protein LOC104807967  69.7    2e-09    
ref|XP_010677118.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  69.7    2e-09    
ref|XP_002993129.1|  hypothetical protein SELMODRAFT_431269           70.1    2e-09    
ref|XP_006351754.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  69.7    2e-09    
ref|XP_008800447.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  69.7    2e-09    
ref|XP_002514985.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...  69.7    2e-09    
ref|NP_201161.1|  HXXXD-type acyl-transferase-like protein            69.7    2e-09    
ref|XP_011021361.1|  PREDICTED: BAHD acyltransferase At5g47980-like   69.7    2e-09    
ref|XP_002964139.1|  BAHD family acyltransferase                      69.7    2e-09    
gb|AAM62785.1|  acyltransferase-like protein                          69.7    2e-09    
ref|XP_008454499.1|  PREDICTED: BAHD acyltransferase At5g47980-like   69.7    2e-09    
ref|XP_004240930.1|  PREDICTED: vinorine synthase-like                69.7    2e-09    
ref|XP_008368264.1|  PREDICTED: vinorine synthase-like                69.7    2e-09    
ref|XP_002964534.1|  hypothetical protein SELMODRAFT_405848           69.7    2e-09    
ref|XP_006372866.1|  hypothetical protein POPTR_0017s05810g           69.7    2e-09    
ref|XP_001754825.1|  predicted protein                                69.7    2e-09    
ref|XP_011000149.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...  69.3    3e-09    
ref|XP_009378418.1|  PREDICTED: uncharacterized protein LOC103966919  68.9    3e-09    
gb|KFK34173.1|  hypothetical protein AALP_AA5G109900                  69.3    3e-09    
emb|CDR07647.1|  Transferase                                          69.3    3e-09    
ref|XP_011047581.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...  68.6    4e-09    
ref|XP_010088398.1|  Salutaridinol 7-O-acetyltransferase              68.9    4e-09    
ref|XP_010097637.1|  Salutaridinol 7-O-acetyltransferase              68.9    4e-09    
ref|XP_010031390.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  68.9    4e-09    
gb|KHN13395.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...  68.9    4e-09    
ref|XP_009783396.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  68.6    5e-09    
ref|XP_003548918.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  68.6    5e-09    
ref|WP_030683835.1|  hypothetical protein                             68.6    5e-09    
gb|EYU21749.1|  hypothetical protein MIMGU_mgv1a006630mg              68.6    5e-09    
gb|KFK28037.1|  hypothetical protein AALP_AA8G463700                  68.6    5e-09    
ref|XP_010529016.1|  PREDICTED: BAHD acyltransferase At5g47980-like   68.6    5e-09    
ref|XP_010041158.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  66.6    6e-09    
ref|XP_003580268.1|  PREDICTED: uncharacterized protein LOC100831202  68.2    6e-09    
ref|XP_001762426.1|  predicted protein                                68.6    6e-09    
ref|NP_001266253.1|  acylsugar acetyltransferase AT2                  68.6    6e-09    
ref|XP_011047580.1|  PREDICTED: anthranilate N-benzoyltransferase...  68.2    6e-09    
ref|XP_002303376.2|  transferase family protein                       67.8    6e-09    
ref|XP_006351850.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  68.2    7e-09    
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase       68.2    7e-09    
ref|XP_009781024.1|  PREDICTED: rosmarinate synthase-like             67.8    7e-09    
gb|KCW63862.1|  hypothetical protein EUGRSUZ_G01531                   68.2    7e-09    
ref|XP_010907772.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...  68.2    8e-09    
ref|XP_006362516.1|  PREDICTED: anthranilate N-benzoyltransferase...  67.8    8e-09    
ref|XP_003519204.1|  PREDICTED: protein ECERIFERUM 1-like             68.2    8e-09    
gb|AFU55348.1|  truncated acylsugar acetyltransferase                 67.4    9e-09    
gb|AFU55345.1|  truncated acylsugar acetyltransferase                 67.4    9e-09    
gb|KCW63853.1|  hypothetical protein EUGRSUZ_G01522                   67.8    9e-09    
ref|XP_011037156.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  67.8    9e-09    
ref|XP_010673394.1|  PREDICTED: protein ECERIFERUM 26-like            67.8    9e-09    
ref|XP_010068489.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  67.8    9e-09    
ref|XP_009342764.1|  PREDICTED: vinorine synthase-like                67.8    9e-09    
ref|XP_008340165.1|  PREDICTED: deacetylvindoline O-acetyltransfe...  67.8    9e-09    
ref|XP_004149124.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  67.8    9e-09    
ref|XP_009351167.1|  PREDICTED: anthranilate N-benzoyltransferase...  67.4    9e-09    
dbj|BAA87043.1|  N-hydroxycinnamoyl/benzoyltransferase                67.8    9e-09    
gb|KEH40827.1|  transferase family protein                            67.8    9e-09    
ref|XP_002875921.1|  transferase family protein                       67.8    1e-08    
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  67.8    1e-08    
ref|XP_009800587.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  67.8    1e-08    
ref|XP_004166134.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  67.8    1e-08    
ref|XP_006443123.1|  hypothetical protein CICLE_v10024067mg           67.4    1e-08    
ref|XP_002445215.1|  hypothetical protein SORBIDRAFT_07g006100        67.8    1e-08    
ref|XP_006465262.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  67.4    1e-08    
gb|KCW63863.1|  hypothetical protein EUGRSUZ_G01532                   67.4    1e-08    
ref|XP_008441993.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  67.4    1e-08    
ref|XP_004253030.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...  67.4    1e-08    
gb|KCW63860.1|  hypothetical protein EUGRSUZ_G01529                   67.4    1e-08    
ref|WP_020869191.1|  hypothetical protein                             67.4    1e-08    
gb|ACC68164.1|  unknown                                               67.4    1e-08    
ref|XP_004253033.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  67.4    1e-08    
ref|XP_010447472.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  67.4    1e-08    
ref|XP_006474077.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  66.6    1e-08    
ref|XP_006363207.1|  PREDICTED: deacetylvindoline O-acetyltransfe...  67.4    1e-08    
ref|XP_010548604.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  67.4    1e-08    
gb|EPS64937.1|  hypothetical protein M569_09840                       67.0    1e-08    
ref|XP_009346997.1|  PREDICTED: protein ECERIFERUM 26-like            67.0    1e-08    
ref|XP_010942061.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  67.0    2e-08    
ref|XP_007156582.1|  hypothetical protein PHAVU_002G000900g           66.6    2e-08    
ref|XP_006427943.1|  hypothetical protein CICLE_v10027036mg           67.0    2e-08    
ref|XP_002869305.1|  transferase family protein                       67.0    2e-08    
ref|XP_010100291.1|  Salutaridinol 7-O-acetyltransferase              67.0    2e-08    
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...  67.0    2e-08    
gb|KDO40774.1|  hypothetical protein CISIN_1g037323mg                 67.0    2e-08    
ref|XP_004310183.1|  PREDICTED: vinorine synthase-like                67.0    2e-08    
ref|XP_008348421.1|  PREDICTED: protein ECERIFERUM 26-like            67.0    2e-08    
gb|EYU24586.1|  hypothetical protein MIMGU_mgv1a0064641mg             65.5    2e-08    
ref|XP_008380478.1|  PREDICTED: protein ECERIFERUM 26-like            67.0    2e-08    
ref|XP_010556178.1|  PREDICTED: vinorine synthase                     67.0    2e-08    
ref|NP_194919.1|  BR-related acyltransferase 1                        66.6    2e-08    
gb|KGN52789.1|  hypothetical protein Csa_4G001560                     66.6    2e-08    
gb|KCW44582.1|  hypothetical protein EUGRSUZ_L01904                   66.6    2e-08    
gb|AFU55349.1|  acylsugar acetyltransferase                           66.6    2e-08    
ref|XP_009789576.1|  PREDICTED: protein ECERIFERUM 1-like             66.2    2e-08    
ref|XP_010088399.1|  Salutaridinol 7-O-acetyltransferase              66.6    2e-08    
gb|AFU55344.1|  acylsugar acetyltransferase                           66.6    2e-08    
ref|XP_011036822.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  64.7    2e-08    
ref|XP_006412537.1|  hypothetical protein EUTSA_v10025159mg           66.6    2e-08    
ref|XP_010669430.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  66.6    2e-08    
gb|AFU55343.1|  acylsugar acetyltransferase                           66.6    2e-08    
gb|AFU55340.1|  acylsugar acetyltransferase                           66.6    2e-08    
ref|XP_002964537.1|  hypothetical protein SELMODRAFT_405851           67.0    2e-08    
ref|XP_006368960.1|  hypothetical protein POPTR_0001s15250g           66.2    2e-08    
ref|XP_002981455.1|  BAHD family acyltransferase, clade V             66.6    3e-08    
gb|AFU55351.1|  acylsugar acetyltransferase                           66.2    3e-08    
gb|AFU55341.1|  acylsugar acetyltransferase                           66.2    3e-08    
ref|XP_002308878.2|  hypothetical protein POPTR_0006s03450g           66.2    3e-08    
ref|WP_014054225.1|  transferase                                      66.2    3e-08    
ref|XP_011084630.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  66.2    3e-08    
ref|XP_004143047.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...  66.2    3e-08    
ref|XP_010068273.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...  66.2    3e-08    
ref|WP_037963216.1|  hypothetical protein                             66.2    3e-08    
ref|XP_010437980.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  66.2    3e-08    
ref|XP_010467740.1|  PREDICTED: spermidine hydroxycinnamoyl trans...  66.2    3e-08    
ref|XP_011029622.1|  PREDICTED: BAHD acyltransferase At5g47980        66.2    3e-08    
ref|XP_006282253.1|  hypothetical protein CARUB_v10028527mg           66.6    3e-08    
gb|AFU55350.1|  acylsugar acetyltransferase                           66.2    3e-08    
ref|XP_004310025.1|  PREDICTED: vinorine synthase-like                65.9    3e-08    
ref|XP_010918051.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  65.9    3e-08    
ref|XP_002969985.1|  BAHD family acyltransferase, clade V             65.9    3e-08    
gb|KDO37672.1|  hypothetical protein CISIN_1g0394691mg                65.5    4e-08    



>ref|XP_002514352.1| transferase, putative [Ricinus communis]
 gb|EEF48306.1| transferase, putative [Ricinus communis]
Length=448

 Score =   452 bits (1162),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 250/449 (56%), Positives = 314/449 (70%), Gaps = 24/449 (5%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY-----REFDKDYTKLNESIAET  1297
             ICKRTVVST  VQPGKF PL+VL R+ME N +RIV+Y+     RE  +   KL ES++E 
Sbjct  7     ICKRTVVSTKPVQPGKFFPLSVLGRLMERNHLRIVYYFQTPGGREAGEITKKLRESLSEL  66

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L  Y I+ GRLL+    QW++KCNDAG+RV+EA+AKGSV+EWL ++DR+KEL L+HWE M
Sbjct  67    LTCYPIVTGRLLKDQDGQWMVKCNDAGVRVVEARAKGSVEEWLRSLDREKELTLIHWEEM  126

Query  1116  MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphf  937
                PYFWS FYVQLTEFEE G ++GLSC H LADP  AT+F+KAWAD +F+GKMISPP F
Sbjct  127   FHKPYFWSTFYVQLTEFEESGFAIGLSCFHPLADPTCATIFMKAWADTTFSGKMISPPLF  186

Query  936   hplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVR  757
             HPLPPRRP N   N    +   L+NHYK  +T       + T+     T++LLFTD M+R
Sbjct  187   HPLPPRRPGNKIPNHQPYT--HLINHYK--STIGKTSSVTATTGHAYATVALLFTDPMIR  242

Query  756   ACMSMAQT--------PDAFDALAGLLWTRISKAKNNV-GLMDLAVGLDVRKVLGLDKGF  604
             ACM+M++T        P  F AL+GL W  ISK K    GL+D+++ LD+RKVLGLD GF
Sbjct  243   ACMAMSRTTRRPDQPNPSPFQALSGLFWACISKVKGKENGLIDMSICLDMRKVLGLDHGF  302

Query  603   YGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNV  424
             +GNCMVYNKV+  S    L +D +S A  AI     +MD EGIMDLIEWL+ N+C    +
Sbjct  303   FGNCMVYNKVQPKS----LSNDKISSATWAIEEEMAKMDTEGIMDLIEWLESNDCQTPPL  358

Query  423   LDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRT  244
             ++GCD L+C NLEGVDPY A F   + P+ VSY+VEP  G G ++L+LPSPPG GA+S+ 
Sbjct  359   MNGCD-LICANLEGVDPYLAIFEGGLAPIRVSYHVEPVSGAG-QVLVLPSPPGEGAMSKV  416

Query  243   VMVTLPENEAVKLMEDQLIHQLSPCIKMG  157
             VMVTLPE+E  KL ED LI   SP I +G
Sbjct  417   VMVTLPEDEVFKLCEDDLILGFSPAILLG  445



>emb|CDP04825.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   448 bits (1152),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 247/454 (54%), Positives = 312/454 (69%), Gaps = 35/454 (8%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYTKLNESIA  1303
             S ICKRTVVST  V+ GKFCPL+VLDR+ME+N VR+V YYR     +  +    L ES+A
Sbjct  5     SWICKRTVVSTKPVEAGKFCPLSVLDRIMEHNHVRVVLYYRCPKERKAGESIRMLRESLA  64

Query  1302  ETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWE  1123
             E L+AY I+ GRLL++    W+IKCNDAG+R++EA+AKG VD+WL N DR+KEL LVHWE
Sbjct  65    ELLSAYPIVTGRLLKTAEGHWMIKCNDAGVRMVEARAKGRVDKWLQNFDREKELNLVHWE  124

Query  1122  PMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpp  943
             PM    YFWS FYVQLTEFEEGGL++GLSC HLL+DPI  T+FIKAWADM+  GKM++PP
Sbjct  125   PMFHKLYFWSTFYVQLTEFEEGGLAVGLSCGHLLSDPICVTIFIKAWADMTLNGKMVTPP  184

Query  942   hfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEM  763
              FH LP RR CN   NP      +L+N+YK        + P      +  TI + F DEM
Sbjct  185   LFHRLPRRRQCNETTNPQPFP--ELINYYKSTL-----EKPVPVVQAKQTTIKIAFGDEM  237

Query  762   VRACMSMAQTPDA--------FDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGLDK  610
             VR+C++M+  P +        F ALAGL W  ISK K    GL+ +++ LD+RKVLGLDK
Sbjct  238   VRSCIAMSHAPGSPDEPSPTPFQALAGLFWVGISKIKGLKNGLITMSICLDMRKVLGLDK  297

Query  609   GFYGNCMVYNKVKWSSGSMVLGDDL----LSQAANAIRNMRKEMDKEGIMDLIEWLDQNN  442
             GF+GNCMVYN+V         GD +    LS+AANAIR +   MD EGIM+LIEW++   
Sbjct  298   GFFGNCMVYNRVP--------GDGIEEYELSKAANAIREVVDTMDAEGIMNLIEWMEGKA  349

Query  441   CCASNVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGT  262
                S +++G D L+CVNLE VD YSA F  N  P+H SYY+EP +G G  +L+LPSPPG 
Sbjct  350   DQFSCLMNGYD-LICVNLEHVDSYSAIFEENFKPIHASYYIEPTVGEG-MILVLPSPPGE  407

Query  261   GALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
             G+ SR VM+TLPE+EA+ L+ED+LI Q SP I M
Sbjct  408   GSFSRVVMITLPEDEAINLLEDKLIQQFSPTILM  441



>ref|XP_007223985.1| hypothetical protein PRUPE_ppa014744mg [Prunus persica]
 gb|EMJ25184.1| hypothetical protein PRUPE_ppa014744mg [Prunus persica]
Length=448

 Score =   433 bits (1113),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 244/453 (54%), Positives = 311/453 (69%), Gaps = 28/453 (6%)
 Frame = -2

Query  1473  ISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY------REFDKDYTKLNE  1312
             I + ICKRTVVST  VQ GK  PL+VLDR ME+N +R+V YY       E  +   +L E
Sbjct  4     IITIICKRTVVSTKPVQAGKSYPLSVLDRHMEHNHLRMVLYYPSMGAPTEPGEITGRLRE  63

Query  1311  SIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLV  1132
             S+A  L  + I+ GRL ++  +QW+IKCNDAG+R++EAKAKGS++EWL NVDRDKEL LV
Sbjct  64    SLAVMLTHFPIVTGRLQKNDNDQWMIKCNDAGVRMLEAKAKGSLEEWLRNVDRDKELMLV  123

Query  1131  HWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMI  952
             +WE M   PYFWS FYVQ+TEFE+GGL++GLSCTHLLADP  ATMFIKAWAD +F GKM+
Sbjct  124   YWEEMYHKPYFWSTFYVQITEFEDGGLAIGLSCTHLLADPTCATMFIKAWADTTFPGKMM  183

Query  951   SpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFT  772
             S P F+PLP R P N   N +  +S  L+ HYK    +  D         +  T+S  F+
Sbjct  184   SLPFFYPLPRRSPGNTRPNHNTYNS--LITHYKASINESID-----LVDKKHTTVSFGFS  236

Query  771   DEMVRACMSMAQ--------TPDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLG  619
             D+MVRACM MAQ        +P  F+ALAGL W  ISK K    GL+D+++ +DVR+VLG
Sbjct  237   DDMVRACMEMAQPDGANDKSSPSPFEALAGLFWVCISKVKGVRNGLIDMSISIDVRQVLG  296

Query  618   LDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNC  439
             LDKGF+GN MVYNKV   S      ++ LSQAA +I  +  +MD EGIMDLIEWL  N+ 
Sbjct  297   LDKGFFGNSMVYNKVHLES----FQENSLSQAATSIGEVVAKMDNEGIMDLIEWLQCNDD  352

Query  438   CASNVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTG  259
              + ++++GCD L+C +LE VDP+SA F + + P+HVS Y+EP +G G ++LILP+ P  G
Sbjct  353   QSPSLMNGCD-LICASLEAVDPFSAIFEDGIAPIHVSCYIEPVLGLG-KVLILPAKPKDG  410

Query  258   ALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
              LSR VMVTLP +E  KL ED LI QLSP I M
Sbjct  411   QLSRAVMVTLPRDEVTKLCEDDLILQLSPTILM  443



>ref|XP_002282283.1| PREDICTED: protein ECERIFERUM 26-like [Vitis vinifera]
 emb|CBI20979.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   430 bits (1106),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 241/457 (53%), Positives = 311/457 (68%), Gaps = 36/457 (8%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYTKLNESIA  1303
             S ICKRTVVST  VQPGK  PL+ LDR M++N VRIV+YYR     E  +   +L E+I+
Sbjct  5     SYICKRTVVSTKPVQPGKTHPLSALDRAMDHNRVRIVYYYRTPPGREVGEVTKRLRETIS  64

Query  1302  ETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWE  1123
             E L ++ ++ GRL R+   QW++KCNDAG+R++EA+AKGSV EWL +VDR+KELKLVHWE
Sbjct  65    EMLTSFPMVTGRLQRNEEGQWVVKCNDAGVRMVEARAKGSVGEWLKSVDREKELKLVHWE  124

Query  1122  PMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpp  943
              M    YFWS FYVQLTEFEEGGL++G SCTHLLADPI ATM IKAWAD S  G+M +PP
Sbjct  125   DMFHKIYFWSTFYVQLTEFEEGGLAIGFSCTHLLADPICATMIIKAWADTSLLGEMPNPP  184

Query  942   hfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEM  763
              FH   P     N+ N +  +   L+NHYK  ++ D   P + T   +  TI+LLFT+ M
Sbjct  185   LFHSSLPLIRPVNSINHNPYT--HLINHYK--SSLDNSTPVTNT---KYTTIALLFTNPM  237

Query  762   VRACMSMAQT----------PDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGL  616
             V+ACM MA+T          P  F+ALAGL WT IS  K    GL+++++ LD+RKVLGL
Sbjct  238   VQACMEMARTHPEAHGTPIFPSPFEALAGLFWTCISNVKGWREGLINMSICLDMRKVLGL  297

Query  615   DKGFYGNCMVYNKVKWSSGSMVLGDDL----LSQAANAIRNMRKEMDKEGIMDLIEWLDQ  448
             D+GF+GNCMVYN V+        G D     +S+AA AIR + ++MD E IMDLI+WL+ 
Sbjct  298   DEGFFGNCMVYNAVR--------GGDFNRHEISKAAMAIRGVMEKMDSEEIMDLIQWLEC  349

Query  447   NNCCASNVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPP  268
             ++  +S ++ GC+ L+C NLE V+PYSA F     PV VSY++EP +    ++LILP+PP
Sbjct  350   DSNRSSVLMGGCEHLICTNLEDVEPYSAKFEEGYAPVRVSYHIEP-VSTKGQVLILPAPP  408

Query  267   GTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKMG  157
               G LSR VMVTLPENEAVKL +D  +   SP I MG
Sbjct  409   EEGPLSRVVMVTLPENEAVKLCKDVRVLSFSPTILMG  445



>ref|XP_011081909.1| PREDICTED: protein ECERIFERUM 26-like [Sesamum indicum]
Length=446

 Score =   421 bits (1081),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 236/452 (52%), Positives = 300/452 (66%), Gaps = 31/452 (7%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY-----REFDKDYTKLNESIA  1303
             S ICKRTV ST  VQ G+F PL++LDRVME+N +R+VFYY     R   +   KL ESI+
Sbjct  5     SFICKRTVSSTKPVQAGQFSPLSILDRVMEHNHLRVVFYYSLQTRRRAGELTKKLRESIS  64

Query  1302  ETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWE  1123
               L+A+ ++ GRLLR+    W IKCND+G+R++EA+ +G++DEWL NVDR+KELKLVHWE
Sbjct  65    AMLSAFPVVTGRLLRTSEGDWTIKCNDSGVRMVEARVEGTIDEWLKNVDREKELKLVHWE  124

Query  1122  PMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpp  943
              M   PYFWS FYVQ+TEFE GGL++GLSCTHLL+DP  A M IKAWAD++  G++I+PP
Sbjct  125   DMFHRPYFWSTFYVQITEFEGGGLAIGLSCTHLLSDPTCAAMMIKAWADVTLHGEIIAPP  184

Query  942   hfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEM  763
              FHPLPP R    N N H       +NHYK    +       Q S  +  TI+L F  +M
Sbjct  185   FFHPLPPPRTGKKNRNFHS------INHYKSAKENS-----VQASETKQTTITLNFNQQM  233

Query  762   VRACMSMAQTPDA---------FDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGLD  613
             V+ C++MA+  +A         F+ALA L WTRISK K     L+D+++ LDVRKVLGL+
Sbjct  234   VKICIAMARATNAHNSEQSLTPFEALAALFWTRISKVKGMKSALVDMSLCLDVRKVLGLE  293

Query  612   KGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCA  433
             KGF+GNCMVYN+VK   G  +   D LS+AA  I+    + D++ +MDLIEWL+Q N   
Sbjct  294   KGFFGNCMVYNRVK---GDGIQETD-LSRAAGFIKEAVSKTDRDEVMDLIEWLEQENWEK  349

Query  432   SNVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGAL  253
             +        L+C NLE VD YSA F  N  P+ VSYY+EP  G G ++LILPSP G GA 
Sbjct  350   NPSCMNGSCLICANLENVDSYSAIFEENSSPLRVSYYIEPVAGAG-QILILPSPGGDGAC  408

Query  252   SRTVMVTLPENEAVKLMEDQLIHQLSPCIKMG  157
             SR V VTLPE EA KL+ED LI Q  P I MG
Sbjct  409   SRVVSVTLPEVEAEKLLEDGLIKQFGPTIWMG  440



>ref|XP_008219914.1| PREDICTED: protein ECERIFERUM 26-like [Prunus mume]
Length=448

 Score =   419 bits (1076),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 241/453 (53%), Positives = 304/453 (67%), Gaps = 28/453 (6%)
 Frame = -2

Query  1473  ISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYT------KLNE  1312
             I + ICKRTVVST  VQ GK  PL+VLDR ME+N +R+V YY              +L E
Sbjct  4     IITIICKRTVVSTKPVQAGKSYPLSVLDRHMEHNHLRMVLYYPSMGAPTKPGEITGRLRE  63

Query  1311  SIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLV  1132
             S+A TL  + I+ GRL ++  +QW+IKCNDAG+R++EAKAKGS++EWL NVDRDKEL LV
Sbjct  64    SLAVTLTHFPIVTGRLQKNDNDQWMIKCNDAGVRMLEAKAKGSLEEWLRNVDRDKELMLV  123

Query  1131  HWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMI  952
             +WE M   PYFWS FYVQ+TEFE+GGL++GLSCTHLLADP  ATMFIKAWAD SF GKM+
Sbjct  124   YWEEMYHKPYFWSTFYVQITEFEDGGLAIGLSCTHLLADPTCATMFIKAWADTSFLGKMM  183

Query  951   SpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFT  772
             SP  F+ LPPRRP N   N    +S  L+NHYK       D         +  T+S  F+
Sbjct  184   SPLFFYQLPPRRPGNTRPNYEPYNS--LINHYKASINKSID-----LVDKKHTTVSFSFS  236

Query  771   DEMVRACMSMAQ--------TPDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLG  619
             D+MVRACM MAQ        +P  F+ALAGL W  ISK K    GL+D+++ LD RKVLG
Sbjct  237   DDMVRACMEMAQPNGANDKLSPSPFEALAGLFWVCISKVKGVRNGLIDMSISLDARKVLG  296

Query  618   LDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNC  439
             LDKGF+GN  VYNKV   S      ++ LSQAA +I  +  +MD +GIMDLIEWL  N+ 
Sbjct  297   LDKGFFGNSTVYNKVHLES----FQENSLSQAATSIGEVVAKMDNKGIMDLIEWLRCNDD  352

Query  438   CASNVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTG  259
              + ++++ CD L+C +LE VD + A F + + P+HVS Y+EP +G G ++LILP+ P  G
Sbjct  353   QSPSLMNNCD-LICASLEVVDLFLAIFEDGIAPIHVSCYIEPVLGLG-KVLILPAKPRDG  410

Query  258   ALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
              LSR VMVTLP +E  KL +  LI QLSP I M
Sbjct  411   QLSRVVMVTLPRDEVTKLCQTDLILQLSPTILM  443



>ref|XP_011026508.1| PREDICTED: protein ECERIFERUM 26 [Populus euphratica]
Length=445

 Score =   417 bits (1073),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 237/451 (53%), Positives = 302/451 (67%), Gaps = 27/451 (6%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYTKLNESIA  1303
             + ICKRTVVST  VQPGK C L+VLDR+ME N +R V+Y+R     E  +   KL ES++
Sbjct  5     TCICKRTVVSTKSVQPGKHCSLSVLDRLMEQNHLRSVYYFRTPGGREPGEITKKLRESLS  64

Query  1302  ETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWE  1123
             E L  + I+ GRLL+ P   W+IKCNDAG+R++EA+ KGSV++WL +VDR++ELKLVHWE
Sbjct  65    EMLTCFPIVTGRLLKDPKGHWMIKCNDAGVRMVEARIKGSVEDWLKSVDREQELKLVHWE  124

Query  1122  PMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpp  943
              M   PYFWS FYVQ+TEF EGGL++GLSC HLLADP  ATMF+KAWAD++ TGKM++PP
Sbjct  125   EMYHKPYFWSTFYVQITEFGEGGLAIGLSCFHLLADPTCATMFVKAWADVTLTGKMLNPP  184

Query  942   hfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEM  763
              FH LPPRRP   N +       +L+N Y KP  D  +      +  +  TI+L F+D M
Sbjct  185   LFHQLPPRRPGGKNSSHEPYM--ELINCY-KPIADKTN----LVTDTKHATIALAFSDPM  237

Query  762   VRACMSMAQT--------PDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGLDK  610
             VRACM+  Q         P  F+AL GL W  ISK K     L+D+++  D+R VL LD 
Sbjct  238   VRACMANGQATNAIDQSIPSPFEALGGLFWVCISKLKGAGDRLIDMSICSDMRNVLHLDN  297

Query  609   GFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCAS  430
             GF+GNCMVYNKV   S    L +  LS  A AI  +  +MD +GI+DLIEWL+ N C + 
Sbjct  298   GFFGNCMVYNKVNSKS----LTEHKLSDVAKAIGEVMAKMDNDGIIDLIEWLEHNGCQSP  353

Query  429   NVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALS  250
               ++GC+ L+C +LE VDPY A F     P+ VS YVEP +G G+ +L+LPSPP  G LS
Sbjct  354   PPMNGCE-LMCASLEAVDPYLAVFEEGFVPIRVSSYVEPVVGAGH-VLVLPSPPCEGPLS  411

Query  249   RTVMVTLPENEAVKLMEDQLIHQLSPCIKMG  157
             RTVMVTLPE+EA +L ED LI   SP I MG
Sbjct  412   RTVMVTLPEDEAARLCEDDLILHFSPTILMG  442



>ref|XP_004498644.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cicer 
arietinum]
Length=451

 Score =   416 bits (1070),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 235/452 (52%), Positives = 301/452 (67%), Gaps = 28/452 (6%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYTKLNESIA  1303
             STICKRTVVST  V+ GK+ PL+VLDR+ME N +R+V+YY+     E      KL E+++
Sbjct  6     STICKRTVVSTKAVEAGKYLPLSVLDRLMEKNRIRMVYYYQTSGDLELGILTKKLRETLS  65

Query  1302  ETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWE  1123
             E L  + I+ GRLLR     W IKCNDAG+R++E+KAKGSV+ WL NVDR+KELKLV+WE
Sbjct  66    EMLIHFPIVTGRLLRDDVGHWRIKCNDAGVRMVESKAKGSVEGWLRNVDREKELKLVYWE  125

Query  1122  PMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpp  943
              +   PY+WS FYVQLTEFEEGGL++GLSCTHLLAD I AT F+K WAD+S   KMIS P
Sbjct  126   DIPQKPYYWSTFYVQLTEFEEGGLAIGLSCTHLLADSICATRFMKTWADISLGNKMISLP  185

Query  942   hfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEM  763
              FHPLP ++  N   N +      L+ HYK        + P      R  TIS+ F+D M
Sbjct  186   IFHPLPSQKSQNKKLNNNQYMG--LIAHYKSSI-----EKPISIKEARYTTISMGFSDHM  238

Query  762   VRACMSMAQ----------TPDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGL  616
             V+ACMSMAQ          TP  F+ALAGL W  +SK K    GL+D+++ LDVRK+LGL
Sbjct  239   VQACMSMAQPSGPSSPKPTTP--FEALAGLFWVALSKIKGIKNGLVDMSICLDVRKILGL  296

Query  615   DKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCC  436
             DKGF+GN M+YNKV    G+  L ++    A  AIR++   +D EGIMDLI+W + N+  
Sbjct  297   DKGFFGNSMIYNKVHL-EGNFNLDENKFPHATRAIRDVVATIDNEGIMDLIDWFENNDIN  355

Query  435   ASNVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGA  256
             +S +++G D LVC +LE V+PY A F   + P+ VSYY+EP  G G+ +LI P+P   G 
Sbjct  356   SSPMMNGHD-LVCTSLENVNPYLAMFEERLKPIRVSYYIEPIFGEGH-ILIFPTPHDEGP  413

Query  255   LSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
             L R VMVTL E EA+KL ED+LI Q SP I M
Sbjct  414   LGRVVMVTLQEEEAIKLCEDELISQFSPTILM  445



>ref|XP_008392130.1| PREDICTED: protein ECERIFERUM 26-like [Malus domestica]
Length=448

 Score =   415 bits (1067),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 240/449 (53%), Positives = 309/449 (69%), Gaps = 28/449 (6%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY------REFDKDYTKLNESIAE  1300
             ICKRTVVST  VQ GK  PL+VLDR ME N +R+V YY       +  +  TKL ES+A 
Sbjct  8     ICKRTVVSTKPVQAGKTYPLSVLDRHMEVNHLRMVLYYPSTGLPTKPGEITTKLRESLAV  67

Query  1299  TLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEP  1120
             TL  Y II GRL ++  EQW+IKCNDAG+R+IEAKA+GS++EWL NVDR+KEL LV+WE 
Sbjct  68    TLTNYPIITGRLQKNDKEQWMIKCNDAGVRMIEAKARGSLEEWLRNVDREKELMLVYWEE  127

Query  1119  MMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpph  940
             M   PYFWS FYVQLTEFE+GGL++GLSCTHLLAD   ATMFIKAWA+ +   KM+ PP 
Sbjct  128   MYHKPYFWSTFYVQLTEFEDGGLAIGLSCTHLLADQTCATMFIKAWANTTLFSKMMHPPF  187

Query  939   fhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMV  760
             F+PLP RRP N   N    ++  L+NHYK   +             +  T++L+F+D+MV
Sbjct  188   FYPLPQRRPGNRKLNQKPYTA--LINHYKTSISKS-----IHIVDAKHTTVTLVFSDDMV  240

Query  759   RACMSMAQ--------TPDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGLDKG  607
             RAC++MAQ        +P  F+AL+GL W  ISK K    GL+D+++ +D+RKVLGLDKG
Sbjct  241   RACIAMAQPIDGTDKSSPTPFEALSGLFWVCISKVKGVRNGLVDMSIRMDMRKVLGLDKG  300

Query  606   FYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASN  427
             F+GNCMVYNKV          +D LSQAA++I  +  +MD+EGIMDLIEWL   +  + +
Sbjct  301   FFGNCMVYNKVHLEG----FQEDNLSQAASSIGEVVAKMDREGIMDLIEWLVCKDDRSQS  356

Query  426   VLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSR  247
              ++GCD L+C +LEGVD +S  F + + P+ VS YVEP  G G ++LILP+ PG G LSR
Sbjct  357   FMNGCD-LICASLEGVDLFSIIFEDVIVPIRVSCYVEPVSGLG-QVLILPAKPGDGELSR  414

Query  246   TVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
              VMVTLP +EA+K+ E  LI +LSP I M
Sbjct  415   VVMVTLPRDEAIKMCEHDLILRLSPTILM  443



>ref|XP_003588700.1| Taxadien-5-alpha-ol O-acetyltransferase [Medicago truncatula]
 gb|AES58951.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=448

 Score =   414 bits (1063),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 234/451 (52%), Positives = 303/451 (67%), Gaps = 25/451 (6%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYTKLNESIA  1303
             S +CKRTVVST  V+PGK+ PL+VLDR M+ N +R+V+YY+     E  +   KL E+++
Sbjct  6     SIVCKRTVVSTKAVEPGKYLPLSVLDRFMDKNHIRMVYYYQTSGDLELGQLTKKLRETLS  65

Query  1302  ETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWE  1123
             E L+ + I+ GRLLR     W IKCNDAG+R++EAKAKGSV+EWL +VDR+KELKLV+WE
Sbjct  66    EMLSHFPIVTGRLLRDEMGHWKIKCNDAGVRMVEAKAKGSVEEWLRSVDREKELKLVYWE  125

Query  1122  PMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpp  943
              M+  PY+WS FYVQLTEFEEGGL++GLSCTHLLAD I AT F+KAWAD+S   K+ SPP
Sbjct  126   DMLQKPYYWSTFYVQLTEFEEGGLAIGLSCTHLLADSICATKFMKAWADISLGNKITSPP  185

Query  942   hfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEM  763
              FHPLP +RP N   N +   S  L++HYK    +     P      +  TIS+ F+D+M
Sbjct  186   IFHPLPHQRPQNRKPNNNSYMS--LISHYKSLIEN-----PISIKEAKYTTISMGFSDQM  238

Query  762   VRACMSMAQ---------TPDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGLD  613
             V+AC+SMAQ         TP  F+ALAGL W  +SK K    GL+D ++ LDVRK+LGLD
Sbjct  239   VQACISMAQPNDSLSPTSTPTPFEALAGLFWVTLSKIKGIKNGLVDTSLYLDVRKILGLD  298

Query  612   KGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCA  433
             +GF+GN M+YNKV     +  L  D   QA  AIRN+  +   E IM LIEW + N+  +
Sbjct  299   EGFFGNSMLYNKVHLDE-NFNLDYDKFPQATKAIRNVVTKFGNEEIMGLIEWFENNDINS  357

Query  432   SNVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGAL  253
             S +++G D LV  +LE V+PY A F +   P+HVSYY+EP  G G+ +LILP+    G L
Sbjct  358   SAMMNGHD-LVFTSLENVEPYLAMFQDKFKPIHVSYYIEPVFGEGH-VLILPTSNDEGPL  415

Query  252   SRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
              R VMVTL E EA+KL ED+ I Q SP I M
Sbjct  416   GRVVMVTLQEEEAIKLCEDEFILQFSPTILM  446



>ref|XP_007161246.1| hypothetical protein PHAVU_001G054300g [Phaseolus vulgaris]
 gb|ESW33240.1| hypothetical protein PHAVU_001G054300g [Phaseolus vulgaris]
Length=443

 Score =   406 bits (1043),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 228/450 (51%), Positives = 291/450 (65%), Gaps = 28/450 (6%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR------EFDKDYTKLNESI  1306
             S ICKRTVVST  V+PGK+ PL+ LDR MENN +R+V YY+      E  +   KL ES+
Sbjct  6     SYICKRTVVSTKAVEPGKYFPLSALDRYMENNHIRLVCYYQSSREVVELGEMSKKLRESL  65

Query  1305  AETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHW  1126
             +E L  + ++ GRL R     W IKCNDAG+RV+EAKAKGSV+ WL N+DR+KEL+LVHW
Sbjct  66    SEMLTDFPMVSGRLTRDERGHWKIKCNDAGVRVVEAKAKGSVEGWLANLDREKELQLVHW  125

Query  1125  EPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISp  946
             E M   PY+WS FYVQLTEFEEGGL++GLSC HLLAD  SA  F+KAWAD+S   K+++ 
Sbjct  126   EEMFHKPYYWSTFYVQLTEFEEGGLAIGLSCAHLLADSTSAISFMKAWADISKGNKILT-  184

Query  945   phfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDE  766
                   P       N NP+H+   +L++HYK        + P      R  TIS+ F+  
Sbjct  185   -PPLFHPLPLTREPNTNPNHHPHMELIHHYKSLI-----QKPISLKESRYTTISMGFSAH  238

Query  765   MVRACMSMAQ-----TPDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGLDKGF  604
             MV+ACMS AQ     TP  F ALA L W  +SK K    GL+D+++ LD+RKVLGLD GF
Sbjct  239   MVQACMSTAQLNGPITP--FAALAALFWISLSKVKGFRNGLVDMSICLDMRKVLGLDTGF  296

Query  603   YGNCMVYNKVKWSSGSMVLGDDLLS--QAANAIRNMRKEMDKEGIMDLIEWLDQNNCCAS  430
             +GNCMVYNKV    G    G+  L+  +A  AI ++  +MD EG+MDLIEWL+ ++  + 
Sbjct  297   FGNCMVYNKVHEVEG----GNHKLNFPEAVRAISDVVAKMDYEGVMDLIEWLENDDVNSP  352

Query  429   NVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALS  250
               +     LVC +LEGVDPY   F +   P+HVS YVEP +G G ++LILP PPG G LS
Sbjct  353   PTMMNGHDLVCASLEGVDPYLTVFQDGFKPIHVSCYVEPVLGEG-QVLILPGPPGEGPLS  411

Query  249   RTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
             R  MVT+ E EA+KL ED+LI Q SP   M
Sbjct  412   RVAMVTIREEEAIKLCEDELISQFSPTTLM  441



>ref|XP_010102806.1| Vinorine synthase [Morus notabilis]
 gb|EXB94134.1| Vinorine synthase [Morus notabilis]
Length=445

 Score =   398 bits (1023),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 217/447 (49%), Positives = 283/447 (63%), Gaps = 21/447 (5%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR------EFDKDYTKLNESI  1306
             + ICKRTVVST  V PGKF PL+ +D++ME N +R+VFYY       E  +   +L ES+
Sbjct  6     TLICKRTVVSTKPVPPGKFFPLSKIDQLMEKNHLRMVFYYPPIGDMLESGQVTRRLRESL  65

Query  1305  AETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHW  1126
             AE L  +  + GRLLR+   QW+IKCNDAG+R+IEA+AKGSV++W   V+R+KE KLV+W
Sbjct  66    AELLTHFPAVTGRLLRNDKGQWMIKCNDAGVRMIEARAKGSVEDWFKCVNREKEFKLVYW  125

Query  1125  EPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISp  946
             E M   PYFWS FYVQLTEFE+GG ++GLSC HL+ D   ATMFI +WA  +F GKM++ 
Sbjct  126   EEMYHKPYFWSTFYVQLTEFEDGGFAVGLSCIHLVGDITCATMFINSWAQTTFYGKMVAS  185

Query  945   phfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDE  766
                   P +      ++  + S   L+NHYK          P   +  +  T S  F D 
Sbjct  186   YFHPLPPRKPGNKKPNHTPYIS---LINHYKSTIEKSNSIIPMVET--KYTTASFAFADR  240

Query  765   MVRACMSMAQT---PDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGLDKGFYG  598
              VRACM+  Q    P  F+ALAGL W  ISK K    GL+D++V  D+R VLG+DK F+G
Sbjct  241   AVRACMATTQRRHGPSPFEALAGLFWVCISKVKGLTNGLVDMSVCFDMRTVLGVDKRFFG  300

Query  597   NCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLD  418
             NCMVYN V          ++ LS AANAI  +  +MD EGIMDLIEWL + +     +++
Sbjct  301   NCMVYNSVHAKG----FRENDLSGAANAIAEVVAKMDNEGIMDLIEWLQRRDDEKLPLMN  356

Query  417   GCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTVM  238
             GCD LVC +L   DPY A FG  + P+ VSYYVEP +G G ++L+ P PPG G LSR VM
Sbjct  357   GCD-LVCASLGPADPYLAMFGGGVRPIRVSYYVEPVLGLG-QVLVFPGPPGEGPLSRVVM  414

Query  237   VTLPENEAVKLMEDQLIHQLSPCIKMG  157
             VTLP +E V+L ED L+ + +P I MG
Sbjct  415   VTLPHDEVVRLCEDDLLLRFTPAIIMG  441



>ref|XP_006450533.1| hypothetical protein CICLE_v10008314mg [Citrus clementina]
 gb|ESR63773.1| hypothetical protein CICLE_v10008314mg [Citrus clementina]
Length=441

 Score =   397 bits (1020),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 224/441 (51%), Positives = 292/441 (66%), Gaps = 14/441 (3%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYTKLNESIAET  1297
             ICK+TVVST   Q GK  PL+V DR+ME N +RIV+Y+      E      KL ES++  
Sbjct  9     ICKQTVVSTKPAQAGKCNPLSVFDRLMEKNHIRIVYYFPSTRNGEPGVVTKKLRESLSHV  68

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L  + I+ GRL +     W+IKCNDAG+R++EA+A+GSV+EWL NV+RDKEL LV WE M
Sbjct  69    LTCFPIVTGRLQKKDDGHWMIKCNDAGVRMVEARAQGSVEEWLKNVNRDKELMLVTWEDM  128

Query  1116  MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphf  937
                PYFW+ FYVQLTEFEEGGL++G SC+HLLADP SATMF+KAWAD +  G M++PP F
Sbjct  129   FHKPYFWATFYVQLTEFEEGGLAIGFSCSHLLADPTSATMFVKAWADTTLAGTMLAPPFF  188

Query  936   hplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVR  757
             HPLPP R  N N N +  +  DL+NHYK  +T D   P    +     T +L F+  MV+
Sbjct  189   HPLPPPRLGNKNPNHNPYT--DLINHYK--STIDDRSPAFTNNITNYATATLAFSGPMVQ  244

Query  756   ACMSMAQTPDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGLDKGFYGNCMVYN  580
             ACM    +P  F+A+AGLLW  +SK K    GL+ +++ LD+RK LGLDKGF+GNCMVYN
Sbjct  245   ACMLDTSSPSPFEAMAGLLWVCVSKVKGMKQGLLSMSICLDMRKQLGLDKGFFGNCMVYN  304

Query  579   KVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGCDSLV  400
             KV  +    +L    LS+AA A+     +M+ EGIMDLIEWL+ ++     +++ C  L+
Sbjct  305   KVHHAES--LLDKRKLSEAARAVGESVTKMNNEGIMDLIEWLEHHDYEFPPLMN-CHDLI  361

Query  399   CVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTVMVTLPEN  220
             C NLE +DPY+  F     P+ VSYYVEP  G G ++L+L SPP  G LSR V VTLP +
Sbjct  362   CANLEDLDPYATLFEEGFVPIRVSYYVEPVFGIG-QILVLQSPPSEGPLSRMVTVTLPAD  420

Query  219   EAVKLMEDQLIHQLSPCIKMG  157
             E  KL +D LI + +P I MG
Sbjct  421   ELSKLCDDDLILRFNPTILMG  441



>ref|XP_003549253.1| PREDICTED: protein ECERIFERUM 1-like [Glycine max]
 gb|KHN45205.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=440

 Score =   396 bits (1017),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 232/448 (52%), Positives = 301/448 (67%), Gaps = 28/448 (6%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYTKLNESIA  1303
             + ICKRTVVST  V+PGK+ PL+VLDR MENN +R+V+YY+     E  K   KL E+++
Sbjct  6     THICKRTVVSTKAVEPGKYFPLSVLDRYMENNHIRMVYYYQTSREVELGKVTKKLRETLS  65

Query  1302  ETLNAYTIIMGRLLRS-PGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHW  1126
             E L  + I+ GRL+R      W IKCNDAG+RV+EAKAKGSV  WL N+DR+KEL+LVHW
Sbjct  66    EMLTHFPIVSGRLVRDDETGHWKIKCNDAGVRVVEAKAKGSVGGWLANLDREKELQLVHW  125

Query  1125  EPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISp  946
             E M   PY+WS FYVQLTEFEEGGL++GLSC HLL D   AT+F+KAWAD+S   KMI+P
Sbjct  126   EDMFHKPYYWSTFYVQLTEFEEGGLAIGLSCFHLLVDSTCATLFMKAWADISMVNKMITP  185

Query  945   phfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDE  766
             P FH LPPRRP N N N H +   +L++HYK        + P+ T      TIS+ F++ 
Sbjct  186   PLFHHLPPRRPPNRNPNHHLHM--ELIHHYKSLI-----EKPNSTKETMYTTISMGFSNP  238

Query  765   MVRACMSMAQTPDA----FDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGLDKGFY  601
             MV+ACMSMAQ P+     F+ALA L W  +SK K     L+D+++ LD+RKVLGLD  F+
Sbjct  239   MVQACMSMAQ-PNGPIPPFEALAALFWVSLSKVKGLRNRLVDMSICLDMRKVLGLDCTFF  297

Query  600   GNCMVYNKVKWSSGSMVLGDDL-LSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNV  424
             GNCMVYNKV       V G++    Q   AI ++  +MD E I++L EWL+ N+  +  +
Sbjct  298   GNCMVYNKVN------VEGNNYKFPQVVRAISDVVAKMDTEAIINLTEWLENNDVNSPTM  351

Query  423   LDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRT  244
             ++   +LVC +LEG+DPY   F +   P+HVSYY+EP +G G ++LILP  P  G LSR 
Sbjct  352   MNN-HNLVCTSLEGMDPYLTVFPDLFKPIHVSYYIEPVVGEG-QVLILPGLPEEGPLSRV  409

Query  243   VMVTLPENEAVKLMEDQLIHQLSPCIKM  160
              MVTL + EA+KL ED LI Q SP I M
Sbjct  410   AMVTLRKEEAIKLCEDDLISQFSPTILM  437



>gb|KDO79585.1| hypothetical protein CISIN_1g045312mg [Citrus sinensis]
Length=441

 Score =   395 bits (1014),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 224/441 (51%), Positives = 291/441 (66%), Gaps = 14/441 (3%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYTKLNESIAET  1297
             ICKRTVVST   Q GK  PL+V DR+ME N +RIV+Y+      E      KL ES++  
Sbjct  9     ICKRTVVSTKPAQAGKCNPLSVFDRLMEKNHIRIVYYFPSTRNGEPGVVTKKLRESLSHV  68

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L  + I+ GRL +     W+IKCNDAG+R++EA+ +GSV+EWL NV+RDKEL LV WE M
Sbjct  69    LTCFPIVTGRLQKKDDGHWMIKCNDAGVRMVEARTQGSVEEWLKNVNRDKELMLVTWEDM  128

Query  1116  MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphf  937
                PYFW+ FYVQLTEFEEGGL++G SC+HLLADP SATMF+KAWAD +  G M++PP F
Sbjct  129   FHKPYFWATFYVQLTEFEEGGLAIGFSCSHLLADPTSATMFVKAWADTTLAGTMLAPPFF  188

Query  936   hplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVR  757
             HPLPP R  N N N +  +  DL+NHYK  +T D   P    +     T +L F+  MV+
Sbjct  189   HPLPPPRLGNKNPNHNPYT--DLINHYK--STIDDRSPAFTNNITNYVTATLAFSGPMVQ  244

Query  756   ACMSMAQTPDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGLDKGFYGNCMVYN  580
             ACM     P  F+A+AGLLW  +SK K    GL+ +++ LD+RK LGLDKGF+GNC+VYN
Sbjct  245   ACMLDTSRPSPFEAMAGLLWVCVSKVKGMKQGLISMSICLDMRKQLGLDKGFFGNCLVYN  304

Query  579   KVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGCDSLV  400
             KV  +    +L    LS+AA A+     +M+ E IMDLIEWL+ ++     +++G D L+
Sbjct  305   KVHHAES--LLDKSELSEAARAVGESVTKMNNERIMDLIEWLEHHDYEFPPLMNGHD-LI  361

Query  399   CVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTVMVTLPEN  220
             C NLE +DPY+  F     P+ VSYYVEP  G G ++L+L SPP  G LSR VMVTLP +
Sbjct  362   CANLEDLDPYATLFEEGFVPIRVSYYVEPVFGIG-QILVLQSPPSEGPLSRMVMVTLPAD  420

Query  219   EAVKLMEDQLIHQLSPCIKMG  157
             E  KL +D LI + +P I MG
Sbjct  421   ELSKLCDDDLILRFNPTILMG  441



>ref|XP_006476225.1| PREDICTED: protein ECERIFERUM 26-like [Citrus sinensis]
Length=437

 Score =   394 bits (1013),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 224/441 (51%), Positives = 291/441 (66%), Gaps = 14/441 (3%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYTKLNESIAET  1297
             ICKRTVVST   Q GK  PL+V DR+ME N +RIV+Y+      E      KL ES++  
Sbjct  5     ICKRTVVSTKPAQAGKCNPLSVFDRLMEKNHIRIVYYFPSTRNGEPGVVTKKLRESLSHV  64

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L  + I+ GRL +     W+IKCNDAG+R++EA+ +GSV+EWL NV+RDKEL LV WE M
Sbjct  65    LTCFPIVTGRLQKKDDGHWMIKCNDAGVRMVEARTQGSVEEWLKNVNRDKELMLVTWEDM  124

Query  1116  MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphf  937
                PYFW+ FYVQLTEFEEGGL++G SC+HLLADP SATMF+KAWAD +  G M++PP F
Sbjct  125   FHKPYFWATFYVQLTEFEEGGLAIGFSCSHLLADPTSATMFVKAWADTTLAGTMLAPPFF  184

Query  936   hplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVR  757
             HPLPP R  N N N +  +  DL+NHYK  +T D   P    +     T +L F+  MV+
Sbjct  185   HPLPPPRLGNKNPNHNPYT--DLINHYK--STIDDRSPAFTNNITNYVTATLAFSGPMVQ  240

Query  756   ACMSMAQTPDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGLDKGFYGNCMVYN  580
             ACM     P  F+A+AGLLW  +SK K    GL+ +++ LD+RK LGLDKGF+GNC+VYN
Sbjct  241   ACMLDTSRPSPFEAMAGLLWVCVSKVKGMKQGLISMSICLDMRKQLGLDKGFFGNCLVYN  300

Query  579   KVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGCDSLV  400
             KV  +    +L    LS+AA A+     +M+ E IMDLIEWL+ ++     +++G D L+
Sbjct  301   KVHHAES--LLDKSELSEAARAVGESVTKMNNERIMDLIEWLEHHDYEFPPLMNGHD-LI  357

Query  399   CVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTVMVTLPEN  220
             C NLE +DPY+  F     P+ VSYYVEP  G G ++L+L SPP  G LSR VMVTLP +
Sbjct  358   CANLEDLDPYATLFEEGFVPIRVSYYVEPVFGIG-QILVLQSPPSEGPLSRMVMVTLPAD  416

Query  219   EAVKLMEDQLIHQLSPCIKMG  157
             E  KL +D LI + +P I MG
Sbjct  417   ELSKLCDDDLILRFNPTILMG  437



>emb|CAN80953.1| hypothetical protein VITISV_032203 [Vitis vinifera]
Length=417

 Score =   391 bits (1004),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 221/429 (52%), Positives = 288/429 (67%), Gaps = 36/429 (8%)
 Frame = -2

Query  1383  MENNFVRIVFYYR-----EFDKDYTKLNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDA  1219
             M++N VRIV+YYR     E  +   +L E+I+E L ++ ++ GRL R+   QW++KCNDA
Sbjct  1     MDHNRVRIVYYYRTPPGREVGEVTKRLRETISEMLTSFPMVTGRLQRNEEGQWVLKCNDA  60

Query  1218  GLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGL  1039
             G+R++EA+AKGSV EWL +VDR+KELKLVHWE M    YFWS FYVQLTEFEEGGL++G 
Sbjct  61    GVRMVEARAKGSVGEWLKSVDREKELKLVHWEDMFHKIYFWSTFYVQLTEFEEGGLAIGF  120

Query  1038  SCTHLLADPISATMFIKAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNH  859
             SCTHLLADPI ATM IKAWAD S  G+M +PP FH   P     N  N +  +   L+NH
Sbjct  121   SCTHLLADPICATMIIKAWADTSLLGQMPNPPLFHSSLPLIRPINRINHNPYT--HLINH  178

Query  858   YKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMSMAQT----------PDAFDALA  709
             YK  ++ D   P + T   +  TI+LLFT  MV+ACM MA+T          P  F+ALA
Sbjct  179   YK--SSLDNSTPVTNT---KYTTIALLFTSPMVQACMEMARTHPEAHGTPIFPSPFEALA  233

Query  708   GLLWTRISKAKN-NVGLMDLAVGLDVRKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDL-  535
             GL WT IS  K    GL+++++ LD+RKVLGLD+GF+GNCMVYN V+        G D  
Sbjct  234   GLFWTCISNVKGWREGLINMSICLDMRKVLGLDEGFFGNCMVYNXVR--------GGDFN  285

Query  534   ---LSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGCDSLVCVNLEGVDPYSA  364
                +S+AA AIR + ++MD E IMDLI+WL+ ++  +S ++ GC+ L+C NLE V+PYSA
Sbjct  286   RHEISKAAMAIRGVMEKMDSEEIMDLIQWLECDSNRSSVLMGGCEHLICTNLEDVEPYSA  345

Query  363   CFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIH  184
              F     PV VSY++EP +    ++LILP+PP  G LSR VMVTLPENEAVKL +D  + 
Sbjct  346   KFEEGYAPVRVSYHIEP-VSTKGQVLILPAPPEEGPLSRVVMVTLPENEAVKLCKDVRVL  404

Query  183   QLSPCIKMG  157
               SP I MG
Sbjct  405   SFSPTILMG  413



>ref|XP_007013792.1| Transferase, putative [Theobroma cacao]
 gb|EOY31411.1| Transferase, putative [Theobroma cacao]
Length=452

 Score =   385 bits (990),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 218/460 (47%), Positives = 300/460 (65%), Gaps = 28/460 (6%)
 Frame = -2

Query  1488  MSEDNISSTICKRTVVSTN-VVQPGKFCPLTVLDRVMENNFVRIVFYY------REFDKD  1330
             M+E  ++  I KR+VVS+    +PGKFC ++VLDR+ME N V+IV+YY       E  + 
Sbjct  1     MAEGTVTH-IGKRSVVSSRWHAEPGKFCHVSVLDRLMEQNQVKIVYYYPSRGDHAEPGEW  59

Query  1329  YTKLNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRD  1150
               KL +S++  L  + I+ GRL ++    W++KCND G+R++EAK KGSV++WL +VDR+
Sbjct  60    IKKLRDSLSCVLTNFPILTGRLHKNQEGHWMVKCNDGGVRMVEAKVKGSVEDWLKSVDRE  119

Query  1149  KELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMS  970
             KELKL++WE M   PY W   YVQ+TEFE+GGL++GLSC HLLADPI ATMF KAWAD +
Sbjct  120   KELKLLYWEEMFHKPYHWPTVYVQVTEFEKGGLAIGLSCCHLLADPICATMFSKAWADTT  179

Query  969   FTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKT  790
              +G M S P      P    + + NP+H S  DL+N+YK       ++    T++ +  T
Sbjct  180   LSGIM-STPPLFHSLPLTKADYSKNPNHESCTDLINYYKYSI----ERLTPLTTNQKYAT  234

Query  789   ISLLFTDEMVRACMSMAQTPD--------AFDALAGLLWTRISKAKNNVG-LMDLAVGLD  637
             ++L FTD MVR C++MAQ           AF+ALA L W  +SK K   G L ++++ LD
Sbjct  235   VTLSFTDSMVRDCIAMAQATGASGKSCSPAFEALAALFWVCLSKVKATKGRLFNMSLCLD  294

Query  636   VRKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEW  457
             +R  LGLD GF+GNCMV NKV   S     G+ +L +A  AI  + K+M+ EGI DLI+W
Sbjct  295   MRNCLGLDPGFFGNCMVCNKVHLESA----GETMLPEATKAISEVVKKMNAEGIKDLIQW  350

Query  456   LDQNNCCASNVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILP  277
             L  N+     +++G D L+CVNLEGV+PY A F + ++P+ VSYYVEP +GPG ++LI  
Sbjct  351   LKCNDNQTVPLMNGYD-LICVNLEGVNPYLATFKDQLEPLQVSYYVEPMVGPG-QVLISR  408

Query  276   SPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKMG  157
             S PG G+LSR VM TLPE+E  KL ED LI + SP + MG
Sbjct  409   SAPGEGSLSRVVMATLPEDEVAKLCEDDLIQRFSPAVLMG  448



>ref|XP_004293014.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=450

 Score =   378 bits (971),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 219/447 (49%), Positives = 293/447 (66%), Gaps = 28/447 (6%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYTKLNESIAET  1297
             IC RTVVST  V+  K   L+VLDR+ME   +R+V YY      E  +   +  ESI++ 
Sbjct  7     ICTRTVVSTKPVEVEKCHSLSVLDRIMEKKHLRMVLYYASMGVPEPGEVTRRRRESISDA  66

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L ++ I+ GRL R+   QW  K NDAG+R++E +AKGS++EWL NVDR+KEL LV+WE M
Sbjct  67    LTSFPIMTGRLARNERGQWTSKFNDAGVRMVEVRAKGSLEEWLRNVDREKELMLVYWEEM  126

Query  1116  MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphf  937
                P  WS FYVQLTEFE+GGL++GLSC HLLADP SATMF+KAWAD SF GK++ PP F
Sbjct  127   DHRPLLWSTFYVQLTEFEDGGLAIGLSCNHLLADPTSATMFLKAWADASFPGKLLQPPFF  186

Query  936   hplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVR  757
             HPL PRR  N   +    +S  L+NHYK    +    P +++ +    T++  F+D MVR
Sbjct  187   HPLLPRRSGNKKLDHKPYTS--LINHYKDSIKNSMQLPANKSHT----TVAFAFSDSMVR  240

Query  756   ACMSMAQ--------TPDAFDALAGLLWTRISKAKNNVG--LMDLAVGLDVRKVLGLDKG  607
             AC++MAQ         P  F+ALAGL W  ISK K  +G  L+++++ +D+R VLGLDKG
Sbjct  241   ACIAMAQPIGATNRSKPSPFEALAGLFWFCISKVK-GIGNELINMSICMDMRTVLGLDKG  299

Query  606   FYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASN  427
             F+GNCMVYNKV           + LS+A ++I  +  +MD EGIMDLIEWL+  +     
Sbjct  300   FFGNCMVYNKVHQEG----FQGNNLSEAVSSIGEVVAKMDCEGIMDLIEWLEHTDDQCPL  355

Query  426   VLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSR  247
             +++  D L+C +LE VDP+S  F +   P+ VSYYVEP +  G ++LI P+ PG G LSR
Sbjct  356   LMNDSD-LICASLEAVDPFSTVFEDGNAPIRVSYYVEPVLRLG-QVLIFPAKPGDGELSR  413

Query  246   TVMVTLPENEAVKLMEDQLIHQLSPCI  166
              VMVTLP +E  KL ED+L+ +LSP I
Sbjct  414   VVMVTLPHDEMAKLHEDELVRRLSPTI  440



>gb|EYU21930.1| hypothetical protein MIMGU_mgv1a026668mg [Erythranthe guttata]
Length=460

 Score =   375 bits (962),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 229/462 (50%), Positives = 297/462 (64%), Gaps = 30/462 (6%)
 Frame = -2

Query  1479  DNISSTICKRTVVSTNVVQPGKFCPLTVLDRVM-ENNFVRIVFYY----REFDKDYT-KL  1318
             DN  S ICKRTVVST  V+PG+F PL+VLDR+  EN+ +R+VFYY    R+   + T KL
Sbjct  3     DNEVSFICKRTVVSTKPVRPGQFSPLSVLDRLNNENSNIRLVFYYSFPARKTAGELTDKL  62

Query  1317  NESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKA-KGSVDEWLHNVDRDKEL  1141
              ESI++ L+ + ++ GRLLR+    W IKCNDAGLR++EAK  KGSV++WL NVDR+KEL
Sbjct  63    RESISDMLSYFPVVTGRLLRTSDGDWTIKCNDAGLRMVEAKVMKGSVEKWLQNVDREKEL  122

Query  1140  KLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTG  961
             KLVHWE M   PYFWS FYVQ+TEFE GGL++GLSCT LL DPI ATM IKAWAD +  G
Sbjct  123   KLVHWEEMFHKPYFWSTFYVQITEFEGGGLAIGLSCTRLLCDPICATMMIKAWADTTLIG  182

Query  960   KMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISL  781
             ++ SPP   PLP +    N+H+   +     +N      +DD  K        +  TI+L
Sbjct  183   EITSPPLLRPLPIQNQNTNHHSSLIDRYKSYLNSSPILKSDDNTK--------QITTITL  234

Query  780   LFTDEMVRA-CMSMAQ-------TPDAFDALAGLLWTRISKAK-NNVGLMDLAVGLDVRK  628
              F  E VR  C++MA         P  F+ALAG+ WT IS+AK    G  D+ V LD+RK
Sbjct  235   QFNQETVRKLCIAMANDVNGHGPGPTPFEALAGIFWTCISRAKGKQRGFFDMYVCLDMRK  294

Query  627   VLGLDKGFYGNCMVYNKVKWSSGSMVLGD-DLLSQAANAIRNMRKEMDKEGIMDLIEWLD  451
              LGLD+GF+GNCMVYNKV    G    G+ ++LS A   I+    EMD   +M+LIEWL+
Sbjct  295   ALGLDEGFFGNCMVYNKVVLLHGDGNHGNCEVLSDAVALIKEAVSEMDGRDVMELIEWLE  354

Query  450   QNNCCASN-VLDGC-DSLVCVNLEGVDPYSACFGNNMDPVHVSYYVE-PEIGPGNRLLIL  280
                   ++ V+ GC D L+C +L  V  YSA F  N+ PV VSYY++ P +G G ++L++
Sbjct  355   SEKINRNSLVISGCDDHLICADLGNVHCYSAVFEENVVPVRVSYYMDGPGMGTG-QILVM  413

Query  279   PSPPGT-GALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKMG  157
             P+P G  G  SR V VTLPE+EA K++ED LI QL P   MG
Sbjct  414   PAPGGGDGPESRVVAVTLPEDEAEKVLEDSLIRQLGPITLMG  455



>ref|XP_002869444.1| hypothetical protein ARALYDRAFT_491831 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45703.1| hypothetical protein ARALYDRAFT_491831 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   360 bits (925),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 205/459 (45%), Positives = 285/459 (62%), Gaps = 28/459 (6%)
 Frame = -2

Query  1488  MSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYT  1324
             M E++    ICKRTVVST  ++PG+    +VLD VME N +R+V+YYR     E  +   
Sbjct  1     MMEEDRVRFICKRTVVSTRSIEPGRLYRFSVLDHVMEPNHIRLVYYYRSLKTREPGEITK  60

Query  1323  KLNESIAETLNAYTIIMGRLLRS---------PGEQWLIKCNDAGLRVIEAKAKGSVDEW  1171
             KL ES+A TLN Y I+ GRL+R             +W +K NDAG+R++EA+A GSV+EW
Sbjct  61    KLRESLAYTLNCYPIVTGRLVRENDGSEEQEDVSRRWKVKSNDAGMRMVEARATGSVEEW  120

Query  1170  LHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFI  991
             L NV+R++ELKLVHWE M    Y+WS F VQ+TEFE GGL++GLSC+HLLADP+ A MFI
Sbjct  121   LRNVNREEELKLVHWEGMYHLHYYWSTFCVQVTEFESGGLAIGLSCSHLLADPVCAMMFI  180

Query  990   KAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQT  811
             +AWAD++ +  M++     PL    P     N    S+  L++HY K  T      PS  
Sbjct  181   RAWADLTLSRSMMA----PPLFHPLPPRRFANHKLISNNQLLSHYIKSCTLTAS--PSNV  234

Query  810   SSDRPKTISLLFTDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVG-LMDLAVGLDV  634
             + D   T++ LF D +VRA  +  +    F+ LAGL W  +S+AK     LMD+++ LDV
Sbjct  235   TEDHMVTVTFLFPDPLVRAGENEPRI-STFEILAGLFWVCVSRAKGKRNELMDMSLCLDV  293

Query  633   RKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWL  454
             RK+L LD+G++GNCMVY+KV +S   +   D LL  A   I N+ K++D + +MDLIEWL
Sbjct  294   RKLLRLDQGYFGNCMVYHKVPYSK-PVKTKDKLLFHAVQEIENITKKLDYDTVMDLIEWL  352

Query  453   DQNNCCASNVLDGCDSLVCVNLEGVD-PYSACFGNNMDPVHVSYYVEPEIGPGNRLLILP  277
               NN   SN   G D LVC NLE +       F  ++   H+S YV+  +  G ++++LP
Sbjct  353   SSNNGAISN---GSD-LVCTNLENMSHSRPMMFEEDLVLSHLSCYVKGPVAGGGQVIVLP  408

Query  276   SPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
             S PG G +SR VMV+LP+ E VK++ED+L+   SP + M
Sbjct  409   SLPGKGPMSRVVMVSLPQREMVKVVEDELLLSFSPVVVM  447



>ref|XP_010051199.1| PREDICTED: protein ECERIFERUM 26-like [Eucalyptus grandis]
 gb|KCW81447.1| hypothetical protein EUGRSUZ_C02832 [Eucalyptus grandis]
Length=449

 Score =   360 bits (924),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 208/444 (47%), Positives = 280/444 (63%), Gaps = 27/444 (6%)
 Frame = -2

Query  1458  CKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR------EFDKDYTKLNESIAET  1297
             CKRT VST  VQPGK  PL+VLDR+ME   +R+V+YYR      E  +    L E++A T
Sbjct  8     CKRTAVSTKPVQPGKRLPLSVLDRLMEPKHLRVVYYYRSDEPAREAGERTRTLRETLART  67

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L ++    GRL R    +W I CNDAG+RV+EA+A+GSV++WL N  R+ EL+LVHWE M
Sbjct  68    LTSFPKATGRLQRDGEGRWEIDCNDAGVRVMEARARGSVEDWLRNAGREDELRLVHWEEM  127

Query  1116  MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphf  937
                PYFWS FYVQ+TEFE GG ++GLSC HLLADP  AT+FIKAWADM+   +  +PP  
Sbjct  128   FDTPYFWSTFYVQMTEFEGGGFAIGLSCIHLLADPTCATLFIKAWADMTLNARPTAPPPS  187

Query  936   hplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVR  757
                 P+R  ++ ++P  ++S  L+NH K           S T S +  T+SL FT+ +VR
Sbjct  188   FRALPKRRPSHRNDPDRHNS--LINHCKSSINTS-----SLTPSAKFGTLSLAFTEPIVR  240

Query  756   ACMSMAQTPDA--------FDALAGLLWTRISKAK-NNVGLMDLAVGLDVRKVLGLDKGF  604
             +C++MAQ  DA        F+ALAGL W  ISK K    GL+ + +GLDVRK+LGL++ F
Sbjct  241   SCIAMAQPVDAPDGPGPSPFEALAGLFWACISKVKGEREGLVSMCLGLDVRKLLGLEREF  300

Query  603   YGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNV  424
             +GNCMVYN    +  +    D+ L  AA AI  M  ++DK G+MDLIEWL+ N+      
Sbjct  301   FGNCMVYNNSLHARDNE--EDNSLPGAAKAIGEMMAKLDKNGVMDLIEWLEINDDTGPKN  358

Query  423   LDGCD--SLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALS  250
                 +   L+ +NLEG++P +A F +   P+ VS + EP    G +++ILPS P  G +S
Sbjct  359   TRSLNFSELLFLNLEGIEPDTARFEDTHAPIRVSCFFEPPCKEG-QVVILPSTPKDGPMS  417

Query  249   RTVMVTLPENEAVKLMEDQLIHQL  178
             R VMVTLPE+E VKLME  L+  L
Sbjct  418   RVVMVTLPEDELVKLMEHDLVMSL  441



>ref|NP_567826.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 gb|AEE85607.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=460

 Score =   357 bits (916),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 203/462 (44%), Positives = 286/462 (62%), Gaps = 29/462 (6%)
 Frame = -2

Query  1497  RSTMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDK  1333
             ++ M ED +   ICKRTVVST  ++PG+   L+VLD VME N +R+V+YYR     E  +
Sbjct  6     KTIMEEDRVR-FICKRTVVSTRSIEPGRLYQLSVLDHVMEPNHIRLVYYYRCSKTREPGE  64

Query  1332  DYTKLNESIAETLNAYTIIMGRLLRSP---------GEQWLIKCNDAGLRVIEAKAKGSV  1180
                KL ES+A TLN Y I+ GRL++            ++W++K NDAG+R++EA+A GSV
Sbjct  65    ITKKLRESLAYTLNCYPIVTGRLVKEVDGMEENKDLSQRWMVKSNDAGVRMVEARATGSV  124

Query  1179  DEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISAT  1000
              EWL +V+R++ELKLVHWE M    Y+WS F VQ+TEFE GGL++GLSC+HLLADP+ A 
Sbjct  125   KEWLRSVNREEELKLVHWEDMYHLQYYWSTFCVQVTEFESGGLAIGLSCSHLLADPVCAM  184

Query  999   MFIKAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPP  820
             MFI+AWAD++ +  M++     PL    P     N    S+  L++HY K  +      P
Sbjct  185   MFIRAWADLTLSRSMMA----PPLFHPLPPRRFSNQRLISNNQLLSHYIKSCSLTAS--P  238

Query  819   SQTSSDRPKTISLLFTDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVG-LMDLAVG  643
             S  + D   T++ LF D +VRA  +  +    F+ LAGL W  +S+AK     LMD+++ 
Sbjct  239   SNMTEDHMVTVTFLFPDPLVRAGENEPRI-STFEILAGLFWVCVSRAKGKRNELMDMSLC  297

Query  642   LDVRKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLI  463
             LDVRK+L LD+ ++GNCMVY+KV +S   +   D LL  A   I ++ K +D + +MDLI
Sbjct  298   LDVRKLLRLDQSYFGNCMVYHKVPYSK-PVKTKDKLLFHAVQEIESITKRLDYDTVMDLI  356

Query  462   EWLDQNNCCASNVLDGCDSLVCVNLEGVD-PYSACFGNNMDPVHVSYYVEPEIGPGNRLL  286
             EWL  NN   SN   G D LVC NLE +       F  ++   HVS YVE  +  G +++
Sbjct  357   EWLSSNNGAISN---GSD-LVCTNLENMSHSRPMMFEEDLALSHVSCYVEGPVAGGGQVI  412

Query  285   ILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
             +LPSPPG   +SR VMV+LP+   VK++ED+L+   SP + M
Sbjct  413   VLPSPPGKEPMSRVVMVSLPQRVMVKVIEDELLLSFSPVVIM  454



>gb|KFK29862.1| hypothetical protein AALP_AA7G188600 [Arabis alpina]
Length=450

 Score =   355 bits (911),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 201/451 (45%), Positives = 275/451 (61%), Gaps = 28/451 (6%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYTKLNESIAET  1297
             ICKR+VVST  V+ GK    +VLD +ME N +R+V+YYR     E  +    L ES+A T
Sbjct  8     ICKRSVVSTKPVEQGKLYRFSVLDYIMEPNHIRLVYYYRSSKIRELGEITKVLRESLAHT  67

Query  1296  LNAYTIIMGRLLRSP----------GEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK  1147
             LN Y II GRL++              QW ++ NDAG+R++EA+A G+VDEWL +V+R++
Sbjct  68    LNCYPIITGRLVKEIDGTEEKDQDLNRQWKVRSNDAGVRMVEARATGTVDEWLRSVNREE  127

Query  1146  ELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSF  967
             ELKLVHWE M   PY+WS FYVQ+TEFE GGL++GLSC+HLLADP+ A MFI+AWAD++ 
Sbjct  128   ELKLVHWEEMYRLPYYWSTFYVQVTEFESGGLAIGLSCSHLLADPVCAMMFIRAWADLTM  187

Query  966   TGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTI  787
             T  M++     PL    P     N   +++  L++HY K         PS  + DR  T+
Sbjct  188   TRSMMA----PPLYHPLPPRRFTNHRLSNNNQLLSHYIKSCALTAQ--PSNVTEDRVVTV  241

Query  786   SLLFTDEMVRACMSMAQTPDAFDALAGLLWTRISKAK-NNVGLMDLAVGLDVRKVLGLDK  610
             +L+F D +VR   +       F+ LAGL W  +S+AK  N  LMD+++ LDVRK+L LDK
Sbjct  242   TLMFPDPLVRVGENEPGI-STFEVLAGLFWICVSQAKGKNNELMDMSLCLDVRKLLRLDK  300

Query  609   GFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCAS  430
              ++GNCMVY KV +S         L+S     I N  K +D + +MDLIEWL  NN   S
Sbjct  301   SYFGNCMVYQKVHYSKPVKTKDKLLVSHVVQEIHNTTKRLDYDTVMDLIEWLSSNNNPIS  360

Query  429   NVLDGCDSLVCVNLEG-VDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGAL  253
             N   G D LVC NLE  V+     F  +    HVS YVE  +  G ++++LPS  G G +
Sbjct  361   N---GSD-LVCTNLENMVNSRPMMFEKDFVLSHVSCYVEGPVAGGGQVIVLPSRSGEGPM  416

Query  252   SRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
             SR VMV+LP+ E VK++E++L+   SP + M
Sbjct  417   SRVVMVSLPQREMVKVLENELLQSFSPVLLM  447



>emb|CDX68855.1| BnaC01g05980D [Brassica napus]
Length=459

 Score =   353 bits (906),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 197/458 (43%), Positives = 279/458 (61%), Gaps = 27/458 (6%)
 Frame = -2

Query  1491  TMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY-----REFDKDY  1327
             T+ E+N    IC RTVVST  V+ G+    +V D VME N +R+V+YY     RE  +  
Sbjct  7     TVMEENRVRLICTRTVVSTKPVEQGRVYRFSVFDHVMEPNHIRLVYYYQSSRTRELGEIT  66

Query  1326  TKLNESIAETLNAYTIIMGRLLR----SPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNV  1159
              KL ES+A TLN Y ++ GRL++    +   +W +K NDAG+R+IEA+A G+V+EW  +V
Sbjct  67    KKLRESLAYTLNCYPVVTGRLVKETDGTEENRWKVKSNDAGVRMIEARATGTVEEWRRSV  126

Query  1158  DRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
              R++ELKLVHWE M   PY+WS FYVQ+TEFE GGL++GLSCTHLLADP+ A MFI+ WA
Sbjct  127   TREEELKLVHWEDMYHLPYYWSTFYVQVTEFESGGLAIGLSCTHLLADPVCAMMFIRTWA  186

Query  978   DMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDR  799
             D++ T  M++     P           + H  S+  L++HY +  +     PP   + DR
Sbjct  187   DLTLTRNMMT-----PPLFHSLPPRRFSNHKLSNNQLLSHYIRSCSLTA--PPPNITEDR  239

Query  798   PKTISLLFTDEMVRACMSMAQTP--DAFDALAGLLWTRISKAKNNVG-LMDLAVGLDVRK  628
               TI+LLF D MV+   S    P   AF+ L+GL    +S+AK     LMD+++ LDVRK
Sbjct  240   MVTITLLFPDPMVQ---SGENEPGLTAFEILSGLFCVCVSRAKGKRNELMDMSLCLDVRK  296

Query  627   VLGLDKGFYGNCMVYNKVKWSSGSMVLGD-DLLSQAANAIRNMRKEMDKEGIMDLIEWLD  451
             +L LD+ ++GNCMVY+KV +S     +    LLS     I N+ K +D   +MDL+EWL 
Sbjct  297   LLRLDQSYFGNCMVYHKVHYSKPVKAIDRLLLLSYVVQEIHNVTKGLDYHAVMDLVEWLG  356

Query  450   QNNCCASNVLDGCDSLVCVNLEGV-DPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPS  274
              NN    N +     LVC NLE + +P    F  ++   H+S YVE  +  G ++++LPS
Sbjct  357   SNN---KNPISNGSDLVCTNLENMGNPRPIMFEEDLMLSHLSCYVEGPVAGGGQVIVLPS  413

Query  273   PPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
             P G G +SR VM++LP+ E VK++ED+L+   SP + M
Sbjct  414   PSGEGPMSRVVMISLPQREMVKVLEDELLQSFSPIVLM  451



>gb|AAM61611.1| unknown [Arabidopsis thaliana]
Length=452

 Score =   352 bits (902),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 202/459 (44%), Positives = 283/459 (62%), Gaps = 29/459 (6%)
 Frame = -2

Query  1488  MSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYT  1324
             M ED +   ICKRTVVST  ++PG+   L+VLD VME N +R+V+YYR     E  +   
Sbjct  1     MEEDRVR-FICKRTVVSTRSIEPGRLYQLSVLDHVMEPNHIRLVYYYRCSKTREPGEITK  59

Query  1323  KLNESIAETLNAYTIIMGRLLRSP---------GEQWLIKCNDAGLRVIEAKAKGSVDEW  1171
             KL ES+A TLN Y I+ GRL++            ++W++K NDAG+ ++EA+A GSV EW
Sbjct  60    KLRESLAYTLNCYPIVTGRLVKEVDGMEENKDLSQRWMVKSNDAGVGMVEARATGSVKEW  119

Query  1170  LHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFI  991
             L +V+R++ELKLVHWE M    Y+WS F VQ+TEFE GGL++GLSC+HLLADP+ A MFI
Sbjct  120   LRSVNREEELKLVHWEDMYHLQYYWSTFCVQVTEFESGGLAIGLSCSHLLADPVCAMMFI  179

Query  990   KAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQT  811
             +AWAD++ +  M++     PL    P     N    S+  L++HY K  +      PS  
Sbjct  180   RAWADLTLSRSMMA----PPLFHPLPPRRFSNQRLISNNQLLSHYIKSCSLTAS--PSNM  233

Query  810   SSDRPKTISLLFTDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVG-LMDLAVGLDV  634
             + D   T++ LF D +VRA  +  +    F+ LAGL W  +S+AK     LMD+++ LDV
Sbjct  234   TEDHMVTVTFLFPDPLVRAGENEPRI-STFEILAGLFWVCVSRAKGKRNELMDMSLCLDV  292

Query  633   RKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWL  454
             RK+L LD+ ++GNCMVY+KV +S   +   D LL  A   I ++ K +D + +MDLIEWL
Sbjct  293   RKLLRLDQSYFGNCMVYHKVPYSK-PVKTKDKLLFHAVQEIESITKRLDYDTVMDLIEWL  351

Query  453   DQNNCCASNVLDGCDSLVCVNLEGVD-PYSACFGNNMDPVHVSYYVEPEIGPGNRLLILP  277
               NN   SN   G D LVC NLE +       F  ++   HVS YVE  +  G ++++LP
Sbjct  352   SSNNGAISN---GSD-LVCTNLENMSHSRPMMFEEDLALSHVSCYVEGPVAGGGQVIVLP  407

Query  276   SPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
             SPPG   +SR VMV+LP+   VK++ED+L+   SP + M
Sbjct  408   SPPGKEPMSRVVMVSLPQRVMVKVIEDELLLSFSPVVIM  446



>ref|XP_010433114.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=462

 Score =   352 bits (903),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 202/462 (44%), Positives = 284/462 (61%), Gaps = 27/462 (6%)
 Frame = -2

Query  1497  RSTMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDK  1333
             ++ M ED +   ICKRTVVST  ++PG+    +VLD VME N +R+V+YYR     E  +
Sbjct  6     KTIMEEDRVR-FICKRTVVSTRSIEPGRLYQFSVLDHVMEPNHIRLVYYYRSSKTREPGE  64

Query  1332  DYTKLNESIAETLNAYTIIMGRLLRSP---------GEQWLIKCNDAGLRVIEAKAKGSV  1180
                KL ES+A TLN Y I+ GRL++             +W +K NDAG+R++EA+A GSV
Sbjct  65    ITKKLRESLAYTLNCYPIVTGRLVKETDGTEEKEGVNRRWKVKSNDAGVRMVEARAAGSV  124

Query  1179  DEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISAT  1000
             +EWL +V+R++ELKLVHWE M    Y+WS F VQ+TEFE GGL++GLSC+HLLAD + A 
Sbjct  125   EEWLRSVNREEELKLVHWEDMYHLHYYWSTFNVQVTEFESGGLAVGLSCSHLLADTVCAM  184

Query  999   MFIKAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPP  820
             MFI+AWAD++ +  M++     PL  + P     N    S+  L+N Y K  +      P
Sbjct  185   MFIRAWADLTLSRSMMA----PPLFHQLPPRRFANERLISNNQLINQYTKSCSLMVS--P  238

Query  819   SQTSSDRPKTISLLFTDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVG-LMDLAVG  643
             S  + D   T++LLF D +VRA  + +     F+ LAGL W  +S+AK     LMD+++ 
Sbjct  239   SNVTEDHIVTVTLLFPDPLVRAGENESGF-STFEILAGLFWISVSRAKGKRNELMDMSLC  297

Query  642   LDVRKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLI  463
             LDVRK+L LD+ ++GNCMVY+KV +S         LL      I+N+ K +D + +MDLI
Sbjct  298   LDVRKLLRLDQSYFGNCMVYHKVPYSKPVKTKDRMLLFHTIEEIQNITKRLDYDKVMDLI  357

Query  462   EWLDQNNCCASNVLDGCDSLVCVNLEGVD-PYSACFGNNMDPVHVSYYVEPEIGPGNRLL  286
             EWL  NN  A  + +G D LVC NLE +  P    F  ++   HVS YV+  +  G +++
Sbjct  358   EWLGSNNNGA--ISNGSD-LVCTNLENMSHPRPVMFEEDLVLSHVSCYVKGPVAGGGQVI  414

Query  285   ILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
             +LPSP G G  SR VMV+LPE E VK++ED+L+   SP + M
Sbjct  415   VLPSPSGKGQKSRVVMVSLPEREMVKVVEDELLLSFSPVVLM  456



>ref|XP_006285422.1| hypothetical protein CARUB_v10006839mg [Capsella rubella]
 gb|EOA18320.1| hypothetical protein CARUB_v10006839mg [Capsella rubella]
Length=459

 Score =   347 bits (891),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 203/462 (44%), Positives = 285/462 (62%), Gaps = 28/462 (6%)
 Frame = -2

Query  1497  RSTMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY-----REFDK  1333
             ++ M ED +   ICKRTVVST  V+PG+    +VLD VME N +R+V+YY     RE  +
Sbjct  6     KTIMEEDRVR-FICKRTVVSTRSVEPGRLYHFSVLDHVMEPNQIRLVYYYKTSKTREPGE  64

Query  1332  DYTKLNESIAETLNAYTIIMGRLLR-SPGEQ--------WLIKCNDAGLRVIEAKAKGSV  1180
                KL ES+A TLN Y II GRL++ + G++        W +K NDAG+R++EA+A GSV
Sbjct  65    ITKKLRESLAYTLNCYPIITGRLVKETDGKEEKEDVILRWKVKSNDAGMRMVEARAAGSV  124

Query  1179  DEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISAT  1000
             +EWL +V R++ELKLVHWE M    Y+WS F VQ+TEFE GGL++GLSC+HLLADP+ A 
Sbjct  125   EEWLRSVTREEELKLVHWEDMYHLHYYWSTFNVQVTEFESGGLAIGLSCSHLLADPVCAM  184

Query  999   MFIKAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPP  820
             MF++AWAD++ +  M++     PL    P     N    S+  L++ Y K  +      P
Sbjct  185   MFMRAWADLTLSRSMMA----PPLFHPLPPRRFANDGLISNNQLLSQYIKSCSLMVS--P  238

Query  819   SQTSSDRPKTISLLFTDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVG-LMDLAVG  643
             S  + D   T++LLF D +VRA  + +     F+ LAGL W  +S+AK     LMD+++ 
Sbjct  239   SNVAEDHMVTVTLLFPDPLVRAGENESAI-STFEILAGLFWICVSRAKGKRNELMDMSLC  297

Query  642   LDVRKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLI  463
             LDVRK+L LD+ ++GNCMVY+KV +S         LL  A   I+N+ K +D + +MDLI
Sbjct  298   LDVRKLLRLDQSYFGNCMVYHKVPYSKPVKTKDRLLLFHAVEEIQNITKRLDYDTVMDLI  357

Query  462   EWLDQNNCCASNVLDGCDSLVCVNLEGVD-PYSACFGNNMDPVHVSYYVEPEIGPGNRLL  286
             EWL  NN   SN   G D LVC NLE +  P    F  ++   H+S YV+  +  G +++
Sbjct  358   EWLSSNNGAISN---GSD-LVCTNLENMSHPRPMMFEEDLVLRHMSCYVKGPVAGGGQVI  413

Query  285   ILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
             +LPSP G G  SR VM++LP+ E  K++ED+L+   SP I M
Sbjct  414   VLPSPSGKGPKSRVVMISLPQREMTKVVEDELLLSFSPVILM  455



>ref|XP_010447873.1| PREDICTED: rosmarinate synthase-like [Camelina sativa]
Length=465

 Score =   347 bits (889),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 197/462 (43%), Positives = 285/462 (62%), Gaps = 27/462 (6%)
 Frame = -2

Query  1497  RSTMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDK  1333
             ++ M ED++   ICKRTVVST  ++PG+    +VLD VME N +R+V+YYR     E  +
Sbjct  6     KTIMVEDHVR-FICKRTVVSTRSIEPGRLYQFSVLDHVMEPNHIRLVYYYRSSKTREPGE  64

Query  1332  DYTKLNESIAETLNAYTIIMGRLLRSP---------GEQWLIKCNDAGLRVIEAKAKGSV  1180
                KL ES+A TLN Y I+ GRL++             +W +K NDAG+R++EA+A GSV
Sbjct  65    ITKKLRESLAYTLNCYPIVTGRLVKETDGTEEKEDVNLRWKVKSNDAGVRMVEARAAGSV  124

Query  1179  DEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISAT  1000
             +EWL +V+R++ELKLVHWE M    Y+WS F VQ+TEFE GGL++GLSC+HLLAD + A 
Sbjct  125   EEWLRSVNREEELKLVHWEDMYQLHYYWSTFNVQVTEFERGGLAIGLSCSHLLADSVCAM  184

Query  999   MFIKAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPP  820
             MFI+AWAD++ +  M++     PL    P     N    S+  L++ Y K  +      P
Sbjct  185   MFIRAWADLTLSRSMMA----PPLFHPLPPRRFANERLVSNNQLISQYIKSCSLMVS--P  238

Query  819   SQTSSDRPKTISLLFTDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVG-LMDLAVG  643
             S  S D   T++LLF D +VRA  + ++    F+ LAGL W  +S+AK     LM++++ 
Sbjct  239   SNVSEDHMVTVTLLFPDPLVRAGENESEI-STFEILAGLFWICVSRAKGKRNELMNMSLC  297

Query  642   LDVRKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLI  463
             LDVR +L LD+ ++GNCM+Y++V +S         LL  A   I+N+ K +D + +MDLI
Sbjct  298   LDVRNLLRLDQSYFGNCMIYHRVPYSKPVKTKDKMLLFHAVEEIQNITKRLDYDTVMDLI  357

Query  462   EWLDQNNCCASNVLDGCDSLVCVNLEGVD-PYSACFGNNMDPVHVSYYVEPEIGPGNRLL  286
             EWL  NN    ++ +G D LVC N+E +  P    F  ++   HVS YV+  +  G +++
Sbjct  358   EWLSSNN--TGSICNGSD-LVCTNIENMSHPRPVMFEEDLVLSHVSCYVKGPVAGGGQVI  414

Query  285   ILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
             +LPSP G G  SR VMV+LPE E VK++ED+L+   SP + M
Sbjct  415   VLPSPSGKGPKSRVVMVSLPEREMVKVVEDELLLSFSPVVLM  456



>ref|XP_010670732.1| PREDICTED: protein ECERIFERUM 26-like [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 197/457 (43%), Positives = 281/457 (61%), Gaps = 29/457 (6%)
 Frame = -2

Query  1482  EDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKL  1318
             ED  S T  K+ V ++  VQPGK   L+ LD +ME + +R+V+YY+        +   KL
Sbjct  2     EDYFSFT-RKKIVTTSKPVQPGKKIQLSSLDLLMEKHHIRMVYYYKTPKGLLIGELTRKL  60

Query  1317  NESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELK  1138
                ++E  + +    GRL+R+   +W+I CNDAG+R+IEA AKGSV+ WL NVD +KE K
Sbjct  61    RIILSEVTSYFPATTGRLVRNEEGKWMINCNDAGVRIIEAIAKGSVETWLQNVDVEKEKK  120

Query  1137  LVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGK  958
             L+HWE     PY+W+  YV +TEFEEGG+++GLSC+HL+ DP SAT+ I+AWAD    G 
Sbjct  121   LIHWEDWYHIPYYWATVYVMVTEFEEGGMAIGLSCSHLVCDPSSATLLIRAWADQVLWGN  180

Query  957   MISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLL  778
             +         P  +     H   +  +  L+NHYK        + PS  ++ +  TI+L 
Sbjct  181   I--SIPPFLHPLPKRTLGFHKAQNQPNNHLINHYKTLL-----ESPSSCTAQKSTTIALA  233

Query  777   FTDEMVRACMSMAQT--------PDAFDALAGLLWTRISKAKNNV-GLMDLAVGLDVRKV  625
             FTD MV++C+++A          P  F ALAGLLW  ISK K    GL+D+++GLD+RKV
Sbjct  234   FTDNMVQSCINLAHLNGPNNGPDPSPFVALAGLLWVCISKLKECTNGLVDMSIGLDMRKV  293

Query  624   LGLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQ-  448
             LGLDKGF+GNC V+ +VK   G+ +  DD L  A   I    K+++KE I+DL+EWL+  
Sbjct  294   LGLDKGFFGNCTVHTQVK---GNDIKMDD-LQLATKVIEESIKKVNKEEIIDLVEWLENY  349

Query  447   NNCCASNVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPP  268
             NN    + LD  D+LV +NL+ +DPYS+ F    +P+ ++YY E  I  G ++L+LP  P
Sbjct  350   NNFSPPSSLDK-DNLVILNLDHLDPYSSVFIKGYEPIKIAYYNESHINKG-KILVLPCHP  407

Query  267   GTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKMG  157
               G  SR V+VTLP +EAV+L ED+L+ + SP I MG
Sbjct  408   SAGKFSRIVIVTLPNDEAVRLCEDKLLARFSPTILMG  444



>ref|XP_010438318.1| PREDICTED: rosmarinate synthase-like [Camelina sativa]
Length=463

 Score =   343 bits (880),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 202/463 (44%), Positives = 284/463 (61%), Gaps = 31/463 (7%)
 Frame = -2

Query  1491  TMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDY  1327
             T+ E++    ICKRTVVST  ++PG+    +VLD VME N +R+V+YYR     E  +  
Sbjct  7     TIMEEDCVRFICKRTVVSTRSIEPGRLYKFSVLDHVMEPNHIRLVYYYRSSKTREPGEIT  66

Query  1326  TKLNESIAETLNAYTIIMGRLLRSP---------GEQWLIKCNDAGLRVIEAKAKGSVDE  1174
              KL ES+A TLN Y I+ GRL++             +W +K NDAG+R++EA+A GSV+E
Sbjct  67    KKLRESLAYTLNCYPIVTGRLVKETDGKEEKEDVNPRWKVKSNDAGVRMVEARAAGSVEE  126

Query  1173  WLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMF  994
             WL +V+R++ELKLVHWE M    Y+WS F VQ+TEFE GGL++GLSC+HLLAD + A MF
Sbjct  127   WLRSVNREEELKLVHWEDMYQLHYYWSTFNVQVTEFESGGLAIGLSCSHLLADSVCAMMF  186

Query  993   IKAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQ  814
             I+AWAD++ +  M++     P+    P     N    S+  L++ Y K  +      PS 
Sbjct  187   IRAWADLTLSRSMMA----PPIFHPLPPRRFVNERVISNNQLLSQYIKSCSLMVS--PSN  240

Query  813   TSSDRPKTISLLFTDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVG-LMDLAVGLD  637
              + D   T++LLF D +VRA  +       F+ LAGL W  +S+AK     LMD+++ LD
Sbjct  241   VTEDHMVTVTLLFPDPLVRAGDNEPGI-STFEILAGLFWICVSRAKGKRNELMDMSLCLD  299

Query  636   VRKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDD---LLSQAANAIRNMRKEMDKEGIMDL  466
             VRK+L LD+ ++GNCMVY+KV +S    V   D   LL  A   I+N+ K +D + +MDL
Sbjct  300   VRKLLRLDQSYFGNCMVYHKVPYSKP--VKTKDKMLLLFHAVEEIQNITKRLDYDTVMDL  357

Query  465   IEWLDQNNCCASNVLDGCDSLVCVNLEGVD-PYSACFGNNMDPVHVSYYVEPEIGPGNRL  289
             IEWL  NN  A  + +G D LVC NLE +  P    F  ++   HVS YV+  +  G ++
Sbjct  358   IEWLGSNNNGA--ISNGSD-LVCTNLENMSHPRPMMFEEDLVLSHVSCYVKGPVAGGGQV  414

Query  288   LILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
             ++LPSP G G  SR VMV+LPE E VK++ED+L+   SP + M
Sbjct  415   IVLPSPSGKGQKSRVVMVSLPEREMVKVVEDELLLSFSPVVIM  457



>ref|XP_009125885.1| PREDICTED: protein ECERIFERUM 26 [Brassica rapa]
Length=454

 Score =   341 bits (875),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 195/454 (43%), Positives = 277/454 (61%), Gaps = 25/454 (6%)
 Frame = -2

Query  1488  MSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY-----REFDKDYT  1324
             M ED +   ICKRTVVST  V+ G+    +V D VME N +R+V+YY     RE  +   
Sbjct  1     MEEDRVK-LICKRTVVSTKPVEQGRLYRFSVFDHVMEPNHIRLVYYYQSSKAREPGEITK  59

Query  1323  KLNESIAETLNAYTIIMGRLLR----SPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVD  1156
             KL ES+A TLN Y I+ GRL++    +   +W +K NDAG+R+IEA+A G+V+EW  +V+
Sbjct  60    KLRESLAYTLNCYPIVTGRLVKETDGTEENRWKVKSNDAGVRMIEARATGTVEEWRSSVN  119

Query  1155  RDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWAD  976
             R++ELKLVHWE M   PY+WS FYVQ+TEFE GGL++GLSCTHLLADP+ A MFI+ WAD
Sbjct  120   REEELKLVHWEDMYHLPYYWSTFYVQVTEFESGGLAIGLSCTHLLADPVCAMMFIRTWAD  179

Query  975   MSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRP  796
             ++ T  M++     P           + H  S+  L++HY + ++     P    + D  
Sbjct  180   LTLTRNMMT-----PPIFHSLPPRRFSSHKLSNNQLLSHYNRSSSLTAPSP--NITEDYM  232

Query  795   KTISLLFTDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVG-LMDLAVGLDVRKVLG  619
              TI+LLF D MV+   +      AF+ LAGL    +S+AK     L D+++ LDVRK+L 
Sbjct  233   VTITLLFPDPMVQVGENEPGL-TAFEILAGLFCVCVSRAKGKRNELTDMSLCLDVRKLLR  291

Query  618   LDKGFYGNCMVYNKVKWSSGSMVLGD-DLLSQAANAIRNMRKE-MDKEGIMDLIEWLDQN  445
             LD+ ++GNCMVY+KV +S     +    LLS     I N+ K  +D   +MDL+EWL  N
Sbjct  292   LDQSYFGNCMVYHKVHYSKPVKAIDRLLLLSYVVQEIHNVTKGLLDYHAVMDLVEWLGSN  351

Query  444   NCCASNVLDGCDSLVCVNLEGV-DPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPP  268
             N   +N +     LVC NLE + +P    F  ++   H+S YVE  +  G ++++LPSP 
Sbjct  352   N---NNPISNGSDLVCTNLENMGNPRPMMFEEDLMLSHLSCYVEGPVAGGGQVIVLPSPS  408

Query  267   GTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
             G G +SR VMV+LP+ E VK++ED+L+   SP +
Sbjct  409   GEGPMSRVVMVSLPQREMVKVLEDELLQSFSPVL  442



>emb|CDX75252.1| BnaA01g04500D [Brassica napus]
Length=451

 Score =   339 bits (870),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 194/454 (43%), Positives = 275/454 (61%), Gaps = 25/454 (6%)
 Frame = -2

Query  1488  MSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY-----REFDKDYT  1324
             M ED +   ICKRTVVST  V+ G+    +V D VME N +R V+YY     RE  +   
Sbjct  1     MEEDRVK-LICKRTVVSTKPVEQGRLYRFSVFDHVMEPNHIRFVYYYQSSKTREPGEITK  59

Query  1323  KLNESIAETLNAYTIIMGRLLRSPG----EQWLIKCNDAGLRVIEAKAKGSVDEWLHNVD  1156
             KL ES+A TLN Y I+ GRL++        +W +K NDAG+R+IEA+A G+V+EW  +V+
Sbjct  60    KLRESLAYTLNCYPIVTGRLVKETAGTEENRWKVKSNDAGVRMIEARATGTVEEWRSSVN  119

Query  1155  RDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWAD  976
             R++ELKLVHWE M   PY+WS FYVQ+TEFE GGL++GLSCTHLLADP+ A MFI+ WAD
Sbjct  120   REEELKLVHWEDMYHLPYYWSTFYVQVTEFESGGLAIGLSCTHLLADPVCAMMFIRTWAD  179

Query  975   MSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRP  796
             ++ T  M++     P           + H  S+  L++HY + ++     P    + D  
Sbjct  180   LTLTRNMMT-----PPIFHSLPPRRFSSHKLSNNQLLSHYIRSSSLTAPSP--NITEDYM  232

Query  795   KTISLLFTDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVG-LMDLAVGLDVRKVLG  619
              T++LLF D MV+   +      AF+ LAGL    +S+AK     L D+++ LDVRK+L 
Sbjct  233   VTVTLLFPDPMVQVGENEPGL-TAFEILAGLFCVCVSRAKGKRNELTDMSLCLDVRKLLR  291

Query  618   LDKGFYGNCMVYNKVKWSSGSMVLGD-DLLSQAANAIRNMRKE-MDKEGIMDLIEWLDQN  445
             LD+ ++GNCMVY+KV +S     +    LLS     I N+ K  +D   +MDL+EWL  N
Sbjct  292   LDQSYFGNCMVYHKVHYSKPVKAIDRLLLLSYVVQEIHNVTKGLLDYHAVMDLVEWLGSN  351

Query  444   NCCASNVLDGCDSLVCVNLEGV-DPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPP  268
             N   +N +     LVC NLE + +P    F  ++   H+S YVE  +  G ++++LPSP 
Sbjct  352   N---NNPISNGSDLVCTNLENMGNPRPMMFEEDLMLSHLSCYVEGPVAGGGQVIVLPSPS  408

Query  267   GTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
             G G +SR VMV+LP+ E VK++ED+L+   SP +
Sbjct  409   GDGPMSRVVMVSLPQREMVKVLEDELLQSFSPVL  442



>ref|XP_006412466.1| hypothetical protein EUTSA_v10025128mg [Eutrema salsugineum]
 gb|ESQ53919.1| hypothetical protein EUTSA_v10025128mg [Eutrema salsugineum]
Length=466

 Score =   335 bits (859),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 197/462 (43%), Positives = 275/462 (60%), Gaps = 27/462 (6%)
 Frame = -2

Query  1491  TMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDY  1327
             T+ E+     ICKRTVVST  V+PG+   L+VLD VME N +R+V+YYR     E  +  
Sbjct  7     TIMEEERVRFICKRTVVSTKQVEPGQLYRLSVLDHVMEPNHIRLVYYYRCSKTREPGEIT  66

Query  1326  TKLNESIAETLNAYTIIMGRLLRSP---------GEQWLIKCNDAGLRVIEAKAKGSVDE  1174
              KL ES+A TLN Y II GRL++             QW +K ND+G+R++EA+A G+V+E
Sbjct  67    KKLRESLAYTLNCYPIITGRLVKEIDGTDEKNELNRQWKVKSNDSGMRMVEARATGTVEE  126

Query  1173  WLHNVDRDKELKLVHWEPMMSD-PYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATM  997
             WL NV+R++ELKLVHWE +  D PY+WS FYVQ+TEFE GGL++GLSC+HLLAD + A M
Sbjct  127   WLRNVNREEELKLVHWEDIYHDLPYYWSTFYVQVTEFESGGLAIGLSCSHLLADSVCAMM  186

Query  996   FIKAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPS  817
             FI+AWAD++ T  M++           P    ++    ++  L++HY K         PS
Sbjct  187   FIRAWADLTLTRNMMA---PPLFHSLPPRRFANHRLIANNNQLLSHYIKSCALTAT--PS  241

Query  816   QTSSDRPKTISLLFTDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVG-LMDLAVGL  640
               + DR  T++LLF D +VRA  +      AF+ LAG+ W  +S AK      MD+++ +
Sbjct  242   NVAKDRMVTVTLLFPDPLVRA-RNNEPGVSAFEILAGVFWVCVSLAKGKRNEFMDMSLCV  300

Query  639   DVRKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDL-LSQAANAIRNMRKEMDKEGIMDLI  463
             DVRK+L LD+ ++GNCMVY+KV +S         L LS A   I    K +D + +MDLI
Sbjct  301   DVRKLLRLDQSYFGNCMVYHKVHYSKPVKTKDRLLSLSHAVQEIHKTTKRLDYDTVMDLI  360

Query  462   EWLDQNNCCASNVLDGCDSLVCVNLEGV-DPYSACFGNNMDPVHVSYYVEPEIGPGNRLL  286
             EWL  N    SN +     LVC NLE +       F  ++   HVS YVE  +  G + +
Sbjct  361   EWLSSN---NSNPISNGSDLVCANLENMASSRPMMFEEDLILSHVSCYVEGPVAGGGQFI  417

Query  285   ILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
             +LPSP   G +SR VMV+LP  E VK+++D L+   +P + M
Sbjct  418   VLPSPSCEGPMSRVVMVSLPSREMVKVLDDDLLLSFAPVLLM  459



>ref|XP_002324841.2| hypothetical protein POPTR_0018s01250g [Populus trichocarpa]
 gb|EEF03406.2| hypothetical protein POPTR_0018s01250g [Populus trichocarpa]
Length=399

 Score =   330 bits (846),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 212/449 (47%), Positives = 265/449 (59%), Gaps = 73/449 (16%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYTKLNESIAET  1297
             ICKRTVVST  VQPGK C L+VLDR+ME N +R V+Y+R     E  +   KL ES++E 
Sbjct  7     ICKRTVVSTKPVQPGKHCSLSVLDRLMEQNHLRSVYYFRTPGGREPGELTKKLRESLSEM  66

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L  + I+ GRLL+ P   WLIKCNDAG+                                
Sbjct  67    LTCFPIVTGRLLKDPKGHWLIKCNDAGI--------------------------------  94

Query  1116  MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphf  937
                           TEF EGGL++GLSC HLLADP  ATMF+KAWAD++ TGKM++PP F
Sbjct  95    --------------TEFGEGGLAIGLSCFHLLADPTCATMFVKAWADVTLTGKMLNPPLF  140

Query  936   hplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVR  757
             H LPPRRP   N N       +L+N Y KP  D  +      S  +  TI+L F+D MVR
Sbjct  141   HQLPPRRPGRKNPNHEPYM--ELINCY-KPIADKTN----LVSDTKHATIALAFSDPMVR  193

Query  756   ACMSMAQ--------TPDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGLDKGF  604
             ACM+  Q        +P  F+ALAGL W  ISK K    GL+D+++ LD+R VL LD GF
Sbjct  194   ACMANGQAMNAFDQSSPSPFEALAGLFWVCISKLKGAGDGLIDMSICLDMRNVLHLDNGF  253

Query  603   YGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNV  424
             +GNCMVYNKV   S    L +  LS  A AI  +  +MD +GI DLIEWL+ N+  +   
Sbjct  254   FGNCMVYNKVNSKS----LKEHKLSDVAKAIGEVMAKMDNDGITDLIEWLEHNDYQSPPP  309

Query  423   LDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRT  244
             ++GC+ L+C +LE VDPY A F     P+ VS YVEP +G G+ +L+LPSPP  G LSRT
Sbjct  310   MNGCE-LMCASLEAVDPYLAVFEEGFVPIRVSSYVEPVVGAGH-VLVLPSPPCEGPLSRT  367

Query  243   VMVTLPENEAVKLMEDQLIHQLSPCIKMG  157
             VMVTLPE+EA +L ED LI   SP I MG
Sbjct  368   VMVTLPEDEAARLCEDDLILHFSPTILMG  396



>ref|XP_010525926.1| PREDICTED: protein ECERIFERUM 26-like [Tarenaya hassleriana]
Length=458

 Score =   316 bits (809),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 193/464 (42%), Positives = 268/464 (58%), Gaps = 32/464 (7%)
 Frame = -2

Query  1488  MSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYT  1324
             M +D +   ICKRTVVST  V+PGK    +V DRVME N +R+VFYY+     +  +   
Sbjct  1     MGDDRVK-FICKRTVVSTKPVEPGKSYRFSVFDRVMEPNHIRLVFYYKCPNAKKPGETTK  59

Query  1323  KLNESIAETLNAYTIIMGRLLRSPGEQ-WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK  1147
             KL ES+AE L  + +I GRL++  GE+ W ++CNDAG+R+IEA+A G+V+EWL NVD ++
Sbjct  60    KLRESLAEALTCFPMITGRLVKDEGERGWKVRCNDAGVRMIEARASGTVEEWLGNVDTEE  119

Query  1146  ELKLVHWEPMM--SDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
             EL+LVHWE +   S  YFWS FYVQ+TEFE GG ++GLS +HLLADPI AT  + AWA+ 
Sbjct  120   ELRLVHWEEIYHGSSSYFWSTFYVQITEFEGGGFAIGLSSSHLLADPICATTLLGAWAEA  179

Query  972   SFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRP-  796
             +     ++        P     N           L+ HY    +       SQ SS  P 
Sbjct  180   TLAPTTMAASPLVHQLPSCRPRNEKADPKPYDNHLLKHYINSCS-------SQPSSFNPT  232

Query  795   ----KTISLLFTDEMVRACM---SMAQTPDAFDALAGLLWTRISKAKN-NVGLMDLAVGL  640
                  T++LLFTD M+RA      M  +P  F+A  GL+WT +S+AK     LM +++ L
Sbjct  233   NNDFTTVTLLFTDPMIRAMARANGMKISP--FEATVGLIWTCMSRAKGMRDELMGMSLCL  290

Query  639   DVRKVLGLDKGFYGNCMVYNKVKWSSGSMVLGD-DLLSQAANAIRNMRKEMDKEGIMDLI  463
             DVR  L +++ F+GNCMVY+K++ +  S V    D+LS A   IR   KE+D + +MDLI
Sbjct  291   DVRMTLNVNENFFGNCMVYHKLQNTKRSSVTTTGDILSHAIEEIRRTTKEIDYDSVMDLI  350

Query  462   EWLDQNNCCASNVLDGCDSLVCVNLEGV-DPYSACFGNNMDPVHVSYYVE-PEIGPGNRL  289
             EWL   +     + +G D +VC NLE + D     F   M   HVS YVE P +G G   
Sbjct  351   EWLRIKD-HIDPIRNGSD-MVCTNLENLMDLGHTRFEEEMTLKHVSCYVEGPAVGGGRVT  408

Query  288   LILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKMG  157
             ++ P   G G +SR  M+TLP     K++ D+L+    P + MG
Sbjct  409   VLPPLSTGEGPMSRVAMITLPRTLIAKVLSDELLQTFHPIVLMG  452



>gb|EYU21934.1| hypothetical protein MIMGU_mgv1a008485mg [Erythranthe guttata]
Length=372

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 179/403 (44%), Positives = 238/403 (59%), Gaps = 61/403 (15%)
 Frame = -2

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKA-KGSVDEWLHNVDRDKELKLVHWEP  1120
             L+ + ++ GRLLR+    W +KCNDAGLR++EAK  KGSV++WL NVDR KELKLVHWE 
Sbjct  2     LSYFPMVTGRLLRTSDGDWTVKCNDAGLRMVEAKVMKGSVEKWLRNVDRKKELKLVHWEE  61

Query  1119  MMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpph  940
             M   PYFWS FYVQ+TEFE GGL++GLSCT LL+DPI ATM IKAWAD +  G++ S   
Sbjct  62    MFYKPYFWSTFYVQITEFEGGGLAIGLSCTRLLSDPICATMMIKAWADTTLIGEITS---  118

Query  939   fhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMV  760
                 P  R     +   ++ S  L++ +K   T     P S +++ +  TI+L F  E V
Sbjct  119   ---PPLFRLLPVPNRNTNHHSSSLIDRHKSYLTSS-PVPKSDSNTKQITTITLQFNQETV  174

Query  759   RA-CMSMAQ-------TPDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLGLDKG  607
             +  C++M          P  F ALAGL WT IS+AK    GL+D++             G
Sbjct  175   KKLCIAMVNDVNGRGPGPTPFQALAGLFWTCISRAKGMKRGLVDMS-------------G  221

Query  606   FYGNCMVYNKVKWSSGSMVLGDD--------LLSQAANAIRNMRKEMD-KEGIMDLIEWL  454
             F+GN MVYNKV      ++ GDD        +LS A  +I+     MD  + +M+LIE  
Sbjct  222   FFGNSMVYNKVV----VLLHGDDYHYHGNCEVLSDAVVSIKEAVSGMDGGDHVMELIE--  275

Query  453   DQNNCCASNVLDGC--DSLVCVNLEGVDPYSACFGNNMDPVHVSYYVE-PEIGPGNRLLI  283
                 C       GC  D L+CV+LE VD YSA F  N+ P+ VSYY++ P +G G ++L+
Sbjct  276   ----C-------GCDDDHLICVDLENVDCYSAVFEENVVPIRVSYYMDGPGVGAG-QILV  323

Query  282   LPSPPGT-GALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKMG  157
             +P+P G  G  SR V VTLPE+EA K++ED LI QL P   MG
Sbjct  324   MPAPGGGDGPESRVVAVTLPEDEAEKVLEDSLIRQLGPITLMG  366



>emb|CAB79683.1| hypothetical protein [Arabidopsis thaliana]
Length=414

 Score =   276 bits (705),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 176/462 (38%), Positives = 250/462 (54%), Gaps = 75/462 (16%)
 Frame = -2

Query  1497  RSTMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDK  1333
             ++ M ED +   ICKRTVVST  ++PG+   L+VLD VME N +R+V+YYR     E  +
Sbjct  6     KTIMEEDRVR-FICKRTVVSTRSIEPGRLYQLSVLDHVMEPNHIRLVYYYRCSKTREPGE  64

Query  1332  DYTKLNESIAETLNAYTIIMGRLLRSP---------GEQWLIKCNDAGLRVIEAKAKGSV  1180
                KL ES+A TLN Y I+ GRL++            ++W++K NDAG+           
Sbjct  65    ITKKLRESLAYTLNCYPIVTGRLVKEVDGMEENKDLSQRWMVKSNDAGV-----------  113

Query  1179  DEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISAT  1000
                                                TEFE GGL++GLSC+HLLADP+ A 
Sbjct  114   -----------------------------------TEFESGGLAIGLSCSHLLADPVCAM  138

Query  999   MFIKAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPP  820
             MFI+AWAD++ +  M++     PL    P     N    S+  L++HY K  +      P
Sbjct  139   MFIRAWADLTLSRSMMA----PPLFHPLPPRRFSNQRLISNNQLLSHYIKSCSLTAS--P  192

Query  819   SQTSSDRPKTISLLFTDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVG-LMDLAVG  643
             S  + D   T++ LF D +VRA  +  +    F+ LAGL W  +S+AK     LMD+++ 
Sbjct  193   SNMTEDHMVTVTFLFPDPLVRAGENEPRI-STFEILAGLFWVCVSRAKGKRNELMDMSLC  251

Query  642   LDVRKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLI  463
             LDVRK+L LD+ ++GNCMVY+KV +S   +   D LL  A   I ++ K +D + +MDLI
Sbjct  252   LDVRKLLRLDQSYFGNCMVYHKVPYSK-PVKTKDKLLFHAVQEIESITKRLDYDTVMDLI  310

Query  462   EWLDQNNCCASNVLDGCDSLVCVNLEGVD-PYSACFGNNMDPVHVSYYVEPEIGPGNRLL  286
             EWL  NN   SN   G D LVC NLE +       F  ++   HVS YVE  +  G +++
Sbjct  311   EWLSSNNGAISN---GSD-LVCTNLENMSHSRPMMFEEDLALSHVSCYVEGPVAGGGQVI  366

Query  285   ILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
             +LPSPPG   +SR VMV+LP+   VK++ED+L+   SP + M
Sbjct  367   VLPSPPGKEPMSRVVMVSLPQRVMVKVIEDELLLSFSPVVIM  408



>ref|XP_006829665.1| hypothetical protein AMTR_s00122p00127100 [Amborella trichopoda]
 gb|ERM97081.1| hypothetical protein AMTR_s00122p00127100 [Amborella trichopoda]
Length=461

 Score =   271 bits (692),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 173/466 (37%), Positives = 243/466 (52%), Gaps = 44/466 (9%)
 Frame = -2

Query  1464  TIC-KRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKD-----YTKLNESIA  1303
             +IC KRT+VS  V  PGK   L+ LDR+ME + +R V+YYR   +D       KL ES++
Sbjct  9     SICSKRTIVSAYVTPPGKIFLLSPLDRIMELHNIRAVYYYRFGGEDEALVLVNKLKESLS  68

Query  1302  ETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWE  1123
               L+++ ++ GRL+R     W +K  D G+R++E +   ++DEWL  V+RD ELKL HWE
Sbjct  69    MLLSSFPVMTGRLVRGETGSWWVKLIDTGVRLVEGRVNMTIDEWLTVVNRDAELKLAHWE  128

Query  1122  PMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpp  943
              M  D YFWS FYVQLT FE GGL+LG SC+HLL+D I A  F+K WA+     K IS  
Sbjct  129   DMRVDMYFWSTFYVQLTVFEGGGLALGFSCSHLLSDAICAAQFVKKWAETHL--KQISIY  186

Query  942   hfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSD---RPKTISLLFT  772
                 L          +   N S   + HY+       ++  SQ   D      T++  F+
Sbjct  187   PPTHLSLTPITGAVSSSFLNDS-PCVKHYESAAKAHTEQGRSQGLRDPIAAHSTVTFHFS  245

Query  771   DEMVRACMSMAQ-------TPDAFDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVLGLD  613
             +EMV+ C+  AQ        P  F+AL  L W   S+ K    L+DL++ L++R  LGL 
Sbjct  246   NEMVQKCIRDAQWGSLNGLQPTPFEALTALFWVACSRVKGQETLVDLSLCLNMRSTLGLG  305

Query  612   KGFYGNCMVYN---------KVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIE  460
               F+GN MV+          K +   G +     +L +A N I        +E  M L+ 
Sbjct  306   DEFFGNAMVFTIMDPHNMNIKKEMKEGELGYLTRILQEAVNKI-------GEEEAMHLLR  358

Query  459   WLDQNNCCASNVLD------GCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPG  298
             W++                     LVC NLE +  Y   FGN ++PV VS YVEP  G G
Sbjct  359   WVESKREGEGGKKQYEPFPVYGPGLVCANLEELPLYEVVFGNGLEPVRVSLYVEPVAGEG  418

Query  297   NRLLILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
               +LILPSP   G L+R V VTLP+++A+KL ++ LI   +  I +
Sbjct  419   E-ILILPSP--EGGLARNVSVTLPKDQALKLSKEPLIFSFNSMIPI  461



>ref|XP_009393051.1| PREDICTED: protein ECERIFERUM 26-like [Musa acuminata subsp. 
malaccensis]
Length=452

 Score =   229 bits (584),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 154/465 (33%), Positives = 239/465 (51%), Gaps = 47/465 (10%)
 Frame = -2

Query  1488  MSEDNISSTIC-KRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK-DYTKLN  1315
             M+      T+C K TVVS   V+ GK  PL+ LD  M  + +R+VFYYR     D  KL 
Sbjct  1     MTAGGRRVTVCAKTTVVSMTPVRQGKTYPLSALDHAMGRHTLRLVFYYRPGPTMDKFKLK  60

Query  1314  ESIAETLNAYTIIMGRLLRSPGEQ-----WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRD  1150
             ES++E L+ Y  + GRL R   E      W++KCNDAG+R+ EA+A  ++DEWL + D +
Sbjct  61    ESLSEVLSQYPAVTGRLAREEEEGGGHGGWVVKCNDAGVRLAEARASVTLDEWLRSADDE  120

Query  1149  KELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMS  970
             +E++L +WEPM +DP+ WSPFYVQ+TEFE+  +++GLSC H+ ADP  A + ++AW+D  
Sbjct  121   EEMELAYWEPMDADPFIWSPFYVQITEFEDKAIAIGLSCPHMHADPTCAILLVRAWSDAH  180

Query  969   FTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKT  790
                 ++        P          P  N S  L++ +K  +T      P+  +  R  +
Sbjct  181   RRACVV------YPPFLHAPAFFPRPQPNPSSPLLS-FKSSST------PATHTKGRMSS  227

Query  789   ISLLFTDEMVRACMSMAQTP---DAFDALAGLLWTRISKAKN-----NVGLMDLAVGLDV  634
              + +F+D  V++C++ A  P     FDALA L WTRI++A        +GL DL + +D 
Sbjct  228   ATFVFSDAAVKSCLADAGLPLDSSPFDALAALFWTRIARASTPEPDAPLGLADLTLCIDF  287

Query  633   RKVLG--LDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIE  460
             RK +   L  GFYGN   + + +   GS       L   A  +R     + +E   + +E
Sbjct  288   RKHMHAPLPHGFYGNAFHFYRTRADLGSG------LEHVAAELRRHAAAIREEDFWEAVE  341

Query  459   WLDQNNCCASNV-----LDGCDSLVCVNLEGVD-PYSACF-GNNMDPVHVSYYVEPEIGP  301
             W+ +             + G + L C+ ++     Y A F  +   P HV+  V    G 
Sbjct  342   WVHERRPGRREADPPFQMYGPE-LTCMQMDHQPFAYGAAFEKDGGRPAHVTCRVRGVEGA  400

Query  300   GNRLLILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
             G  L++  +  G    +R V+VTLPE  A ++ +D  I +  P +
Sbjct  401   GLVLVMTAAEEGA---ARQVVVTLPEEVADRICQDDAIMKYVPVV  442



>ref|XP_006838953.1| hypothetical protein AMTR_s00002p00270800 [Amborella trichopoda]
 gb|ERN01522.1| hypothetical protein AMTR_s00002p00270800 [Amborella trichopoda]
Length=474

 Score =   224 bits (571),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 154/451 (34%), Positives = 236/451 (52%), Gaps = 28/451 (6%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPG---KFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYTKLNESI  1306
             +C R  ++     PG   K  PL++LD +M  + +RIVFYY+     E    +  L E++
Sbjct  13    VCPRAKLTVIPAVPGQLSKIHPLSLLDHMMGVHNLRIVFYYKTPRNKEEGLRHESLKEAL  72

Query  1305  AETLNAYTIIMGRLLRSPGE-QWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVH  1129
             +ETL++Y I+ GRL     E +W ++CNDAG+RV+EAK +G+V++WL   +   E  L +
Sbjct  73    SETLSSYPIVTGRLKGGNEEGRWEVQCNDAGVRVVEAKVEGTVEDWLERAEAADEEGLTY  132

Query  1128  WEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMIS  949
             WE M  DP FWS FYVQLT+FE GG ++GLSCTHL ADP SAT+ IKAW+++    K IS
Sbjct  133   WEKMPEDPCFWSTFYVQLTQFEGGGFAIGLSCTHLSADPTSATLLIKAWSEI-HRRKAIS  191

Query  948   pphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDD--GDKPPSQTSSDRPKTISLLF  775
              P F       P       H  ++  L +      T    G+  PS T    P ++  L 
Sbjct  192   TPPFFHAYALSPNPQILTVHTPATHLLHSKLTAQNTPQNFGENYPSATFHFPPSSVRTLI  251

Query  774   TDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVGLMD-LAVGLDVRKVLG--LDKGF  604
             +   +     +  TP  F+ALA L W   +++ +     + + +  + R++L   L +G+
Sbjct  252   SK--IEEETKLQVTP--FEALAALFWVASTRSHHTDSYTESICLCTEFRRLLQVPLPQGY  307

Query  603   YGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWL-----DQNNC  439
             +GN + +++V     ++   +  L+ AA  I   + +  +E I  +I WL     D    
Sbjct  308   FGNALHFSEVSEKRANLARYNSGLALAARLIHEDQDKAKEEEIWSVINWLAARKSDSGRS  367

Query  438   CASNVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTG  259
              +   + G   L   N EGV  Y+A F     P+HVSY VEP +G G  +L+LPS    G
Sbjct  368   SSPFPIYG-PGLTVANFEGVMSYNAVFTEGDRPLHVSYRVEPVVGEG-MVLVLPS--DEG  423

Query  258   ALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
                R V+VTL  +   +L +D+ +  L P I
Sbjct  424   DFGRIVVVTLQGDRLSRLRKDKEVSGLGPKI  454



>ref|XP_010256176.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nelumbo nucifera]
Length=454

 Score =   221 bits (563),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 150/455 (33%), Positives = 232/455 (51%), Gaps = 37/455 (8%)
 Frame = -2

Query  1476  NISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREF---DKDYTKLNESI  1306
              I     K TVVS    +PGK   L++LD  M  + + IVFYYR       D  +L ES+
Sbjct  6     TIVEVCSKLTVVSDTPTRPGKTFSLSLLDHTMGLHTLHIVFYYRHKWSNSDDLGRLRESL  65

Query  1305  AETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHW  1126
             A+ LN Y  I GR  +     W++ CNDAG+R++++    ++D+WL + +  +E  L  W
Sbjct  66    ADVLNYYPPITGRFQKGEDGNWVVACNDAGVRILKSNVHTTLDDWLKSAEGSEERDLTVW  125

Query  1125  EPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISp  946
             E M  DP  WSPF +QL EFE  G+++GLSC+H+ ADP  AT+F K+W + ++    I  
Sbjct  126   EDMPEDPTLWSPFRIQLNEFEGEGMAIGLSCSHMHADPTCATIFFKSWTE-TYRRDAIKH  184

Query  945   phfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDE  766
               F   P  R   + +    ++        K        +PPS     +  T +  F++ 
Sbjct  185   SPFFHPPGLRGRPSPNTNTESA--------KYYAAKSKAEPPSPV---KMSTATFRFSEA  233

Query  765   MVRACMSMAQT--PDA--FDALAGLLWTRISKAKNNVGLM-----DLAVGLDVRKVLG--  619
              ++ C+S  Q   PDA  FD LA L WT   +AK     +      L++ +D+RK++   
Sbjct  234   AIQKCLSEVQNQCPDATPFDVLAALFWTSAVRAKTAPEAIPEQKRSLSICIDIRKLMHAP  293

Query  618   LDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQN--  445
             L  G++GN + ++ V   +G M  G   L+  A  +R+    + +E     I+W++    
Sbjct  294   LPHGYFGNALYFSLVSSEAGKMDEGG--LAYVAGLVRSHMSSLKEEDFWSAIDWIESQKE  351

Query  444   --NCCASNVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSP  271
                   +  + G + L C N+E +  YSA     + PVHVSY++    G G  +L+LPSP
Sbjct  352   GGKFAPAWRMYGPE-LTCANMEHLFSYSAML-EELKPVHVSYHIGNVEGEG-LILVLPSP  408

Query  270   PGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
                  L RTVMVTLPE++ V+L +D  I  L P +
Sbjct  409   --EEGLGRTVMVTLPEDQTVQLCKDPAILSLQPTM  441



>ref|XP_010917798.1| PREDICTED: LOW QUALITY PROTEIN: protein ECERIFERUM 26-like [Elaeis 
guineensis]
Length=434

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 149/457 (33%), Positives = 223/457 (49%), Gaps = 60/457 (13%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE---FDKDYTKLNESIAET  1297
             +   K T VS   V+PGK  PL+ LD +M  + + +VFYYR     D+D   L ES++E 
Sbjct  9     TVYAKSTAVSGTPVRPGKTYPLSSLDHLMGRHTLHLVFYYRPGPTLDRD--GLKESLSEV  66

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L+ Y    GRL R     W++KCNDAG+R+++A+A  +++EWL +   ++E++L +WEPM
Sbjct  67    LSHYPAATGRLSRGEDGGWIVKCNDAGVRLLDARANVTLEEWLGSASAEEEMELAYWEPM  126

Query  1116  MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphf  937
               DP  WSP+Y+Q+TEFE+   ++GLSCTH+ ADP  AT+ ++AWAD S     I+   F
Sbjct  127   GDDPSIWSPYYIQITEFEDKAFAIGLSCTHMHADPTCATLLVRAWAD-SHRRACIAYAPF  185

Query  936   hplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPP--SQTSSDRP-------KTIS  784
                                   L      P  D     P  S  SS  P        + +
Sbjct  186   ----------------------LHPPAFLPRPDPRPSHPLLSLKSSSTPFASNSKMSSAT  223

Query  783   LLFTDEMVRACMSMAQTPDA--FDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLG--  619
               F+D  V++ ++  Q PDA  F ALA L W+RI++A     G  +L + +DVRK +   
Sbjct  224   FRFSDLAVKSLLADLQ-PDASPFSALAALFWSRIARAAGVPPGPGELTLVVDVRKRMHAP  282

Query  618   LDKGFYGNCMVYNKVK--WSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQN  445
             L  GFYGN + +++ +   ++G   + D+L    A         + ++ +    EW  + 
Sbjct  283   LPHGFYGNALHFSRARANLAAGVAHVVDELGRHVAG--------LPEDEVWAAAEWAHER  334

Query  444   NCCASNVLD-GCDSLVCVNLEGVDPYSACF---GNNMDPVHVSYYVEPEIGPGNRLLILP  277
                           L C  L+ +  Y A F   G    P HVS  V    G G   L++ 
Sbjct  335   RHRGEEAFQMYGPELTCFALDHLMAYGAAFEKEGEGGRPAHVSCRVGGAEGEG---LVVV  391

Query  276   SPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
              P      +RTVMVTLPE  A  +  D  I +  P +
Sbjct  392   LPAAEEGAARTVMVTLPEEVAKTICRDDAILRYGPTV  428



>ref|XP_011091952.1| PREDICTED: protein ECERIFERUM 1-like [Sesamum indicum]
Length=458

 Score =   208 bits (529),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 147/470 (31%), Positives = 223/470 (47%), Gaps = 87/470 (19%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-------FDKDYTKLNESIAETLN  1291
             +VVS + V PGK   L+ LDR M ++ + IVFYY         F  D   L  S+++ L+
Sbjct  24    SVVSGSPVAPGKVHILSPLDRAMGHHTIHIVFYYESNPFKDGPFPLDIDNLRVSLSKLLD  83

Query  1290  AYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMS  1111
              Y I+ GRL R     W ++CNDAG+R+++A    S+DEWL + D  +E  L  WE M  
Sbjct  84    EYPIVTGRLTRGAEGGWQVRCNDAGVRILQATVNTSMDEWLRSADASEERDLTLWEDMPQ  143

Query  1110  DPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhp  931
             DP +WSPF +Q+  FE G L++GLSCTH+ AD  SATM IK+W ++              
Sbjct  144   DPSYWSPFRIQINNFECGALAIGLSCTHMHADMTSATMLIKSWTEV--------------  189

Query  930   lpprrpcnnnhnphhNSSGDLMNH-----YKKPTTDDGDKPPSQTSSDRP------KTIS  784
                              SG  + H        P +  G+  PS T+   P       T++
Sbjct  190   ----------------HSGQPLTHSPIFNLPPPPSSHGNFVPSFTALHSPITPANMGTVT  233

Query  783   LLFTDEMVRACMSMAQT--PDA--FDALAGLLWTRISKAKN---NVGLMDLAVGLDVRKV  625
             + F+  ++  C+   Q+  PDA  FD L  + W+RI++ +    N     L++ +D R  
Sbjct  234   MKFSGSVIENCLLQVQSQCPDATPFDVLVAIFWSRIARWQEPSFNNHKCSLSICVDSRSA  293

Query  624   LG--LDKGFYGNCMVYNKVKWSSGSMVLGDDLLS----QAANAIRNMRKEMDKEGIMDLI  463
                 +  G++GN + ++ +       V  D LLS    Q +  + +   +   +    ++
Sbjct  294   GHPEVPFGYFGNALHFSVL------YVDADKLLSCGLGQVSQYVHSHVAKARADEFWSVM  347

Query  462   EWLDQNNCCASNVLDG-----CDSLVCVNLEGVDP--------YSACFGNNMDPVHVSYY  322
              WLD++    SN  +G        L C+N+E +          Y+A F     P+HVSY+
Sbjct  348   RWLDEH----SNEGEGPFTIYGPRLTCINMEHMAVAENGTALMYAASFKKGERPIHVSYH  403

Query  321   VEPEIGPGNRLLILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSP  172
             V    G G   LI+  P   G L+RTV V LPE E   + +DQ I  L P
Sbjct  404   VGKVEGQG---LIMVMPSAEGGLARTVTVMLPEEEITNICKDQTILDLEP  450



>ref|XP_011032417.1| PREDICTED: protein ECERIFERUM 26-like [Populus euphratica]
Length=450

 Score =   207 bits (527),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 149/453 (33%), Positives = 228/453 (50%), Gaps = 43/453 (9%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAETLNAY  1285
             T VS+  V PG+  PL+ LD  M  + + +VFYY++     FD D   L  S++E L+ Y
Sbjct  15    TAVSSKPVGPGQTHPLSALDHAMALHTLHLVFYYKKNPFGIFDVD--PLRVSLSEVLSLY  72

Query  1284  TIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDP  1105
               + GRL R     W +KCNDAG+R++ A    ++DEWL + D  +E  L  WE M  DP
Sbjct  73    PQVTGRLTRGESGNWEVKCNDAGVRIVRANVGVTIDEWLRSADVSEEKDLAVWEEMPEDP  132

Query  1104  YFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplp  925
               WSPF +Q+TEFE GG++ GLSCTH+ ADP S T+  K+W + S   + I        P
Sbjct  133   STWSPFRIQVTEFEGGGVAFGLSCTHMNADPTSLTLLFKSWIE-SHRQEPIE-----HPP  186

Query  924   prrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMS  745
                    +H    ++SG   N+Y        +K  ++T   +  T +  F++  +  C++
Sbjct  187   LFNSTPPHHQQVPDTSGKSTNYY-------ANKANARTPLVKMVTATFRFSNSAINKCLN  239

Query  744   MA--QTPDA--FDALAGLLWTRIS--KAKNNVGLMDLAVGLDVRKVLG--LDKGFYGNCM  589
                 Q P+A  FD LA L WTR+   KA  +     L+V LD R+++   +  G++GN +
Sbjct  240   EVHDQCPEATPFDLLAALFWTRLVLLKAPKHDNKCSLSVCLDFRRLVQPPIPLGYFGNAL  299

Query  588   VYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWL----DQNNCCASNVL  421
              +  +  +   M  G   L      +      + +E I D ++WL    ++    A    
Sbjct  300   HFAMITVTEEEMDNGK--LGHMVELVHRHVSGVGEEEIWDAVDWLESRKEEGGKHAPPFR  357

Query  420   DGCDSLVCVNLEGVDP------YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTG  259
                  L CV++E +         SA F ++  PVHV+ + +  +G G   LI+  P    
Sbjct  358   MYGPELTCVSMEHMIIGNKSLMSSASFKSDEKPVHVACHFDNVVGEG---LIVVMPSINE  414

Query  258   ALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKM  160
              L+RTV+VTLPE E  +L EDQ I +L P + M
Sbjct  415   DLARTVIVTLPEEEMPQLCEDQAIQRLQPTMLM  447



>ref|XP_007030599.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY11101.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=450

 Score =   206 bits (524),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 146/466 (31%), Positives = 236/466 (51%), Gaps = 47/466 (10%)
 Frame = -2

Query  1488  MSEDNISSTI-CKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDY  1327
             MSE +    +  K T VS+  V+PGK   LT LD+ M  + + +VFYY +     FD D 
Sbjct  1     MSEQSSRVNVHSKLTAVSSKPVEPGKTHLLTPLDQAMGQHSLHLVFYYEKNPFGSFDLDP  60

Query  1326  TKLNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK  1147
              ++  S++ETL+ Y  + GRL R     W +KCND+G+RV+ AK    +DEWL   +  +
Sbjct  61    IRV--SLSETLSLYPTVTGRLTRGESGNWEVKCNDSGVRVLRAKVSVGIDEWLRYGNGME  118

Query  1146  ELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSF  967
             E  L  WE M  +P  WSPF +Q+TE E GG+++GL+C+H+ AD  S  +F K W +   
Sbjct  119   ERDLAAWEDMPENPNTWSPFRIQVTELEGGGVAIGLNCSHMNADLTSLVLFFKTWTEAHR  178

Query  966   TGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTI  787
                ++        PP      +      S      HY         K   +  S +  + 
Sbjct  179   QQAIV-------YPPVFSSALHGRAVPVSDSKSAEHYVA-------KSFVEAPSVKMAST  224

Query  786   SLLFTDEMVRACMSMAQT--PDA--FDALAGLLW---TRISKAKNNVGLMDLAVGLDVRK  628
             +  F++ +++ C+S      PDA  FD LA L W    R++ +K++     +++ +D R+
Sbjct  225   AFKFSNSVIKKCLSEIHVTCPDATPFDLLAALFWIPVARLNGSKHD-HTHSISICIDFRR  283

Query  627   VLG--LDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWL  454
             +L   L  G++GN + ++ +      ++ G+  L   A A+      M +E I+ +++WL
Sbjct  284   LLKEPLSYGYFGNALHFSVLSLGEKDLIPGE--LGHVAEAVHGHIAGMKEEEILSVMDWL  341

Query  453   D----QNNCCASNVLDGCDSLVCVNLEGVDP------YSACFGNNMDPVHVSYYVEPEIG  304
             +    +    A         L CV++E +        Y+  F +N+ P HV+ +V    G
Sbjct  342   ESRKGEGGKYAQPFRMYGPELTCVSMEHMINGDQSLMYATMFEDNVRPAHVACHVGNVEG  401

Query  303   PGNRLLILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
              G  ++++PSP   GAL+RTVMVTLPE E  KL ED+ I +L P +
Sbjct  402   EG-LIMVMPSP--EGALARTVMVTLPEEEIAKLCEDEAILRLEPTM  444



>ref|XP_010695055.1| PREDICTED: protein ECERIFERUM 26-like [Beta vulgaris subsp. vulgaris]
Length=476

 Score =   206 bits (524),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 148/453 (33%), Positives = 229/453 (51%), Gaps = 36/453 (8%)
 Frame = -2

Query  1449  TVVSTNVVQPG-KFCPLTVLDRVMENNFVRIVFYYREFDKDYTKLNESIAETLNAYTIIM  1273
             TVVS+  V P  K CPLTV+DR M  + + ++FY+R    D+  +  +I E L+ Y  + 
Sbjct  27    TVVSSIPVNPSDKTCPLTVVDRAMGQHSLHVIFYFRSGSLDFDGIRPAINEVLSMYPNVT  86

Query  1272  GRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWS  1093
             GRL +     W+IKC DAG+RV  AK + SVDEWL +   D E  L  ++ +  DP +WS
Sbjct  87    GRLAKDDDSNWVIKCTDAGMRVHRAKVETSVDEWLRSASADDERYLSVYQELPDDPKYWS  146

Query  1092  PFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplpprrp  913
             PF +++T+FE GG ++ LSC H+LADPIS T+ IK+W +      ++ PP  HP     P
Sbjct  147   PFRMKVTDFEGGGTAISLSCPHMLADPISMTLLIKSWTEAYHHDVVVHPPFLHPHALNIP  206

Query  912   cnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMSMAQT  733
                     + +S    ++Y   +      P  + +S      +L     +V+ C  +   
Sbjct  207   HTFTTPLPNTTSP---SYYLSKSKTSYPNPKVKMASATFDFSNLAIKQFLVKNCSVL---  260

Query  732   PDA--FDALAGLLWTRISKAKNNVGLM--DLAVGLDVRKVL--GLDKGFYGNCMVYNKVK  571
             PDA  FD L  L WT I+K K     +   +++ +D+RK L   L  G++GN + ++++ 
Sbjct  261   PDATPFDLLTALFWTSIAKLKAQTDDLKQSISICMDMRKRLRAALPYGYFGNALHFSQLT  320

Query  570   WSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWL-----DQNNCCASNVLDGCDS  406
               +G+ +     + Q A  +      +  E     ++WL     DQ        + G + 
Sbjct  321   -VNGNKISNKGDIGQVAELVHRHVVGLKDEEFWSAVDWLNSRKDDQGKFLPPFRMYGPE-  378

Query  405   LVCVNLEG-VDP------------YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPG  265
             L  VN+E  + P            Y   F  +  PVHVSY+VE   G G  +L++PSP  
Sbjct  379   LTFVNMESMIAPIGLNMNEAQPLMYGVEFMKDQKPVHVSYHVENVEGEG-LILVMPSP--  435

Query  264   TGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
                L+R V VTLPE E  KL++D++I  L P +
Sbjct  436   EEELARRVTVTLPEEEIEKLLKDEVILSLDPIL  468



>ref|XP_006382783.1| hypothetical protein POPTR_0005s05380g [Populus trichocarpa]
 gb|ERP60580.1| hypothetical protein POPTR_0005s05380g [Populus trichocarpa]
Length=450

 Score =   204 bits (519),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 149/463 (32%), Positives = 231/463 (50%), Gaps = 46/463 (10%)
 Frame = -2

Query  1476  NISSTICKR---TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTK  1321
             NI+S +      T VS+  V PG+  PL+ LD  M  + + +VFYY++     FD D  K
Sbjct  3     NINSRVSVHSMLTAVSSKPVGPGQTHPLSALDHAMALHTLHLVFYYKKNPFGIFDVDPLK  62

Query  1320  LNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKEL  1141
             +  S++E L+ Y  + GRL R     W +KCNDAG+R++ A    ++DEWL + D  +E 
Sbjct  63    V--SLSEVLSLYPQVAGRLTRGESGNWEVKCNDAGVRILRANVGVTIDEWLRSADVSEEK  120

Query  1140  KLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTG  961
              L  WE M  DP  WSPF +Q+ EFE GG++ GLSCTH+ ADP S T+  K+W + S   
Sbjct  121   DLTVWEEMPEDPSTWSPFRIQVNEFEGGGVAFGLSCTHMNADPTSVTLLFKSWIE-SHRQ  179

Query  960   KMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISL  781
             + I        P       +H    ++SG   N+Y        +K  ++T S +  T + 
Sbjct  180   EPIE-----HPPLFNSTPLHHQQVPDTSGKSTNYY-------ANKANARTPSVKMVTATF  227

Query  780   LFTDEMVRACMSMA--QTPDA--FDALAGLLWTRIS--KAKNNVGLMDLAVGLDVRKVLG  619
              F++  +  C++    Q P A  FD LA L WTR+   KA  +     L+V LD R+++ 
Sbjct  228   RFSNSAINKCLNEVHDQCPQATPFDLLAALFWTRLVLLKAPKHDNKCSLSVCLDFRRLVQ  287

Query  618   --LDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWL---  454
               +  G++GN + ++ +  +   M  G   L      +      ++ E +   ++WL   
Sbjct  288   PPIPLGYFGNALHFSMLTLNEEEMDYGK--LGHVVELVHRHVSGVETEEVWYAVDWLESQ  345

Query  453   -DQNNCCASNVLDGCDSLVCVNLEGVDP------YSACFGNNMDPVHVSYYVEPEIGPGN  295
              ++    A         L CV++E +         SA F ++  PVHV+ +    +G G 
Sbjct  346   KEEGGKHAPPFRMYGPELTCVSMEHMIIGNKSLMSSASFKSDEKPVHVACHFGNVVGEG-  404

Query  294   RLLILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
               LI+  P     L+RTV+VTLPE E  +L EDQ I +L P +
Sbjct  405   --LIVVLPSVEEGLARTVIVTLPEEEMPQLCEDQAIQRLQPTM  445



>ref|XP_011004269.1| PREDICTED: protein ECERIFERUM 26-like [Populus euphratica]
 ref|XP_011004270.1| PREDICTED: protein ECERIFERUM 26-like [Populus euphratica]
Length=472

 Score =   204 bits (518),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 144/473 (30%), Positives = 224/473 (47%), Gaps = 43/473 (9%)
 Frame = -2

Query  1506  SFIRSTMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----  1342
             SF    + +++  S     T +S+  V  GK  PL+VLD  M  + V +VFYY+      
Sbjct  18    SFSEKMVRKNSRVSVRSMLTAISSKPVGSGKTHPLSVLDHAMGLHTVHVVFYYKNNPFGI  77

Query  1341  FDKDYTKLNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHN  1162
             FD D  ++  +++E L  Y  + GRL R     WL+KC+DAG+RV+ AK + ++DEWL +
Sbjct  78    FDVDPLRI--ALSEVLCLYPQVTGRLTRGESGNWLVKCHDAGVRVLRAKVEATMDEWLRS  135

Query  1161  VDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAW  982
              D  +E  L  WE +  +P  WSPF VQ+ EFE GG++ GLSCTH+ ADP S T+  K+W
Sbjct  136   ADGSEEKDLTFWEEIPEEPSTWSPFRVQVNEFEGGGVAFGLSCTHMNADPTSITLLFKSW  195

Query  981   ADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSD  802
              +      +                   +        + N   KP      K  ++T S 
Sbjct  196   IECHRQEPL-------------EHPPLFSSTTLHHQQVPNTSTKPDNYYATKGNAETPSV  242

Query  801   RPKTISLLFTDEMVRACMSMAQTPDA----FDALAGLLWTRIS--KAKNNVGLMDLAVGL  640
             +  T +  F+   ++  +       A    F+ LA L WTR++  KA  N     L++ L
Sbjct  243   KMVTATFKFSGSAIKKWLDEVHDQCAKATPFELLAALFWTRVAHLKAPKNDNKHSLSICL  302

Query  639   DVRKVLG--LDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDL  466
             D R+++   +  G++GN + ++ +      M  G   L    N +      + +E +  +
Sbjct  303   DFRRLVQPPISLGYFGNALHFSLLTLDEEEMDYGK--LGHVVNMVHRHISNVGEEEVWSV  360

Query  465   IEWL----DQNNCCASNVLDGCDSLVCVNLEGVDP------YSACFGNNMDPVHVSYYVE  316
             ++W     ++    A         L CV++E +        + A F ++  PVHVS +V 
Sbjct  361   VDWFESQKEEGGKYAQPFRMYGPELTCVSMEHMIIGHKSLMFPASFKSDEKPVHVSCHVG  420

Query  315   PEIGPGNRLLILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCIKMG  157
                G G   LI+  P     L+RTVMVTLPE E  KL EDQ I  L P + +G
Sbjct  421   NVRGEG---LIVVLPSVEEGLARTVMVTLPEEEMPKLCEDQAIQCLQPTMLIG  470



>ref|XP_008811612.1| PREDICTED: protein ECERIFERUM 26-like [Phoenix dactylifera]
Length=434

 Score =   202 bits (514),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 136/443 (31%), Positives = 212/443 (48%), Gaps = 32/443 (7%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK-DYTKLNESIAETLN  1291
             +   K T VS + V+PGK  PL+ LD +M  + + +VFYYR     D   L ES++E L+
Sbjct  9     TVFAKSTAVSVSPVRPGKTYPLSALDELMGRHTLHLVFYYRPGPTLDREGLKESLSEVLS  68

Query  1290  AYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMS  1111
              Y  + GRL R     W +KCNDAG+R+++A+A  +++EWL +   ++E++L  WEPM  
Sbjct  69    HYPAVTGRLGRGEDGGWTVKCNDAGVRLLDARASVTLEEWLGSATAEEEMELACWEPMGE  128

Query  1110  DPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhp  931
             DP  WSP+Y+Q+TEFE+   ++GLSCTH+ ADP  A + ++AWAD        S      
Sbjct  129   DPSIWSPYYIQITEFEDKAFAIGLSCTHMHADPTCAILLVRAWAD--------SHRRASI  180

Query  930   lpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRAC  751
                         P  +   D      K ++      P  +S+      +  F+D  V++ 
Sbjct  181   AYAPFFHPPAFLPRPDPRPDHPLLSLKSSSSALAAAPKMSSA------TFRFSDLAVKSL  234

Query  750   MSMAQT-PDAFDALAGLLWTRISKAKN-NVGLMDLAVGLDVRKVLG--LDKGFYGNCMVY  583
             ++  Q     F ALA L W+RI++A     G  +L + +D RK +   L  GFYGN + +
Sbjct  235   LADLQADASPFSALAALFWSRIARASGVPPGPGELTLFVDFRKRMHAPLPHGFYGNALHF  294

Query  582   NKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGCD-S  406
             ++ +          D ++  A+ +      + +E      EW  +               
Sbjct  295   SRARADLA------DGVAHVADHLGRHVAGLQEEEFWAAAEWAYERRRRGEEAFQMYGPE  348

Query  405   LVCVNLEGVDPYSACF---GNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTVMV  235
             L C+ L+ V  Y A F   G    P HVS  V    G G   +++  P      +RTV+V
Sbjct  349   LTCLALDHVTAYGAAFEKEGEGGRPAHVSCRVGGADGEG---VVVVLPAAEEGAARTVVV  405

Query  234   TLPENEAVKLMEDQLIHQLSPCI  166
             TLPE  A  +  D  I +  P +
Sbjct  406   TLPEEVAKTICRDDAILRYGPTV  428



>ref|XP_002273086.1| PREDICTED: protein ECERIFERUM 26-like [Vitis vinifera]
Length=443

 Score =   197 bits (502),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 138/451 (31%), Positives = 220/451 (49%), Gaps = 43/451 (10%)
 Frame = -2

Query  1455  KRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY-----REFDKDYTKLNESIAETLN  1291
             + TVVS+  V PG    L+ LD  M  + + ++FYY       FD D  ++  S++E L+
Sbjct  9     RLTVVSSKPVGPGVTHKLSGLDHAMGLHTIHMIFYYGNNPATSFDLDPFRV--SLSEVLS  66

Query  1290  AYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMS  1111
              Y  + GRL+R     W++ CNDAG+RV+ A  + ++DEWL + D  +E  L  WE M  
Sbjct  67    MYPAVTGRLIRGEDGNWVVNCNDAGVRVLRATVRTTLDEWLRSADGAEERDLTVWEDMAQ  126

Query  1110  DPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhp  931
             DP  WSPF +Q+ EFE GG+++GLSCTHL ADP  AT+ +K+W++               
Sbjct  127   DPTIWSPFRIQINEFEGGGIAIGLSCTHLHADPTCATLLLKSWSE-------------AH  173

Query  930   lpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRAC  751
                        +        ++N   K       K  ++  S +    +  F+D  ++ C
Sbjct  174   RREAIAHPPFFHSSALRGRPVLNTKTKSANYYAAKSKAKPPSVKMAATTFRFSDSSIKQC  233

Query  750   MSMAQT--PDA--FDALAGLLWTRISKAKNNV--GLMDLAVGLDVRKVLG--LDKGFYGN  595
             +       PDA  FD LA L WT ++  K+        L++ +D RK++   L  G++GN
Sbjct  234   LEEVHESCPDATPFDLLAALFWTSLAPMKSPAPDHKHSLSICIDFRKLMHAPLPYGYFGN  293

Query  594   CMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQN-----NCCAS  430
              + ++ +  S     + +  L      +      +++E    +I+WL+          A 
Sbjct  294   ALHFSLL--SRDREEIDNGRLGHVTGLVHEHVSSINEEECQSVIDWLESQKGEGGKFGAP  351

Query  429   NVLDGCDSLVCVNLEG-VDP--YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTG  259
               + G + L CV++E  V P  Y+  F  +  PVH++ +V    G G   LI+  P    
Sbjct  352   FRMYGPE-LTCVSMEHMVIPRGYAGMF-KDAKPVHIACHVGNVEGEG---LIMVLPSHEE  406

Query  258   ALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
              L+RTVMVTLPE +  KL +DQ I +L P +
Sbjct  407   GLARTVMVTLPEEQMAKLCKDQAILRLEPTV  437



>ref|XP_008388670.1| PREDICTED: protein ECERIFERUM 26-like [Malus domestica]
Length=456

 Score =   197 bits (501),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 140/446 (31%), Positives = 218/446 (49%), Gaps = 28/446 (6%)
 Frame = -2

Query  1455  KRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE--FDK-DYTKLNESIAETLNAY  1285
             K TVVS+  V PGK    T LD  M  + + +VFYY+E  F   D   L  S++ETL+ Y
Sbjct  15    KLTVVSSRPVVPGKTHTFTALDHAMGLHSLHVVFYYKEQLFGSIDLDPLRVSLSETLSLY  74

Query  1284  TIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDP  1105
               + GR+ ++P   W +KCNDAG+RV+ A+   ++DEWL + DR +E  L  W+ M  D 
Sbjct  75    PQVTGRVDKNPDGNWEVKCNDAGVRVLMARVGTTLDEWLRSGDRSEERLLTMWDDMPDDH  134

Query  1104  YFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplp  925
               WSP+ +Q+ EFE GG+++GLSCTH+ ADP  AT+ IK+WA+ +   + IS P      
Sbjct  135   STWSPYRIQINEFEGGGVAIGLSCTHMHADPTCATLLIKSWAE-THRREAISHPLLVDGS  193

Query  924   prrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMS  745
                         +  S       K   +     P  +       T +  F++  ++  ++
Sbjct  194   SVLGGRPVDQVINKKSSAAYYEAKFVASKTTSLPVRKMG-----TATFKFSNSTIKQELN  248

Query  744   MAQTPDAFDALAGLLWTRISKAK--NNVGLMDLAVGLDVRKVLGLDKGFYGNCMVYNKVK  571
                    FD LA + WT+I++ K   +     ++V +D RK      G+YGN M ++ + 
Sbjct  249   SCPGATPFDLLAAMFWTQIARLKPSESKXKHSISVCIDFRKKKSF--GYYGNAMHFSLLS  306

Query  570   WSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNV-----LDGCDS  406
                   +  +D L+     +        +E     ++W +              L G + 
Sbjct  307   VLDVEELEREDGLAHVVRVVHRHVSSQKEEDFWSGMDWFEAQKGEGDKFGEPFKLYGPE-  365

Query  405   LVCVNLEGV----DP--YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRT  244
             L CV++E +     P  Y   F     PVHVSY+V    G G  ++++P+P   G L+RT
Sbjct  366   LTCVSMEHMLDDCQPLMYGVMFEKEEKPVHVSYHVGNMEGEG-LIMVMPAP--EGGLART  422

Query  243   VMVTLPENEAVKLMEDQLIHQLSPCI  166
             VMVTLPE E  +L E + I  L+P +
Sbjct  423   VMVTLPEGELAQLCEAEAISSLNPTM  448



>ref|XP_010102303.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB93246.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=459

 Score =   196 bits (498),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 148/469 (32%), Positives = 230/469 (49%), Gaps = 54/469 (12%)
 Frame = -2

Query  1485  SEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-----EFDKDYTK  1321
             S  NI S   K T VS+  V PGK  P T LD  M  + + +VFYY+     +FD D ++
Sbjct  8     SRVNIHS---KLTTVSSRPVGPGKAHPFTALDHAMGLHSLHVVFYYKANIFKDFDLDPSR  64

Query  1320  LNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKEL  1141
             +  S+++ L+ Y  + GR++R+    W + CNDAG+R++ A    ++DEWL + D  +E 
Sbjct  65    V--SLSDALSLYPPVTGRIVRNGDGNWEVNCNDAGVRIVRASVGTTLDEWLRSADGVEEK  122

Query  1140  KLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTG  961
              L  W+ M  DP  WSPF +Q+ EFE GG+++GLSCTH+ ADP  AT+  K+W D   + 
Sbjct  123   DLAVWDDMPEDPINWSPFRIQVNEFEGGGVAIGLSCTHMHADPTCATLLYKSWIDTHRSR  182

Query  960   KMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISL  781
              ++ PP F     +   + N      +     +  + P             S++  T + 
Sbjct  183   SVVHPPVFSRSVIQARPDPNTETSSAAYYAAKSAARAP------------PSEKMATATF  230

Query  780   LFTDEMV-RACMSMAQ---TPDAFDALAGLLWTRIS----KAKNNVGLMDLAVGLDVRKV  625
              F+   + R  M +++   +   FD LA L WTR++    KA+ N     L+V  D R V
Sbjct  231   KFSHAAIKRRLMEISENCTSATPFDLLAALFWTRVARLKVKAEGNDYSHSLSVCTDARMV  290

Query  624   LGLDK-----GFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIE  460
                +      G+YGN + ++ +   S   V G   L      +    + +D+E I   I+
Sbjct  291   SKENGKPVPLGYYGNALHFSLL---SLEQVDGCG-LGHVVREVHCHVESIDEEWIRSSID  346

Query  459   WLDQNNCCASNV-----LDGCDSLVCVNLE------GVDPYSACFGNNMDPVHVSYYVEP  313
             WL+              + G + L C+ ++      G   Y A FG   +P+HVSY+V  
Sbjct  347   WLESRKGEGGKYGPPFRMYGPE-LTCIRMDHMIGPSGPLTYEAGFGEEAEPIHVSYHVRS  405

Query  312   EIGPGNRLLILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
               G G  +L++PSP   G L+R V VTLPE E  +L +D+ I  L P  
Sbjct  406   VEGEG-LILVMPSP--EGGLARAVTVTLPEKELAELSKDEAILGLDPTF  451



>ref|XP_004494691.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cicer 
arietinum]
Length=452

 Score =   194 bits (494),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 152/456 (33%), Positives = 218/456 (48%), Gaps = 49/456 (11%)
 Frame = -2

Query  1455  KRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYTK-----LNESIAETLN  1291
             K TVVS+  V  GK   L+ LD  M  + +  +FYY+  DK +       L ES++E L+
Sbjct  11    KLTVVSSRPVSYGKTHKLSALDHGMGFHTLHFIFYYKNKDKWFESFELDPLRESLSEVLS  70

Query  1290  AYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDR--DKELKLVHWEPM  1117
              Y  I GRL    G  W ++CNDAG+RVI+A    ++DEWL         E  L+ W+ M
Sbjct  71    VYPTITGRLGNGDG-NWEVRCNDAGVRVIKANVDTTLDEWLSTSSHFVYDEADLIAWDHM  129

Query  1116  MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphf  937
               D   WSPF +Q+  F+EGG+++GLSC+H+LAD   A+ F K+W+  ++    IS P F
Sbjct  130   PLDYNTWSPFQIQINRFKEGGVAIGLSCSHMLADLTCASSFFKSWSQ-TYRHFPISHPPF  188

Query  936   hplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVR  757
                                  ++ N + KP T       S  SS    T +  F++ +++
Sbjct  189   CTPITTSSPL---------PNNIANSFSKPQT-------SIISSKNMATSTFKFSNSIIK  232

Query  756   ACMSMAQT--PDA--FDALAGLLWTRI---SKAKNNVGLMDLAVGLDVRKVL--GLDKGF  604
              C+S  Q   P+A  FD L  L WTR+     +K+      L++  D RK++   L  GF
Sbjct  233   HCLSKIQNTCPNATPFDFLTALFWTRVIHLKPSKSQSQSHSLSICRDFRKLIKPSLPIGF  292

Query  603   YGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLD-QNNCCASN  427
             +GN + ++++      M   +D L   A  I N  KE+ +E I+  IEW + Q       
Sbjct  293   FGNALHFSELSLKVEDM--ENDELGNIAKQIHNHLKEITEEEILSSIEWFESQKESEGGK  350

Query  426   VLD-GC---DSLVCVNLEGVDP-----YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPS  274
              L   C     L CV +E         Y A F +N  P HVS  V    G G   LI+  
Sbjct  351   FLTPKCMYGSELTCVYMEEEKETESLLYDAMFSDNEKPAHVSCRVGNVGGEG---LIMVM  407

Query  273   PPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
             P      +RTV+  LPE E  KL  DQ I +L P I
Sbjct  408   PSMERGFARTVIAMLPEEELEKLSNDQEILKLEPTI  443



>ref|NP_001140499.1| transferase [Zea mays]
 gb|ACF83946.1| unknown [Zea mays]
 tpg|DAA51300.1| TPA: transferase [Zea mays]
Length=456

 Score =   194 bits (493),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 145/441 (33%), Positives = 209/441 (47%), Gaps = 40/441 (9%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK-DYTKLNESIAETLNAY  1285
               K T  S   V+PGK   L+ LD  ME + V +V Y R     D  +L ES++E L+ Y
Sbjct  23    FAKSTAASVTPVRPGKTHALSPLDNAMERHTVHVVVYLRAAPGLDREQLKESLSEVLSLY  82

Query  1284  TIIMGRLLRSPGEQ--------WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVH  1129
               + GRL R  G          W++KCNDAG+R+++A+A  ++DEWL     D+E+ L++
Sbjct  83    PAMTGRLTRGEGSADAEPAHRGWVVKCNDAGVRMVDARAAVTLDEWLATATGDEEMDLLY  142

Query  1128  WEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMIS  949
             +EPM ++PY WSPFYVQLTEF +   +LGLSC H+  DP +A +F  AWA  +   +  S
Sbjct  143   YEPMGAEPYIWSPFYVQLTEFTDKSYALGLSCIHIHNDPTAAALFFHAWA--AAHRRTTS  200

Query  948   pphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTD  769
                    PP    +    P              PT+ D     S        + +  F  
Sbjct  201   TYPPFLHPPALAVSPTSPPPAPPLLAEKASAASPTSTDAAAAMS--------SATFHFPA  252

Query  768   EMVRACMSMAQ---TPDAFDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVL--GLDKGF  604
               VRA +S  +   TP  F ALA L W RI+ A +  G  +L + LD RK +   L  G+
Sbjct  253   SAVRALLSSLEPGTTP--FAALAALFWLRITGAAD--GERELTLALDFRKRMYAPLPWGY  308

Query  603   YGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLD--QNNCCAS  430
             YG+ + + + +    S       L   A A+      + +E +   +EWL   Q    A 
Sbjct  309   YGSSVHFTRARADLASG------LPAVAAALDRHVAGVPEEELWRALEWLHTRQQQENAP  362

Query  429   NVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALS  250
               + G + L C  L+ V  Y A F     P  VS  V    G G  +L+LP+P G  A  
Sbjct  363   FQMYGPE-LTCAALDHVPMYGAEFEAGASPARVSCRVGGATGEG-LVLVLPAPEGGEA--  418

Query  249   RTVMVTLPENEAVKLMEDQLI  187
             R V+VTLP     ++  D  +
Sbjct  419   RDVVVTLPAGATARVCRDAEV  439



>gb|ACG37219.1| transferase [Zea mays]
Length=455

 Score =   194 bits (493),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 145/441 (33%), Positives = 209/441 (47%), Gaps = 40/441 (9%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK-DYTKLNESIAETLNAY  1285
               K T  S   V+PGK   L+ LD  ME + V +V Y R     D  +L ES++E L+ Y
Sbjct  23    FAKSTAASVTPVRPGKTHALSPLDNAMERHTVHVVVYLRAAPGLDREQLKESLSEVLSLY  82

Query  1284  TIIMGRLLRSPGEQ--------WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVH  1129
               + GRL R  G          W++KCNDAG+R+++A+A  ++DEWL     D+E+ L++
Sbjct  83    PAMTGRLTRGEGSADAEPAHRGWVVKCNDAGVRMVDARAAVTLDEWLATATGDEEMDLLY  142

Query  1128  WEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMIS  949
             +EPM ++PY WSPFYVQLTEF +   +LGLSC H+  DP +A +F  AWA  +   +  S
Sbjct  143   YEPMGAEPYIWSPFYVQLTEFTDKSYALGLSCIHIHNDPTAAALFFHAWA--AAHRRTTS  200

Query  948   pphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTD  769
                    PP    +    P              PT+ D     S        + +  F  
Sbjct  201   TYPPFLHPPALAVSPTSPPPAPPLLAEKASAASPTSTDAAAAMS--------SATFHFPA  252

Query  768   EMVRACMSMAQ---TPDAFDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVL--GLDKGF  604
               VRA +S  +   TP  F ALA L W RI+ A +  G  +L + LD RK +   L  G+
Sbjct  253   AAVRALLSSLEPGTTP--FAALAALFWLRITGAAD--GERELTLALDFRKRMYAPLPWGY  308

Query  603   YGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLD--QNNCCAS  430
             YG+ + + + +    S       L   A A+      + +E +   +EWL   Q    A 
Sbjct  309   YGSSVHFTRARADLASG------LPAVAAALDRHVAGVPEEELWRALEWLHTRQQQENAP  362

Query  429   NVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALS  250
               + G + L C  L+ V  Y A F     P  VS  V    G G  +L+LP+P G  A  
Sbjct  363   FQMYGPE-LTCAALDHVPMYGAEFEAGASPARVSCRVGGATGEG-LVLVLPAPEGREA--  418

Query  249   RTVMVTLPENEAVKLMEDQLI  187
             R V+VTLP     ++  D  +
Sbjct  419   RDVVVTLPAXATARVCRDAEV  439



>ref|XP_009364516.1| PREDICTED: protein ECERIFERUM 26-like [Pyrus x bretschneideri]
Length=456

 Score =   193 bits (491),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 140/446 (31%), Positives = 216/446 (48%), Gaps = 28/446 (6%)
 Frame = -2

Query  1455  KRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE--FDK-DYTKLNESIAETLNAY  1285
             K TVVS+  V PGK    T LD  M  + + +VFYY+E  F   D   L  S++ETL+ Y
Sbjct  15    KLTVVSSRPVVPGKAHTFTALDHAMGLHSLHVVFYYKEQLFGSIDLDPLRVSLSETLSLY  74

Query  1284  TIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDP  1105
               + GRL ++P   W +KCNDAG+RV+ A+   ++DEWL + D  +E  L  W+ M  D 
Sbjct  75    PQVTGRLDKNPDGNWEVKCNDAGVRVLMARVGTTLDEWLRSGDGSEERLLTMWDDMPDDH  134

Query  1104  YFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplp  925
               WSP  +Q+ EFE GG+++GLSCTH+ ADP  AT+ IK+WA+ +   + IS P F    
Sbjct  135   STWSPCRIQINEFEGGGVAIGLSCTHMHADPTCATLLIKSWAE-THCREAISHPLFVDES  193

Query  924   prrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMS  745
                         +  S       K   +     P  +       T +  F++  ++  ++
Sbjct  194   SALGGRPVDQVINKKSSAAYYEAKSVASKTTSLPVKKMG-----TATFKFSNSTIKRELN  248

Query  744   MAQTPDAFDALAGLLWTRISKAK--NNVGLMDLAVGLDVRKVLGLDKGFYGNCMVYNKVK  571
                    FD LA + WT+I++ K   +      +V +D RK      G+YGN + ++ + 
Sbjct  249   SCPGATPFDLLAAMFWTQIARLKPSESKTKHSFSVCIDFRKKKSF--GYYGNALHFSLLS  306

Query  570   WSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNV-----LDGCDS  406
                   +  +D L+     +        +E     ++W +              L G + 
Sbjct  307   VPDVEELEREDGLAHVVGVVHRHVSSQKEEDFWSGMDWFEAQKGEGGKFGEPFKLYGPE-  365

Query  405   LVCVNLEGV----DP--YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRT  244
             L CV++E +     P  Y   F     PVHVSY+V    G G  ++++P+P   G L+RT
Sbjct  366   LTCVSMEHMLDECQPLMYGVMFEKEKKPVHVSYHVGNMEGEG-LIMVMPAP--EGGLART  422

Query  243   VMVTLPENEAVKLMEDQLIHQLSPCI  166
             VMVTLPE E  +L E + I  L+P +
Sbjct  423   VMVTLPEEELAQLCEAEAISSLNPTM  448



>ref|XP_006432968.1| hypothetical protein CICLE_v10001131mg [Citrus clementina]
 ref|XP_006471653.1| PREDICTED: protein ECERIFERUM 1-like [Citrus sinensis]
 gb|ESR46208.1| hypothetical protein CICLE_v10001131mg [Citrus clementina]
Length=450

 Score =   191 bits (486),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 150/464 (32%), Positives = 228/464 (49%), Gaps = 48/464 (10%)
 Frame = -2

Query  1485  SEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTK  1321
             S  N+ S +   T VS+      +  PLT LD  M ++ + ++FYY +     FD D  +
Sbjct  6     SRVNVHSVL---TQVSSRPSASDETYPLTRLDHAMGHHTIHVIFYYEKSPFGSFDMDPIR  62

Query  1320  LNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKEL  1141
             +  +++E L++Y  + GRL R     W +KCNDAG+RV+ A+   ++DEWL + D ++E 
Sbjct  63    V--TLSEVLSSYPPVTGRLTRDDAGNWAVKCNDAGVRVLRARVGITLDEWLRSADGNEER  120

Query  1140  KLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTG  961
              L  WE M   P  WSPF +QL +FE GG+++GLSCTH+  D  S  +  KA+++ +  G
Sbjct  121   DLTVWEDMPEVPNTWSPFRIQLNDFEGGGVAIGLSCTHMHGDLTSLILLFKAFSE-AHHG  179

Query  960   KMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISL  781
             + I+ P F   P       + N              K T+    K   QT S +  T + 
Sbjct  180   QAITFPPFFKPPAPPDRKFSVNN------------SKSTSYLEAKLQKQTPSVKMSTATF  227

Query  780   LFTDEMVRACMS--MAQTPDA--FDALAGLLWTRI---SKAKNNVGLMDLAVGLDVRKVL  622
              F+D +V+ C+S    + PDA  FD LA L W R+      K++     L++ +D R++L
Sbjct  228   KFSDSVVKQCLSEIHDKCPDASPFDLLAALFWIRVVHLKGPKHDDHTHSLSLCVDFRRLL  287

Query  621   G--LDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLD-  451
                L  G++GN + ++ +  +   M     +L + A  +      + +E     + WLD 
Sbjct  288   QEPLPYGYFGNALNFSLLSLNEEEMDCS--MLGRVAELVHCHVSGLKEEEFWATLHWLDL  345

Query  450   ---QNNCCASNVLDGCDSLVCVNLE----GVDP--YSACFGNNMDPVHVSYYVEPEIGPG  298
                +    A           CV++E    G  P  YS  F ++  PVHVS +V    G G
Sbjct  346   QKEEGGKYAPPFAMYGPEFTCVSMEHMIIGDQPVMYSMNF-DSAKPVHVSCHVGNAEGEG  404

Query  297   NRLLILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
                LIL  P     L+RTVMVTLPE E  KL EDQ I  L P +
Sbjct  405   ---LILVMPSAEAGLARTVMVTLPEEETAKLCEDQSILHLKPTM  445



>ref|XP_007205176.1| hypothetical protein PRUPE_ppa005581mg [Prunus persica]
 gb|EMJ06375.1| hypothetical protein PRUPE_ppa005581mg [Prunus persica]
Length=453

 Score =   191 bits (486),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 139/451 (31%), Positives = 214/451 (47%), Gaps = 34/451 (8%)
 Frame = -2

Query  1455  KRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAETLN  1291
             K T VS+  V+ G    LT LD  M  + + +VFYY+      FD D  +L  S++E L+
Sbjct  9     KLTAVSSRPVKAGTTHNLTALDHAMGLHTLHVVFYYKHKLFGCFDLDPLRL--SLSEALS  66

Query  1290  AYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMS  1111
              +  +MGR+ + P   W +KCNDAG+RV  A+   ++DEWL + D  +E  L  W+ M  
Sbjct  67    LHPPVMGRMAQKPDGNWEVKCNDAGVRVFMARVATTLDEWLRSADGSEERLLTVWDDMPD  126

Query  1110  DPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhp  931
             DP  WSP+ +Q+ EFE GG ++G+SCTH+ ADP   T+ +KAWA+ +   + I+ P    
Sbjct  127   DPSTWSPYRIQINEFEGGGAAIGVSCTHMHADPTCVTLLVKAWAE-THRKQAIAHPLLVG  185

Query  930   lpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVR-A  754
                             +      +  K        P  + S     T +  F+  M++  
Sbjct  186   ESSALGGRPVDQGIIKTKSAAAYYEAKSVAAKTPLPEKKMS-----TATFKFSSAMIKQG  240

Query  753   CMSMAQT-PDA--FDALAGLLWTRIS--KAKNNVGLMDLAVGLDVRKVLGLDKGFYGNCM  589
              + + +T P+A  FD LA + WT I+  K   +     L++  D RK L      YGN +
Sbjct  241   LLQIHKTCPEANPFDLLAAVFWTSIACLKPPKSATKHSLSICTDFRKKL-CSGWHYGNAL  299

Query  588   VYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWL-----DQNNCCASNV  424
              ++ +       V   + L   A A+        +E     ++W      ++    A+  
Sbjct  300   HFSMLSVPDVEDVENTNWLEHVAGAVHRHVWSQKEEEFWSGVDWFGSQKGEEGKFGAAFR  359

Query  423   LDGCDSLVCVNLEGVDP-----YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTG  259
             + G + L CV++E ++      Y+A F  +  P HVSY+V    G G   LI+  P   G
Sbjct  360   MYGPE-LTCVSMEHMNEKEPMMYAALFDKDKKPAHVSYHVGNVEGEG---LIMVMPASEG  415

Query  258   ALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
              L R VMVTLPE E  +L E Q I  L P +
Sbjct  416   GLGRMVMVTLPEEELARLCEAQPILSLKPTM  446



>ref|XP_002463889.1| hypothetical protein SORBIDRAFT_01g008360 [Sorghum bicolor]
 gb|EER90887.1| hypothetical protein SORBIDRAFT_01g008360 [Sorghum bicolor]
Length=465

 Score =   191 bits (485),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 137/446 (31%), Positives = 202/446 (45%), Gaps = 47/446 (11%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK-DYTKLNESIAETLNAY  1285
               K T  S   V+PGK   L+ LD  ME + V +V Y R     D  +L ES++E L+ Y
Sbjct  23    FAKSTAASVTPVRPGKTHALSPLDNAMERHTVHVVLYLRAAPGLDREQLKESLSEVLSLY  82

Query  1284  TIIMGRLLRSPGEQ---------------WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRD  1150
               + GRL R  G                 W++KCNDAG+R+++A+A  ++DEWL     D
Sbjct  83    PAMTGRLTRGEGSDGAGTGSADAAHAHRGWVVKCNDAGVRMVDARAGVTLDEWLATATGD  142

Query  1149  KELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMS  970
             +E+ L+++EP+  DPY WSPFYVQLTEF +   +LGLSCTH+  DP +A +F  AWA   
Sbjct  143   EEMDLLYYEPLGPDPYIWSPFYVQLTEFADKSYALGLSCTHIHNDPTAAALFFHAWA---  199

Query  969   FTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKT  790
                        +P     P              L+       +      P+ T +    +
Sbjct  200   --AAHRRTTSPYPPFLHAPALAVSPTSPPPPPPLLAEKASAVS------PASTDATAMSS  251

Query  789   ISLLFTDEMVRACMSMAQ---TPDAFDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVLG  619
              +  F    VRA +S  +   TP  F ALA L W RI+ A +  G + LA+    R    
Sbjct  252   ATFHFPASAVRALLSTLEPGTTP--FAALAALFWLRITGAADGEGELTLALDFRKRMYAP  309

Query  618   LDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWL-----  454
             L  G+YG+ + + + +    S       L   A A+      + ++ +   +EWL     
Sbjct  310   LPLGYYGSSVHFARARADLASG------LPAVAAALDRHVAGVPEDDLWRALEWLHARQQ  363

Query  453   DQNNCCASNVLDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPS  274
              + +  A   + G + L C  L+ V  Y A F   + P  VS  V    G G   L+L  
Sbjct  364   QEGDAAAPFQMYGPE-LTCAALDHVLMYGAEFEAGVPPARVSCRVGGAAGEG---LVLVL  419

Query  273   PPGTGALSRTVMVTLPENEAVKLMED  196
             P   G  +R V+VTLP     ++  D
Sbjct  420   PAAEGGEARDVVVTLPAEATARICRD  445



>emb|CAN70576.1| hypothetical protein VITISV_018974 [Vitis vinifera]
Length=405

 Score =   189 bits (479),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 138/451 (31%), Positives = 215/451 (48%), Gaps = 81/451 (18%)
 Frame = -2

Query  1455  KRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY-----REFDKDYTKLNESIAETLN  1291
             + TVVS+  V PG    L+ LD  M  + + ++FYY       FD D  ++  S++E L+
Sbjct  9     RLTVVSSKPVGPGVTHKLSGLDHAMGLHTIHMIFYYGNNPATSFDLDPFRV--SLSEVLS  66

Query  1290  AYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMS  1111
              Y  + GRL+R     W++ CNDAG+RV+ A  + ++DEWL + D  +E  L  WE M  
Sbjct  67    MYPAVTGRLIRGEDGNWVVNCNDAGVRVLRATVRTTLDEWLRSADGAEERDLTVWEDMAQ  126

Query  1110  DPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhp  931
             DP  WSPF +Q+ EFE GG+++GLSCTHL ADP  AT+ +K+W++               
Sbjct  127   DPTIWSPFRIQINEFEGGGIAIGLSCTHLHADPTCATLLLKSWSEA--------------  172

Query  930   lpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRAC  751
                                    H ++        PP   S          F+D  ++ C
Sbjct  173   -----------------------HRREAIA----HPPFFHS----------FSDSSIKQC  195

Query  750   MSMAQ--TPDA--FDALAGLLWTRISKAKNNV--GLMDLAVGLDVRKVLG--LDKGFYGN  595
             +       PDA  FD LA L WT ++  K+        L++ +D RK++   L  G++GN
Sbjct  196   LEEVHESCPDATPFDLLAALFWTSLAPMKSPAPDHKHSLSICIDFRKLMHAPLPYGYFGN  255

Query  594   CMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQN-----NCCAS  430
              + ++ +  S     + +  L      +      +++E    +I+WL+          A 
Sbjct  256   ALHFSLL--SRDREEIDNGRLGHVTGLVHEHVSSINEEECQSVIDWLESQKGEGGKFGAP  313

Query  429   NVLDGCDSLVCVNLEG-VDP--YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTG  259
               + G + L CV++E  V P  Y+  F  +  PVH++ +V    G G   LI+  P    
Sbjct  314   FRMYGPE-LTCVSMEHMVIPRGYAGMF-KDAKPVHIACHVGNVEGEG---LIMVLPSHEE  368

Query  258   ALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
              L+RTVMVTLPE +  KL +DQ I +L P +
Sbjct  369   GLARTVMVTLPEEQMAKLCKDQAILRLEPTV  399



>ref|XP_006395015.1| hypothetical protein EUTSA_v10004237mg [Eutrema salsugineum]
 gb|ESQ32301.1| hypothetical protein EUTSA_v10004237mg [Eutrema salsugineum]
Length=438

 Score =   189 bits (479),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 141/448 (31%), Positives = 219/448 (49%), Gaps = 52/448 (12%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY-----REFDKDYTKLNESIAETLNAY  1285
             T VS+      +  P T LD V+  + V ++FYY       F+ D  ++   ++E L+ Y
Sbjct  16    TAVSSKPSGSDRVHPFTALDDVLSPHTVHVIFYYARSPFESFNLDSVRI--PLSELLSMY  73

Query  1284  TIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM-MSD  1108
               ++GR+ ++P   W +KCNDAGLRV++AK    +DEWL + D  +E  L  W+ M   D
Sbjct  74    PPVIGRVTKNPDGIWQVKCNDAGLRVLKAKVSVGIDEWLRSADGLEEYDLTAWQDMPEED  133

Query  1107  PYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhpl  928
             P  WSPF +Q+ EFE GG+++GLSC H  ADP + T+ +K+W +      ++        
Sbjct  134   PTTWSPFRLQINEFEGGGVAIGLSCPHRQADPTTLTILLKSWTEAQRRQCIVH-------  186

Query  927   pprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACM  748
                 P +    P   +  D +   ++P      KP +   S +  T +  F++   + C+
Sbjct  187   ----PPSFTPLPSSLTDTDAVKSDREPFP----KPITGPVSTKTATATFRFSESAFKTCL  238

Query  747   SMAQT----PDA--FDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVL--GLDKGFYGNC  592
                      P A  FD  A L WTR++  K     + + V  D R++L   L  GF+GN 
Sbjct  239   DEYSIEGVFPKASPFDVFAALFWTRVALVKRMCDRVCICV--DFRRLLPNPLPYGFFGNA  296

Query  591   MVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGC  412
             + ++ ++  +G +V G   +   A +I    K +D E I       D     +   + G 
Sbjct  297   LNFSSLEM-TGVVVRG---IGHVARSINEHVKSLDVEKIRS-----DLKRAGSQGQMYGR  347

Query  411   DSLVCVNLEGV----DP--YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALS  250
             D L  VN+E +    +P  Y A F + + PVHVSY +    G G  + ++PSP       
Sbjct  348   D-LTIVNMEHMIVEGEPLMYEAVFEDGVKPVHVSYRIGNHGGEG-MITVMPSP--EKGFG  403

Query  249   RTVMVTLPENEAVKLMEDQLIHQLSPCI  166
             RTV VTLPE E  KL+ DQ I +L P I
Sbjct  404   RTVAVTLPEEEMSKLLADQEILRLEPKI  431



>ref|XP_006604843.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Glycine 
max]
Length=433

 Score =   187 bits (474),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 133/444 (30%), Positives = 207/444 (47%), Gaps = 68/444 (15%)
 Frame = -2

Query  1419  GKFCPLTVLDRVMENNFVRIVFYYREFDK-----DYTKLNESIAETLNAYTIIMGRL-LR  1258
             GK   L+ LDR M ++ + +++YY+  +      D   L ES++E L  Y  + GRL +R
Sbjct  24    GKAHALSALDRGMGSHTLHVIYYYKNEENWFESFDLNSLRESLSEVLTLYPTVTGRLGIR  83

Query  1257  SPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQ  1078
                  W +KCNDAG+RVI+A    ++D+WL +    +E  LV W+ M  DP  WSPF +Q
Sbjct  84    GVDGGWEVKCNDAGVRVIKASVDATLDQWLKSASGSEENLLVAWDHMPDDPTTWSPFRIQ  143

Query  1077  LTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplpprrpcnnnh  898
             +  F+ GG+++G+SC+H++AD      F K+W ++     +  PP               
Sbjct  144   INSFQGGGVAIGISCSHMVADLTFVASFFKSWTEVHRHLPITHPP---------------  188

Query  897   nphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPK---TISLLFTDEMVRACMSMAQ--T  733
                          +  P   D +  P    +D P+   T +  F+  ++  C++      
Sbjct  189   -------------FVAPNHADAESLPRHAKTDSPRNMATATFKFSTSIINQCLTKVHDTC  235

Query  732   PDA--FDALAGLLWTRISKA---KNNVGLMDLAVGLDVRKVL--GLDKGFYGNCMVYNKV  574
             P+A  FD LA L W+RI++    KN+     L +  D R ++   L  G++GN + ++ +
Sbjct  236   PNATPFDFLAALFWSRIARVKPPKNHHQTQSLCICTDFRSLIKASLPIGYFGNALHFSML  295

Query  573   KWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGCDSLVCV  394
                   M  G   L    +A+      + +E I       ++ N C          L CV
Sbjct  296   SQKVEDMESGQ--LGGIVSAVHGHLGGLSEEEIWS----TNEGNYCMYGT-----ELTCV  344

Query  393   NLEGVD--------PYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTVM  238
              +E +          Y+A FGNN  PVHVS  V    G G   LI   P   G LSRTVM
Sbjct  345   CMEHLVFEEENESLLYAAMFGNNEKPVHVSCRVGNVDGEG---LITVMPSSVGGLSRTVM  401

Query  237   VTLPENEAVKLMEDQLIHQLSPCI  166
             V LPE E  +L +D+ I +L P +
Sbjct  402   VMLPEEELAELSKDEAILELEPAM  425



>gb|KHN43198.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=433

 Score =   186 bits (472),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 132/442 (30%), Positives = 206/442 (47%), Gaps = 64/442 (14%)
 Frame = -2

Query  1419  GKFCPLTVLDRVMENNFVRIVFYYREFDK-----DYTKLNESIAETLNAYTIIMGRL-LR  1258
             GK   L+ LDR M ++ + +++YY+  +      D   L ES++E L  Y  + GRL +R
Sbjct  24    GKAHALSALDRGMGSHTLHVIYYYKNEENWFESFDLNSLRESLSEVLTLYPTVTGRLGIR  83

Query  1257  SPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQ  1078
                  W +KCNDAG+RVI+A    ++D+WL +    +E  LV W+ M  DP  WSPF +Q
Sbjct  84    GVDGGWEVKCNDAGVRVIKASVDATLDQWLKSASGSEENLLVAWDHMPDDPTTWSPFRIQ  143

Query  1077  LTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplpprrpcnnnh  898
             +  F+ GG+++G+SC+H++AD      F K+W ++     +  PP               
Sbjct  144   INSFQGGGVAIGISCSHMVADLTFVASFFKSWTEVHRHLPITHPP---------------  188

Query  897   nphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPK---TISLLFTDEMVRACMSMAQ--T  733
                          +  P   D +  P    +D P+   T +  F+  ++  C++      
Sbjct  189   -------------FVAPNHADAESLPRHAKTDSPRNMATATFKFSTSIINQCLTKVHDTC  235

Query  732   PDA--FDALAGLLWTRISKA---KNNVGLMDLAVGLDVRKVL--GLDKGFYGNCMVYNKV  574
             P+A  FD LA L W+RI++    KN+     L +  D R ++   L  G++GN + ++ +
Sbjct  236   PNATPFDFLAALFWSRIARVKPPKNHHQTQSLCICTDFRSLIKASLPIGYFGNALHFSML  295

Query  573   KWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGCDSLVCV  394
                   M  G   L    +A+      + +E I       ++ N C       C   VC+
Sbjct  296   SQKVEDMESGQ--LGGIVSAVHGHLGGLSEEEIWS----TNEGNYCMYGTELTC---VCM  346

Query  393   NLEGVDP------YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTVMVT  232
                  +       Y+A FGNN  PVHVS  V    G G   LI   P   G LSRTVMV 
Sbjct  347   EHSVFEEENESLLYAAMFGNNEKPVHVSCRVGNVDGEG---LITVMPSSVGGLSRTVMVM  403

Query  231   LPENEAVKLMEDQLIHQLSPCI  166
             LPE E  +L +D+ I +L P +
Sbjct  404   LPEEELAELSKDEAILELEPAM  425



>ref|XP_008218251.1| PREDICTED: protein ECERIFERUM 26-like [Prunus mume]
Length=458

 Score =   184 bits (468),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 137/451 (30%), Positives = 213/451 (47%), Gaps = 34/451 (8%)
 Frame = -2

Query  1455  KRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAETLN  1291
             K T VS+  V+ G    LT LD  M  + + +VFYY+      FD D  +L  S++E L+
Sbjct  14    KLTAVSSRPVKAGTTHNLTALDHAMGLHTLHVVFYYKHKLLGCFDLDPLRL--SLSEALS  71

Query  1290  AYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMS  1111
              +  +MGR+ + P   W +KCNDAG+RV  A+   ++D+WL + D  +E  L  W+ M  
Sbjct  72    LHPPVMGRMAQKPDGNWEVKCNDAGVRVYMARVATTLDQWLRSADGSEERLLTVWDDMPD  131

Query  1110  DPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhp  931
             DP  WSP+ +Q+ EFE GG ++G+SCTH+ ADP   T+ +KAWA+ +   + I+ P    
Sbjct  132   DPSIWSPYRIQINEFEGGGAAIGVSCTHMHADPTCVTLLVKAWAE-THRKQAIAHPLLVG  190

Query  930   lpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMV-RA  754
                             +      +  K        P  + S     T +  F+  M+ + 
Sbjct  191   ESSALGGRPVDQDIIKTKSAAAYYEAKSVAAKTPLPEKKMS-----TATFKFSSAMIEQG  245

Query  753   CMSMAQT-PDA--FDALAGLLWTRISKAK--NNVGLMDLAVGLDVRKVLGLDKGFYGNCM  589
              + + +T P+A  FD LA L WT I++ K   +     L++  D RK L      YGN +
Sbjct  246   LLQIHKTCPEANPFDLLAALFWTSIARLKPPKSATKHSLSICTDSRKKL-CSGWHYGNAL  304

Query  588   VYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWL-----DQNNCCASNV  424
              ++ +       V   + L   A A+       ++E     ++W      ++    A+  
Sbjct  305   HFSMLSVPDVEEVENANGLEHVAEAVHRHVWSQNEEEFWSGVDWFGSQKGEEGKFGAAFR  364

Query  423   LDGCDSLVCVNLEGVDP-----YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTG  259
             + G + L CV++E ++      Y+A F  +  P HVSY V    G G    I+  P   G
Sbjct  365   MYGPE-LTCVSMEHMNDKEPLMYAAMFDKDKKPAHVSYRVGNVEGEG---FIMVMPASGG  420

Query  258   ALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
              L R VMVTLPE E  +L   Q I  L P +
Sbjct  421   GLGRMVMVTLPEEELGQLCVAQPILSLKPTM  451



>gb|KFK26566.1| hypothetical protein AALP_AA8G265500 [Arabis alpina]
Length=425

 Score =   182 bits (462),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 144/448 (32%), Positives = 216/448 (48%), Gaps = 64/448 (14%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAETLNAY  1285
             T VS+      +    T LD  M  + V +VFYY       FD D  ++   ++E L  Y
Sbjct  16    TTVSSKPSASDRVHTFTALDSAMSPHTVHVVFYYARSPFGSFDLDSVRI--PLSELLCLY  73

Query  1284  TIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDP  1105
               ++GR+ ++P   W +KCNDAGLR++ AK    +DEWL + D  +E  L  WE M  DP
Sbjct  74    PPVVGRVTKNPDGIWEVKCNDAGLRILRAKVCVGIDEWLRSADGHEETDLTAWEEMPEDP  133

Query  1104  YFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplp  925
               WSPF +Q+ EFE GG++LGLSC H  ADP + T+ +K+W +      ++ PP F  LP
Sbjct  134   TTWSPFRLQINEFEGGGVALGLSCPHRQADPTTLTILLKSWTEAQRRQCIVHPPSFSILP  193

Query  924   prrpcnnnhnphhNSSGDLMN-HYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACM  748
                              DL + +  KP      KP S  ++    T +  F+D   + C+
Sbjct  194   L----------------DLTDINAVKPNA----KPISTKTAT--ATATFRFSDSAFKRCL  231

Query  747   SMAQT----PDA--FDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVL--GLDKGFYGNC  592
              +       P A  FD  A L WTR+++ +       +++ +D R++L   L  GF+GN 
Sbjct  232   QVYSIDGIFPQASPFDVFAALFWTRVARDR-------VSICVDFRRLLPDPLPYGFFGNA  284

Query  591   MVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGC  412
             + ++ ++ S       D  +   A  I      +D E I       D N   +  ++ G 
Sbjct  285   LSFSSLEISDTV----DKGIGHVARLINEHVASLDVEKIR-----FDLNRAGSQGLMYGR  335

Query  411   DSLVCVNLEGV----DP--YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALS  250
             D L  VN+E +    +P  Y A F + + P HVSY +    G G  + ++PSP       
Sbjct  336   D-LTIVNMEHLIVEGEPLMYKAVFEDGVRPEHVSYRIGNHGGEG-MITVMPSP--EKGFG  391

Query  249   RTVMVTLPENEAVKLMEDQLIHQLSPCI  166
             RTV V+LPE E  KL+ DQ I +L P I
Sbjct  392   RTVAVSLPEVEMAKLLSDQEILRLEPKI  419



>ref|XP_006577283.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Glycine 
max]
Length=445

 Score =   181 bits (458),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 144/461 (31%), Positives = 217/461 (47%), Gaps = 70/461 (15%)
 Frame = -2

Query  1455  KRTVVSTNVVQP---GKFCPLTVLDRVMENNFVRIVFYYREFDKDYTK------LNESIA  1303
             K TVVS+  V     GK   L+ LD  M ++ V +++YY+  +K +        L ES++
Sbjct  11    KLTVVSSRPVSASGKGKAHALSALDSAMGSHTVHVIYYYKNEEKWFESFDLLDPLRESLS  70

Query  1302  ETLNAYTIIMGRL-LRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHW  1126
             E L  Y  + GRL  R     W +KCNDAG+RVI+A    ++D+WL +    +E  LV W
Sbjct  71    EVLTLYPTVTGRLGKRGVDGGWEVKCNDAGVRVIKASVDATLDQWLKSASGSEENLLVAW  130

Query  1125  EPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISp  946
             + M  DP  WSPF +Q+  FE GG+++G+SC+H++AD      F K+W ++     +  P
Sbjct  131   DHMPDDPTTWSPFRIQVNRFEGGGVAIGISCSHMVADLTFLASFFKSWTEVHRHLAITHP  190

Query  945   phfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPK---TISLLF  775
             P                        L NH      DD +  P    +  P+   T +  F
Sbjct  191   PFV--------------------APLPNH----ADDDAESLPRHAKTHSPRNMATATFKF  226

Query  774   TDEMVRACMSMAQ--TPDA--FDALAGLLWTRISKA---KNNVGLMDLAVGLDVRKVL--  622
             +  ++  C+S      P+A  FD LA L W RI++    KN+     L +  D R ++  
Sbjct  227   SSSIINRCLSKVHGTCPNATPFDFLAALFWNRIARVKPPKNHHQTHCLCICTDFRNLIKA  286

Query  621   GLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNN  442
              L  G++GN + ++ +      M LG        +A+ +  K + +E I     W   NN
Sbjct  287   SLPIGYFGNALHFSMLSQKVEDMQLGG-----IVSAVHSHLKGLSEEEI-----W-STNN  335

Query  441   CCASNVLDGCDSLVCVNLEGVD--------PYSACFGNNMDPVHVSYYV-EPEIGPGNRL  289
                   + G + L CV +E +          Y+A FGNN  P+ VS  V   + G G   
Sbjct  336   EGNYYCMYGTE-LTCVCMEHLVFEEENESLLYAAMFGNNEKPIQVSCRVGNVDYGEG---  391

Query  288   LILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
             LI   P   G LSRTVMV LPE E  +L +D+ I +L P +
Sbjct  392   LITVMPSEEGGLSRTVMVMLPEEELAELSKDEAILELEPAM  432



>gb|KHN31456.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=445

 Score =   180 bits (457),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 144/461 (31%), Positives = 217/461 (47%), Gaps = 70/461 (15%)
 Frame = -2

Query  1455  KRTVVSTNVVQP---GKFCPLTVLDRVMENNFVRIVFYYREFDKDYTK------LNESIA  1303
             K TVVS+  V     GK   L+ LD  M ++ V +++YY+  +K +        L ES++
Sbjct  11    KLTVVSSRPVSASGKGKAHALSALDSAMGSHTVHVIYYYKNEEKWFESFDLLDPLRESLS  70

Query  1302  ETLNAYTIIMGRL-LRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHW  1126
             E L  Y  + GRL  R     W +KCNDAG+RVI+A    ++D+WL +    +E  LV W
Sbjct  71    EVLTLYPTVTGRLGKRGVDGGWEVKCNDAGVRVIKASVDATLDQWLKSASGSEENLLVAW  130

Query  1125  EPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISp  946
             + M  DP  WSPF +Q+  FE GG+++G+SC+H++AD      F K+W ++     +  P
Sbjct  131   DHMPDDPTTWSPFRIQVNRFEGGGVAIGISCSHMVADLTFLASFFKSWTEVHRHLAITHP  190

Query  945   phfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPK---TISLLF  775
             P                        L NH      DD +  P    +  P+   T +  F
Sbjct  191   PFV--------------------APLPNH----ADDDAESLPRHAKTHSPRNMATATFKF  226

Query  774   TDEMVRACMSMAQ--TPDA--FDALAGLLWTRISKA---KNNVGLMDLAVGLDVRKVL--  622
             +  ++  C+S      P+A  FD LA L W RI++    KN+     L +  D R ++  
Sbjct  227   SSSIINRCLSKVHGTCPNATPFDFLAALFWNRIARVKPPKNHHQTHCLCICTDFRNLIKA  286

Query  621   GLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNN  442
              L  G++GN + ++ +      M LG        +A+ +  K + +E I     W   NN
Sbjct  287   SLPIGYFGNALHFSMLSQKVEDMQLGG-----IVSAVHSHLKGLSEEEI-----W-STNN  335

Query  441   CCASNVLDGCDSLVCVNLEGVD--------PYSACFGNNMDPVHVSYYV-EPEIGPGNRL  289
                   + G + L CV +E +          Y+A FGNN  P+ VS  V   + G G   
Sbjct  336   EGNYYCMYGTE-LTCVCMEHLVFEEENESLLYAAMFGNNEKPIQVSCRVGNVDYGEG---  391

Query  288   LILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
             LI   P   G LSRTVMV LPE E  +L +D+ I +L P +
Sbjct  392   LITVMPSEEGGLSRTVMVMLPEEELAELSKDEAILELEPAM  432



>ref|XP_003626431.1| Omega-hydroxypalmitate O-feruloyl transferase [Medicago truncatula]
 gb|AES82649.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=459

 Score =   180 bits (456),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 139/470 (30%), Positives = 221/470 (47%), Gaps = 49/470 (10%)
 Frame = -2

Query  1488  MSEDNISSTI-CKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK-----DY  1327
             MSE     T+  K TVVS+  V  GK   LT +D  M  + + +++YY+  +K     + 
Sbjct  1     MSETECKVTLDSKLTVVSSRPVSSGKSHKLTGVDHGMSYHTLHLIYYYKNEEKWFGSFEL  60

Query  1326  TKLNESIAETLNAYTIIMGRLLRSP---GEQWLIKCNDAGLRVIEAKAKGSVDEWLHN-V  1159
               L ES++E L+ Y  I GRL R     G  W ++CNDAG+R+I+A    ++DEWL +  
Sbjct  61    DPLRESLSEVLSIYPTITGRLGREKEEDGGNWEVRCNDAGVRIIKANVDSTIDEWLSSSA  120

Query  1158  DRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
                 E +L+ W+ M  DP  WSPF +Q+  F+EGG+++GLS +H+L+D   A+ F K+W 
Sbjct  121   TGSDEAQLIAWDDMPHDPSTWSPFRIQINSFKEGGVAIGLSYSHMLSDLTFASSFFKSWT  180

Query  978   DMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDR  799
                    +                     +  +S  L+N+      +   KP + TSS  
Sbjct  181   QTHRHSPI------------SNSPFFTPINITTSSPLLNNN---IPNSSLKPQTITSSSN  225

Query  798   PKTISLLFTDEMVRACMSMAQTPDA-----FDALAGLLWTRISK---AKNNVGLMDLAVG  643
               T +  F+  +++  +S+ Q         FD L+ L WTR++     K +     L++ 
Sbjct  226   LATATFKFSSSIIKHSLSIIQNKKCLNATPFDFLSALFWTRVTHLKPTKIHNQTHSLSIC  285

Query  642   LDVRKVL--GLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMD  469
              D RK++   L  G++GN + ++ +      M  G+  L   A+ I    K +  + I  
Sbjct  286   RDFRKLIKPSLPTGYFGNALHFSNLSLKMEEMENGE--LGDIASLIHTKLKGVTDKEIRS  343

Query  468   LIEWL------DQNNCCASNVLDGCD-SLVCVNLEGVDP--YSACFGNNMDPVHVSYYVE  316
              IEW       ++        + G + + VC+  E  +   Y + F ++  P HVS  V 
Sbjct  344   SIEWFESQKETEEGKFGTPKCMYGKELTFVCMEEEETESLLYESMFCDSEKPAHVSCRVG  403

Query  315   PEIGPGNRLLILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
                G G   LI+  P   G  +RTV+V L E E  KL  DQ I +L P I
Sbjct  404   NVEGEG---LIIVMPSSEGGFARTVIVMLKEEELDKLCNDQEILKLEPKI  450



>emb|CDP06790.1| unnamed protein product [Coffea canephora]
Length=366

 Score =   176 bits (447),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 132/450 (29%), Positives = 193/450 (43%), Gaps = 131/450 (29%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE--------FDKDYTKLNESIAETL  1294
             TVVS+    PG+    T LD  M  +   IVFYYR          + D   L  S++E L
Sbjct  16    TVVSSKPTAPGRIHKFTALDHAMGFHTGHIVFYYRRNPIRDGASMENDLDNLRISLSELL  75

Query  1293  NAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMM  1114
               Y  + GRL R     W +KCNDAG+R+++A    ++DEWL   +  +E  L  WE + 
Sbjct  76    CLYPPVTGRLGRGADGNWEVKCNDAGVRMLKANVCATLDEWLSYANAAEERDLTVWEDLP  135

Query  1113  SDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfh  934
              DP+ WSPF +Q+ +F  GGL++ +S TH+ AD  SAT+ IK+WA++             
Sbjct  136   DDPHIWSPFRIQINDFNCGGLAVAISFTHMHADFTSATLLIKSWAEI-------------  182

Query  933   plpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRA  754
                                     H  +P      +PP             +F    +R 
Sbjct  183   ------------------------HRHEPVA----RPP-------------IFNLPSIRQ  201

Query  753   CMSMAQ--TPDA--FDALAGLLWTRISKAK------NNVGLMDLAVGLDVRKVLGLDKGF  604
             C+S      PDA  FD LA L W++I++ K      +N   + + + L  R+   +  G+
Sbjct  202   CLSEVHESCPDASPFDVLAALFWSKITRLKSPACDDDNKCSLSMCIDLRKRERDSIPYGY  261

Query  603   YGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNV  424
             +GN + ++K+                                                  
Sbjct  262   FGNALHFSKLS-------------------------------------------------  272

Query  423   LDGCDSLVCVNL------EGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGT  262
             L GC  L C+++      EG   Y+A F  N  PVHVSY +   +G    +L++PSP   
Sbjct  273   LFGCQ-LTCLSMENTISSEGSFTYAAMFKQNEKPVHVSYQIG-NVGGEGLILVMPSP--E  328

Query  261   GALSRTVMVTLPENEAVKLMEDQLIHQLSP  172
               L+R VMVTLPE + VKL EDQ I  L P
Sbjct  329   EGLARIVMVTLPEEQIVKLCEDQTILGLQP  358



>ref|XP_010546595.1| PREDICTED: protein ECERIFERUM 26-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010546596.1| PREDICTED: protein ECERIFERUM 26-like isoform X2 [Tarenaya hassleriana]
Length=435

 Score =   177 bits (449),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 136/451 (30%), Positives = 214/451 (47%), Gaps = 63/451 (14%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAETLNAY  1285
             T VS+    PG+  PLT +D  M+ + V ++FYYR      FD D  ++  S++E L+ Y
Sbjct  17    TAVSSKPTGPGRIHPLTDIDHAMDQHTVHVIFYYRRSPFSSFDLDSVRV--SLSELLSFY  74

Query  1284  TIIMGRLLRSP-GEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSD  1108
               + GR+ R+P   +W +KCNDAG+R+++A+    +DEWL + D ++E  L  WE M  D
Sbjct  75    PPVTGRVARNPETRKWEVKCNDAGVRILKARVGVGLDEWLRSADGNEERDLTVWEAMPED  134

Query  1107  PYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhpl  928
             P  WSPF +Q+ EFE GG ++GLSC+H  ADP S     K+W +      +         
Sbjct  135   PSIWSPFRIQINEFEGGGAAIGLSCSHKQADPTSLIFLFKSWTEAQRRQPI---------  185

Query  927   pprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQ--TSSDRPKTISLLFTDEMVRA  754
                         H  S   L+N      T+  + P  +  T++    T +  F+    R 
Sbjct  186   -----------SHPPSFSPLIN------TNAVNSPSLETPTTATATATATFRFSAYAFRR  228

Query  753   CMSMAQT---PDA--FDALAGLLWTRISKAK--NNVGLMDLAVGLDVRKVL--GLDKGFY  601
             C+  +     PDA  FD  A L  +RI+ AK  ++     + + +D+R++L   +  GF+
Sbjct  229   CLEESVAGIFPDASPFDVFAALFSSRIANAKRDHSRNRSSVTICVDIRRLLPDPVPYGFF  288

Query  600   GNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVL  421
             GN + ++ ++ S       D  +   A  I      +D + I+  ++ L          +
Sbjct  289   GNALHFSSLELSHTD----DTRIGHVARMINRHVANLDGDQILSGLKRLGPEAVQ----M  340

Query  420   DGCDSLVCVNLEGV----DP--YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTG  259
              G D L  V++E +    +P  Y A F     P HVS  +      G   +I+ +P    
Sbjct  341   YGSD-LTVVSMEHMVVEGEPSMYEAVFDGGERPSHVSCMIG---NSGREGVIVVTPSPEK  396

Query  258   ALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
                RTV VTLPE E  KL+ DQ I +  P I
Sbjct  397   GFGRTVTVTLPEEETKKLLVDQEILRFEPEI  427



>emb|CDY52503.1| BnaAnng11500D [Brassica napus]
Length=436

 Score =   175 bits (443),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 134/447 (30%), Positives = 215/447 (48%), Gaps = 51/447 (11%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAETLNAY  1285
             T +S+   + G+    T LD  M  + V ++FYY       FD D  ++   ++E L+ Y
Sbjct  16    TAISSKPSRSGQIHTFTALDNAMSPHTVHVIFYYPRSPFGSFDLDSVRI--PLSELLSMY  73

Query  1284  TIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDP  1105
                +GR+ ++P     +KCNDAGLR+++AK    +DEWL + D  +E  L  WE M  DP
Sbjct  74    PPAIGRVTKNPEGILEVKCNDAGLRILKAKVSVGIDEWLRSADGHEESNLTAWEDMPEDP  133

Query  1104  YFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplp  925
               WSPF +Q+ EFE GG+++GLSC H+ AD  + T+ +K+W +                 
Sbjct  134   STWSPFRLQINEFEGGGVAIGLSCPHMHADATTLTVLLKSWTEAQ-----------RRQC  182

Query  924   prrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMS  745
                P + +  P++ +  D +N  +    D   KP + T S +  T +  F+      C+ 
Sbjct  183   ITHPPSFSPLPYNLTDTDAVNSDR----DSFSKPIAGTVSTKTATATFRFSGSAFTRCVK  238

Query  744   MAQ----TPDA--FDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVL--GLDKGFYGNCM  589
                    +P A  FD  A L WTR++  K+      + V +D R++L   L  GF+GN +
Sbjct  239   EHSIHEISPKATPFDVFAALFWTRVALVKDKSD--RVCVCVDFRRLLPNPLPYGFFGNAL  296

Query  588   VYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGCD  409
              ++ ++ ++    + D  +   A  I      ++ E I   ++        +   + G D
Sbjct  297   NFSSLEMAN----VVDMEIGHVARLINEHVAGLNVEKIRSGLK-----RAGSQRKMYGTD  347

Query  408   SLVCVNLEGV----DP--YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSR  247
              L  VN+E +    +P  Y   F   + P+HVSY +  + G G   +I  +  G G   R
Sbjct  348   -LTIVNMEHMIVNGEPLMYETVFEEGVKPMHVSYRIGNKGGEGVITVIPSTEKGFG---R  403

Query  246   TVMVTLPENEAVKLMEDQLIHQLSPCI  166
             TV VTLPE E  KL+ DQ I +L P I
Sbjct  404   TVAVTLPEEEMSKLLSDQEILRLEPEI  430



>ref|XP_007147162.1| hypothetical protein PHAVU_006G101000g [Phaseolus vulgaris]
 gb|ESW19156.1| hypothetical protein PHAVU_006G101000g [Phaseolus vulgaris]
Length=431

 Score =   175 bits (443),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 137/449 (31%), Positives = 209/449 (47%), Gaps = 56/449 (12%)
 Frame = -2

Query  1455  KRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK-----DYTKLNESIAETLN  1291
             K TVVS+  V  GK   L+VLDR M ++ + ++FYY   D      D   L ES++E L 
Sbjct  11    KLTVVSSRPVTSGKVHTLSVLDRGMASHTLHVIFYYMNEDNWFKSFDLGPLRESLSEVLT  70

Query  1290  AYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM-M  1114
              Y ++ GRL+R    +W +KCNDAG+R  +A    ++ EWL +    +E  L  W+ M  
Sbjct  71    MYPVVTGRLVRGENGEWQVKCNDAGVRTTKATVDATLHEWLKSASHSEEKLLFTWDDMPE  130

Query  1113  SDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfh  934
              DP  W PF +Q+  F+EGG+++ +SC+H++ D      F K+WA++     +  P    
Sbjct  131   EDPSTWPPFRIQINSFKEGGVAIVVSCSHMVTDLTFLASFFKSWAELHRHFPITHPSLIA  190

Query  933   plpprrpcnnnhnphhNSSGDLMNHYKKPTTDDG-DKPPSQTSSDRP-KTISLLFTDEMV  760
              L                          PT       PP++T+S +   T +  F+   +
Sbjct  191   SL--------------------------PTRGHASSSPPTKTASPKDLATATFKFSSSTI  224

Query  759   RACMSMAQ--TPDA--FDALAGLLWTRISKA---KNNVGLMDLAVGLDVRKVL--GLDKG  607
             + C+S      P+A  FD LA L WTR+++    K       L +  D R +    L  G
Sbjct  225   KQCLSKVHDSCPNATPFDFLAALFWTRVARVKPPKTQDQTHSLCLCTDSRSLQKPSLPIG  284

Query  606   FYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASN  427
             + GN + +     S+ S  + D  L    +A+    +E+ +E I    E         S 
Sbjct  285   YLGNALHF-----STLSKKVKDVELGGVVSAVHRHLEELSEEEIGAGNE---GKRVYGSE  336

Query  426   VLDGC-DSLVCVNLEGVDPYSACFGNNMD-PVHVSYYVEPEIGPGNRLLILPSPPGTGAL  253
             +   C + L+    E    Y A FG N + PVHVS +V    G G   LI+  P   G L
Sbjct  337   LTCVCMEQLMVEEDEESLLYGAVFGRNEEKPVHVSCWVGNVEGEG---LIMVMPCSEGGL  393

Query  252   SRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
             SR+VMV L E E  +L +D+ I +L P +
Sbjct  394   SRSVMVMLAEEEVAELSKDEAIMELEPAM  422



>emb|CDY05591.1| BnaC02g39460D [Brassica napus]
Length=436

 Score =   174 bits (441),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 132/447 (30%), Positives = 212/447 (47%), Gaps = 51/447 (11%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAETLNAY  1285
             T +S+   + G+    T LD  M  + V ++FYY       FD D  ++   ++E L+ Y
Sbjct  16    TAISSKPSRSGQVHTFTALDNAMSPHTVHVIFYYPRSPFGSFDLDSVRI--PLSELLSMY  73

Query  1284  TIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDP  1105
                +GR+ ++P     +KCNDAGLR+++AK    +DEWL + D  +E  L  WE M  DP
Sbjct  74    PPAIGRVTKNPEGILEVKCNDAGLRILKAKVSVGIDEWLRSADGHEESNLTAWEDMPEDP  133

Query  1104  YFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplp  925
               WSPF +Q+ EFE GG+++GLSC H+ AD  + T+ +K+W +                 
Sbjct  134   STWSPFRLQINEFEGGGVAIGLSCPHMHADATTLTVLLKSWTEAQ-----------RRQC  182

Query  924   prrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMS  745
                P + +  P++ +  D +    K   D   KP +   S +  T +  F+      C+ 
Sbjct  183   ITHPPSFSPLPYNLTDTDAV----KSDRDSFSKPIAGPVSTKTATATFRFSGSAFTRCVK  238

Query  744   MAQ----TPDA--FDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVL--GLDKGFYGNCM  589
                    +P A  FD  A L WTR++  K+N     + V +D R++L   L  GF+GN +
Sbjct  239   EHSIHEISPKATPFDVFAALFWTRVALVKDNSD--RVCVCVDFRRLLPNPLPYGFFGNAL  296

Query  588   VYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGCD  409
              ++ ++ ++   +    + S     +  +  E  + G+             +   + G D
Sbjct  297   NFSSLEMANVVNMEVRHVASLINKHVAGLNVEKIRSGL---------KRAGSQRKMYGTD  347

Query  408   SLVCVNLEGV----DP--YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSR  247
              L  VN+E +    +P  Y   F   + P+HVSY +    G G  + ++PSP       R
Sbjct  348   -LTIVNMEHMIVDGEPLMYETVFEEGVKPMHVSYRIGNNGGEG-VITVIPSP--EKGFGR  403

Query  246   TVMVTLPENEAVKLMEDQLIHQLSPCI  166
             TV VTLPE E  KL+ DQ I +L P I
Sbjct  404   TVAVTLPEAEMSKLLSDQEILRLEPEI  430



>ref|XP_006286502.1| hypothetical protein CARUB_v10001016mg [Capsella rubella]
 gb|EOA19400.1| hypothetical protein CARUB_v10001016mg [Capsella rubella]
Length=429

 Score =   172 bits (436),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 138/456 (30%), Positives = 216/456 (47%), Gaps = 50/456 (11%)
 Frame = -2

Query  1488  MSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYT  1324
             ++++N        T VS+   +  +  P T LD  M  + + ++ YY       FD D  
Sbjct  3     IAQENRVEVKSMLTAVSSKPCRSDRVHPFTALDNAMSPHTLHVIVYYSRSPFGSFDLDSV  62

Query  1323  KLNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKE  1144
             +   S++E L+ Y  ++GR+ ++P     +KCNDAGLR + AK    VDEWL + D  +E
Sbjct  63    R--TSLSELLSLYPPVVGRVAKTPDGILEVKCNDAGLRTLRAKVSVGVDEWLRSADGLEE  120

Query  1143  LKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFT  964
               L  W+ M  DP  W+PF +Q+ EFE GG+++GLSC H  AD  + T+ +K+W +    
Sbjct  121   GDLTAWDDMPDDPSTWAPFRLQINEFEGGGVAIGLSCPHRQADATTLTVLLKSWTEAQRH  180

Query  963   GKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTIS  784
               +I PP F PLP                        KP   + + P S+  S +  T +
Sbjct  181   QSIIHPPSFSPLPSILTDT------------------KPVKPNSE-PISKPISTKTTTAT  221

Query  783   LLFTDEMVRACMSMAQTPDA--FDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVL--GL  616
               F+    + C+     P A  FD  A L WTR++  K       + + +D R++L   L
Sbjct  222   FSFSTSAFKKCLQDGIFPKASPFDVFAALFWTRVALTKRK-SHDRVCMCVDFRRLLPDPL  280

Query  615   DKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCC  436
               GF+GN + +  ++  +    + D  +   A  I +    +  E I       + N   
Sbjct  281   PYGFFGNALSFTSLEMCN----VADQEIRHVARLINDHVASLTVEKIRS-----ELNRVG  331

Query  435   ASNVLDGCDSLVCVNLEGV----DP--YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPS  274
                ++ G D L  VN+E +    +P  Y A F N + PVHVSY +  ++G    ++++PS
Sbjct  332   EQGLMYGGD-LTIVNMEHMIVEGEPLMYEAVFENGVRPVHVSYRIG-KVGGEGVIMVMPS  389

Query  273   PPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
             P       R V VTLPE E  KL+ DQ I +L P I
Sbjct  390   P--EKGFGRVVSVTLPEEEMSKLLVDQEILRLEPKI  423



>ref|XP_008455878.1| PREDICTED: protein ECERIFERUM 26 [Cucumis melo]
Length=471

 Score =   173 bits (438),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 145/473 (31%), Positives = 218/473 (46%), Gaps = 54/473 (11%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAET  1297
             I K T VS+N    G+  PL   D  +  +   +V YY E     F  D   + ES+++ 
Sbjct  11    ITKLTAVSSNPSVSGRVYPLLAADHALARHSAAVVMYYSENPFGSFILD--PMRESLSKI  68

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L  Y  + GRL R+    W +K NDAG+RV   K   S+DEWL + D  +E  L  ++ M
Sbjct  69    LTLYPTVTGRLTRTENGNWAVKGNDAGVRVTMTKVGSSLDEWLRSADSVEERDLAAFDDM  128

Query  1116  MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphf  937
               DPY WSPF +Q+ EFE GG+++G+S THLLADP SAT  +K WAD +  G+ +SPP F
Sbjct  129   PEDPYIWSPFRIQINEFEGGGVAIGVSFTHLLADPTSATFLLKTWAD-AHRGRPVSPPLF  187

Query  936   hplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVR  757
                          N    S+    N   K   DD    P++ SS     ++  F++  + 
Sbjct  188   TRRLSLGDGEKIPNIATKSTTFYAN---KSKLDDHIVSPTKMSS-----VTFKFSNTTMN  239

Query  756   ACMSMAQT--PDA--FDALAGLLWTRISKAKNN---------VGLMDLAVGLDVRKVL--  622
              C+S  +   P+A  FD LA L W +I K K+N              L++  D+R     
Sbjct  240   QCLSKIKPHCPNATPFDFLASLFWKQILKIKSNSPKDGQNNNNNNHSLSICSDIRNSFQS  299

Query  621   -GLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIM--DLIEWLD  451
                 + ++GN +  +++      M   ++ L      + N  + + +E       +EWL+
Sbjct  300   SNSQRYYFGNALHISQLTIDPKEM--AENELGHIVELVHNHLERLGEEEEETWSAMEWLE  357

Query  450   -QNNCCASNVLDGC---DSLVCVNLEGVD----------PYSACFGNNMDPVHVSYYVEP  313
              Q       V+        L CV++E +            Y+  F  +  PVHVSY +  
Sbjct  358   SQKEKDGRYVMPFTMYGPELSCVSMEHMMMKKGNENESLSYATKFVKDSKPVHVSYNIGN  417

Query  312   EIGPGNRLLILPSPPGTGALSRTVMVTLPENEAV-KLMEDQLIHQLSPCIKMG  157
               G G   LI+  P   G ++R V V LP    V +L EDQ I   +P + +G
Sbjct  418   VEGEG---LIIIMPSNEGGVARNVKVMLPSKREVDELCEDQAILSFNPTMILG  467



>ref|XP_010455172.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
Length=431

 Score =   171 bits (434),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 132/450 (29%), Positives = 209/450 (46%), Gaps = 62/450 (14%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAETLNAY  1285
             T VS+   + G+  P T LD  M  + + ++ YY       FD D  ++  S++E L+ Y
Sbjct  16    TAVSSKPSRSGRVHPFTTLDNAMSRHTLHVIVYYPRSPFGSFDLDSVRI--SLSELLSMY  73

Query  1284  TIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDP  1105
               ++GR+ ++P     +KCNDAGLR ++AK    +DEWL + D   E  L  WE M  DP
Sbjct  74    PPVVGRVAKTPDGILEVKCNDAGLRTLKAKVCVGIDEWLRSADGHDESDLTAWEDMPEDP  133

Query  1104  YFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplp  925
               W+PF +Q+ EFE GG+++GLSC H  AD  + T+ +K+W +      ++ PP      
Sbjct  134   STWAPFRLQINEFEGGGVAIGLSCPHRQADATTLTVLLKSWTEAQRRRCLVHPPS-----  188

Query  924   prrpcnnnhnphhNSSGDLMNHYKKPTTDDGD--KPPSQTSSD----RPKTISLLFTDEM  763
                                 +      TDD D  KP S + S+    +  T +  F+   
Sbjct  189   -------------------FSPLPSILTDDTDAVKPNSASISEPISTKTATATFRFSSSA  229

Query  762   VRACMS---MAQTPDAFDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVL--GLDKGFYG  598
              +  +    +       D  A L WTR++  K       + + +D R++L   L  GF+G
Sbjct  230   FKKYVEEEGIFPKASPLDVFAALFWTRVALVKRK-SHDRVCMCVDFRRLLPNPLPYGFFG  288

Query  597   NCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLD  418
             N + ++ ++ ++    + D  +   A  I +    +  E I       D N      ++ 
Sbjct  289   NALNFSSLEMTN----VADQGIVHVARLINDHVTNLTVEKIRS-----DLNRVGEQELMY  339

Query  417   GCDSLVCVNLEGV----DP--YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGA  256
             G D L  VN+E +    DP  Y A F + + PVHVSY +   +G    ++++PSP     
Sbjct  340   GRD-LTIVNMEHMIVEGDPMMYDAVFEDGVRPVHVSYRIG-NVGGEGVIMVMPSP--EKG  395

Query  255   LSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
               R V VTLPE E  KL+ DQ I +  P I
Sbjct  396   FGRVVSVTLPEEEMSKLLVDQEILRFEPKI  425



>ref|XP_009129839.1| PREDICTED: protein ECERIFERUM 26-like [Brassica rapa]
Length=436

 Score =   170 bits (431),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 135/447 (30%), Positives = 214/447 (48%), Gaps = 51/447 (11%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAETLNAY  1285
             T +S+   + G+    T LD  M  + V ++FYY       FD D  ++   ++E L+ Y
Sbjct  16    TAISSKPSRSGQIHTFTALDNAMSPHTVHVIFYYPRSPFGSFDLDSVRI--PLSELLSMY  73

Query  1284  TIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDP  1105
                +GR+ ++P     +KCNDAGLR+++AK    +DEWL + D  +E  L  WE M  DP
Sbjct  74    PPAIGRVTKNPEGILEVKCNDAGLRILKAKVSVGIDEWLRSADGHEETNLTAWEDMPEDP  133

Query  1104  YFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplp  925
               WSPF +Q+ EFE GG+++GLSC H+ AD  + T+ +K+W +                 
Sbjct  134   STWSPFRLQINEFEGGGVAIGLSCPHMHADATTLTVLLKSWTEAQ-----------RRQC  182

Query  924   prrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMS  745
                P + +  P++ +  D +    K   D   KP + T S +  T +  F+      C+ 
Sbjct  183   ITHPPSFSPLPYNLTETDAV----KSDRDSFSKPIAGTVSTKTTTATFRFSGSAFTRCVK  238

Query  744   MAQ----TPDA--FDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVL--GLDKGFYGNCM  589
                    +P A  FD  A L WTR++  KN      + V +D R++L   L  GF+GN +
Sbjct  239   EHSIHEISPKATPFDVFAALFWTRVALVKNKSD--RVCVCVDFRRLLPNPLPYGFFGNAL  296

Query  588   VYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGCD  409
              ++ ++ ++    + D  +   A  I      ++ E I   ++        +   + G D
Sbjct  297   NFSSLEMAN----VVDMEVGHVARLINEHVAGLNVEKIRSGLK-----RAGSQRKMYGTD  347

Query  408   SLVCVNLEGV----DP--YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSR  247
              L  VN+E +    +P  Y   F   + P+HVSY +    G G  + ++PSP       R
Sbjct  348   -LTIVNMEHMIVDGEPLMYETVFEEGVKPMHVSYRIGNNGGEG-VITVIPSP--EKGFGR  403

Query  246   TVMVTLPENEAVKLMEDQLIHQLSPCI  166
             TV VTLPE E  KL+ DQ I +L P I
Sbjct  404   TVAVTLPEEEMSKLLSDQEILRLEPEI  430



>ref|XP_004302041.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=398

 Score =   168 bits (425),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 118/364 (32%), Positives = 190/364 (52%), Gaps = 25/364 (7%)
 Frame = -2

Query  1491  TMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDY  1327
             T S  N  +   K T VS+  V PG     T LDR M  + V +VFYY+E     FD D 
Sbjct  3     TQSHSNRVALRSKLTAVSSRPVNPGTIHCFTGLDRAMALHSVHVVFYYKEKLFTYFDLDP  62

Query  1326  TKLNESIAETLNAYTIIMGRLLRSPGE-QWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRD  1150
              ++   ++E L+ Y  + GR++R   + +W +KCND+G+RV++A    ++DEWL + D  
Sbjct  63    FRV--CLSEALSLYPPVTGRIVRREDDGEWEVKCNDSGVRVVKATVATTLDEWLISADEA  120

Query  1149  KELKLVHWE--PMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWAD  976
             +E  L  W+  P   DP  WSP+ +Q+ EFE GG+++GLSC+H+ ADP SAT+ IK+WA+
Sbjct  121   EERLLAAWDDMPQQGDPSLWSPYRIQINEFEGGGVAIGLSCSHMQADPTSATLLIKSWAE  180

Query  975   MSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRP  796
                   ++ PP F  L        + + +++ S       K   T     P       + 
Sbjct  181   THRREAVVHPPSFGDLSDSSLTRGSLSINNSKSLSAYYEAKSMATKTPLVP------KKM  234

Query  795   KTISLLFTDEMVR-ACMSMAQT-PDA--FDALAGLLWTRISKAKNNV--GLMDLAVGLDV  634
              T +  F+DE ++ + + + QT P A  FD LA L W RI++ K++       L++ +D 
Sbjct  235   GTATFKFSDEAIKQSLLEIHQTCPVATPFDLLAALFWARIARLKHSKSESKHSLSICVDF  294

Query  633   RKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWL  454
             RK L L  G+YGN + ++ +      + +  DL   A    R++  + ++E   D I+W 
Sbjct  295   RKKLQLSYGYYGNALHFSLLTLP--DVEVKQDLGDVAGAVHRHVSSQGEEEFWSD-IDWF  351

Query  453   DQNN  442
             +  N
Sbjct  352   ESRN  355



>ref|XP_010421688.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
Length=431

 Score =   169 bits (427),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 130/450 (29%), Positives = 206/450 (46%), Gaps = 62/450 (14%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAETLNAY  1285
             T VS+   +  +  P T LD  M  + + ++ YY       FD D  ++  S++E L+ Y
Sbjct  16    TAVSSKPSRSARVHPFTTLDNAMSRHTLHVIVYYPRSPFGSFDLDSVRI--SLSELLSMY  73

Query  1284  TIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDP  1105
               ++GR+ ++P     +K NDAGLR ++AK    +DEWL + D   E  L  WE M  DP
Sbjct  74    PPVVGRVAKTPDGILEVKRNDAGLRTLKAKVCVGIDEWLRSADGHDESDLTAWEDMPEDP  133

Query  1104  YFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplp  925
               W+PF +Q+ EFE GG+++GLSC H  AD  + T+ +K+W +      ++ PP      
Sbjct  134   STWAPFRLQINEFEGGGVAIGLSCPHRQADATTLTVLLKSWTEAQRRRCIVHPPS-----  188

Query  924   prrpcnnnhnphhNSSGDLMNHYKKPTTDDGD------KPPSQTSSDRPKTISLLFTDEM  763
                                 +      TDD D       P S+  S +  T +  F+   
Sbjct  189   -------------------FSPLPSILTDDTDAVKPNSAPISKPISTKTATATFRFSSSA  229

Query  762   VRACMS---MAQTPDAFDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVL--GLDKGFYG  598
              +  +    +      FD  A L WTR++  K       + + +D R++L   L  GF+G
Sbjct  230   FKKYIEEEGIFPKASPFDVFAALFWTRVALVKRK-SHDRVCLCVDFRRLLPNPLPYGFFG  288

Query  597   NCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLD  418
             N + ++ ++ ++    + D  +   A  I +    +  E I       D N      ++ 
Sbjct  289   NALNFSSLEMTN----VADQGIGHVARLINDHVTNLTVEKIRS-----DLNRVGEQGLVY  339

Query  417   GCDSLVCVNLEGV----DP--YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGA  256
             G D L  VN+E +    DP  Y A F + + PVHVSY +   +G    ++++PSP     
Sbjct  340   GGD-LTIVNMEHMIVEGDPMMYDAVFEDGVRPVHVSYRIG-NVGGEGVIMVMPSP--EKG  395

Query  255   LSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
               R V VTLPE E  KL+ DQ I +  P I
Sbjct  396   FGRVVSVTLPEEEMSKLLVDQEILRFEPKI  425



>ref|XP_010494090.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
Length=431

 Score =   168 bits (425),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 131/450 (29%), Positives = 207/450 (46%), Gaps = 62/450 (14%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAETLNAY  1285
             T VS+   +  +  P T LD  M  + + ++ YY       FD D  ++  S++E L+ Y
Sbjct  16    TAVSSKPSRSARVHPFTALDNAMSPHTLHVIVYYPRSPFGSFDLDSVRI--SLSELLSMY  73

Query  1284  TIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDP  1105
               ++GR+ ++P     +KCNDAGLR ++AK    +DEWL + D   E  L  W  M  DP
Sbjct  74    PPVVGRVAKTPDGILEVKCNDAGLRTLKAKVCVGIDEWLRSADGHDESDLTAWGDMPEDP  133

Query  1104  YFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplp  925
               W+PF +Q+ EF+ GG+++GLSC H  AD  + T+ +K+W +      ++ PP      
Sbjct  134   STWAPFRLQINEFQGGGVAIGLSCPHRQADATTLTVLLKSWTEAQRRRCIVHPPS-----  188

Query  924   prrpcnnnhnphhNSSGDLMNHYKKPTTDDGD--KPPSQTSSD----RPKTISLLFTDEM  763
                                 +      TDD D  KP S T S     +  T +  F+   
Sbjct  189   -------------------FSPLPSILTDDTDAVKPNSATISKPISTKTATATFRFSSSS  229

Query  762   VRACMS---MAQTPDAFDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVL--GLDKGFYG  598
              +  +    +      FD  A L WTR++  K       + + +D R++L   L  GF+G
Sbjct  230   FKKYIEEDGIFPKASPFDVFAALFWTRVALVKRK-SHDRVCMCVDFRRLLPNPLPYGFFG  288

Query  597   NCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLD  418
             N + ++ ++ ++    + D  +   A  I +    +  E I       D N      ++ 
Sbjct  289   NALNFSSLEMTN----VADQGIVHVARLINDHVTNLTVEKIRS-----DLNRVGEQELMY  339

Query  417   GCDSLVCVNLEGV----DP--YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGA  256
             G D L  VN+E +    DP  Y A F + + PVHVSY +   +G    ++++PSP     
Sbjct  340   GGD-LTIVNMEHMIVEGDPMMYEAVFEDGVRPVHVSYRIG-NVGGEGVIMVMPSP--EKG  395

Query  255   LSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
               R V VTLPE E  KL+ DQ I +  P I
Sbjct  396   FGRVVSVTLPEEEVSKLLVDQEILRFEPKI  425



>ref|XP_004156459.1| PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cucumis 
sativus]
Length=475

 Score =   167 bits (424),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 148/476 (31%), Positives = 221/476 (46%), Gaps = 57/476 (12%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAET  1297
             I K T VS+N    G+  PL+  D  +  +   +V YY E     F  D   + ES+++ 
Sbjct  12    ITKLTAVSSNPSVSGRVYPLSAADHALARHSAAVVMYYSENPFGSFILD--PMRESLSKV  69

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L  Y  + GRL R+    W +K NDAG+RV   K   S+DEWL + D  +E  L  ++ M
Sbjct  70    LTLYPTVTGRLTRTENGNWAVKGNDAGVRVTMTKVGSSLDEWLRSADSVEERDLAAFDEM  129

Query  1116  MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphf  937
               DPY WSPF +Q+ EFE GG+++G+S THL+ADP SAT  +K WAD +  G  +SPP F
Sbjct  130   PEDPYIWSPFRIQINEFEGGGVAIGVSFTHLIADPTSATFLLKTWAD-AHRGGPVSPPLF  188

Query  936   hplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVR  757
                          N    S+    N   K   D+    P++ SS     ++  F++  + 
Sbjct  189   TKPSSLGDGEKIPNIATKSTSFYAN---KSKLDNHIVSPTKMSS-----VTFKFSNTTIN  240

Query  756   ACMSMAQT--PDA--FDALAGLLWTRISKAK----------NNVGLMDLAVGLDVRKVL-  622
              C+S  +   P+A  FD LA L W +I K K          NN     L++  D+R    
Sbjct  241   QCLSKIKPHCPNATPFDFLASLFWKQILKIKSNSPNSEHNNNNNNNHSLSICSDIRNSFQ  300

Query  621   --GLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIM--DLIEWL  454
                  + ++GN +  +++      M   +  L Q    + N  + + +E       +EWL
Sbjct  301   SSNSQRCYFGNALHISQLTIDPKEMEQNE--LGQIVELVHNHLERLGEEEEETWSAMEWL  358

Query  453   D-QNNCCASNVLD---GCDSLVCVNLE--------GVD----PYSACFGNNMDPVHVSYY  322
             + Q       V+        L CV++E        G D     Y+  F  +  PVHVSY 
Sbjct  359   ESQKEKDGKYVMPFKMYGPELSCVSMEHMMMMMKKGNDNESLSYATKFVKDSKPVHVSYN  418

Query  321   VEPEIGPGNRLLILPSPPGTGALSRTVMVTLP-ENEAVKLMEDQLIHQLSPCIKMG  157
             +    G G   LI+  P   G ++R V+V LP E E  +L EDQ I   +P + +G
Sbjct  419   IGNVEGEG---LIIVMPSNEGGVARNVVVMLPSEREVDELCEDQAILSFNPTMILG  471



>gb|KGN60817.1| hypothetical protein Csa_2G011500 [Cucumis sativus]
Length=475

 Score =   167 bits (422),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 148/476 (31%), Positives = 221/476 (46%), Gaps = 57/476 (12%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAET  1297
             I K T VS+N    G+  PL+  D  +  +   +V YY E     F  D   + ES+++ 
Sbjct  12    ITKLTAVSSNPSVSGRVYPLSAADHALARHSAAVVMYYSENPFGSFILD--PMRESLSKV  69

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L  Y  + GRL R+    W +K NDAG+RV   K   S+DEWL + D  +E  L  ++ M
Sbjct  70    LTLYPTVTGRLTRTENGNWAVKGNDAGVRVTMTKVGSSLDEWLRSADSVEERDLAAFDEM  129

Query  1116  MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphf  937
               DPY WSPF +Q+ EFE GG+++G+S THL+ADP SAT  +K WAD +  G  +SPP F
Sbjct  130   PEDPYIWSPFRIQINEFEGGGVAIGVSFTHLIADPTSATFLLKTWAD-AHRGGPVSPPLF  188

Query  936   hplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVR  757
                          N    S+    N   K   D+    P++ SS     ++  F++  + 
Sbjct  189   TKPSSLGDGEKIPNIATKSTSFYAN---KSKLDNHIVSPTKMSS-----VTFKFSNTTIN  240

Query  756   ACMSMAQT--PDA--FDALAGLLWTRISKAK----------NNVGLMDLAVGLDVRKVL-  622
              C+S  +   P+A  FD LA L W +I K K          NN     L++  D+R    
Sbjct  241   QCLSKIKPHCPNATPFDFLASLFWKQILKIKSNSPNSEHNNNNNNNHSLSICSDIRNSFQ  300

Query  621   --GLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIM--DLIEWL  454
                  + ++GN +  +++      M   +  L Q    + N  + + +E       +EWL
Sbjct  301   SSNSQRCYFGNALHISQLTIDPKEMEQHE--LGQIVELVHNHLERLGEEEEETWSAMEWL  358

Query  453   D-QNNCCASNVLD---GCDSLVCVNLE--------GVD----PYSACFGNNMDPVHVSYY  322
             + Q       V+        L CV++E        G D     Y+  F  +  PVHVSY 
Sbjct  359   ESQKEKDGKYVMPFKMYGPELSCVSMEHMMMMMKKGNDNESLSYATKFVKDSKPVHVSYN  418

Query  321   VEPEIGPGNRLLILPSPPGTGALSRTVMVTLP-ENEAVKLMEDQLIHQLSPCIKMG  157
             +    G G   LI+  P   G ++R V+V LP E E  +L EDQ I   +P + +G
Sbjct  419   IGNVEGEG---LIIVMPSNEGGVARNVVVMLPSEREVDELCEDQAILSFNPTMILG  471



>gb|EAY91836.1| hypothetical protein OsI_13481 [Oryza sativa Indica Group]
Length=466

 Score =   164 bits (415),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 141/462 (31%), Positives = 202/462 (44%), Gaps = 74/462 (16%)
 Frame = -2

Query  1458  CKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK-DYTKLNESIAETLNAYT  1282
              K T  S   V+PGK   L+ LD  ME + V +V YYR     D   L ES+++ L+ Y 
Sbjct  17    AKSTAASVTPVRPGKTHALSALDNAMERHAVYLVLYYRAAPGLDREPLKESLSDVLSQYP  76

Query  1281  IIMGRLLRSPG--------------------EQWLIKCNDAGLRVIEAKAKGSVDEWLHN  1162
              + GRL R                        +W++KCNDAG+R ++A A  ++DEWL  
Sbjct  77    AMTGRLTRPAAAAAGGGGEGGEGGGATAAVHHRWIVKCNDAGVRTVDATAAATLDEWLAT  136

Query  1161  VDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAW  982
                ++E+ L ++EPM  DPY WSPFYVQLTEF +   +LGLSCTHL  DP +A +F+ AW
Sbjct  137   ASGEEEMDLAYFEPMGPDPYIWSPFYVQLTEFADKSYALGLSCTHLHNDPTAAVLFLNAW  196

Query  981   A-----DMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPS  817
             A     D  +   + SP          P +            L+    + + D G +  S
Sbjct  197   AAAHRRDSPYPPFLHSPALAAKSAAPPPEH-----------PLLAAKSRGSPDTGGEMSS  245

Query  816   QTSSDRPKTISLLFTDEMVRACMSMAQ---TPDAFDALAGLLWTRISKAKNNVGLM----  658
              T           F+   +RA +S  +   TP  F ALA L W R++ A  +        
Sbjct  246   AT---------FRFSAAAMRALLSAVEPGTTP--FAALAALFWLRVAAAAADAAAGGGAA  294

Query  657   ---DLAVGLDVRKVLG--LDKGFYGNCMVYNKVK--WSSGSMVLGDDLLSQAANAIRNMR  499
                +L + LD RK +   L  G+YG  + +   +   SSG        L+  A A+    
Sbjct  295   EERELTLALDFRKRMQAPLPTGYYGTAVHFATARADLSSG--------LASVAAAVERRA  346

Query  498   KEMDKEGIMDLIEWLDQNNCCASNVLD-GCDSLVCVNLEGVDPYSACFGNNMDPVHVSYY  322
               + +E +   IEWL                 L C+ L+ V  Y A F     P   +  
Sbjct  347   AAVPEEELWPAIEWLHARQAAGGEPFQMYGPELTCMALDHVPLYGAEFAAGAAPARAACR  406

Query  321   VEPEIGPGNRLLILPSPPGTGALSRTVMVTLPENEAVKLMED  196
             V    G G  +++LPS  G  A  R V VTLP     ++  D
Sbjct  407   VGGASGEG-LVIVLPSAEGESA--RDVAVTLPAAVTARICRD  445



>ref|NP_001051243.1| Os03g0745200 [Oryza sativa Japonica Group]
 gb|AAP13009.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF13157.1| Os03g0745200 [Oryza sativa Japonica Group]
Length=466

 Score =   163 bits (412),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 141/462 (31%), Positives = 201/462 (44%), Gaps = 74/462 (16%)
 Frame = -2

Query  1458  CKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK-DYTKLNESIAETLNAYT  1282
              K T  S   V+PGK   L+ LD  ME + V +V YYR     D   L ES+++ L+ Y 
Sbjct  17    AKSTAASVTPVRPGKTHALSALDNAMERHAVYLVLYYRAAPGLDREPLKESLSDVLSQYP  76

Query  1281  IIMGRLLRSPG--------------------EQWLIKCNDAGLRVIEAKAKGSVDEWLHN  1162
              + GRL R                         W++KCNDAG+R ++A A  ++DEWL  
Sbjct  77    AMTGRLTRPAAAAAGGGGEGGEGGGATAAVHHGWIVKCNDAGVRTVDATAAATLDEWLAT  136

Query  1161  VDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAW  982
                ++E+ L ++EPM  DPY WSPFYVQLTEF +   +LGLSCTHL  DP +A +F+ AW
Sbjct  137   ASGEEEMDLAYFEPMGPDPYIWSPFYVQLTEFADKSYALGLSCTHLHNDPTAAVLFLNAW  196

Query  981   A-----DMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPS  817
             A     D  +   + SP          P +            L+    + + D G +  S
Sbjct  197   AAAHRRDSPYPPFLHSPALAAKSAAPPPEH-----------PLLAAKSRGSPDTGGEMSS  245

Query  816   QTSSDRPKTISLLFTDEMVRACMSMAQ---TPDAFDALAGLLWTRISKAKNNVGLM----  658
              T           F+   +RA +S  +   TP  F ALA L W R++ A  +        
Sbjct  246   AT---------FRFSAAAMRALLSAVEPGTTP--FAALAALFWLRVAAAAADAAAGGGAA  294

Query  657   ---DLAVGLDVRKVLG--LDKGFYGNCMVYNKVK--WSSGSMVLGDDLLSQAANAIRNMR  499
                +L + LD RK +   L  G+YG  + +   +   SSG        L+  A A+    
Sbjct  295   EERELTLALDFRKRMQAPLPTGYYGTAVHFATARADLSSG--------LASVAAAVERRA  346

Query  498   KEMDKEGIMDLIEWLDQNNCCASNVLD-GCDSLVCVNLEGVDPYSACFGNNMDPVHVSYY  322
               + +E +   IEWL                 L C+ L+ V  Y A F     P   +  
Sbjct  347   AAVPEEELWPAIEWLHTRQAAGGEPFQMYGPELTCMALDHVPLYGAEFAAGAAPARAACR  406

Query  321   VEPEIGPGNRLLILPSPPGTGALSRTVMVTLPENEAVKLMED  196
             V    G G  +++LPS  G  A  R V VTLP     ++  D
Sbjct  407   VGGASGEG-LVIVLPSAEGESA--RDVAVTLPAAVTARICRD  445



>gb|ABF98834.1| Transferase family protein, expressed [Oryza sativa Japonica 
Group]
Length=472

 Score =   162 bits (411),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 141/462 (31%), Positives = 201/462 (44%), Gaps = 74/462 (16%)
 Frame = -2

Query  1458  CKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK-DYTKLNESIAETLNAYT  1282
              K T  S   V+PGK   L+ LD  ME + V +V YYR     D   L ES+++ L+ Y 
Sbjct  23    AKSTAASVTPVRPGKTHALSALDNAMERHAVYLVLYYRAAPGLDREPLKESLSDVLSQYP  82

Query  1281  IIMGRLLRSPG--------------------EQWLIKCNDAGLRVIEAKAKGSVDEWLHN  1162
              + GRL R                         W++KCNDAG+R ++A A  ++DEWL  
Sbjct  83    AMTGRLTRPAAAAAGGGGEGGEGGGATAAVHHGWIVKCNDAGVRTVDATAAATLDEWLAT  142

Query  1161  VDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAW  982
                ++E+ L ++EPM  DPY WSPFYVQLTEF +   +LGLSCTHL  DP +A +F+ AW
Sbjct  143   ASGEEEMDLAYFEPMGPDPYIWSPFYVQLTEFADKSYALGLSCTHLHNDPTAAVLFLNAW  202

Query  981   A-----DMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPS  817
             A     D  +   + SP          P +            L+    + + D G +  S
Sbjct  203   AAAHRRDSPYPPFLHSPALAAKSAAPPPEH-----------PLLAAKSRGSPDTGGEMSS  251

Query  816   QTSSDRPKTISLLFTDEMVRACMSMAQ---TPDAFDALAGLLWTRISKAKNNVGLM----  658
              T           F+   +RA +S  +   TP  F ALA L W R++ A  +        
Sbjct  252   AT---------FRFSAAAMRALLSAVEPGTTP--FAALAALFWLRVAAAAADAAAGGGAA  300

Query  657   ---DLAVGLDVRKVLG--LDKGFYGNCMVYNKVK--WSSGSMVLGDDLLSQAANAIRNMR  499
                +L + LD RK +   L  G+YG  + +   +   SSG        L+  A A+    
Sbjct  301   EERELTLALDFRKRMQAPLPTGYYGTAVHFATARADLSSG--------LASVAAAVERRA  352

Query  498   KEMDKEGIMDLIEWLDQNNCCASNVLD-GCDSLVCVNLEGVDPYSACFGNNMDPVHVSYY  322
               + +E +   IEWL                 L C+ L+ V  Y A F     P   +  
Sbjct  353   AAVPEEELWPAIEWLHTRQAAGGEPFQMYGPELTCMALDHVPLYGAEFAAGAAPARAACR  412

Query  321   VEPEIGPGNRLLILPSPPGTGALSRTVMVTLPENEAVKLMED  196
             V    G G  +++LPS  G  A  R V VTLP     ++  D
Sbjct  413   VGGASGEG-LVIVLPSAEGESA--RDVAVTLPAAVTARICRD  451



>gb|ACF78901.1| unknown [Zea mays]
Length=372

 Score =   157 bits (397),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 122/379 (32%), Positives = 178/379 (47%), Gaps = 39/379 (10%)
 Frame = -2

Query  1278  IMGRLLRSPGEQ--------WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWE  1123
             + GRL R  G          W++KCNDAG+R+++A+A  ++DEWL     D+E+ L+++E
Sbjct  1     MTGRLTRGEGSADAEPAHRGWVVKCNDAGVRMVDARAAVTLDEWLATATGDEEMDLLYYE  60

Query  1122  PMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpp  943
             PM ++PY WSPFYVQLTEF +   +LGLSC H+  DP +A +F  AWA  +   +  S  
Sbjct  61    PMGAEPYIWSPFYVQLTEFTDKSYALGLSCIHIHNDPTAAALFFHAWA--AAHRRTTSTY  118

Query  942   hfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEM  763
                  PP    +    P              PT+ D     S        + +  F    
Sbjct  119   PPFLHPPALAVSPTSPPPAPPLLAEKASAASPTSTDAAAAMS--------SATFHFPASA  170

Query  762   VRACMSMAQ---TPDAFDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVL--GLDKGFYG  598
             VRA +S  +   TP  F ALA L W RI+ A +  G  +L + LD RK +   L  G+YG
Sbjct  171   VRALLSSLEPGTTP--FAALAALFWLRITGAAD--GERELTLALDFRKRMYAPLPWGYYG  226

Query  597   NCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLD--QNNCCASNV  424
             + + + + +    S       L   A A+      + +E +   +EWL   Q    A   
Sbjct  227   SSVHFTRARADLASG------LPAVAAALDRHVAGVPEEELWRALEWLHTRQQQENAPFQ  280

Query  423   LDGCDSLVCVNLEGVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRT  244
             + G + L C  L+ V  Y A F     P  VS  V    G G  +L+LP+P G  A  R 
Sbjct  281   MYGPE-LTCAALDHVPMYGAEFEAGASPARVSCRVGGATGEG-LVLVLPAPEGGEA--RD  336

Query  243   VMVTLPENEAVKLMEDQLI  187
             V+VTLP     ++  D  +
Sbjct  337   VVVTLPAGATARVCRDAEV  355



>gb|EYU30520.1| hypothetical protein MIMGU_mgv1a006319mg [Erythranthe guttata]
Length=448

 Score =   158 bits (399),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 107/170 (63%), Gaps = 8/170 (5%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-------FDKDYTKLNESIAETLN  1291
             +VVS+N  +PGK   L++LD+ M  + + IVFYY            D      S+++ L+
Sbjct  17    SVVSSNPTRPGKVHKLSLLDQSMGPHTIHIVFYYGSNPFSDGPMSSDLENFRVSLSDVLD  76

Query  1290  AYTIIMGRLLRSP-GEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMM  1114
              Y ++ GRL R P G  W +KCNDAG+RV++A+   +VDEWL + D D+E  L  WE M 
Sbjct  77    EYPVVTGRLTRGPDGGGWQVKCNDAGVRVLQARVDATVDEWLRSADVDEERDLTVWEDMP  136

Query  1113  SDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFT  964
              DP FWSPF +Q+  F+ GGL++GLSCTH+ AD  SAT+ IK+WAD   T
Sbjct  137   LDPSFWSPFRIQVNNFKCGGLAIGLSCTHMHADITSATLLIKSWADYHST  186



>ref|XP_004139230.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
sativus]
Length=316

 Score =   147 bits (371),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 97/271 (36%), Positives = 139/271 (51%), Gaps = 20/271 (7%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAET  1297
             I K T VS+N    G+  PL+  D  +  +   +V YY E     F  D   + ES+++ 
Sbjct  12    ITKLTAVSSNPSVSGRVYPLSAADHALARHSAAVVMYYSENPFGSFILD--PMRESLSKV  69

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L  Y  + GRL R+    W +K NDAG+RV   K   S+DEWL + D  +E  L  ++ M
Sbjct  70    LTLYPTVTGRLTRTENGNWAVKGNDAGVRVTMTKVGSSLDEWLRSADSVEERDLAAFDEM  129

Query  1116  MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphf  937
               DPY WSPF +Q+ EFE GG+++G+S THL+ADP SAT  +K WAD +  G  +SPP F
Sbjct  130   PEDPYIWSPFRIQINEFEGGGVAIGVSFTHLIADPTSATFLLKTWAD-AHRGGPVSPPLF  188

Query  936   hplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVR  757
                          N    S+    N   K   D+    P++ SS     ++  F++  + 
Sbjct  189   TKPSSLGDGEKIPNIATKSTSFYAN---KSKLDNHIVSPTKMSS-----VTFKFSNTTIN  240

Query  756   ACMSMAQT--PDA--FDALAGLLWTRISKAK  676
              C+S  +   P+A  FD LA L W +I K K
Sbjct  241   QCLSKIKPHCPNATPFDFLASLFWKQILKIK  271



>ref|XP_004981805.1| PREDICTED: uncharacterized protein LOC101779453 [Setaria italica]
Length=706

 Score =   152 bits (384),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 108/178 (61%), Gaps = 15/178 (8%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK-DYTKLNESIAETLN  1291
             +   K T  S   V+PGK   L+ LD  ME + V +V Y R     D  +L ES++E L+
Sbjct  21    TRFAKSTAASVTPVRPGKTHALSPLDNAMERHTVHVVLYCRAAPGVDREQLKESLSEVLS  80

Query  1290  AYTIIMGRLLRS-------------PGEQ-WLIKCNDAGLRVIEAKAKGSVDEWLHNVDR  1153
              Y  + GRL R              P  + W++KCNDAG+R+++A+A  ++DEWL     
Sbjct  81    LYPAMTGRLTRGGEGGEGAAAAEAEPAPRGWVVKCNDAGVRMVDARAAATLDEWLATATG  140

Query  1152  DKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
             D+E+ L+++EPM ++P+ WSPFY+QLTEF +   +LGLSCTH+  DP +A +F +AWA
Sbjct  141   DEEMDLLYYEPMGAEPFIWSPFYIQLTEFADKSFALGLSCTHIHNDPTAAALFFQAWA  198



>ref|XP_003559747.1| PREDICTED: protein ECERIFERUM 26-like [Brachypodium distachyon]
Length=466

 Score =   149 bits (375),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 100/311 (32%), Positives = 152/311 (49%), Gaps = 29/311 (9%)
 Frame = -2

Query  1458  CKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE---FDKDYTKLNESIAETLNA  1288
              K T  S   V+PGK   L+ LD  ME + V +V Y R      +D   L ES++E L+ 
Sbjct  24    AKSTAASVTPVRPGKTHALSALDNAMEWHAVHLVLYCRAAPGVGRD--ALKESLSEALSL  81

Query  1287  YTIIMGRLLRSPGEQ-------WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVH  1129
             Y  + GRL+R+   +       W++KCNDAG+R ++A A  ++DEWL     D+E+ L +
Sbjct  82    YPAMTGRLVRAAQGEEGGAAGGWIVKCNDAGVRTVDATAAVTLDEWLATASADEEMDLAY  141

Query  1128  WEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMIS  949
             +E M ++PY WSPFYVQLTEF +   +LGLSCTH+  DP +A++F   WA      +  +
Sbjct  142   FEQMGAEPYIWSPFYVQLTEFTDKSYALGLSCTHVHNDPTAASLFFHGWAAAH---RRAT  198

Query  948   pphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTD  769
              P+   L       +   P              P   + D   S        + +  F  
Sbjct  199   SPYPPFLHSPSFAVSPTTPPSPPPLLAAKSTAAPAPPNSDAAMS--------SATFHFPA  250

Query  768   EMVRACMSMAQTPDA--FDALAGLLWTRISKAKNNVGLM-DLAVGLDVRKVL--GLDKGF  604
               +RA +S  + P A  F ALA L W R++          +L + LD RK +   L  G+
Sbjct  251   AAMRALLSSLE-PGATPFAALAALFWLRVAGHDAAESRQKELTLALDFRKKMRAPLPTGY  309

Query  603   YGNCMVYNKVK  571
             YG+ + + + +
Sbjct  310   YGSAVHFTRAR  320



>emb|CBI34184.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   145 bits (366),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 103/165 (62%), Gaps = 7/165 (4%)
 Frame = -2

Query  1455  KRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY-----REFDKDYTKLNESIAETLN  1291
             + TVVS+  V PG    L+ LD  M  + + ++FYY       FD D  ++  S++E L+
Sbjct  9     RLTVVSSKPVGPGVTHKLSGLDHAMGLHTIHMIFYYGNNPATSFDLDPFRV--SLSEVLS  66

Query  1290  AYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMS  1111
              Y  + GRL+R     W++ CNDAG+RV+ A  + ++DEWL + D  +E  L  WE M  
Sbjct  67    MYPAVTGRLIRGEDGNWVVNCNDAGVRVLRATVRTTLDEWLRSADGAEERDLTVWEDMAQ  126

Query  1110  DPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWAD  976
             DP  WSPF +Q+ EFE GG+++GLSCTHL ADP  AT+ +K+W++
Sbjct  127   DPTIWSPFRIQINEFEGGGIAIGLSCTHLHADPTCATLLLKSWSE  171



>dbj|BAK06476.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=456

 Score =   144 bits (363),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 101/170 (59%), Gaps = 12/170 (7%)
 Frame = -2

Query  1458  CKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE---FDKDYTKLNESIAETLNA  1288
              K T  S   V+PGK   L+ LD  M  + V +V Y R     D+D   L ES++E L+ 
Sbjct  23    AKSTAASVTPVRPGKTHELSALDNAMGRHAVHLVLYCRAAPGVDRD--PLKESLSEALSL  80

Query  1287  YTIIMGRLLR-------SPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVH  1129
             Y  ++GRL R       + G  W++KCNDAG+R ++A+A  ++D+WL     D E+ L +
Sbjct  81    YPAMVGRLTRPEGEGGAAAGSGWIVKCNDAGVRTVDARASVTLDDWLATASADDEMDLAY  140

Query  1128  WEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
             +EPM  +PY WSPFYVQLTEF +   +LGLSCTH   DP +A +F   WA
Sbjct  141   FEPMGPEPYIWSPFYVQLTEFADKSYALGLSCTHSHNDPTAAALFFHGWA  190



>gb|EMT30805.1| hypothetical protein F775_21434 [Aegilops tauschii]
Length=312

 Score =   135 bits (339),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 100/170 (59%), Gaps = 14/170 (8%)
 Frame = -2

Query  1458  CKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE---FDKDYTKLNESIAETLNA  1288
              K T  S   V+PGK   L+ LD  M  + V +V Y R     D+D   L ES++E L+ 
Sbjct  23    AKSTAASVTPVRPGKTHELSALDNAMGRHAVHLVLYCRAAPGVDRD--PLKESLSEALSL  80

Query  1287  YTIIMGRLLRSPGEQ-------WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVH  1129
             Y  ++GRL R+ GE        W++KCNDAG+R ++A+A G++D        D E+ L +
Sbjct  81    YPAMVGRLTRAEGEGGAAAGSGWIVKCNDAGVRTVDARASGTLDT--SPPPADDEMDLAY  138

Query  1128  WEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
             +EPM S+ Y WSPFYVQLTEF +   +LGLSCTH   DP +A +F   WA
Sbjct  139   FEPMGSEAYIWSPFYVQLTEFADKSYALGLSCTHYHNDPTAAALFFHGWA  188



>gb|EEE59916.1| hypothetical protein OsJ_12543 [Oryza sativa Japonica Group]
Length=396

 Score =   126 bits (316),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 89/288 (31%), Positives = 131/288 (45%), Gaps = 59/288 (20%)
 Frame = -2

Query  1323  KLNESIAETLNAYTIIMGRLLRSPG--------------------EQWLIKCNDAGLRVI  1204
              L ES+++ L+ Y  + GRL                           W++KCNDAG+R +
Sbjct  17    PLKESLSDVLSQYPAMTGRLKGPAAAAAGGGGEGGEGGGATAAVHHGWIVKCNDAGVRTV  76

Query  1203  EAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHL  1024
             +A A  ++DEWL     ++E+ L ++EPM  DPY WSPFYVQLTEF +   +LGLSCTHL
Sbjct  77    DATAAATLDEWLATASGEEEMDLAYFEPMGPDPYIWSPFYVQLTEFADKSYALGLSCTHL  136

Query  1023  LADPISATMFIKAWA-----DMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNH  859
               DP +A +F+ AWA     D  +   + SP          P +            L+  
Sbjct  137   HNDPTAAVLFLNAWAAAHRRDSPYPPFLHSPALAAKSAAPPPEH-----------PLLAA  185

Query  858   YKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMSMAQ---TPDAFDALAGLLWTRI  688
               + + D G +  S T           F+   +RA +S  +   TP  F ALA L W R+
Sbjct  186   KSRGSPDTGGEMSSAT---------FRFSAAAMRALLSAVEPGTTP--FAALAALFWLRV  234

Query  687   SKAKNNVGLM-------DLAVGLDVRKVL--GLDKGFYGNCMVYNKVK  571
             + A  +           DL + LD RK +   L  G+YG  + +   +
Sbjct  235   AAAAADAAAGGGAAQERDLTLALDFRKRMQAPLPTGYYGTAVHFATAR  282



>tpg|DAA51299.1| TPA: hypothetical protein ZEAMMB73_720390 [Zea mays]
Length=162

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 9/138 (7%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK-DYTKLNESIAETLNAY  1285
               K T  S   V+PGK   L+ LD  ME + V +V Y R     D  +L ES++E L+ Y
Sbjct  23    FAKSTAASVTPVRPGKTHALSPLDNAMERHTVHVVVYLRAAPGLDREQLKESLSEVLSLY  82

Query  1284  TIIMGRLLRSPGEQ--------WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVH  1129
               + GRL R  G          W++KCNDAG+R+++A+A  ++DEWL     D+E+ L++
Sbjct  83    PAMTGRLTRGEGSADAEPAHRGWVVKCNDAGVRMVDARAAVTLDEWLATATGDEEMDLLY  142

Query  1128  WEPMMSDPYFWSPFYVQL  1075
             +EPM ++PY WSPFYVQ+
Sbjct  143   YEPMGAEPYIWSPFYVQV  160



>ref|XP_006387736.1| hypothetical protein POPTR_0633s00210g [Populus trichocarpa]
 gb|ERP46650.1| hypothetical protein POPTR_0633s00210g [Populus trichocarpa]
Length=151

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 78/130 (60%), Gaps = 7/130 (5%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAETLNAY  1285
             T VS+  V  GK  PL+VLD  M  + + +VFYY++     FD D  ++  +++E L  Y
Sbjct  15    TAVSSQPVGSGKTHPLSVLDHAMGLHTIHVVFYYKKNPFGIFDVDPLRI--ALSEVLCLY  72

Query  1284  TIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDP  1105
               + GRL R     WL+KCNDAG+RV+ AK + ++DEWL + D  +E  L  WE +  +P
Sbjct  73    PQVTGRLTRGESGNWLVKCNDAGVRVLRAKVEATMDEWLRSADSSEEKDLTFWEEIPEEP  132

Query  1104  YFWSPFYVQL  1075
               WSPF +Q+
Sbjct  133   STWSPFRIQV  142



>ref|XP_002319620.2| hypothetical protein POPTR_0013s03730g [Populus trichocarpa]
 gb|EEE95543.2| hypothetical protein POPTR_0013s03730g [Populus trichocarpa]
Length=311

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 92/331 (28%), Positives = 147/331 (44%), Gaps = 48/331 (15%)
 Frame = -2

Query  1077  LTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplpprrpcnnnh  898
             + EFE GG++ GLSCTH+ ADP S T+  K+W + S   + I  P               
Sbjct  3     VNEFEGGGVAFGLSCTHMNADPTSITILFKSWIE-SHRQEPIEHPPLF------------  49

Query  897   nphhNSSGDLMNHYKKPTTDD------GDKPPSQTSSDRPKTISLLFTDEMVRACMSMAQ  736
                   S   ++H + P T          K  ++T S +  T +  F+D  ++  +    
Sbjct  50    ------SSTTLHHQQVPNTSTKSDNYCATKGNAETPSVKMVTATFKFSDSAIKKWLDEVH  103

Query  735   TPDA----FDALAGLLWTRIS--KAKNNVGLMDLAVGLDVRKVLG--LDKGFYGNCMVYN  580
                A    F+ LA L WTR++  KA  N     L++ LD R+++   +  G++GN + ++
Sbjct  104   DQCAKATPFELLAALFWTRVAHLKAPKNDNKHSLSICLDFRRLVQPPISLGYFGNALHFS  163

Query  579   KVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGCD---  409
              +      M  G   L      +     ++ +E +  +++W +          +      
Sbjct  164   LLTLDEEEMDYGK--LGHVVELVHRHISDVREEEVWSVVDWFESQKEEGGKYAEPFRMYG  221

Query  408   -SLVCVNLEGVDP------YSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALS  250
               L CV++E +        +SA F ++  PVHVS +V    G G   LI+  P     L+
Sbjct  222   PELTCVSMEHIIIGHKSLMFSASFKSDEKPVHVSCHVGNVRGEG---LIVVLPSVEEGLA  278

Query  249   RTVMVTLPENEAVKLMEDQLIHQLSPCIKMG  157
             RTVMVTLPE E  KL EDQ I  L P + +G
Sbjct  279   RTVMVTLPEEEMPKLCEDQAIQCLQPTMLIG  309



>gb|EMS49281.1| hypothetical protein TRIUR3_27392 [Triticum urartu]
Length=135

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 69/116 (59%), Gaps = 8/116 (7%)
 Frame = -2

Query  1398  VLDRVMENNFVRIVFYYREFDK-DYTKLNESIAETLNAYTIIMGRLLRSPGEQ-------  1243
              LD  M  + V +V Y R     D   L ES++E L+ Y  ++GRL R  GE        
Sbjct  7     ALDNAMGRHAVHLVLYCRAAPGVDRDPLKESLSEALSLYPAMVGRLTRPEGEGGPAAGSG  66

Query  1242  WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQL  1075
             W++KCNDAG+R ++A+A  ++DEWL     D E+ L ++EPM SD Y WSPFYVQ+
Sbjct  67    WIVKCNDAGVRTVDARASVTLDEWLATASGDDEMDLAYFEPMGSDAYIWSPFYVQV  122



>ref|XP_006297739.1| hypothetical protein CARUB_v10013773mg [Capsella rubella]
 gb|EOA30637.1| hypothetical protein CARUB_v10013773mg [Capsella rubella]
Length=425

 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 112/431 (26%), Positives = 184/431 (43%), Gaps = 57/431 (13%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYTKLN--ESIAETLNAYTI  1279
             TV S+   + G     T LD  M+ +++++V+ Y  E  +D T +N   S     +    
Sbjct  19    TVGSSRPTETGTTHEPTGLDLAMKLHYIKLVYIYSAETARDLTVMNVKASFFPVFDQNPW  78

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
             I GR  R    +  IKCND G R +E+    +V+EWL   DR  +  LV+ +P+  +   
Sbjct  79    ITGRFRRHESGRPYIKCNDCGTRFVESHCDLTVEEWLRAPDRSVDESLVYHQPVGPELGS  138

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplppr  919
                 Y+Q+T F  GGL+LGLS  H++ DP S + F   WA  +F G+ I           
Sbjct  139   SPLIYIQMTRFNCGGLALGLSWAHVMGDPFSLSHFFNLWA-RAFAGEKI-----------  186

Query  918   rpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPS------------QTSSDRPKTISLLF  775
                      +  ++ DL   ++KP +    KP S              S+ R  T S   
Sbjct  187   ---------YCPNTSDLERVFQKPNSTGTTKPNSIKRVDPVEDLWVAPSNSRMITFSFNL  237

Query  774   TDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVLGLDKGFYGN  595
             T + +++    A   D F+ L G++W  ++K +       + + +      GL      N
Sbjct  238   TVDAIKSNFP-AIGEDVFEILIGIIWKCVAKVREEES-DPVTITVIRSDPNGLKPRAVRN  295

Query  594   CMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDG  415
               + + V              S A  ++  + K +   G  D   W+D+     S+ +  
Sbjct  296   SQMISSVHVD----------FSVAEASLEEILKSIG--GADDERFWIDEIVNGVSDFIVY  343

Query  414   CDSLVCVNLEGVDPYSA-CFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTVM  238
               +L  V++ GVD Y A   G + + V+ +      IG G  +++LPS        R V 
Sbjct  344   GANLTFVDMSGVDFYEAKVKGKSPESVYCNVQ---GIGDGGAVVVLPSGVEE---ERVVT  397

Query  237   VTLPENEAVKL  205
             VTLPE+E  K+
Sbjct  398   VTLPEDEVEKV  408



>gb|EPS70649.1| hypothetical protein M569_04114, partial [Genlisea aurea]
Length=199

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 89/173 (51%), Gaps = 14/173 (8%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-------FDKDYTKLNESIAETLN  1291
             +VV++  V PG    ++ LD       +R V YYR               L  S++  L+
Sbjct  10    SVVASRPVDPGMRIEVSSLDATAARYAIRAVVYYRSNPFARGPMATALENLRFSLSNVLD  69

Query  1290  AYTIIMGRLLRSPGEQ-----WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHW  1126
              Y  + GRL R  G+      W ++CNDAG+RV  A    S+DEWL +     E KL  W
Sbjct  70    MYPKVTGRLSRRSGDDSDDDRWEVRCNDAGVRVFSADVDASLDEWLMSAGTADEEKLSAW  129

Query  1125  EPMMS-DPYFWSPFYV-QLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
             E M   D  FW PF + Q+  F+ GG++LG SC+HL+ D  S  +FI +W+++
Sbjct  130   ETMPPVDAGFWPPFRIQQMNSFKCGGIALGFSCSHLIGDITSLALFINSWSEL  182



>ref|XP_010933592.1| PREDICTED: uncharacterized protein LOC105053945 [Elaeis guineensis]
Length=370

 Score =   103 bits (257),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 112/185 (61%), Gaps = 12/185 (6%)
 Frame = -2

Query  1494  STMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRV---MENNFVRIVFYYREFDKDYT  1324
             ST++   +      +TV    + +PG+   ++V+  V   +  + +RIV YY++  K+  
Sbjct  6     STVTPSKLLHIDAIQTVAPGRMAKPGQSRRISVVAPVGLGILRSHLRIVLYYKKARKESA  65

Query  1323  -KLNESIAETLNAYT----IIMGRLLR-SPGEQ-WLIKCNDAGLRVIEAKAKGSVDEWLH  1165
               +   I E+LNA T    ++ GRL R S G+  W +K NDAG+R+++A A+ ++ E+L 
Sbjct  66    LDVAAWIKESLNAMTPDMPVLAGRLRRDSEGDGFWEVKFNDAGVRLVQASAEMTMSEFLE  125

Query  1164  NVDRD-KELKLVHWEPM-MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFI  991
             + +RD +E +L +W  +   +PY+ + FYVQ+T+F+  G S+G+SC+ LLADP+  T F+
Sbjct  126   SEERDGREAQLAYWVDVDQENPYYSALFYVQVTQFQGDGYSIGISCSVLLADPLFLTRFL  185

Query  990   KAWAD  976
             K WA 
Sbjct  186   KFWAQ  190



>ref|XP_011003614.1| PREDICTED: protein ECERIFERUM 26-like [Populus euphratica]
Length=443

 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 107/417 (26%), Positives = 192/417 (46%), Gaps = 40/417 (10%)
 Frame = -2

Query  1404  LTVLDRVMENNFVRIVFYYREF---DKDYTKLNESIAETLNAYTIIMGRLLRSPGEQWLI  1234
             L+ +D  M+  +++ V+++           ++  S+   LN Y  + GR  R+   +  +
Sbjct  33    LSGMDLAMKLPYLKGVYFFSSQACQGLTIMQIKGSMFYWLNDYYTVCGRFQRTEAGRPYM  92

Query  1233  KCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGG  1054
             KC+D+G+R++EA+   +VDEWL   D   +  L++  P+  + +F    Y+Q+T+F+ GG
Sbjct  93    KCSDSGVRIVEARCSKTVDEWLETRDCSLDNLLIYHSPIGPELFFSPSLYMQVTKFKCGG  152

Query  1053  LSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSG  874
             +SLG+S  H++ D  SA+  + +W        +     + PL   +           S G
Sbjct  153   MSLGISWAHVIGDVFSASECLNSWGQF-----LAGVKSYGPLKLTKSPTGLERSKSPSVG  207

Query  873   DLMNHYKKPTTDDGDKPPSQ---TSSDRP-KTISLLFTDEMVRACMS-------MAQTPD  727
                   K+P +     P      T+++R  +T S   +   V    S       +A+ P 
Sbjct  208   T-----KEPVSLKQVDPVGDLWVTANNRKMETFSFHLSASQVSQLHSRIWGRSGLAKIP-  261

Query  726   AFDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVLGLDKGFYGNCMVYNKVKWSSGSMVL  547
              F++L  ++W  I+K K+  GL    V L  +       G   N  + + VK  + S V+
Sbjct  262   FFESLCAIMWQCIAKGKD--GLEPQVVTLCKKDPNNPKDGILSNSQIISSVK--ADSSVV  317

Query  546   GDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGCDSLVCVNLEGVDPYS  367
               DL   A   +    +E  +     + E ++++N     V+ G + L  V+LE  + Y 
Sbjct  318   DADLKELATLLVDQATEENSQ-----IEEAVEKDNGVIDYVVYGAN-LTFVDLEETNFYG  371

Query  366   ACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGA---LSRTVMVTLPENEAVKL  205
               + N   P  V Y ++  +G    +++LP P  +G    + R V+VTLPENE VKL
Sbjct  372   LEW-NGHKPEAVHYSIQG-VGDEGAVMVLPWPKDSGTDGNIGRIVVVTLPENEVVKL  426



>gb|KDO45042.1| hypothetical protein CISIN_1g0140001mg, partial [Citrus sinensis]
Length=309

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 98/320 (31%), Positives = 146/320 (46%), Gaps = 36/320 (11%)
 Frame = -2

Query  1077  LTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplpprrpcnnnh  898
             L +FE GG+++GLSCTH+  D  S  +  KA+++ S  G+ I+ P F   P       + 
Sbjct  1     LNDFEGGGVAIGLSCTHMHGDLTSLILLFKAFSE-SHHGQAITFPPFFKPPAPPDKKFSV  59

Query  897   nphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMS--MAQTPDA  724
             N              K T+    K   QT S +  T +  F+D +V+ C+S    + PDA
Sbjct  60    NN------------SKSTSYLEAKLQKQTPSVKMSTATFKFSDSVVKQCLSEIHDKCPDA  107

Query  723   --FDALAGLLWTRISK---AKNNVGLMDLAVGLDVRKVLG--LDKGFYGNCMVYNKVKWS  565
               FD LA L W R+      K++     L++ +D R++L   L  G++GN + ++ +  +
Sbjct  108   SPFDLLAALFWIRVVHLKGPKHDDHTHSLSLCVDFRRLLQEPLPYGYFGNALNFSLLSLN  167

Query  564   SGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLD----QNNCCASNVLDGCDSLVC  397
                M     +L + A  +      + +E     + WLD    +    A           C
Sbjct  168   EEEM--DCSMLGRVAELVHCHVSGLKEEEFWATLHWLDLQKEEGGKYAPPFAMYGPEFTC  225

Query  396   VNLEG--VDPYSACFGNNMD---PVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTVMVT  232
             V++E   +   S  +  N D   PVHVS +V    G G   LIL  P     L+RTVMVT
Sbjct  226   VSVEHMIIGDQSVMYSMNFDSAKPVHVSCHVGNAEGEG---LILVMPSAEAGLARTVMVT  282

Query  231   LPENEAVKLMEDQLIHQLSP  172
             LPE E  KL EDQ I  L P
Sbjct  283   LPEEETAKLCEDQSILHLKP  302



>ref|XP_010421841.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
Length=428

 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 78/283 (28%), Positives = 129/283 (46%), Gaps = 38/283 (13%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYTKLN--ESIAETLNAYTI  1279
             TV S+   + G    LT LD  M+ +++++V+ Y  E   D T +N    +    +  + 
Sbjct  19    TVSSSRPTETGTTHELTGLDLAMKLHYLKVVYIYSAEAASDLTVMNVKAPLFPVFDQISW  78

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
             I GRL R    +  IKCND G R +E+    +VDEWL   DR  +  LV+ +P+  +  F
Sbjct  79    ITGRLRRHESRRPYIKCNDCGTRFVESHCDLTVDEWLRIPDRSVDESLVYHQPVGPEMAF  138

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplppr  919
                 Y+Q+T F  GGL+LGLS  H++ DP+S + F   WA  ++ G+ I           
Sbjct  139   SPLIYIQMTRFSCGGLALGLSWAHIMGDPLSLSHFFNLWA-RAYVGEKIH----------  187

Query  918   rpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPS------------QTSSDRPKTISLLF  775
                          + +L   ++ P +  G +P S              S+ +  T S   
Sbjct  188   ----------SPKTSELERVFQNPNS-TGKEPESIKRVDPVGDLWVAPSNRKMTTFSFNL  236

Query  774   TDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVGLMDLAV  646
             T   +++    A   D F+ L+G++W  I+KA+     + + V
Sbjct  237   TVSEIKSHFP-ATGDDEFEILSGIIWKCIAKARGESAPVTITV  278



>ref|NP_001241338.1| uncharacterized protein LOC100819144 [Glycine max]
 gb|ACU18001.1| unknown [Glycine max]
Length=434

 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 86/142 (61%), Gaps = 3/142 (2%)
 Frame = -2

Query  1395  LDRVMENNFVRIVFYY-REFDKDYT--KLNESIAETLNAYTIIMGRLLRSPGEQWLIKCN  1225
             LD  M+ +++R+V+++  E  +D T  K+ E++   LN Y I  GR  RS   + LIKCN
Sbjct  33    LDLAMKLHYLRVVYFFASEAAQDLTIMKIKEAMFTLLNHYFITCGRFRRSDSGRPLIKCN  92

Query  1224  DAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSL  1045
             D G+R IEAK   ++DEWL   D      LV  + +  +  F  P  +Q+T+F+ GG+SL
Sbjct  93    DCGVRFIEAKCSKTLDEWLAMKDWPLYKLLVSHQVIGPELSFSPPVLLQVTKFKCGGISL  152

Query  1044  GLSCTHLLADPISATMFIKAWA  979
             GLS  H+L DP+SA+ FI +W 
Sbjct  153   GLSWAHVLGDPLSASEFINSWG  174



>ref|XP_010466747.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
Length=425

 Score =   102 bits (254),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 79/283 (28%), Positives = 129/283 (46%), Gaps = 38/283 (13%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYTKLN--ESIAETLNAYTI  1279
             TV S+   + G    LT LD  M+ +++++V+ Y  E  +D T +N    +    +  + 
Sbjct  19    TVSSSRPTETGTTHELTGLDLAMKLHYLKVVYIYSAETARDLTVMNVKAPLFPVFDQISW  78

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
             I GRL R    +  IKCND G R++E+    +VDEWL   DR  +  LV+ +P+  +  F
Sbjct  79    ITGRLRRDESGRPYIKCNDCGTRLVESHCDLTVDEWLRVPDRSVDESLVYHQPVGPEMAF  138

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplppr  919
                 Y+Q+T F  GGL+LGLS  H++ DP+S +     WA  S   K+            
Sbjct  139   SPLIYIQMTRFSCGGLALGLSWAHIMGDPLSLSHVFNLWARASVGEKI------------  186

Query  918   rpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPS------------QTSSDRPKTISLLF  775
                      H   + +L   ++ P + D  KP S              S+ +  T S   
Sbjct  187   ---------HCPKTSELERVFQNPNSTD-KKPDSIKPVDPVGDLWVAPSNRKMTTFSFNL  236

Query  774   TDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVGLMDLAV  646
             T   +++    A   + FD L+G++W  I+KA+     + + V
Sbjct  237   TVNEIKSHFP-ATGENEFDILSGIIWKCIAKARGESAPVTITV  278



>ref|XP_011074277.1| PREDICTED: protein ECERIFERUM 1 [Sesamum indicum]
Length=435

 Score =   100 bits (248),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 101/178 (57%), Gaps = 6/178 (3%)
 Frame = -2

Query  1494  STMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIV-FYYREFDKDYT--  1324
             S ++ +N+   I   TVV  ++   GK   LT +D  M+ +++  V F+ R+  +  +  
Sbjct  5     SDLAGENVIYDIKLSTVVPASITAEGKTRQLTNMDLAMKLHYITTVHFFGRDAAEGLSIQ  64

Query  1323  KLNESIAETLNAYTIIMGRLLRS-PGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVD-RD  1150
              L   + + L  Y  I GR+ R   G +  IKCND+G+R++EAK   +VDEWL  V+  D
Sbjct  65    DLKNPMFQWLQPYYPICGRIRRHDGGGRPFIKCNDSGVRIVEAKCAKTVDEWLETVNGGD  124

Query  1149  KELKLVHWEPMMSDPYFWSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
                 LV+ +P+++D + ++P  ++Q TEF+ GGL +G+S  H+L D  SAT  I  W 
Sbjct  125   HHRLLVYKQPLVADNFGFTPLVFLQFTEFKCGGLCVGMSWAHILGDAFSATECINMWG  182



>ref|XP_010933591.1| PREDICTED: uncharacterized protein LOC105053944 [Elaeis guineensis]
Length=369

 Score = 99.0 bits (245),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 103/169 (61%), Gaps = 11/169 (7%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRV---MENNFVRIVFYYREFDKDY----TKLNESIAETL  1294
             +TV    + +PG+   ++V+  V   +  + +RIV YY++  +      T+  ES+   +
Sbjct  20    QTVAPGRMTKPGQSRRISVVAPVGLEILRSHLRIVLYYKKARESVLDVATRTRESLHAMM  79

Query  1293  NAYTIIMGRLLR-SPGEQ-WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRD-KELKLVHWE  1123
                 ++ GRL R S G+  W +K NDAG+R ++A A+ ++ E+L + +RD +E +L +W 
Sbjct  80    PDVPVLAGRLRRDSEGDGFWEVKFNDAGVRWVQASAEMTMSEFLESEERDGREAQLAYWV  139

Query  1122  PM-MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
              +   +PY+ + FYVQ+T+F+  G S+G+SC+ LLADP+  T F+K WA
Sbjct  140   DVDQENPYYSALFYVQVTQFQGDGYSIGISCSVLLADPLFLTRFLKLWA  188



>ref|XP_009400234.1| PREDICTED: uncharacterized protein LOC103984463 [Musa acuminata 
subsp. malaccensis]
Length=349

 Score = 97.4 bits (241),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 102/174 (59%), Gaps = 18/174 (10%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKF------CPLTVLDRVMENNFVRIVFYYREFDKDYTK-------LNE  1312
             +T     V  PG+        PL +   V++  F  +++Y +  +++          + E
Sbjct  9     QTATPGKVASPGQARRIVTATPLGL--EVLQRRFQVVLYYGKAREEEVESPLAVAAWIKE  66

Query  1311  SIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRD-KELKL  1135
             S++  L  + ++ GRL R+ G  W +K ND+G+R+++A A+ ++ E+L + DRD KE +L
Sbjct  67    SLSAALPRHPVLSGRL-RNGGGSWEVKFNDSGVRLVQATAETTMSEFLASEDRDGKEAQL  125

Query  1134  VHWEPM-MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWAD  976
              +WE +   DP F + FY+Q+T+F+  G ++G+SC+ LLADP+  + F+++W+ 
Sbjct  126   AYWEDINEGDPNFSALFYIQVTQFQGNGYAIGISCSLLLADPLFLSRFLRSWSQ  179



>ref|XP_003531221.1| PREDICTED: protein ECERIFERUM 26-like [Glycine max]
Length=434

 Score = 98.2 bits (243),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 82/142 (58%), Gaps = 3/142 (2%)
 Frame = -2

Query  1395  LDRVMENNFVRIVFYY-REFDKDYT--KLNESIAETLNAYTIIMGRLLRSPGEQWLIKCN  1225
             LD  M+ +++R+V+++  E  +D T  K+ + +    N Y I  GR  RS   + LIKCN
Sbjct  33    LDLAMKLHYLRVVYFFDSEAAQDLTIMKIKDGMFTLFNHYFITCGRFRRSDSGRPLIKCN  92

Query  1224  DAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSL  1045
             D G R IEAK   ++DEWL   D      LV  + +  +  F  P   Q+T+F+ GG+SL
Sbjct  93    DCGARFIEAKCNKTLDEWLAMKDWPLYKLLVSHQVIGPELSFSPPVLFQVTKFKCGGISL  152

Query  1044  GLSCTHLLADPISATMFIKAWA  979
             GLS  H+L DP+SA+ FI +W 
Sbjct  153   GLSWAHVLGDPLSASEFINSWG  174



>gb|KHN12341.1| Omega-hydroxypalmitate O-feruloyl transferase [Glycine soja]
Length=434

 Score = 98.2 bits (243),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 92/176 (52%), Gaps = 9/176 (5%)
 Frame = -2

Query  1497  RSTMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY-REFDKDYT-  1324
              S + +  +SS    R   S     PG       LD  M+ +++R+V+++  E  +D T 
Sbjct  5     ESVVHDVRLSSVGPGRATRSEVFHSPGG------LDLAMKLHYLRVVYFFASEAAQDLTI  58

Query  1323  -KLNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK  1147
              K+ + +    N Y I  GR  RS   + LIKCND G R IEAK   ++DEWL   D   
Sbjct  59    MKIKDGMFTLFNHYFITCGRFRRSDSGRPLIKCNDCGARFIEAKCNKTLDEWLAMKDWPL  118

Query  1146  ELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
                LV  + +  +  F  P   Q+T+F+ GG+SLGLS  H+L DP+SA+ FI +W 
Sbjct  119   YKLLVSHQVIGPELSFSPPVLFQVTKFKCGGISLGLSWAHVLGDPLSASEFINSWG  174



>ref|XP_010512967.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
 ref|XP_010488464.1| PREDICTED: protein ECERIFERUM 26-like [Camelina sativa]
Length=426

 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 76/283 (27%), Positives = 127/283 (45%), Gaps = 38/283 (13%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYTKLN--ESIAETLNAYTI  1279
             TV S+   + G    LT LD  M+ +++++V+ Y  E   D T +N    +    +  + 
Sbjct  19    TVSSSRPTETGTTHELTGLDLAMKLHYLKVVYIYSAETASDLTVMNVKAPLFPVFDQISW  78

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
             I GRL R    +  IKCND G R +E+    +VDEWL   DR  +  LV+ +P+  +  F
Sbjct  79    ITGRLRRHESGRPYIKCNDCGTRFVESHCDLTVDEWLRVPDRSVDESLVYHQPVGPEMAF  138

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplppr  919
                 Y+Q+T F  GGL+LGLS  H++ DP+S +     WA  ++ G+ I           
Sbjct  139   SPLIYIQMTRFSCGGLALGLSWAHIMGDPLSLSHVFNLWA-RAYVGEKIH----------  187

Query  918   rpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSD------------RPKTISLLF  775
                          + +L   ++ P +  G +P S    D            +  T S   
Sbjct  188   ----------CPKTSELERVFQNPNS-TGKEPESIKRVDPVGDLWVAPGNNKMTTFSFNL  236

Query  774   TDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVGLMDLAV  646
             T   +++    A   + F+ L+G++W  I+KA+     + + V
Sbjct  237   TVNEIKSHFP-ATGENEFEILSGIIWKCIAKARGESAPVTITV  278



>ref|XP_006297755.1| hypothetical protein CARUB_v10013790mg [Capsella rubella]
 gb|EOA30653.1| hypothetical protein CARUB_v10013790mg [Capsella rubella]
Length=421

 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 76/273 (28%), Positives = 125/273 (46%), Gaps = 38/273 (14%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYT--KLNESIAETLNAYTI  1279
             TV S+   + G     T LD  M+ +++++V+ Y  E  +D T   +   +    +  + 
Sbjct  19    TVSSSRPTETGTTHEPTGLDLAMKLHYIKVVYIYSAETARDLTVMSVKAPLFPVFDQISW  78

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
             I GRL R    +  IKCND G R +E+    +VDEWL   DR  +  LV+ +P+  D  F
Sbjct  79    ITGRLRRHESGRPYIKCNDCGTRFVESHCDLTVDEWLRVPDRSVDESLVYHQPVGPDMAF  138

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplppr  919
                 Y+Q+T F  GGL+LGLS  H++ DP+S +     WA  +F G+ I           
Sbjct  139   SPLIYLQMTRFSCGGLALGLSWAHIMGDPLSLSHVFNLWA-RAFAGEKI-----------  186

Query  918   rpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPS------------QTSSDRPKTISLLF  775
                      + + + +L   ++ P +  G KP S              S+ +  T S   
Sbjct  187   ---------YSHKTSELERVFQNPNS-TGAKPESIKRVDPVGDLWVTPSNSKMTTFSFNL  236

Query  774   TDEMVRACMSMAQTPDAFDALAGLLWTRISKAK  676
             T + +++    A   D F+ L G++W  I+K +
Sbjct  237   TVKDIKSKFP-ANGDDVFEILIGVIWKCIAKVR  268



>ref|XP_008802334.1| PREDICTED: protein ECERIFERUM 26-like [Phoenix dactylifera]
Length=433

 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 93/164 (57%), Gaps = 6/164 (4%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR--EFDKDYT--KLNESIAETLNAYT  1282
             TVV  +V        L  +D VM+ +++R V+Y++  E     T   L E +   L+ Y 
Sbjct  17    TVVPGSVTGEAAVYELANIDLVMKLHYLRTVYYFKADEIIDSLTIKALKEPMFPWLDVYY  76

Query  1281  IIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPY  1102
              + GR+ R+   +  +KCND G+R++E K   +++EWL   D  +  +LV  + +  D +
Sbjct  77    PVAGRIRRTEAGRPFVKCNDCGVRIVETKCGQTLEEWLEIKDSSRWRQLVPEKVLGPDLH  136

Query  1101  FWSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
             F SPF ++Q T F+ GG+++G S +H+L D I+AT FI  WA +
Sbjct  137   F-SPFVFIQFTRFKCGGMAIGFSWSHILGDAITATNFINLWAQL  179



>ref|XP_004136254.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
sativus]
 gb|KGN60263.1| hypothetical protein Csa_3G892170 [Cucumis sativus]
Length=441

 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 89/156 (57%), Gaps = 12/156 (8%)
 Frame = -2

Query  1404  LTVLDRVMENNFVRIVFYYREFDK----DYTKLNESIAETLNAYTIIMGRLLRS----PG  1249
             LT +D  M+ +++R V+++R  ++        L + +   L  Y ++ GR+ R      G
Sbjct  32    LTAMDLAMKLHYIRGVYFFRASEEVRNLTVYDLKKPLFLLLEKYYVVSGRIRRRIVGDDG  91

Query  1248  EQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELK----LVHWEPMMSDPYFWSPFYV  1081
             ++  IKCND+G+R++EA  + +++EWL   D DK L     LVH + +  D  F    ++
Sbjct  92    DRAFIKCNDSGVRIVEADCEKTIEEWLSIEDGDKILNRDGCLVHSQAIGPDLGFSPLAFI  151

Query  1080  QLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
             QLT F+ GGLS+GLS TH+L D  SA+ FI  W  +
Sbjct  152   QLTRFKCGGLSVGLSWTHVLGDIFSASTFINVWGHI  187



>ref|XP_006432967.1| hypothetical protein CICLE_v10001131mg [Citrus clementina]
 gb|ESR46207.1| hypothetical protein CICLE_v10001131mg [Citrus clementina]
Length=420

 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 79/141 (56%), Gaps = 10/141 (7%)
 Frame = -2

Query  1485  SEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTK  1321
             S  N+ S +   T VS+      +  PLT LD  M ++ + ++FYY +     FD D  +
Sbjct  6     SRVNVHSVL---TQVSSRPSASDETYPLTRLDHAMGHHTIHVIFYYEKSPFGSFDMDPIR  62

Query  1320  LNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKEL  1141
             +  +++E L++Y  + GRL R     W +KCNDAG+RV+ A+   ++DEWL + D ++E 
Sbjct  63    V--TLSEVLSSYPPVTGRLTRDDAGNWAVKCNDAGVRVLRARVGITLDEWLRSADGNEER  120

Query  1140  KLVHWEPMMSDPYFWSPFYVQ  1078
              L  WE M   P  WSPF +Q
Sbjct  121   DLTVWEDMPEVPNTWSPFRIQ  141


 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 111/236 (47%), Gaps = 25/236 (11%)
 Frame = -2

Query  816  QTSSDRPKTISLLFTDEMVRACMS--MAQTPDA--FDALAGLLWTRISK---AKNNVGLM  658
            QT S +  T +  F+D +V+ C+S    + PDA  FD LA L W R+      K++    
Sbjct  186  QTPSVKMSTATFKFSDSVVKQCLSEIHDKCPDASPFDLLAALFWIRVVHLKGPKHDDHTH  245

Query  657  DLAVGLDVRKVLG--LDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDK  484
             L++ +D R++L   L  G++GN + ++ +  +   M     +L + A  +      + +
Sbjct  246  SLSLCVDFRRLLQEPLPYGYFGNALNFSLLSLNEEEMDCS--MLGRVAELVHCHVSGLKE  303

Query  483  EGIMDLIEWLD----QNNCCASNVLDGCDSLVCVNLE----GVDP--YSACFGNNMDPVH  334
            E     + WLD    +    A           CV++E    G  P  YS  F ++  PVH
Sbjct  304  EEFWATLHWLDLQKEEGGKYAPPFAMYGPEFTCVSMEHMIIGDQPVMYSMNF-DSAKPVH  362

Query  333  VSYYVEPEIGPGNRLLILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
            VS +V    G G   LIL  P     L+RTVMVTLPE E  KL EDQ I  L P +
Sbjct  363  VSCHVGNAEGEG---LILVMPSAEAGLARTVMVTLPEEETAKLCEDQSILHLKPTM  415



>emb|CDX85135.1| BnaC07g07710D [Brassica napus]
Length=407

 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/263 (27%), Positives = 120/263 (46%), Gaps = 33/263 (13%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYT--KLNESIAETLNAYTI  1279
             TV S    + G     T LD  M+ ++++ V+ Y  E  +D T   + E+    L+  + 
Sbjct  19    TVGSARPTETGTVHQPTGLDLAMKLHYIKSVYIYSAETTRDLTVMHVKETFFTVLDQISW  78

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
             I GRL R    +  IKCND G RV+E++   +VDEWL   DR  +  LV+ +P+  +  +
Sbjct  79    ITGRLRRRDSGRPFIKCNDCGTRVVESQCDLTVDEWLCAPDRSVDESLVYHQPIGPELAY  138

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplppr  919
                 Y+Q+T F+ GGL++G S  H++ DP S + F   W   +  G+ I           
Sbjct  139   SPLIYIQMTRFKCGGLAIGFSWAHIIGDPHSLSHFFNLWT-RALAGEQI-----------  186

Query  918   rpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMSMA  739
                      +   + DL   ++ P +   DK P       P         ++  A  +  
Sbjct  187   ---------YFPKTSDLERCFQNPNST--DKEPVSIKRVDP-------VGDLWVAPSNSK  228

Query  738   QTPDAFDALAGLLWTRISKAKNN  670
              T  +F+ L+G++W  I+K++  
Sbjct  229   MTTYSFNILSGIIWKCIAKSRGE  251



>ref|XP_006852920.1| hypothetical protein AMTR_s00033p00231280 [Amborella trichopoda]
 gb|ERN14387.1| hypothetical protein AMTR_s00033p00231280 [Amborella trichopoda]
Length=424

 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 98/169 (58%), Gaps = 17/169 (10%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKD---YTKLNESIAETLNAYTI  1279
             TV+   V   G    L+ +D  M+ +++R V+YY +   +     K+ ES+   L  +  
Sbjct  17    TVLPAAVTADGTVHELSNMDLAMKLHYLRAVYYYNKQAAESLSIYKVKESMFVLLQRHVA  76

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELK-LVHWEPMMSDPY  1102
             + GR+ +S   +  IKCND+G+R++EA+   +++EWL       ELK L+H E ++S+  
Sbjct  77    VAGRVRKSESGRPHIKCNDSGVRILEAQCNKTIEEWL-------ELKELIHGEELISNQV  129

Query  1101  F-----WSP-FYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
                   +SP  Y+Q T+F+ GG+S+ ++ +H+L D  +A+ FIKAW ++
Sbjct  130   LGPDLRFSPLLYLQFTKFKCGGMSIAMNWSHILGDAFTASNFIKAWGNL  178



>ref|XP_008466157.1| PREDICTED: protein ECERIFERUM 1 [Cucumis melo]
Length=444

 Score = 94.0 bits (232),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 97/174 (56%), Gaps = 15/174 (9%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR--EFDKDYT--KLNESIAETLNAYT  1282
             +VV        +   LT +D  M+ +++R V+++R  E  K+ T   L + +   L  Y 
Sbjct  17    SVVPAKATGEDEVKELTAMDLAMKLHYIRGVYFFRASEEVKNLTIYDLKKPLFLLLEKYY  76

Query  1281  IIMGRLLR-----SPGEQWLIKCNDAGLRVIEAKAKGSVDEWL--HNVDRDKELK----L  1135
             ++ GR+ R     + G++  IKCND+G+R++EA  + +++EWL   + D DK L     L
Sbjct  77    VVSGRIRRRIIGDNDGDRAFIKCNDSGVRIVEADCEKTIEEWLSIEDDDDDKILNRDGCL  136

Query  1134  VHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
             VH + +  D  F    ++QLT F+ GGLS+GLS TH+L D  SA+ FI  W  +
Sbjct  137   VHSQAIGPDLGFSPLAFIQLTRFKCGGLSVGLSWTHVLGDIFSASTFINVWGHI  190



>ref|XP_002445495.1| hypothetical protein SORBIDRAFT_07g020400 [Sorghum bicolor]
 gb|EES14990.1| hypothetical protein SORBIDRAFT_07g020400 [Sorghum bicolor]
Length=395

 Score = 93.2 bits (230),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 94/187 (50%), Gaps = 22/187 (12%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTV----LDRVMENNFVRIVFYYR--------EFDKDYTKLNES  1309
             +T V T  V+PG+   + V    L         R+V YYR           ++     ES
Sbjct  16    QTAVPTRAVEPGRTRHIAVASPPLPAAALQRRTRVVLYYRVDGASASARLWEEAMWTKES  75

Query  1308  IAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNV-DRDKELKLV  1132
             ++E +  +  + GRL R     W +K NDAG+R  EA A+ ++DE+L  V D+D   +  
Sbjct  76    LSEAVADHPEMAGRLRRHADGSWEVKLNDAGVRFTEATAEATLDEFLATVQDKDHRARSW  135

Query  1131  HWEPMMS--------DPYFWSPFYVQLTEFE-EGGLSLGLSCTHLLADPISATMFIKAWA  979
              WE  ++        DP   +  YVQLT F+ +GG ++G+SC+ +L+DP+S   F+ +WA
Sbjct  136   DWEAALAPWSDVNAEDPDVSALVYVQLTRFQGDGGFAVGVSCSLMLSDPLSLARFLASWA  195

Query  978   DMSFTGK  958
                 T K
Sbjct  196   RTHATMK  202



>dbj|BAJ84920.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=353

 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 82/148 (55%), Gaps = 10/148 (7%)
 Frame = -2

Query  1407  PLTVLDRVMENNFVRIVFYYREFDKDYTK---LNESIAETLNAYTIIMGRLLRSPGEQWL  1237
             P T L R +     R VFYYR  D    +   + ES+ E L  +  + GRL R     W 
Sbjct  40    PATALQRRL-----RAVFYYRGDDAPLEEGIWVKESLGEVLCFFPEMAGRLRRHADGSWE  94

Query  1236  IKCNDAGLRVIEAKAKGSVDEWLHNVDRD-KELKLVHW-EPMMSDPYFWSPFYVQLTEFE  1063
             +K NDAG+R  +A  + +++++L + +R  KE  L  W +    DP   S  ++QL  FE
Sbjct  95    VKLNDAGVRFQQATVEVTMEDFLADKERPRKEAALAPWVDVSAEDPDMCSLLFMQLNRFE  154

Query  1062  EGGLSLGLSCTHLLADPISATMFIKAWA  979
              GG ++G+SCT LLADP+S   F++AWA
Sbjct  155   GGGYAIGVSCTVLLADPLSLARFLRAWA  182



>emb|CDX77480.1| BnaA07g06180D [Brassica napus]
Length=426

 Score = 93.6 bits (231),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 91/169 (54%), Gaps = 4/169 (2%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYTKLN--ESIAETLNAYTI  1279
             TV S    + G     T LD  M+ ++++ V+ Y  E  +D T ++  E++    +  + 
Sbjct  19    TVGSARPTETGTVHQPTGLDLAMKLHYIKAVYIYSAEMTRDLTVMHVKETLFTVFDQISW  78

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
             I GRL R    +  IKCND G RV+E++   +VDEWL   DR  +  LV+ +P+  +  +
Sbjct  79    ITGRLRRRDSGRPFIKCNDCGTRVVESQCDLTVDEWLCVPDRSVDESLVYHQPVGPELAY  138

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMI  952
                 Y+Q+T ++ GGL+LGLS  H++ DP S +     W   +  G++I
Sbjct  139   SPLIYIQMTRYKCGGLALGLSWAHIMGDPFSLSHIFSLWT-RALAGEVI  186



>ref|XP_002883466.1| hypothetical protein ARALYDRAFT_479896 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59725.1| hypothetical protein ARALYDRAFT_479896 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score = 93.2 bits (230),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 82/153 (54%), Gaps = 4/153 (3%)
 Frame = -2

Query  1401  TVLDRVMENNFVRIVFYYR-EFDKDYTKLN--ESIAETLNAYTIIMGRLLRSPGEQWLIK  1231
             T LD  M+ ++++ V+ Y  E  +D T ++    +    +    I+GR  R    +  IK
Sbjct  35    TGLDLAMKLHYLKAVYIYSAETARDLTVMHVKTPLFSVFDQIPCIIGRFRRHDSGRPYIK  94

Query  1230  CNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGL  1051
             CND G R +E+    +V+EWLH  DR  +  LV+ +P+  +  F    Y+Q+T F  GGL
Sbjct  95    CNDCGTRFVESHCDLTVEEWLHVPDRSVDEALVYHQPVGPELAFSPLLYIQMTRFSCGGL  154

Query  1050  SLGLSCTHLLADPISATMFIKAWADMSFTGKMI  952
             +LGLS  H + DP S + F   WA  +F G+ I
Sbjct  155   ALGLSWAHAMGDPFSLSHFFNLWA-QAFAGEKI  186



>ref|XP_009102573.1| PREDICTED: protein ECERIFERUM 26-like [Brassica rapa]
Length=426

 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 90/169 (53%), Gaps = 4/169 (2%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY-REFDKDYTKLN--ESIAETLNAYTI  1279
             TV S    + G     T LD  M+ ++++ V+ Y  E  +D T ++  E+     +  + 
Sbjct  19    TVGSARPTETGTVHQPTGLDLAMKLHYIKAVYIYLAEMTRDLTVMHVKETFFTVFDQISW  78

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
             I GRL R    +  IKCND G RV+E++   +VDEWL   DR  +  LV+ +P+  +  +
Sbjct  79    ITGRLRRRDSGRPFIKCNDCGTRVVESQCDLTVDEWLCVPDRSVDESLVYHQPVGPELAY  138

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMI  952
                 Y+Q+T ++ GGL+LGLS  H++ DP S +     W   +  G++I
Sbjct  139   SPLIYIQMTRYKCGGLALGLSWAHIMGDPFSLSHIFSLWT-RALAGEVI  186



>ref|XP_010919745.1| PREDICTED: uncharacterized protein LOC105043757 [Elaeis guineensis]
Length=372

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 104/171 (61%), Gaps = 13/171 (8%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRV---MENNFVRIVFYYREFDKDYTK------LNESIAE  1300
             +TV    + +PG+   ++V D     +  ++++I+ YY++  ++ +       + ES+  
Sbjct  21    QTVAPARMAKPGQSRRISVADPFRPEILQSYLQIILYYKKAREEESASVVAAWIKESLNV  80

Query  1299  TLNAYTIIMGRLLRS-PGE-QWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRD-KELKLVH  1129
              +    ++ GRL R   G+ +W IK NDAG+R+++A A+ ++ E+L + +RD +E +L +
Sbjct  81    AVADEPLLAGRLWRDDEGDGRWEIKFNDAGVRLVQASAEMTMAEFLGSKERDGREGQLAY  140

Query  1128  WEPM-MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
             W  +   +P + + FY+Q+TEF+  G S+G+SC+ LLADP+    F+K+WA
Sbjct  141   WVDVDKENPRYSALFYIQVTEFQGDGYSIGISCSLLLADPLFLARFLKSWA  191



>ref|XP_011083578.1| PREDICTED: uncharacterized protein LOC105166055 [Sesamum indicum]
Length=368

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 101/194 (52%), Gaps = 16/194 (8%)
 Frame = -2

Query  1500  IRSTMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDR-----VMENNFVRIVFYYREFD  1336
             + ST++     S    +TVV TN   P +   LTV        +++  F  +  Y++  D
Sbjct  3     LSSTLNNAYKLSVAALQTVVPTNPTDPRRSFRLTVPQNLSSTGILQRRFHVLFCYHKTRD  62

Query  1335  KD-----YTKLNESIAETLNAYTIIMGRLLR---SPGEQWLIKCNDAGLRVIEAKAKGSV  1180
             +D       ++ ES+   L    ++ GR+ R   + G+  ++  ND+G+R++EA  +  +
Sbjct  63    EDSGWLFAGRIKESLGRALQEQPLLAGRMRRRGDNSGDLEVVS-NDSGVRLVEASVELKL  121

Query  1179  DEWLHNVDR-DKELKLVHWEPMMSD-PYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPIS  1006
              ++L   D+ D E KLV WE    + P F   FYVQ+T F  GG S+G+SC+ LL DP  
Sbjct  122   SDFLELKDKVDAEAKLVFWEDFTEENPQFSPLFYVQVTNFTCGGYSIGISCSLLLVDPFL  181

Query  1005  ATMFIKAWADMSFT  964
              + F+K WAD+  T
Sbjct  182   LSSFLKRWADLHNT  195



>ref|XP_002862408.1| hypothetical protein ARALYDRAFT_497463 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38666.1| hypothetical protein ARALYDRAFT_497463 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 88/169 (52%), Gaps = 4/169 (2%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYTKLN--ESIAETLNAYTI  1279
             TV ++   + G     T LD  M+ ++++ V+ Y  E  +D T ++    +    +    
Sbjct  19    TVSASQPSETGTTHEPTGLDLAMKLHYLKAVYIYSAETARDLTVMHVKTPLFSVFDQIPC  78

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
             I+GR  R    +  IKCND G R +E+    +V+EWLH  DR  +  LV+ + +  +  F
Sbjct  79    IIGRFRRHDSGRPYIKCNDCGTRFVESHCDLTVEEWLHVPDRSVDEALVYHQSVGPELAF  138

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMI  952
                 Y+Q+T F  GGL+LGLS  H++ DP S + F   WA  +F G+ I
Sbjct  139   SPLLYIQMTRFSCGGLALGLSWAHVMGDPFSLSHFFNLWAQ-AFAGEKI  186



>gb|KFK39684.1| hypothetical protein AALP_AA3G275800 [Arabis alpina]
Length=412

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/265 (28%), Positives = 115/265 (43%), Gaps = 29/265 (11%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKD--YTKLNESIAETLNAYTI  1279
             TV S+   + G     T LD  M+ ++++ V+ Y  E  +D   T +        + Y  
Sbjct  19    TVSSSWPTETGTTHEPTGLDLAMKLHYLKAVYIYSAETARDLTVTHVKNPFFPVFDQYPW  78

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
               GR  R    +  IKCND G R +E+    +VDEWL   DR  +  LV+ +P+  +  F
Sbjct  79    TTGRFARHDSRRPYIKCNDCGTRFVESHCNLTVDEWLLLPDRSIDESLVYHKPIGPELIF  138

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplppr  919
                 Y+Q+T F+ GGL+LGLS  H++ DP S + F   WA  +  G+ I           
Sbjct  139   SPLIYIQMTRFKCGGLALGLSWAHVMGDPFSLSHFFNLWA-RALAGEKI-----------  186

Query  918   rpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQ----TSSDRPKTISLLFTDEMVRAC  751
                         +S    N  K+P +     P        S+ + +T S   T   +R+ 
Sbjct  187   --------YCPKTSNGFQNPGKEPDSIKRVDPVGDHWVVPSNKKMETYSFHVTIHEIRS-  237

Query  750   MSMAQTPDAFDALAGLLWTRISKAK  676
                    D F+ L G++W  I+K +
Sbjct  238   -HFPAKGDEFEILCGVIWKCIAKVR  261



>emb|CDP11510.1| unnamed protein product [Coffea canephora]
Length=439

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 99/183 (54%), Gaps = 4/183 (2%)
 Frame = -2

Query  1494  STMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYTKLN  1315
             ST  E+     +   +VV  ++    K   L+ +D +++ ++V+ ++++R        +N
Sbjct  3     STAGENAAVYDVRLSSVVPASITGEDKVHELSNMDLMLKLHYVKGIYFFRSGAARGLTIN  62

Query  1314  E---SIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKE  1144
             +    + E L  Y+ + GR+ +S   +  IKCND+G+R+ EAK   ++DEWL   D    
Sbjct  63    DLKKPMFECLALYSTLSGRIRKSEDGRPFIKCNDSGVRIAEAKCSKTLDEWLAFNDDSLN  122

Query  1143  LKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFT  964
              +L++ + +  D  F    +VQ T F+ GG+S+GLS  H++ D  SA+ FI  W  +  T
Sbjct  123   DQLIYSQFLAPDAEFTPLVFVQFTWFKCGGISIGLSWAHIVGDAFSASHFINMWGQI-LT  181

Query  963   GKM  955
             G++
Sbjct  182   GQV  184



>ref|XP_010527461.1| PREDICTED: protein ECERIFERUM 26-like [Tarenaya hassleriana]
Length=437

 Score = 90.9 bits (224),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 83/170 (49%), Gaps = 4/170 (2%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE---FDKDYTKLNESIAETLNAYTI  1279
             TV S     PG     T LD  M+ +++++ + +      + D  K+ E +       + 
Sbjct  19    TVGSPRPTAPGTTHEPTGLDLAMKLHYLKVAYVFSAETASEIDVKKVKEGMFVLFEQISW  78

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
               GR  R    +  IKCND G R +E     +V+EWL   DR  +  LV+ +P+  +  F
Sbjct  79    TTGRFRRHVSGRPYIKCNDCGTRFVEGNCDFTVEEWLRKPDRSDDELLVYHKPVGPELSF  138

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMIS  949
                 YVQ+T F+ GGLSLGLS  H+L DP S +     WA  +  GK +S
Sbjct  139   SPLIYVQMTRFKCGGLSLGLSWAHILGDPFSLSYSFNQWAH-ALAGKKVS  187



>ref|XP_002283781.1| PREDICTED: protein ECERIFERUM 1 [Vitis vinifera]
Length=429

 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 88/162 (54%), Gaps = 3/162 (2%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKD---YTKLNESIAETLNAYTI  1279
             +VV   V    K   L+ +D  M+ ++++ V+++R    +    + L E + E L  Y  
Sbjct  17    SVVPATVTGEDKVHGLSNMDLAMKLHYLKGVYFFRREAVEGLTISDLKEPMFEWLKLYYP  76

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
               GR+ RS   + +I+CND G+R++EA+   SVDEW+   D D    L + + +  D  F
Sbjct  77    TSGRIRRSESGRPMIRCNDGGVRIVEAQCDKSVDEWMAMEDHDIHNCLTYDQVLGPDLAF  136

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
                 ++QLT F+ G +S+GLS  H+L D +SA+ FI  W  +
Sbjct  137   SPLVFIQLTWFKCGAMSVGLSWAHVLGDVVSASDFINMWGSI  178



>ref|XP_003570002.1| PREDICTED: uncharacterized protein LOC100841639 [Brachypodium 
distachyon]
Length=365

 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 93/170 (55%), Gaps = 13/170 (8%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVL-----DRVMENNFVRIVFYYR--EFDKDYTK---LNESIA  1303
             +T + T VV+P +   + V      +  ++  F R V YYR  E   ++ +   + ES+ 
Sbjct  15    QTGLPTRVVEPDRTRLIAVAAPPLPEAALQRRF-RAVLYYRGGEQKAEWEEGVWVKESLG  73

Query  1302  ETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDR-DKELKLVHW  1126
             E L  Y  + GRL R     W +K NDAG+R  +A  + +++++L + DR  KE  L  W
Sbjct  74    EVLCFYPEMAGRLRRRGDGSWEVKLNDAGVRFQQATVEATMEDFLADKDRVRKESALAPW  133

Query  1125  -EPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
              +    DP   S  ++QL  F++GG ++G+SCT LLADP++   F+ AWA
Sbjct  134   IDVTAEDPDMCSLLFMQLNRFQDGGYAVGVSCTTLLADPLALARFLLAWA  183



>ref|XP_010060100.1| PREDICTED: protein ECERIFERUM 1-like [Eucalyptus grandis]
 gb|KCW66641.1| hypothetical protein EUGRSUZ_F00422 [Eucalyptus grandis]
Length=458

 Score = 90.5 bits (223),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 90/175 (51%), Gaps = 23/175 (13%)
 Frame = -2

Query  1443  VSTNVVQPGKFCP------LTVLDRVMENNFVRIVFYYRE--------FDKDYTKLNESI  1306
             V  + V PGK  P      LT +D  M+ +++R ++++R         FD     L + +
Sbjct  13    VKLSSVVPGKVTPNNTVHELTSMDLAMKLHYLRGLYFFRSDAAQGLTNFD-----LKKPM  67

Query  1305  AETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK--ELK--  1138
             A  L  Y    GR+  S  E+ +IKCND+G+R++EA+   S+DEWL     D   EL+  
Sbjct  68    AYWLELYPTASGRIRWSETERPVIKCNDSGIRIVEAQCDRSLDEWLAATKEDGGWELQDL  127

Query  1137  LVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
             LVH E +     F    YVQ T F  GG+ +GL+  H+L D  +A+ FI  W  M
Sbjct  128   LVHSEVLGPALGFSPMIYVQFTWFACGGICVGLNWAHVLGDAFAASSFINVWGQM  182



>ref|XP_009412065.1| PREDICTED: protein ECERIFERUM 26-like [Musa acuminata subsp. 
malaccensis]
Length=433

 Score = 90.5 bits (223),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 88/169 (52%), Gaps = 16/169 (9%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK----DYTKLNESIAETLNAYT  1282
             TVV  +V        L  +D VM+ ++VR V+Y+ + +         + + +   LN+Y 
Sbjct  17    TVVPGSVSGEAVVHELADVDLVMKLHYVRTVYYFEQHETIDGLTIVDIKKPMFPWLNSYF  76

Query  1281  IIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDP-  1105
              + GR+ R+   + LIKCND G+R++EAK   +++EWL      +      W P++ D  
Sbjct  77    PVTGRIRRTEAGRPLIKCNDCGVRIVEAKCCRTLEEWLRVPHSAR------WRPLVPDKV  130

Query  1104  -----YFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
                  +F    YVQ T+F+ GG ++G S +H+L DP++ T  I  W  +
Sbjct  131   LGPELHFSPMVYVQFTKFKCGGTAIGYSWSHVLGDPVTGTNCINLWGRL  179



>emb|CBI19276.3| unnamed protein product [Vitis vinifera]
Length=471

 Score = 90.5 bits (223),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 88/162 (54%), Gaps = 3/162 (2%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKD---YTKLNESIAETLNAYTI  1279
             +VV   V    K   L+ +D  M+ ++++ V+++R    +    + L E + E L  Y  
Sbjct  17    SVVPATVTGEDKVHGLSNMDLAMKLHYLKGVYFFRREAVEGLTISDLKEPMFEWLKLYYP  76

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
               GR+ RS   + +I+CND G+R++EA+   SVDEW+   D D    L + + +  D  F
Sbjct  77    TSGRIRRSESGRPMIRCNDGGVRIVEAQCDKSVDEWMAMEDHDIHNCLTYDQVLGPDLAF  136

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
                 ++QLT F+ G +S+GLS  H+L D +SA+ FI  W  +
Sbjct  137   SPLVFIQLTWFKCGAMSVGLSWAHVLGDVVSASDFINMWGSI  178



>gb|AAM65391.1| fatty acid elongase-like protein (cer2-like) [Arabidopsis thaliana]
Length=420

 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 81/153 (53%), Gaps = 4/153 (3%)
 Frame = -2

Query  1401  TVLDRVMENNFVRIVFYYR-EFDKDYTKLN--ESIAETLNAYTIIMGRLLRSPGEQWLIK  1231
             T LD  M+ ++++ V+ Y  E  +D T ++    +    +    I+GR  R    +  +K
Sbjct  35    TGLDLAMKLHYLKTVYIYSAETARDLTVMDVKGPLFSVFDQNPCIIGRFRRHESGRPYLK  94

Query  1230  CNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGL  1051
             CND G R +E     +V+EWL   DR  +  LV+ +P+  D  F    Y+Q+T F  GGL
Sbjct  95    CNDCGTRFVERHCDLTVEEWLRVPDRSVDESLVYHQPVGPDLAFSPLLYIQMTRFSCGGL  154

Query  1050  SLGLSCTHLLADPISATMFIKAWADMSFTGKMI  952
             +LGLS  H++ DP S + F   WA  +F G+ I
Sbjct  155   ALGLSWAHIMGDPFSLSHFFNLWA-QAFAGENI  186



>gb|KHG00208.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
-like protein [Gossypium arboreum]
Length=429

 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 88/169 (52%), Gaps = 5/169 (3%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKD---YTKLNESIAETLNAYTI  1279
             +VV        K   LT +D  M+ ++++ V++++           L E + + L  Y  
Sbjct  17    SVVPAKATGGNKDLELTNMDLAMKLHYIKGVYFFQPEAAQGLSIHDLKEPMFQCLELYYA  76

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
               GR+ RS   +  IKCND G+R++EA+   SVDEWL  + R+ +  L H + +  D  F
Sbjct  77    ASGRIRRSESGRPFIKCNDGGVRIVEAQCDKSVDEWLA-MARNNDHMLGHDQVLGPDLGF  135

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMI  952
                 +VQ T F+ GG+S+GLS  H+L D  SA+ F+  W  +   GK +
Sbjct  136   SPLVFVQFTRFKCGGVSVGLSWAHVLGDAFSASNFLNLWGQI-MAGKQV  183



>ref|XP_009389695.1| PREDICTED: vinorine synthase-like [Musa acuminata subsp. malaccensis]
Length=353

 Score = 88.6 bits (218),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 87/142 (61%), Gaps = 8/142 (6%)
 Frame = -2

Query  1386  VMENNFVRIVFYYREFDKDYTKL----NESIAETLNAYTIIMGRLLRSPGEQWLIKCNDA  1219
             V+++ F  + +Y +  ++    +     ES+   L  + ++ GRL R  G  W +K ND+
Sbjct  43    VLQSRFQAVWYYTKAGEESPLAIAAWIKESLCAALPGHPVLSGRLRRDDG--WEVKFNDS  100

Query  1218  GLRVIEAKAKGSVDEWLHNVDRDK-ELKLVHWEPM-MSDPYFWSPFYVQLTEFEEGGLSL  1045
             G+R+++A A+ ++ E+L + DR+  E  L +W+ + +  P F + FY+Q+T+F+  G ++
Sbjct  101   GVRLVQATAETTMSEFLASKDRNGMEAHLAYWDDVDVQSPNFSALFYIQVTQFQGDGYAI  160

Query  1044  GLSCTHLLADPISATMFIKAWA  979
             G+SC+ LLADP+  T F+ +WA
Sbjct  161   GISCSLLLADPLFLTRFLNSWA  182



>ref|XP_009397930.1| PREDICTED: uncharacterized protein LOC103982667 [Musa acuminata 
subsp. malaccensis]
Length=355

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 78/117 (67%), Gaps = 4/117 (3%)
 Frame = -2

Query  1320  LNESIAETLNAYTIIMGRLLRSPGEQ--WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRD-  1150
             + ES++  L ++ ++ GRL R    +  W IK ND G+R+++A A+ ++ E+L + DRD 
Sbjct  72    MKESLSAVLLSHPVMAGRLRRDDEGRGCWEIKFNDCGVRLLQATAEVTLSEFLCSEDRDE  131

Query  1149  KELKLVHWEPMMSDPYFWSP-FYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAW  982
             +E KL +WE + +D   +SP F++Q+T+F+  G S+G+SC+ LLADP     F+K+W
Sbjct  132   REAKLAYWEDVNADNPNYSPLFFIQVTQFQGDGYSIGISCSLLLADPFVLARFLKSW  188



>ref|NP_566741.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 sp|Q9LIS1.1|CR26L_ARATH RecName: Full=Protein ECERIFERUM 26-like; Short=CER26-like; AltName: 
Full=CER2-like protein 2; Short=CER2-like2 [Arabidopsis 
thaliana]
 dbj|BAB03002.1| fatty acid elongase-like protein [Arabidopsis thaliana]
 gb|ABH04587.1| At3g23840 [Arabidopsis thaliana]
 gb|AEE76821.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=420

 Score = 89.0 bits (219),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 79/152 (52%), Gaps = 3/152 (2%)
 Frame = -2

Query  1401  TVLDRVMENNFVRIVFYYRE-FDKDYTKLNESIAETLNAYTI--IMGRLLRSPGEQWLIK  1231
             T LD  M+ ++++ V+ Y     +D T ++         Y I  I+GR  R    +  +K
Sbjct  35    TGLDLAMKLHYLKAVYIYSAGTARDLTVMDVKAPLFSVFYQIPCIIGRFRRHESGRPYLK  94

Query  1230  CNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGL  1051
             CND G R +E+    +V+EWL   DR  +  LV+ +P+  D  F    Y+Q+T F  GGL
Sbjct  95    CNDCGTRFVESHCDLTVEEWLRVPDRSVDESLVYHQPVGPDLAFSPLLYIQMTRFSCGGL  154

Query  1050  SLGLSCTHLLADPISATMFIKAWADMSFTGKM  955
             +LGLS  H++ DP S + F   WA     GK+
Sbjct  155   ALGLSWAHIMGDPFSLSHFFNLWAQAFAGGKI  186



>ref|XP_007153617.1| hypothetical protein PHAVU_003G050600g [Phaseolus vulgaris]
 gb|ESW25611.1| hypothetical protein PHAVU_003G050600g [Phaseolus vulgaris]
Length=434

 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 132/295 (45%), Gaps = 16/295 (5%)
 Frame = -2

Query  1401  TVLDRVMENNFVRIVFYYR-EFDKDYT--KLNESIAETLNAYTIIMGRLLRSPGEQWLIK  1231
               +D  M+ +++R+VF++  E  +D T  K+ +++    N Y I  GR  RS   +  IK
Sbjct  31    AAMDLAMKLHYLRVVFFFHSEAAQDLTIMKIKDAMFTWFNYYFITCGRFRRSDSGRPFIK  90

Query  1230  CNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGL  1051
             CND G R IEA    ++DEWL   D      L   + +  +  F  P  +Q+ +F+ GG+
Sbjct  91    CNDCGARFIEANCSKTLDEWLATKDCSLNKLLSSNQVIGPELSFSPPVLLQIVKFKCGGI  150

Query  1050  SLGLSCTHLLADPISATMFIKAWADM--SFTGKMISpphfhplpprrpcnnnhnphhNSS  877
             SLGLS  H+L D   A+ FI +W  +  +   KM+S        P +             
Sbjct  151   SLGLSWAHILGDIFIASEFINSWGQIMNNLGLKMVSNIPRSVPEPGQSGPEKDPISAKPI  210

Query  876   GDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMSMAQTPDAFDALAGLLW  697
               + +H+  P     D     T S    +  L +    +    S+ QTP AF++L  ++W
Sbjct  211   DPVGDHWIVPNNKKMD-----TFSFHLTSSQLNYLQAQIWG-PSLDQTP-AFESLCAMIW  263

Query  696   TRISKAKNNVGLMDLAV-GLDVRKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDL  535
               +++ +       + V   D  K    +K   GN  V  KV+  S S ++  DL
Sbjct  264   RCVARVRAKPEPKTVTVCRFDPNKK---NKDIIGNNQVICKVEGGSESCIVDMDL  315



>gb|KFK24737.1| hypothetical protein AALP_AA8G018000 [Arabis alpina]
Length=339

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 87/167 (52%), Gaps = 14/167 (8%)
 Frame = -2

Query  1431  VVQPGKFCPLTVLDRVMENNFVR---IVFYYREFDKDYTKL-----NESIAETLNAYTII  1276
             + Q  +  P+TV D +    F R   IV YY++   D   L      ES+   L    ++
Sbjct  5     ITQHREVRPITVKDPIGVGIFRRTLNIVTYYKQAGDDSGWLAAGWIKESLGSALTEQPML  64

Query  1275  MGRLLR--SPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK---ELKLVHWEPM-M  1114
              GRL R  +      +  ND+G+R++EAK   S  E+L  V RDK   E + V W+ +  
Sbjct  65    AGRLRRRRTVDGGLEVVANDSGVRLVEAKFPASFLEFLEMVKRDKSRVEAETVFWKDIDE  124

Query  1113  SDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              DP F   FYVQ+T FE GG S+G+SC+ L+AD I  T F+  WA +
Sbjct  125   VDPQFSPLFYVQVTNFESGGYSIGISCSILIADIILGTDFLTKWAQL  171



>ref|XP_002990807.1| BAHD family acyltransferase, clade I [Selaginella moellendorffii]
 gb|EFJ08080.1| BAHD family acyltransferase, clade I [Selaginella moellendorffii]
Length=477

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 95/348 (27%), Positives = 152/348 (44%), Gaps = 38/348 (11%)
 Frame = -2

Query  1407  PLTVLDRVMEN--NFVRIVFYYRE------FDKDYTKLNESIAETLNAYTIIMGRLLRSP  1252
             PLT LD +  N     RI+FY  +      +D    KL  S+AETL  +  + GR     
Sbjct  27    PLTSLDFLNRNVACMQRILFYSLDLDSLDNYDSFVDKLKGSLAETLVRFYPLAGRFTDGE  86

Query  1251  GEQWLIKCNDAGLRVIEAKA-KGSVDEWL---HNVDRDKELKLVHWEPMMSDPYFWSPFY  1084
              E+  I CNDAG+  IEA   + S+ ++L   H +D   EL  V    +   P+  +P  
Sbjct  87    SEKPRINCNDAGVPFIEAAMLRKSLGDFLASPHCMDLCSELAHVESSELADAPHI-APVS  145

Query  1083  VQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplpprrpcnn  904
             VQ+T F+ GGL++G+S  H L D  S   F+K+W++++  G+ IS P  H          
Sbjct  146   VQVTRFKSGGLAVGVSYNHFLIDGYSFWHFMKSWSEVA-CGQSISLPPVHSREILISQPP  204

Query  903   nhnphhNSSGDLMNHYKKPTTDDGDKPPSQTS-SDRPKTISLLFTDEMVRACMSMA----  739
                        L  ++  P T   + P   ++   R  + S  F   +    M+ +    
Sbjct  205   VTYM-----SSLPRYFAIPATASMEAPVGFSNIQQRMYSFSAQFIRRLKLQAMAGSNGDI  259

Query  738   QTPDAFDALAGLLWTRISKAKNNVGLMD-----LAVGLDVRK--VLGLDKGFYGN--CMV  586
             Q   +F  L   +W  + +A+   GL +       VG+DVRK  V  L  G++GN  C V
Sbjct  260   QQVSSFRVLCAHIWRCLVRAR---GLEESEETRFFVGVDVRKRLVPCLPDGYFGNAVCAV  316

Query  585   YNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNN  442
             Y + +  +G ++  +   +     +           I  L+EW D+  
Sbjct  317   YAESR--AGELLSPEKGTAHGVRILSQAIAGATDGNIKSLLEWCDKQG  362



>ref|XP_009138132.1| PREDICTED: protein ECERIFERUM 1 [Brassica rapa]
Length=417

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 101/174 (58%), Gaps = 13/174 (7%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYTKLN-ESIAETL---NAYT  1282
             +VV  ++    K   LT +D  ++ ++VR V++++   +D+T +  ++I   L     Y 
Sbjct  13    SVVPASMTGENKPRHLTAMDLAVKLHYVRAVYFFKG-TRDFTIVELKNITFPLLDLQCYD  71

Query  1281  IIMGRLL----RSPGEQWL--IKCNDAGLRVIEAKAKG-SVDEWLHNVDRDKELKLVHWE  1123
              + GR+       P  Q +  I+CND+G+R++EAK +G +V EWL   DR  + + + ++
Sbjct  72    HVTGRIRILNNNDPSAQAIPYIRCNDSGMRIVEAKVEGFTVQEWLDLDDRSIDHRFLVYD  131

Query  1122  PMMSDPYFWSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFT  964
              ++    F+SP  Y+Q+T+F+ GGLSLGLS  H+L D +SA+ F+K    +  T
Sbjct  132   HVLGPDLFYSPLVYLQITQFKCGGLSLGLSWAHVLGDVVSASTFMKTMGQLMST  185



>ref|XP_002514050.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF48633.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=436

 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 92/378 (24%), Positives = 160/378 (42%), Gaps = 73/378 (19%)
 Frame = -2

Query  1404  LTVLDRVMENNFVRIVFYYR-EFDKDYTK--LNESIAETLNAYTIIMGRLLRSPGEQWLI  1234
             LT +D  ++ ++++ V+++  E  +  T   L   +   L+ Y    GR+ RS   +  I
Sbjct  33    LTNMDLALKLHYIKGVYFFAAEAVQGLTTSDLKRPMFPCLSLYYTASGRIRRSETGRPFI  92

Query  1233  KCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGG  1054
             KCND+G+R++EA    +++EW+   +      L H + +  D  F    Y+Q T F+ GG
Sbjct  93    KCNDSGVRIVEAFCDRTIEEWMATDNDLDSFLLAHDQVLGPDLGFTPLVYIQFTWFKCGG  152

Query  1053  LSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSG  874
             LS+GLS  H+L DP SA+ FI  WA   FT   +                          
Sbjct  153   LSVGLSWAHVLGDPFSASNFINNWAQ--FTQGHVP-------------------------  185

Query  873   DLMNHYKKPTTDDGDKPPS-------------------QTSSDRPKTISLLFTDEMVRAC  751
                     P T++ + PPS                    T++ + +T S +FT + +   
Sbjct  186   --CKSLHVPNTNEPECPPSIPREPFSLKRVDPVGDYWLTTNNCKMETYSFVFTAKQLDTI  243

Query  750   MSMAQTPD--------AFDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVLGLDKGFYGN  595
             +S +   D         F+ ++ ++W  +SK + + G       +  RK    +     N
Sbjct  244   LSESAISDLFQSSKISHFEVISAIIWKLLSKIREDSG--PRIATICTRKSRNHENEVSSN  301

Query  594   CMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDK---EGIMDLIEWLDQNNCCASNV  424
              MV++ V+        G D L+    A+   ++E +    EGIM+  +  DQ+N  A   
Sbjct  302   KMVFSTVRADFSVAKGGVDELA----ALIAEKQEGENRWIEGIMECDKGDDQSNYIAYGA  357

Query  423   LDGCDSLVCVNLEGVDPY  370
                  +L  VN+E  + Y
Sbjct  358   -----NLTFVNMEEANIY  370



>gb|KDP39334.1| hypothetical protein JCGZ_01091 [Jatropha curcas]
Length=438

 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 79/138 (57%), Gaps = 3/138 (2%)
 Frame = -2

Query  1395  LDRVMENNFVRIVFYY-REFDKDYTK--LNESIAETLNAYTIIMGRLLRSPGEQWLIKCN  1225
             +D  M+ ++++ V+++  E  +  T   L ES+   LN Y I  GR  R+   +  +KCN
Sbjct  35    IDLAMKLHYLKSVYFFCSEACQGLTISCLKESMFYWLNDYYITCGRFRRNDAGRPYLKCN  94

Query  1224  DAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSL  1045
             D G+R+IEA+   S+DEWL   D      LV+  P+  +  F  P Y Q T+F+ GGLS 
Sbjct  95    DCGIRMIEAECDTSLDEWLELKDSSLNDMLVYHLPIGPELSFSPPVYFQATKFKCGGLSF  154

Query  1044  GLSCTHLLADPISATMFI  991
             GLS  H+L DP SA+ ++
Sbjct  155   GLSWAHILGDPFSASYYM  172



>gb|AAM61705.1| unknown [Arabidopsis thaliana]
Length=353

 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 94/178 (53%), Gaps = 18/178 (10%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVMENNFVR---IVFYYREFDKDYTK--------LNESI  1306
             +TV+   V Q  +   ++V+D V    F R   IV YY+E      +        + ES+
Sbjct  14    QTVMPVEVTQHREIRSVSVVDPVGVGIFRRTVNIVTYYKEAGDSGGERGWLVAGWIKESL  73

Query  1305  AETLNAYTIIMGRLLR--SPGEQWL-IKCNDAGLRVIEAKAKGSVDEWLHNVDRDK---E  1144
                L    ++ GRL R  + G+  L +  ND+G+R++EAK   S+ E+L    RDK   E
Sbjct  74    GRALTEQPMLSGRLRRRKTAGKDGLELVANDSGVRMVEAKFPASLPEFLEMAKRDKSRAE  133

Query  1143  LKLVHWEPMMSDPYFWSP-FYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              + V W+ +  D   +SP FYVQ+T FE GG S+G+SC+ L+AD    T F+  WA +
Sbjct  134   AETVFWKDIDEDEPQYSPLFYVQVTNFESGGYSIGISCSILIADLFLETGFLTKWAQI  191



>ref|XP_009785032.1| PREDICTED: protein ECERIFERUM 26-like [Nicotiana sylvestris]
Length=431

 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 102/383 (27%), Positives = 167/383 (44%), Gaps = 30/383 (8%)
 Frame = -2

Query  1494  STMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYT--  1324
             S+ SE  +   I   +V   NV         + +D  M+ +++R ++Y+  +  +D T  
Sbjct  3     SSKSEAGLIYNIKFSSVGPANVTGQDVVYEPSNIDVAMKLHYLRGIYYFNSQAFQDVTIY  62

Query  1323  KLNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKE  1144
             ++ E I    N + +  GR  R+   +  IKCND G R IEA+   +++EWL   D   E
Sbjct  63    QVKEPIFLCFNHFYMTAGRFRRAESGRPYIKCNDCGARFIEAQCDKTLEEWLEMKDASLE  122

Query  1143  LKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFT  964
               LV  + +  +  F  P  +Q T+F+ GG+SLGLS  H+L D  SAT FI      +F 
Sbjct  123   KLLVSNQVLGPELAFSPPILIQQTKFKCGGVSLGLSWAHVLGDVFSATEFI------NFL  176

Query  963   GKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPS----QTSSDRP  796
             GK++        P R     +     NS+  L    + P +     P        +S + 
Sbjct  177   GKVV----VGYQPARPNNLAHSLTKANSTQTLQKIVEDPLSIKRVGPVEDHWIANNSCKM  232

Query  795   KTISLLFTDEMVRACMSMAQTPDAFDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVLGL  616
             ++ S+  T   +    S  +    F++L  ++W  ISK ++     +  V    +K    
Sbjct  233   ESFSIQVTASKLSQIQSRTEIKGPFESLCAIIWQSISKIRDG---PEPKVVTICKKSEEK  289

Query  615   DKGFYGNCMVYNKVKW-SSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNC  439
              +G  GN  V   VK   S       +L     N I + R ++D E I        +N+ 
Sbjct  290   KEGLVGNNQVIGVVKVDHSIREANPSELARLIKNDIIDERLKID-ESI--------ENDH  340

Query  438   CASNVLDGCDSLVCVNLEGVDPY  370
               S+V+    +L  VN+EG D Y
Sbjct  341   GVSDVVVYGANLTFVNMEGADLY  363



>ref|XP_010433760.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=418

 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 98/172 (57%), Gaps = 15/172 (9%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYT--KLNESIAETLNAYTII  1276
             +VV  +VV   K  PLT +D  M+ ++VR V Y+ +  +D+T   L  ++   L +Y  +
Sbjct  13    SVVPASVVGENKPRPLTPMDLAMKLHYVRAV-YFLKGKRDFTVSDLKTTMFTLLQSYHHV  71

Query  1275  MGRLLRSPGEQ---------WLIKCNDAGLRVIEAKAKG-SVDEWLHNVDRDKELKLVHW  1126
              GR+ R P              I+CND+G+R++EA  +  +V++WL   DR  + + + +
Sbjct  72    SGRI-RMPENDNDPSSGLALPYIRCNDSGIRIVEANVEEFTVEKWLDLEDRSIDHRFLVY  130

Query  1125  EPMMSDPYFWSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
             + ++    F+SP  ++Q+T+F+ GG S+GLS TH+L D  SA+ F+K    +
Sbjct  131   DHVLGPDLFFSPLVFLQITQFKCGGFSIGLSWTHVLGDVFSASTFMKTLGQL  182



>ref|XP_010439020.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=418

 Score = 87.8 bits (216),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 98/171 (57%), Gaps = 14/171 (8%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYT--KLNESIAETLNAYTII  1276
             +VV  +VV   K  PLT +D  M+ ++VR V Y+ +  +D+T   L  ++   L +Y  +
Sbjct  13    SVVPASVVGENKPRPLTPMDLAMKLHYVRAV-YFLKGKRDFTVSDLKTTMFTLLQSYHHV  71

Query  1275  MGRLLRSPGEQ--------WLIKCNDAGLRVIEAKAKG-SVDEWLHNVDRDKELKLVHWE  1123
              GR+ R P             I+CND+G+R++EA  +  +V++WL   DR  + + + ++
Sbjct  72    SGRI-RMPENDNDPSGLALPYIRCNDSGIRIVEANVEEFTVEKWLDLEDRTIDHRFLVYD  130

Query  1122  PMMSDPYFWSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              ++    F+SP  ++Q+T+F+ GG S+GLS TH+L D  SA+ F+K    +
Sbjct  131   HVLGPDLFFSPLVFLQITQFKCGGFSIGLSWTHVLGDVFSASTFMKTLGQL  181



>ref|NP_195909.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 emb|CAB86043.1| putative protein [Arabidopsis thaliana]
 gb|AAO00899.1| putative protein [Arabidopsis thaliana]
 gb|AAQ56813.1| At5g02890 [Arabidopsis thaliana]
 gb|AED90532.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=353

 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 93/178 (52%), Gaps = 18/178 (10%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVMENNFVR---IVFYYREFDKDYTK--------LNESI  1306
             +TV+   V Q  +   ++V+D V    F R   IV YY+E      +        + ES+
Sbjct  14    QTVMPVEVTQHREIRSVSVVDPVGVGIFRRTVNIVTYYKEAGDSGGERGWLVAGWIKESL  73

Query  1305  AETLNAYTIIMGRLLR--SPGEQWL-IKCNDAGLRVIEAKAKGSVDEWLHNVDRDK---E  1144
                L    ++ GRL R  + G   L +  ND+G+R++EAK   S+ E+L    RDK   E
Sbjct  74    GRALTEQPMLSGRLRRRKTAGNDGLELVANDSGVRMVEAKFPASLPEFLEMAKRDKSRAE  133

Query  1143  LKLVHWEPMMSDPYFWSP-FYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              + V W+ +  D   +SP FYVQ+T FE GG S+G+SC+ L+AD    T F+  WA +
Sbjct  134   AETVFWKDIDEDEPQYSPLFYVQVTNFESGGYSIGISCSILIADLFLETGFLTKWAQI  191



>ref|XP_006288039.1| hypothetical protein CARUB_v10001270mg [Capsella rubella]
 gb|EOA20937.1| hypothetical protein CARUB_v10001270mg [Capsella rubella]
Length=357

 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 93/180 (52%), Gaps = 20/180 (11%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVMENNFVR---IVFYYREFDKDYTK--------LNESI  1306
             ++V+   V Q  K   ++V D V    F R   IV YY+E      +        + ES+
Sbjct  14    QSVMPVEVTQHRKVRSISVGDAVGAGIFRRTLNIVTYYKEAGDVSGERAWLVAGWIKESL  73

Query  1305  AETLNAYTIIMGRLLRSPGEQ-----WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK--  1147
                L    ++ GRL R   E      + +  ND+G+R++EA+   S+ E+L  V R+K  
Sbjct  74    GRALTEQPMLSGRLRRRKTESESEDGFEVVANDSGVRLLEAQFPASLSEFLEMVKREKSR  133

Query  1146  -ELKLVHWEPMMSDPYFWSP-FYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              E + V W+ +  D   +SP FYVQ+T FE GG S+G+SC+ LLAD +  T F+  WA +
Sbjct  134   AEAETVFWKDIDEDEPQYSPLFYVQVTNFESGGYSIGISCSILLADLLLETDFLSKWAQI  193



>ref|XP_010532758.1| PREDICTED: protein ECERIFERUM 26-like [Tarenaya hassleriana]
Length=440

 Score = 87.4 bits (215),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 78/153 (51%), Gaps = 4/153 (3%)
 Frame = -2

Query  1401  TVLDRVMENNFVRIVFYYRE---FDKDYTKLNESIAETLNAYTIIMGRLLRSPGEQWLIK  1231
             T LD  M+ +++++ + +      + D T + E +       +   GR  R    +  IK
Sbjct  35    TGLDLAMKLHYLKVAYIFSAETAGEIDVTSVKEGMFVLFEQISWTTGRFRRHLSGRPYIK  94

Query  1230  CNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGL  1051
             CND G R +EA    +V+EWL   DR  +  LV  +P+  +  F    YVQ+T F+ GGL
Sbjct  95    CNDCGARFVEAHCDFTVEEWLSEPDRSDDELLVFHKPVGPELAFSPLIYVQMTRFKCGGL  154

Query  1050  SLGLSCTHLLADPISATMFIKAWADMSFTGKMI  952
             SLGLS  H+L DP S +  I  WA  +F G  I
Sbjct  155   SLGLSWAHVLGDPFSLSYTINQWA-QTFVGDKI  186



>ref|XP_010490761.1| PREDICTED: uncharacterized protein LOC104768462 [Camelina sativa]
Length=354

 Score = 85.9 bits (211),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 95/178 (53%), Gaps = 18/178 (10%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVMENNFVR---IVFYYREF-DKDYTK-------LNESI  1306
             ++V+   V Q  K   ++V D V    F R   IV YY+E  D    K       + ES+
Sbjct  14    QSVMPVEVTQHRKVRFISVGDAVGAGIFRRTLNIVTYYKEASDVSGEKAWLVAGWIKESL  73

Query  1305  AETLNAYTIIMGRLLR---SPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK---E  1144
                L    ++ GRL R   +P + + +  ND+G+R++EA+   S+ E+L  V RDK   E
Sbjct  74    GRALAEQPMLSGRLRRRKTAPEDGFEVVPNDSGVRLLEAQFPASLPEFLEMVKRDKSRAE  133

Query  1143  LKLVHWEPMMSDPYFWSP-FYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              + V W+ +  D   +SP FYVQ+T FE GG S+G+SC+ LLAD +  T F+  W  +
Sbjct  134   AETVFWKDIDEDEPQYSPLFYVQVTNFESGGYSVGISCSILLADLLLETDFLTKWVQI  191



>ref|XP_010086662.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB22549.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=456

 Score = 87.0 bits (214),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 102/198 (52%), Gaps = 29/198 (15%)
 Frame = -2

Query  1488  MSEDNISSTICKRTVVSTNVVQPGKF-------CPLTVLDRVMENNFVRIVFYYREFDK-  1333
             +S DN+ + I   T V  + V PG+          LT +D  ++ ++++ V++++     
Sbjct  2     VSPDNVGTPI---TGVRISTVVPGRVRGDASEDHELTNMDLALKLHYIKGVYFFKSTSSA  58

Query  1332  DYTKLNESIAET-------LNAYTIIMGRLLRSPGE--QWLIKCNDAGLRVIEAKAKGSV  1180
             D+ +L  S+AE        L+ + +  GR+ RS G   +  IKCNDAG+R++EA  + ++
Sbjct  59    DHDQLVLSVAEMKKPMFPLLDQFFVTAGRIRRSDGAAGRPYIKCNDAGVRIVEAFCEKTI  118

Query  1179  DEWLHNVD---------RDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTH  1027
             DEWL   D         ++    L +   +  D  F    Y Q T F+ GGLS+GLS  H
Sbjct  119   DEWLAMADEFGTTSNNCKNFNQGLCYDHVLGPDLGFSPLVYFQFTWFKCGGLSVGLSWAH  178

Query  1026  LLADPISATMFIKAWADM  973
             LL D +SA+ FI  WA +
Sbjct  179   LLGDVLSASAFINTWAKI  196



>ref|XP_006413420.1| hypothetical protein EUTSA_v10025274mg [Eutrema salsugineum]
 gb|ESQ54873.1| hypothetical protein EUTSA_v10025274mg [Eutrema salsugineum]
Length=427

 Score = 86.7 bits (213),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 94/171 (55%), Gaps = 13/171 (8%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY---REFDKDYTKLNESIAETLNAYTI  1279
             +VV  +V    K   LT +D  M+ ++VR V+++   R+F     K N      L  Y  
Sbjct  13    SVVPASVTGENKPRHLTAMDLAMKLHYVRAVYFFKGTRDFTLTDLKDNMFPLLQLQCYGH  72

Query  1278  IMGRLLRSPGEQW------LIKCNDAGLRVIEAKAKG-SVDEWLHNVDRDKELKLVHWEP  1120
             + GR+ R P           I+CND+G RV+EAK  G +V+EWL   DR  + + + ++ 
Sbjct  73    VAGRI-RMPDNDSSAPALPFIRCNDSGTRVVEAKVDGFTVEEWLDLEDRSIDHQYLVYDH  131

Query  1119  MMSDP-YFWSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
             ++ DP   +SP  ++Q+T+F+ GG S+GLS  H+L D +SA+ F+K    +
Sbjct  132   VLGDPDLIFSPLVFLQITQFKCGGFSIGLSWAHVLGDVLSASTFMKTMGQL  182



>gb|ACF37072.1| hydroxycinnamoyl CoA quinate transferase 1 [Cynara cardunculus 
var. scolymus]
 emb|CAM84302.2| hydroxycinnamoyl CoA quinate transferase [Cynara cardunculus 
var. scolymus]
Length=449

 Score = 86.7 bits (213),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 90/370 (24%), Positives = 158/370 (43%), Gaps = 33/370 (9%)
 Frame = -2

Query  1497  RSTMSEDNISSTICKRTVVSTNVVQPGKFCPLTV-----LDRVMENNFVRIVFYYRE---  1342
             ++T++  N    +    +  ++ VQP +  P +      LD V+    +  V++YR    
Sbjct  5     QATIAVPNEHHKLMNINIKHSSFVQPSQPTPSSTIWTSNLDLVVGRIHILTVYFYRPNGA  64

Query  1341  ---FDKDYTKLNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEW  1171
                FD D  K  +++A+ L ++  + GR+ R    +  I CN  G+  +EA++  ++D++
Sbjct  65    SNFFDADVMK--KALADVLVSFYPMAGRISRDQNGRLEINCNGEGVLFVEAESDSTLDDF  122

Query  1170  LHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFI  991
                    +  +L        D   +  F+ Q+T F+ GG++LG    H LAD +S+  FI
Sbjct  123   GEFTPSPELRRLTPTVDYSGDISSYPLFFAQVTHFKCGGVALGCGVFHTLADGLSSIHFI  182

Query  990   KAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQT  811
               W+DM+  G  I+       P               + D + ++  P+     + P   
Sbjct  183   NTWSDMA-RGLSIA-----IPPFIDRTLLRAREPPTPTFDHIEYHAPPSMKTISQNPE--  234

Query  810   SSDRPKTISLLFTDEMVRACMSMAQ------TPDAFDALAGLLWTRISKAKN--NVGLMD  655
             SS +P T  L  T + +    + A+      T   ++ LA  LW    KA+   +  L  
Sbjct  235   SSRKPSTTVLKLTLDQLNVLKASAKNDGSNTTYSTYEILAAHLWRCACKARGLPDDQLTK  294

Query  654   LAVGLDVRKVLG--LDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKE  481
             L V  D R  L   L  G+ GN +        SG +      LS AA+ IR    +MD  
Sbjct  295   LYVATDGRSRLSPQLPPGYLGNVVFTTTPVAKSGDLTTQS--LSNAASLIRTTLTKMDNN  352

Query  480   GIMDLIEWLD  451
              +   I++L+
Sbjct  353   YLRSAIDYLE  362



>ref|XP_009125468.1| PREDICTED: uncharacterized protein LOC103850465 [Brassica rapa]
Length=360

 Score = 85.5 bits (210),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 100/195 (51%), Gaps = 22/195 (11%)
 Frame = -2

Query  1500  IRSTMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVR---IVFYYREFDKD  1330
             + +T+S+  I+     ++V+   V Q  +  P++V D V    F R   IV YY++    
Sbjct  1     METTVSKSMIAGV---QSVMPVEVTQHREVRPISVGDPVGAGIFRRTLNIVTYYKDAGAS  57

Query  1329  YTK-------LNESIAETLNAYTIIMGRLLR---SPGEQ--WLIKCNDAGLRVIEAKAKG  1186
               +       + ES+   L    ++ GRL R   + GE+    +  ND+G+R++EA    
Sbjct  58    GERGWLVAGWIKESLGRALTEQPMLCGRLRRRRTTKGEEDGLEVVANDSGVRMVEAIFPA  117

Query  1185  SVDEWLHNVDRDK---ELKLVHWEPM-MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLA  1018
             S+ E+   V RDK   E + V W  +   DP F   FYVQ+T FE GG S+G+SC+ L+A
Sbjct  118   SLPEFFEMVKRDKSRAEAETVFWRDIDEVDPQFCPLFYVQVTNFESGGYSIGISCSILIA  177

Query  1017  DPISATMFIKAWADM  973
             D +  T F+  WA +
Sbjct  178   DLLLETNFLTKWAKI  192



>ref|XP_004297015.1| PREDICTED: anthranilate N-benzoyltransferase protein 2-like [Fragaria 
vesca subsp. vesca]
Length=428

 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 99/415 (24%), Positives = 181/415 (44%), Gaps = 54/415 (13%)
 Frame = -2

Query  1395  LDRVMENNFVRIVFYYREFDKD---YTKLNESIAETLNAYTIIMGRLLRSPGE-QWLIKC  1228
             +D  M+ +++R V+++     +     K+ E+I   L  +  ++GR  RS    +  +KC
Sbjct  35    MDLAMKLHYLRGVYFFSSEAAEGLSVLKIKETIFVWLIEHWRVLGRFRRSESSGRPFVKC  94

Query  1227  NDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLS  1048
             ND G R IEA++  +++EWL  +D      L   + +  + +F  P   Q T F+ GG+S
Sbjct  95    NDCGARFIEAQSDKTLEEWL-GMDSSIHKLLASNQIIGPELFFSPPVLFQWTRFKCGGVS  153

Query  1047  LGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDL  868
             +GLS +H+L D ++A+ +       + TGK  SP      P      +           +
Sbjct  154   IGLSWSHILGDAMAASEYFFNGLSRTMTGKEPSPYPETSKPNIHQLKHPSPLALKKVDSV  213

Query  867   MNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRA--CMSMAQTPD------AFDAL  712
              +H+  P            ++ + +T SL+ T   + +     + Q P+       F+ +
Sbjct  214   GDHWITP------------NNHKMETFSLVLTPTQLNSLELKLLGQNPNPAEEIPTFELI  261

Query  711   AGLLWTRISKAKNNVGLMDLAVGLDVRKVLGLDKGFY------GNCMVYNKVKWSSGSMV  550
              G++W  ++K +          G + + V    KG        GN  + + V+ +  +  
Sbjct  262   CGVIWQCVAKMRQ---------GSEPKLVTICTKGTKPAVAECGNNQIISTVEAADVA--  310

Query  549   LGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGCDSLVCVNLEGVDPY  370
                D+  ++  A+   R+  ++  I +L+E     N  +  ++ G + L  VN EG D Y
Sbjct  311   ---DMDPKSLAAMLAKRESYEETQIGELVE---SENGASDYIVYGAN-LTFVNWEGSDFY  363

Query  369   SACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTVMVTLPENEAVKL  205
                      PV V+Y ++  +G    +L+ P P G G   R V V  PE E V L
Sbjct  364   -GFEAEGHKPVCVNYSIQ-GVGDEGAVLVQPGPNGEG---RLVNVIFPEKEVVGL  413



>ref|XP_010910676.1| PREDICTED: protein ECERIFERUM 26-like [Elaeis guineensis]
Length=432

 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 88/163 (54%), Gaps = 4/163 (2%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR--EFDKDYT--KLNESIAETLNAYT  1282
             TVV  +V        L  +D VM+ +++R V+Y++  E   + T   L   +   L+ Y 
Sbjct  17    TVVPGSVTGETIVYELANIDLVMKLHYLRSVYYFKANEIIDNLTIQDLKGPMFPWLDVYY  76

Query  1281  IIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPY  1102
              + GR+ R+   +  +KCND G+R++E K   +++EWL   D  +  +LV  + +  D  
Sbjct  77    PVSGRIRRTDNGRPYVKCNDCGVRIVETKCGVTLEEWLEIKDSSRWRQLVPEKVLGPDLQ  136

Query  1101  FWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
             F    +VQ T F+ GG+++G S +H+L D I+A  FI  WA +
Sbjct  137   FSPLVFVQFTRFKCGGMAIGFSWSHVLGDAITAANFIHLWAQL  179



>gb|KFK39682.1| hypothetical protein AALP_AA3G275600 [Arabis alpina]
Length=422

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 120/269 (45%), Gaps = 24/269 (9%)
 Frame = -2

Query  1473  ISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYTKLN--ESIA  1303
             +S+    R   ++   +P      T LD  M+ ++++ V+ Y  E  +D T ++    + 
Sbjct  17    LSTVTASRPTETSTTHEP------TGLDLAMKLHYLKAVYIYSAETARDLTVMHVKGPLF  70

Query  1302  ETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWE  1123
                     I+GR  R    +  IKCND G+R +E++   +V+EWL   DR  +  LV+ +
Sbjct  71    AVFEQIHWIIGRFRRHDSGRPYIKCNDCGMRFVESQCDLTVEEWLRVPDRSVDESLVYHQ  130

Query  1122  PMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpp  943
             P+     F    Y+Q+T  + GGL+LGLS  H++ DP S + F   W   +F+G+ I  P
Sbjct  131   PVGPVLAFSPLIYIQMTRLKCGGLALGLSWAHVMGDPFSLSHFFNLWT-RAFSGEKIYCP  189

Query  942   hfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEM  763
                                     + +H+  P            S+++ +T S   T   
Sbjct  190   KTSNGFQNPNSTGKEPDSIKRVDPVGDHWVVP------------SNNKMETYSFNITVHE  237

Query  762   VRACMSMAQTPDAFDALAGLLWTRISKAK  676
             VR+   +    D F+ L+ ++W  I+K +
Sbjct  238   VRSHFPV--NGDEFEILSAIIWKCIAKVR  264



>ref|XP_007034236.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY05162.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=440

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 89/166 (54%), Gaps = 8/166 (5%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKD---YTKLNESIAET  1297
             S++    V  T+VV       L+ LD  M+ ++++ V+++     +    T++ E +  +
Sbjct  16    SSVGPGRVTGTDVVHE-----LSGLDLAMKLHYLKGVYFFGSQAVEGLTITRMKEIMFFS  70

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             LN Y I  GR+ RS   +  IKCND G+R +E     ++DEWL   D   +  LV+   +
Sbjct  71    LNDYYITSGRIKRSESGRPYIKCNDCGVRFVEGLCDKTIDEWLEMGDDSLDNLLVYHRAI  130

Query  1116  MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
               +  F    Y+Q+T F+ GG+S+G+S  H+L D  SA+ FI +W 
Sbjct  131   GPELSFSPSVYLQVTWFKCGGISVGMSWAHILGDAFSASDFINSWG  176



>ref|XP_002978805.1| BAHD family acyltransferase [Selaginella moellendorffii]
 gb|EFJ20252.1| BAHD family acyltransferase [Selaginella moellendorffii]
Length=464

 Score = 86.3 bits (212),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 95/410 (23%), Positives = 164/410 (40%), Gaps = 35/410 (9%)
 Frame = -2

Query  1326  TKLNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK  1147
             + L  S+++TL  + +  GR+ R  G +  I+CND G+  + A A  S  +W        
Sbjct  66    SSLKASLSQTLVLFNVFAGRV-RENGPRLEIECNDRGVPFLVATADASFSDWGDLARCSI  124

Query  1146  ELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSF  967
             E +L   E  +++P        QLT F  GG++LG+    L+ D  S   F++ W+ +  
Sbjct  125   EHELNPGETYITNPVDSPLLKFQLTRFNCGGIALGVVTAELIVDGSSYFEFMRCWSQIH-  183

Query  966   TGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTI  787
              G                             D  +   KP+TD   K   + ++    T+
Sbjct  184   KGSSPRDLTPPVFDSSLLKAREPPQITIPVRDYTSS-PKPSTDAMGKSSQEHNASAKPTL  242

Query  786   SLLF------TDEMVRACMSMA---QTPDAFDALAGLLWTRISKAKNNVGLMD-------  655
               LF       D ++R   S      TP +F+A   ++W  +++A+   GL D       
Sbjct  243   VKLFEMDPPQVDSLIREIQSGPFGFDTPSSFEATCAMIWKAMTEAR---GLPDSTLTTYV  299

Query  654   LAVGLDVRKVLG--LDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKE  481
              A+ L  +      +   + GN      +  S+G   +  + +S  A   R   +    E
Sbjct  300   YAISLKAKNRWNPPIPAAYIGNSAHSPCLSASAGE--IKSNHVSYVARLFRQDIRTTTPE  357

Query  480   GIMDLIEWLDQNNCCASNVLDGCD-----SLVCVNLEGVDPYSACFGNNMDPVHVSYYVE  316
              I   I+W++        +   CD      +   +L     Y    G    PVH S  ++
Sbjct  358   HIQSAIDWMELEIIRGRKINFNCDFVGGTGVYSTSLHTFPVYGVDLGMGR-PVHYSLVMQ  416

Query  315   PEIGPGNRLLILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
             P  G G   ++LP+P   G  SR ++V+LP  E  KL E++L  + +  +
Sbjct  417   PWYGNG-VAIVLPTP--KGGRSRRLLVSLPREEMRKLCENELFQKFTTAV  463



>emb|CDY04872.1| BnaAnng00540D [Brassica napus]
Length=360

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 100/195 (51%), Gaps = 22/195 (11%)
 Frame = -2

Query  1500  IRSTMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVR---IVFYYREFDKD  1330
             + +T+S+  I+     ++V+   V Q  +  P++V D V    F R   IV YY++    
Sbjct  1     METTVSKSMIAGV---QSVMPVEVTQHREVRPISVGDPVGAGIFRRTLNIVTYYKDAGDS  57

Query  1329  YTK-------LNESIAETLNAYTIIMGRLLR---SPGEQ--WLIKCNDAGLRVIEAKAKG  1186
               +       + ES+   L    ++ GRL R   + GE+    +  ND+G+R++EA    
Sbjct  58    GQRGWLVAGWIKESLGRALTEQPMLCGRLRRRRTTKGEEDGLEVVANDSGVRMVEAIFPA  117

Query  1185  SVDEWLHNVDRDK---ELKLVHWEPM-MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLA  1018
             S+ E+   V RDK   E + V W  +   DP F   FYVQ+T FE GG S+G+SC+ L+A
Sbjct  118   SLPEFFEMVKRDKSRAEAETVFWRDIDEVDPQFCPLFYVQVTNFESGGYSIGISCSILIA  177

Query  1017  DPISATMFIKAWADM  973
             D +  T F+  WA +
Sbjct  178   DLLLETDFLTKWAKI  192



>ref|XP_009621285.1| PREDICTED: protein ECERIFERUM 1 [Nicotiana tomentosiformis]
Length=437

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 92/177 (52%), Gaps = 5/177 (3%)
 Frame = -2

Query  1488  MSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE---FDKDYTKL  1318
             M  + + S +   +VV   +    K    T +D VM+ ++++ ++++      D +    
Sbjct  1     MDVEKLISDVKSSSVVPAKITGADKVHEFTNMDLVMKLHYIKGLYFFSSDAVEDLNIYDF  60

Query  1317  NESIAETLNAYTIIMGRLLRSP--GEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKE  1144
              + +   L  Y    GR+ RS   G +  IKCND G+R+IEAK+  +++EWL   D    
Sbjct  61    KKPMFHFLELYYETSGRIRRSEDGGGRPFIKCNDGGVRIIEAKSSKTIEEWLVMNDSSVN  120

Query  1143  LKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              +LV+ + +  +  F    ++Q T F+ GG+S+GLS  H+L D  SA+ FI  WA +
Sbjct  121   DQLVYDQVLGPELGFAPLVFIQFTWFKCGGMSIGLSWAHVLGDVFSASNFINIWAQI  177



>ref|XP_004973445.1| PREDICTED: uncharacterized protein LOC101772604 [Setaria italica]
Length=422

 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 93/185 (50%), Gaps = 28/185 (15%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVME----NNFVRIVFYYREFD--------------KDY  1327
             +T V T  V+PG+   + V    +         R+V YYR                 ++ 
Sbjct  48    QTAVPTRAVEPGRTRRIAVAAPPLPAAALQRRTRVVLYYRTGGGVDGGGAPAPARLWEEV  107

Query  1326  TKLNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK  1147
                 ES++E L  +  + GRL R     W +K NDAG+R  +A A+ ++ E+L  V  DK
Sbjct  108   CWAKESLSEALADHPEMAGRLRRREDGSWEVKLNDAGMRFAQATAEATLGEFLAAVRDDK  167

Query  1146  ELKLVHWEPMMS--------DPYFWSPFYVQLTEFE-EGGLSLGLSCTHLLADPISATMF  994
             + +   WE  ++        DP   + FY+QLT F+ +GG ++G+SC+ +L+DP+S T F
Sbjct  168   D-RARSWEAALAPWADVNAEDPDMCALFYMQLTRFQGDGGYAVGVSCSLMLSDPLSLTRF  226

Query  993   IKAWA  979
             + +WA
Sbjct  227   LLSWA  231



>ref|XP_002984719.1| BAHD family acyltransferase [Selaginella moellendorffii]
 gb|EFJ14364.1| BAHD family acyltransferase [Selaginella moellendorffii]
Length=464

 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 96/410 (23%), Positives = 163/410 (40%), Gaps = 35/410 (9%)
 Frame = -2

Query  1326  TKLNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK  1147
             + L  S+++TL  + +  GR+ R  G +  I+CND G+  + A A  S  +W        
Sbjct  66    SSLKASLSQTLVLFNVFAGRV-RENGPRLEIECNDRGVPFLVATADASFSDWGDLARCSI  124

Query  1146  ELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSF  967
             E +L   E  +++P        QLT F  GG++LG+    L+ D  S   F++ W+ +  
Sbjct  125   EHELNPGETYITNPVDSPLLKFQLTRFNCGGIALGVVTAELIVDGSSYFEFMRCWSQIH-  183

Query  966   TGKMISpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTI  787
              G                             D  +   KP+TD   K   + ++    T+
Sbjct  184   KGSSPRDLTPPVFDSSLLKAREPPQITIPVRDYTSS-PKPSTDAMGKSSQEHNASAKPTL  242

Query  786   SLLF------TDEMVRACMSMA---QTPDAFDALAGLLWTRISKAKNNVGLMD-------  655
               LF       D +VR   S      TP +F+A   ++W  +++A+   GL D       
Sbjct  243   VKLFEMDPQQVDSLVREIQSGPFGFDTPSSFEATCAMIWKAMTEAR---GLPDSTLTTYV  299

Query  654   LAVGLDVRKVLG--LDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKE  481
              A+ L  +      +   + GN      +  S+G   +  + +S  A   R   +    E
Sbjct  300   YAISLKAKNRWNPPIPAAYIGNSAHSPCLSASAGE--IKSNHVSYVARLFRQDIRTTTPE  357

Query  480   GIMDLIEWLDQNNCCASNVLDGCD-----SLVCVNLEGVDPYSACFGNNMDPVHVSYYVE  316
              I   I+W++        +   CD      +   +L     Y    G    PVH S  ++
Sbjct  358   HIQSAIDWMELEIIRGRKINFNCDFVGGTGVYSTSLHTFPVYGVDLGMGR-PVHYSLVMQ  416

Query  315   PEIGPGNRLLILPSPPGTGALSRTVMVTLPENEAVKLMEDQLIHQLSPCI  166
             P  G G   ++LP+P   G  SR ++V+LP  E  KL E +L  + +  +
Sbjct  417   PWYGNG-VAIVLPTP--KGGRSRRLLVSLPREEMRKLCEHELFQKFTTAV  463



>ref|XP_007018238.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY15463.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=433

 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 84/164 (51%), Gaps = 5/164 (3%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE---FDKDYTKLNESIAETLNAYTI  1279
             +VV   V    K   L+ +D  M+ ++++ V++++         + L E +   L  Y  
Sbjct  17    SVVPAEVTGDNKDFELSSMDLAMKLHYIKGVYFFQSEAVQGVSGSDLKEPMFRWLEFYFT  76

Query  1278  IMGRLLRSPGE-QWLIKCNDAGLRVIEAKAKG-SVDEWLHNVDRDKELKLVHWEPMMSDP  1105
               GR+ RS G  +  IKCNDAG+R++EA     ++DEWL   D   +  L H + +  D 
Sbjct  77    TSGRIRRSSGTGRPFIKCNDAGVRIVEAHCDSKTIDEWLATSDHSLDHLLAHDQVLGPDL  136

Query  1104  YFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              F    ++Q T F  GG+S+GLS  H+L D  SA+ FI  W  +
Sbjct  137   GFSPLVFLQFTWFRSGGVSIGLSWAHVLGDAFSASAFINLWGQI  180



>emb|CDY55691.1| BnaC02g03450D [Brassica napus]
Length=359

 Score = 84.3 bits (207),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 92/179 (51%), Gaps = 19/179 (11%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVMENNFVR---IVFYYREFDKDYTK-------LNESIA  1303
             ++V+   V Q  +  P++V D V    F R   IV YY++      +       + ES+ 
Sbjct  14    QSVMPVEVTQHREVRPISVGDPVGTGIFRRTLNIVTYYKDAGDSGQRGWLVAGWIKESLG  73

Query  1302  ETLNAYTIIMGRLLR---SPGEQ--WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK---  1147
               L    ++ GRL R   + GE+    +  ND+G+R++EA    S+ E+   V RDK   
Sbjct  74    RALTEQPMLCGRLRRRRTTKGEEDGLEVVANDSGVRMVEAIFPASLPEFFEMVKRDKSRA  133

Query  1146  ELKLVHWEPM-MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
             E + V W  +   DP F   FYVQ+T FE GG S+G+SC+ L+AD +  T F+  WA +
Sbjct  134   EAETVFWRDIDEVDPQFSPLFYVQVTNFESGGYSIGISCSILIADLLLETDFLTKWAKI  192



>ref|XP_006360967.1| PREDICTED: protein ECERIFERUM 26-like [Solanum tuberosum]
Length=426

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 86/347 (25%), Positives = 153/347 (44%), Gaps = 24/347 (7%)
 Frame = -2

Query  1395  LDRVMENNFVRIVFYY--REF-DKDYTKLNESIAETLNAYTIIMGRLLRSPGEQWLIKCN  1225
             +D  M+ +++R ++Y+  + F D    K+ E I    N + +  GR  R+   +  IKCN
Sbjct  36    MDLAMKLHYLRGIYYFDSQTFQDVTIYKIKEPIFIWFNYFYMTNGRFRRAESGRPYIKCN  95

Query  1224  DAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSL  1045
             D G R IEA+   +++EWL   D   E  LV  + +  +  F  P  +Q T+F+ GG+SL
Sbjct  96    DCGARFIEAQCDKTLEEWLEMKDASLEKLLVSNQVLGPELAFSPPVLIQHTKFKCGGISL  155

Query  1044  GLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLM  865
             GLS  H+L D  SAT F   W   +F GK++                  N        + 
Sbjct  156   GLSWAHVLGDVFSATEF---W---NFLGKVVGGYQPPRPLNLAHSLTKANSTQTLQKIVE  209

Query  864   NHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMSMAQTPDAFDALAGLLWTRIS  685
             +       D  +      +S + ++ S+  +   +    S       F++L  ++W  IS
Sbjct  210   DPLSIKRVDPVEDHWIANASCKLESFSIHVSASKLGHIQSRIGIQGPFESLCAIIWQSIS  269

Query  684   KAKNNVGLMDLAVGLDVRKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQA--ANAI  511
             + ++  G   + +    +K     +G  GN  V   VK         DD + +A  +   
Sbjct  270   RIRDGPGPKVVTI---CKKSEEKKEGLIGNTQVIGVVKV--------DDSIREANPSELA  318

Query  510   RNMRKEMDKEGIMDLIEWLDQNNCCASNVLDGCDSLVCVNLEGVDPY  370
             R ++ E+  E  + + E +++ +  +  ++ G + L  V+LEG D Y
Sbjct  319   RLIKNEIIDER-LKIDEAIEKEHGVSDFIVYGAN-LTFVSLEGADLY  363



>ref|NP_001130509.1| hypothetical protein [Zea mays]
 gb|ACF78717.1| unknown [Zea mays]
 gb|ACF78755.1| unknown [Zea mays]
 gb|ACF85424.1| unknown [Zea mays]
 gb|ACN34570.1| unknown [Zea mays]
 gb|AFW62180.1| hypothetical protein ZEAMMB73_155304 [Zea mays]
Length=387

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 92/181 (51%), Gaps = 23/181 (13%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVME----NNFVRIVFYYREFD------------KDYTK  1321
             +T V T  V+PG+   +TV    +         R+V YYR               ++   
Sbjct  16    QTAVPTRAVEPGRTRRITVAAPPLPPAALQRRTRVVLYYRADAAGADGRASVRLWEEAMW  75

Query  1320  LNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNV-DRDK-  1147
               ES++E +  +  + GRL R     W +K NDAG+R  EA A+ ++DE+L    D+D+ 
Sbjct  76    AKESLSEAVADHPEMGGRLRRHADGSWEVKLNDAGVRFTEATAEATLDEFLATAQDKDRA  135

Query  1146  ---ELKLVHWEPM-MSDPYFWSPFYVQLTEFE-EGGLSLGLSCTHLLADPISATMFIKAW  982
                E  L  W  +   DP   +  YVQLT F+ +GG ++G+SC+ +L+DP+S   F+ +W
Sbjct  136   PSWEAALAPWADVNAEDPDVSALVYVQLTRFQGDGGFAVGVSCSLMLSDPLSLARFLASW  195

Query  981   A  979
             A
Sbjct  196   A  196



>ref|XP_009408243.1| PREDICTED: protein ECERIFERUM 26-like [Musa acuminata subsp. 
malaccensis]
Length=449

 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 91/170 (54%), Gaps = 9/170 (5%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKD----YTKLNESIAETLNAYT  1282
             TVV   V        LT +D +M+ +++R V+Y+ + +         L   +   LN   
Sbjct  17    TVVPATVTGNAVLHELTNMDLIMKLHYLRAVYYFNQSEITDGITIADLKNPMFLWLNICY  76

Query  1281  IIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELK---LVHWEPMMS  1111
              + GR+ R+   + LIKCND GLR+IEA+ + ++ EWL +V+     +   LV  + +  
Sbjct  77    PMAGRIRRAESGRPLIKCNDCGLRIIEARCRRTLGEWL-DVESSSSSRWRLLVPDKVLGP  135

Query  1110  DPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTG  961
             D  F    Y+Q T F+ GG+++G S  H+L DP+SAT  I  W ++ F+G
Sbjct  136   DLQFSPMVYMQFTRFKCGGMAIGYSWAHVLGDPMSATNCINLWGEL-FSG  184



>emb|CBI17286.3| unnamed protein product [Vitis vinifera]
Length=401

 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 78/143 (55%), Gaps = 3/143 (2%)
 Frame = -2

Query  1395  LDRVMENNFVRIVFYYR-EFDKDYT--KLNESIAETLNAYTIIMGRLLRSPGEQWLIKCN  1225
             +D  M+ +++R V+++  E  +  T  ++ E +   LN Y    GR  RS   + LIKCN
Sbjct  1     MDLAMKLHYLRGVYFFSSEAVQGLTVYRIKEPMFTWLNHYYWTCGRFRRSNSGRPLIKCN  60

Query  1224  DAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSL  1045
             D G+R+IEAK   ++DEWL   D      LV    +  +  F    ++Q+T F+ GG+SL
Sbjct  61    DCGVRIIEAKCDKTIDEWLEMKDSSLTKLLVSNHIVGPELPFSPLVFLQVTSFKCGGMSL  120

Query  1044  GLSCTHLLADPISATMFIKAWAD  976
             GLS  H+L D  SA+ FI  W  
Sbjct  121   GLSWAHVLGDAFSASDFINMWGQ  143



>tpg|DAA51298.1| TPA: hypothetical protein ZEAMMB73_720390 [Zea mays]
Length=299

 Score = 83.2 bits (204),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 90/306 (29%), Positives = 131/306 (43%), Gaps = 31/306 (10%)
 Frame = -2

Query  1083  VQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplpprrpcnn  904
             +QLTEF +   +LGLSC H+  DP +A +F  AWA      +  S       PP    + 
Sbjct  1     MQLTEFTDKSYALGLSCIHIHNDPTAAALFFHAWAAAH--RRTTSTYPPFLHPPALAVSP  58

Query  903   nhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMSMAQ---T  733
                P              PT+ D     S        + +  F    VRA +S  +   T
Sbjct  59    TSPPPAPPLLAEKASAASPTSTDAAAAMS--------SATFHFPASAVRALLSSLEPGTT  110

Query  732   PDAFDALAGLLWTRISKAKNNVGLMDLAVGLDVRKVL--GLDKGFYGNCMVYNKVKWSSG  559
             P  F ALA L W RI+ A +  G  +L + LD RK +   L  G+YG+ + + + +    
Sbjct  111   P--FAALAALFWLRITGAAD--GERELTLALDFRKRMYAPLPWGYYGSSVHFTRARAD--  164

Query  558   SMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLD--QNNCCASNVLDGCDSLVCVNLE  385
                L   L + AA   R++   + +E +   +EWL   Q    A   + G + L C  L+
Sbjct  165   ---LASGLPAVAAALDRHV-AGVPEEELWRALEWLHTRQQQENAPFQMYGPE-LTCAALD  219

Query  384   GVDPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTVMVTLPENEAVKL  205
              V  Y A F     P  VS  V    G G  +L+LP+P G  A  R V+VTLP     ++
Sbjct  220   HVPMYGAEFEAGASPARVSCRVGGATGEG-LVLVLPAPEGGEA--RDVVVTLPAGATARV  276

Query  204   MEDQLI  187
               D  +
Sbjct  277   CRDAEV  282



>ref|XP_002264429.1| PREDICTED: protein ECERIFERUM 26 [Vitis vinifera]
Length=435

 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 78/142 (55%), Gaps = 3/142 (2%)
 Frame = -2

Query  1395  LDRVMENNFVRIVFYYR-EFDKDYT--KLNESIAETLNAYTIIMGRLLRSPGEQWLIKCN  1225
             +D  M+ +++R V+++  E  +  T  ++ E +   LN Y    GR  RS   + LIKCN
Sbjct  35    MDLAMKLHYLRGVYFFSSEAVQGLTVYRIKEPMFTWLNHYYWTCGRFRRSNSGRPLIKCN  94

Query  1224  DAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSL  1045
             D G+R+IEAK   ++DEWL   D      LV    +  +  F    ++Q+T F+ GG+SL
Sbjct  95    DCGVRIIEAKCDKTIDEWLEMKDSSLTKLLVSNHIVGPELPFSPLVFLQVTSFKCGGMSL  154

Query  1044  GLSCTHLLADPISATMFIKAWA  979
             GLS  H+L D  SA+ FI  W 
Sbjct  155   GLSWAHVLGDAFSASDFINMWG  176



>ref|XP_006398747.1| hypothetical protein EUTSA_v10013950mg [Eutrema salsugineum]
 gb|ESQ40200.1| hypothetical protein EUTSA_v10013950mg [Eutrema salsugineum]
Length=356

 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 93/182 (51%), Gaps = 22/182 (12%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVMENNFVR---IVFYYREFDKDYTK---------LNES  1309
             ++V+   V Q  K   +TV D V    F R   +V YY++ +   +          + ES
Sbjct  14    QSVMPVEVTQHRKVRSITVEDPVGVGIFRRTLNMVTYYKQAEAGDSGERGWLVAGWIKES  73

Query  1308  IAETLNAYTIIMGRLLR------SPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK  1147
             +   L    +I GRL R        G +  +  ND+G+R++EA+   S+ E++  V RDK
Sbjct  74    LGRALTEQPMISGRLRRRRTSTEEDGLELEVVANDSGVRLVEARFPASLPEFIEMVKRDK  133

Query  1146  ---ELKLVHWEPMMSD-PYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
                E + V W  +  D P F   FY+Q+T FE+GG ++G+SC+ L+AD +  T F+  WA
Sbjct  134   SRAEAETVFWRDIDEDNPQFSPLFYLQVTNFEKGGYAIGISCSLLIADILLETDFLTKWA  193

Query  978   DM  973
              +
Sbjct  194   QI  195



>ref|XP_010538356.1| PREDICTED: uncharacterized protein LOC104812733 [Tarenaya hassleriana]
Length=366

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 85/178 (48%), Gaps = 18/178 (10%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVMENNFVR---IVFYYREFDKDYTK-------LNESIA  1303
             +TV+        K  P++  D      F R   IV YY+    D          + ES  
Sbjct  14    QTVIPAKATLHRKVRPISAEDAAGAGIFRRTLDIVLYYKHGSGDTDSGWVGAGWIKESRG  73

Query  1302  ETLNAYTIIMGRLLRSPGEQ----WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRD---KE  1144
               L     + GRL R   E+      +  ND+G+R++EAK   S+ E+L    RD    E
Sbjct  74    RALTEQPALSGRLRRRKAEEDGGGLEVVANDSGVRLVEAKFPASMPEFLELAKRDMAKAE  133

Query  1143  LKLVHWEPM-MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              + + W  +   DP F   FYVQ+T FE GG S+G+SC+ LLAD I  T FI+ W+++
Sbjct  134   AETLFWRDIDEDDPQFSPLFYVQVTNFECGGYSVGISCSILLADIIIGTDFIRRWSEI  191



>ref|XP_002298682.2| transferase family protein [Populus trichocarpa]
 gb|EEE83487.2| transferase family protein [Populus trichocarpa]
Length=392

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 79/144 (55%), Gaps = 3/144 (2%)
 Frame = -2

Query  1395  LDRVMENNFVRIVFYYREFDKD---YTKLNESIAETLNAYTIIMGRLLRSPGEQWLIKCN  1225
             +D  M+  +++ V+++           ++  S+   LN Y  + GR  R+   +  +KCN
Sbjct  36    MDLAMKLPYLKGVYFFNSQACQGLTIMQIKGSMFYWLNDYYTVCGRFQRTEAGRPYMKCN  95

Query  1224  DAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSL  1045
             D G+R++EA+   +VDEWL   D   +  L++  P+  + +F    Y+Q+T+F+ GG+SL
Sbjct  96    DCGVRIVEARCSKTVDEWLETRDCSLDNLLIYHSPIGPELFFSPSLYMQVTKFKCGGMSL  155

Query  1044  GLSCTHLLADPISATMFIKAWADM  973
             G+S  H++ D  SA+  + +W   
Sbjct  156   GISWAHIIGDVYSASECLNSWGQF  179



>gb|EPS64444.1| hypothetical protein M569_10336, partial [Genlisea aurea]
Length=424

 Score = 84.0 bits (206),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 83/147 (56%), Gaps = 8/147 (5%)
 Frame = -2

Query  1395  LDRVMENNFVRIVFYY--REFD-KDYTKLNESIAETLNAYTIIMGRLLRSPG-EQWLIKC  1228
             +D  M+ +++R V+Y+  + FD     ++ + + E LN Y +  GR  R    E+  IKC
Sbjct  26    IDLAMKLHYLRGVYYFERKAFDGATVQEVKDPMFEWLNRYPVQCGRFRREEASERPYIKC  85

Query  1227  NDAGLRVIEAKAKGSVDEWLHNVDRDKEL---KLVHWEPMMSDPYFWSPF-YVQLTEFEE  1060
             ND G+R IEA A  ++DEWL   D D  +   KL+    ++     +SP  Y+QLT+F  
Sbjct  86    NDCGVRFIEAAAGETLDEWLELNDDDGLMLREKLLFSGQIIGPELTFSPLVYIQLTKFRC  145

Query  1059  GGLSLGLSCTHLLADPISATMFIKAWA  979
             GG+++GLS  H+L D  SA  F+  WA
Sbjct  146   GGVAVGLSWAHILGDLFSAIKFMNDWA  172



>emb|CDY65534.1| BnaC01g41490D [Brassica napus]
Length=762

 Score = 84.7 bits (208),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 103/174 (59%), Gaps = 13/174 (7%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYTKLN-ESIAETL---NAYT  1282
             +VV  ++    K   LT +D  ++ ++VR V++++   +D+T ++ ++I   L     Y 
Sbjct  358   SVVPASMTGENKPRHLTAMDLAVKLHYVRAVYFFKG-TRDFTIVDLKNITFPLLDLPCYD  416

Query  1281  IIMGRLL----RSPGEQWL--IKCNDAGLRVIEAKAKG-SVDEWLHNVDRDKELKLVHWE  1123
              + GR+     ++P  Q +  I+CND+G+R++EAK +G +V EWL   DR  + + + ++
Sbjct  417   HVTGRIRLLDNKNPSAQAIPYIRCNDSGMRIVEAKVEGFTVQEWLDLDDRSIDHRFLVYD  476

Query  1122  PMMSDPYFWSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFT  964
              ++     +SP  Y+Q+T+F+ GGLS+GLS  H+L D +SA+ F+K    +  T
Sbjct  477   HVLGPDLLYSPLVYLQITQFKCGGLSVGLSWAHVLGDVVSASTFMKTMGQLMST  530



>gb|EYU32707.1| hypothetical protein MIMGU_mgv1a006596mg [Erythranthe guttata]
Length=437

 Score = 83.6 bits (205),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 82/147 (56%), Gaps = 5/147 (3%)
 Frame = -2

Query  1395  LDRVMENNFVRIVFYY--REFDKDYT-KLNESIAETLNAYTIIMGRLLRSPGEQWLIKCN  1225
             +D  M+ +++R V+Y+  R F+   T  + E I   LN + +  GR  R    +  IKCN
Sbjct  36    MDLAMKLHYIRCVYYFGSRAFEGLTTLAIKEPIFVWLNRFPMTAGRFRRDESGRPYIKCN  95

Query  1224  DAGLRVIEAKAKGSVDEWLH-NVDRDKELKLVHWEPMMSDPYFWSPF-YVQLTEFEEGGL  1051
             D G+R IEAK + S+DEW   + D     K +    ++     +SP  Y+QLT+F+ GG+
Sbjct  96    DCGVRFIEAKCRTSLDEWFEMSDDIAMREKFLCSNSIIGPELSFSPLIYIQLTKFKCGGM  155

Query  1050  SLGLSCTHLLADPISATMFIKAWADMS  970
             ++GLS  H+L D  SA  ++  W+ ++
Sbjct  156   AVGLSWAHVLGDVFSAAEYMNNWSRVA  182



>ref|XP_002306532.2| ECERIFERUM 2 family protein [Populus trichocarpa]
 gb|EEE93528.2| ECERIFERUM 2 family protein [Populus trichocarpa]
Length=436

 Score = 83.6 bits (205),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 86/169 (51%), Gaps = 4/169 (2%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVR-IVFYYREFDKDYT--KLNESIAET  1297
             S I   +VV   V    +   LT +D   + ++VR + F+  E  +  T   L E +   
Sbjct  11    SGIKLSSVVPAEVTGDNEDRKLTNMDLAFKLHYVRGVSFFSNETVQGLTIYDLKEPMFSL  70

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L  Y    GR+ +S   +  IKCND G+R++EA    +++EWL   D       + ++ +
Sbjct  71    LALYPTASGRIRKSESGRPFIKCNDGGVRIVEAHCDKTIEEWLKMNDHQPLDDYLVYDQV  130

Query  1116  MSDPYFWSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
             +     +SP  +VQ T F+ GG+S+GLS  H+L DP SA+ FI  W  +
Sbjct  131   LGPDLGFSPLVFVQFTWFKCGGMSVGLSWAHVLGDPFSASTFINTWGKI  179



>emb|CDP08351.1| unnamed protein product [Coffea canephora]
Length=375

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 77/122 (63%), Gaps = 7/122 (6%)
 Frame = -2

Query  1320  LNESIAETLNAYTIIMGRLLRS---PGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRD  1150
             + ES+   L+   ++ GRL R+    GE  ++  ND+G+R+IEA+   ++ E+L   D+ 
Sbjct  79    IRESLGWALSEQPMLAGRLRRNQDVEGELEMVS-NDSGVRLIEAQLAMTLSEFLDLKDKK  137

Query  1149  K-ELKLVHWEPM--MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
             K E +LV+WE +    +P F   FYVQ+T F+ GG S+G+SC+ LL DP++ T F+K W 
Sbjct  138   KAEAELVYWEGLDREQNPQFSPLFYVQVTSFKCGGYSIGISCSLLLVDPVAMTSFLKRWR  197

Query  978   DM  973
             D+
Sbjct  198   DI  199



>ref|XP_004299741.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=442

 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 90/170 (53%), Gaps = 6/170 (4%)
 Frame = -2

Query  1470  SSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKD---YTKLNESIAE  1300
             SS      V +T   Q  K   LT +D  M+ ++++ V++++    +      L + + +
Sbjct  13    SSMRLSSVVPATVTGQEHKVHELTNMDLAMKLHYIKGVYFFKSDAVEGLTAKDLKKPMFQ  72

Query  1299  TLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWL-HNVDRDKELKLVHWE  1123
              L  Y  + GR+ RS   +  IKCND+G+R +EA+ + +VDEWL   V+ D     + + 
Sbjct  73    LLQRYFAVSGRIRRSVTGRPFIKCNDSGVRTVEARCEDTVDEWLARAVEDDSVFDGLAYN  132

Query  1122  PMMSDPYF-WSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
               + DP   +SP  +VQ T F+ GG+S+GL   ++L D  SA+ FI  W 
Sbjct  133   QALGDPDLGFSPLVFVQFTWFKCGGMSVGLGWANVLGDVFSASTFINLWG  182



>gb|EAY86925.1| hypothetical protein OsI_08310 [Oryza sativa Indica Group]
Length=385

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 88/173 (51%), Gaps = 15/173 (9%)
 Frame = -2

Query  1452  RTVVSTNVVQPGK----FCPLTVLDRVMENNFVRIVFYYREFD-------KDYTKLNESI  1306
             +T V T VV+PG+          L        VR V YYR          +D   + ES+
Sbjct  22    QTAVPTRVVEPGRTRLVAVAAPPLPAPALQRRVRAVLYYRSAGGAAPGAWEDGVWVKESL  81

Query  1305  AETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWL--HNVDRDKELKLV  1132
             +E L  +  + GRL R     W +K ND G+R+++A    ++DE+L        +E  L 
Sbjct  82    SEALADHPEMAGRLRRRADGSWEVKLNDTGVRLLQATVDATLDEFLAGKGALARREAALA  141

Query  1131  HWEPMMS-DPYFWSPFYVQLTEFE-EGGLSLGLSCTHLLADPISATMFIKAWA  979
              W  + + DP    PF++QLT F+ +GG ++G+SC  +LADP++   F+ +WA
Sbjct  142   PWTDVNADDPDMCPPFFMQLTRFQGDGGYAVGVSCALVLADPLTLARFLLSWA  194



>ref|XP_004299742.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=446

 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 88/169 (52%), Gaps = 6/169 (4%)
 Frame = -2

Query  1470  SSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK-DYTKLNESIAETL  1294
             SS      V +T   +  K   LT +D  ++ ++++ V+++   +      L + + + L
Sbjct  15    SSMRMSSVVPATVTAEEHKVHELTKMDLALKLHYIKGVYFFGRVEGVTIYDLKKPMFQLL  74

Query  1293  NAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNV---DRDKELKLVHWE  1123
               Y    GR+ RS   +  IKCND+G+R++EA+   +VDEWL      D D    ++ + 
Sbjct  75    QLYFPAAGRIRRSENGRPFIKCNDSGVRIVEARCDETVDEWLAMALGDDHDSSFDVLAYN  134

Query  1122  PMMSDPYF-WSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAW  982
               + DP    SP  ++Q T F+ GG+S+G+S  ++L D  SA+ FI  W
Sbjct  135   QALGDPDLDLSPLVFLQFTRFKCGGMSVGISWANVLGDAFSASTFINLW  183



>ref|XP_006286038.1| hypothetical protein CARUB_v10007574mg [Capsella rubella]
 gb|EOA18936.1| hypothetical protein CARUB_v10007574mg [Capsella rubella]
Length=417

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 97/171 (57%), Gaps = 14/171 (8%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYT--KLNESIAETLNAYTII  1276
             +VV  +VV   K   LT +D  M+ ++VR V++++   +D+T   L  ++   L +Y  +
Sbjct  13    SVVPASVVGENKPRKLTPMDLAMKLHYVRAVYFFKG-RRDFTVSDLKTTMFTLLQSYHHV  71

Query  1275  MGRLLRSPGEQ--------WLIKCNDAGLRVIEAKAKG-SVDEWLHNVDRDKELKLVHWE  1123
              GR+ R P             I+CND+G+R++EA  +  +V++WL   DR  + + + ++
Sbjct  72    SGRI-RMPENDDDPSALALPYIRCNDSGIRIVEANVEDFTVEKWLDLDDRSIDHRFLVYD  130

Query  1122  PMMSDPYFWSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              ++     +SP  ++Q+T+F+ GG S+GLS TH+L D  SA+ F+K    +
Sbjct  131   HVLGPDLIFSPLVFLQITQFKCGGFSIGLSWTHVLGDVFSASTFMKTLGQL  181



>ref|XP_008798819.1| PREDICTED: uncharacterized protein LOC103713604 [Phoenix dactylifera]
Length=369

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 88/142 (62%), Gaps = 12/142 (8%)
 Frame = -2

Query  1368  VRIVFYYREFDKDYTKLNES----IAETLNAY----TIIMGRLLRS-PGEQ-WLIKCNDA  1219
             +RI+ YY++  ++ +         I ETL+A      ++ GRL R   G+  W IK ND+
Sbjct  51    LRIILYYKKAGEEESASAAVVAAWIKETLSAAIADEPLLAGRLRRDDEGDGCWEIKFNDS  110

Query  1218  GLRVIEAKAKGSVDEWLHNVDRD-KELKLVHWEPM-MSDPYFWSPFYVQLTEFEEGGLSL  1045
             G+R+++A A+ ++ E+L + +RD +E +L +W  +   +P + + FY+Q+T+F+  G S+
Sbjct  111   GVRLVQASAEMTMSEFLGSTERDSREGQLAYWVDVDKENPQYSALFYIQVTQFQGDGYSI  170

Query  1044  GLSCTHLLADPISATMFIKAWA  979
             G+SC+  LADP+    F+K+WA
Sbjct  171   GISCSLFLADPLFLARFLKSWA  192



>ref|XP_009602892.1| PREDICTED: protein ECERIFERUM 26-like [Nicotiana tomentosiformis]
Length=431

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 94/184 (51%), Gaps = 9/184 (5%)
 Frame = -2

Query  1494  STMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYT--  1324
             S+ SE  +   I   +V   NV         + +D  M+ +++R ++Y+  +  +D T  
Sbjct  3     SSKSEAGLIYNIKFSSVGPANVTGQDVVYEPSNIDLAMKLHYLRGIYYFNSQAFQDVTIY  62

Query  1323  KLNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKE  1144
             K+ E I    + + +  GR  R+   +  IKCND G R IEA+   +++EWL   D   E
Sbjct  63    KVKEPIFSWFSHFYMTAGRFRRAESGRPYIKCNDCGARFIEAQCDKTLEEWLEMKDASLE  122

Query  1143  LKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFT  964
               LV  + +  +  F  P  +Q T+F+ GG++LGLS  H+L D  SAT FI      +F 
Sbjct  123   KLLVSNQVLGPELTFSPPILIQHTKFKCGGIALGLSWAHVLGDVFSATEFI------NFL  176

Query  963   GKMI  952
             GK++
Sbjct  177   GKVV  180



>ref|XP_002869713.1| hypothetical protein ARALYDRAFT_492392 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45972.1| hypothetical protein ARALYDRAFT_492392 [Arabidopsis lyrata subsp. 
lyrata]
Length=415

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 99/174 (57%), Gaps = 15/174 (9%)
 Frame = -2

Query  1467  STICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYT--KLNESIAETL  1294
             S++   +VV  N  +P  F P+   D  M+ ++VR V++++   +D+T   L  ++   L
Sbjct  12    SSVVPASVVGEN--KPRLFTPM---DLAMKLHYVRAVYFFKGI-RDFTVADLKNTMFTIL  65

Query  1293  NAYTIIMGRLLRS---PGEQWL--IKCNDAGLRVIEAKAKG-SVDEWLHNVDRDKELKLV  1132
              +Y  + GR+  S   P    +  I+CND+G+R++EA  +  +V++WL   DR  + + +
Sbjct  66    QSYHHVSGRIRMSDNDPSAPAIPYIRCNDSGMRIVEANVEEFTVEKWLDLDDRSIDHRFL  125

Query  1131  HWEPMMSDPYFWSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              ++ ++     +SP  +VQ+T+F+ GGLS+GLS  H+L D  SA  F+K    +
Sbjct  126   VYDHVLGPDLTFSPLVFVQITQFKCGGLSIGLSWAHVLGDLFSAATFMKTLGQL  179



>ref|NP_001047605.2| Os02g0653400 [Oryza sativa Japonica Group]
 dbj|BAD24984.1| transferase-like [Oryza sativa Japonica Group]
 dbj|BAF09519.2| Os02g0653400 [Oryza sativa Japonica Group]
Length=385

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 88/173 (51%), Gaps = 15/173 (9%)
 Frame = -2

Query  1452  RTVVSTNVVQPGK----FCPLTVLDRVMENNFVRIVFYYREFD-------KDYTKLNESI  1306
             +T V T VV+PG+          L        VR V YYR          +D   + ES+
Sbjct  22    QTAVPTRVVEPGRTRLVAVAAPPLPAPALQRRVRAVLYYRGAGGAAPGAWEDGVWVKESL  81

Query  1305  AETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWL--HNVDRDKELKLV  1132
             +E L  +  + GRL R     W +K ND G+R+++A    ++DE+L        +E  L 
Sbjct  82    SEALADHPEMAGRLRRRADGSWEVKLNDTGVRLLQATVDATLDEFLAGKGALARREAALA  141

Query  1131  HWEPMMS-DPYFWSPFYVQLTEFE-EGGLSLGLSCTHLLADPISATMFIKAWA  979
              W  + + DP    PF++QLT F+ +GG ++G+SC  +LADP++   F+ +WA
Sbjct  142   PWTDVNADDPDMCPPFFMQLTRFQGDGGYAVGVSCALVLADPLTLARFLLSWA  194



>ref|XP_009786945.1| PREDICTED: LOW QUALITY PROTEIN: protein ECERIFERUM 1-like [Nicotiana 
sylvestris]
Length=430

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 93/180 (52%), Gaps = 11/180 (6%)
 Frame = -2

Query  1488  MSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYTK----  1321
             M  + + S +   +VV   +    K    T +D VM+ ++++ +++   F+ D  +    
Sbjct  1     MDVEKLISDVKLSSVVPAKITGADKVHEFTNMDLVMKLHYIKGLYF---FNSDAVEGLNI  57

Query  1320  --LNESIAETLNAYTIIMGRLLRSP--GEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDR  1153
                 + +   L  Y    GR+ RS   G +  IKCND G+R+IEAK+  ++++WL   D 
Sbjct  58    YDFKKPMFHFLELYYEASGRIRRSEDGGGRSFIKCNDGGVRIIEAKSSKTIEKWLAMNDS  117

Query  1152  DKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
                 +LV+ + +  +  F    ++Q T F+ GG+S+GLS  H+L D  SA+ FI  WA +
Sbjct  118   SVNDQLVYDQVLGPELGFAPLVFIQFTWFKCGGMSIGLSWAHVLGDVFSASKFINIWAQI  177



>ref|XP_010452154.1| PREDICTED: uncharacterized protein LOC104734305 [Camelina sativa]
Length=354

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 94/178 (53%), Gaps = 18/178 (10%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVMENNFVR---IVFYYREF-DKDYTK-------LNESI  1306
             ++V+   V Q  K   ++V D V    F R   IV YY+E  D    K       + ES+
Sbjct  14    QSVMPVEVTQHRKVRSISVGDAVGAGIFRRTLNIVTYYKEAGDVSGEKAWLVAGWIKESL  73

Query  1305  AETLNAYTIIMGRLLR---SPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK---E  1144
                L    ++ GRL R   +  + + +  ND+G+R++EA+   S+ E+L  V +DK   E
Sbjct  74    GRALAEQPMLSGRLRRRKTAAEDGFEVVPNDSGVRLLEAQFPASLPEFLEMVKKDKSRAE  133

Query  1143  LKLVHWEPMMSDPYFWSP-FYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              + V W+ +  D   +SP FYVQ+T FE GG S+G+SC+ LLAD +  T F+  W  +
Sbjct  134   AETVFWKDIDEDEPQYSPLFYVQVTNFESGGYSVGISCSILLADLLLETDFLTKWVQI  191



>emb|CAC39046.1| putative protein [Oryza sativa]
Length=385

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 88/173 (51%), Gaps = 15/173 (9%)
 Frame = -2

Query  1452  RTVVSTNVVQPGK----FCPLTVLDRVMENNFVRIVFYYREFD-------KDYTKLNESI  1306
             +T V T VV+PG+          L        VR V YYR          +D   + ES+
Sbjct  22    QTAVPTRVVEPGRTRLVAVAAPPLPAPALQRRVRAVLYYRGAGGAAPGAWEDGVWVKESL  81

Query  1305  AETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWL--HNVDRDKELKLV  1132
             +E L  +  + GRL R     W +K ND G+R+++A    ++DE+L        +E  L 
Sbjct  82    SEALADHPEMAGRLRRRADGSWEVKLNDTGVRLLQATVDATLDEFLAGKGALARREAALA  141

Query  1131  HWEPMMS-DPYFWSPFYVQLTEFE-EGGLSLGLSCTHLLADPISATMFIKAWA  979
              W  + + DP    PF++QLT F+ +GG ++G+SC  +LADP++   F+ +WA
Sbjct  142   PWTDVNADDPDMCPPFFMQLTRFQGDGGYAVGVSCALVLADPLTLARFLLSWA  194



>ref|NP_001053836.1| Os04g0611200 [Oryza sativa Japonica Group]
 emb|CAE03571.2| OSJNBa0085I10.16 [Oryza sativa Japonica Group]
 dbj|BAF15750.1| Os04g0611200 [Oryza sativa Japonica Group]
 emb|CAH67002.1| OSIGBa0152L12.11 [Oryza sativa Indica Group]
 gb|EEC77977.1| hypothetical protein OsI_17350 [Oryza sativa Indica Group]
 gb|EEE61662.1| hypothetical protein OsJ_16121 [Oryza sativa Japonica Group]
Length=437

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 93/177 (53%), Gaps = 16/177 (9%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK----DYTKLNESIAETLNAYT  1282
             TVV ++V     +  L   D   + +++R  +YY   D         L + +   L+AY 
Sbjct  21    TVVPSSVTGEANY-DLADADLAYKLHYLRGAYYYPAGDAVRGITIKSLKDPMFPWLDAYF  79

Query  1281  IIMGRLLRSPG--------EQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHW  1126
              + GR+ R+ G         +  IKCND G+R++EA+   ++D+WL +   D+ L+ + +
Sbjct  80    PVAGRIRRAEGDDADAAAARRPYIKCNDCGVRIVEARCDRALDDWLRDESPDR-LRHLCY  138

Query  1125  EPMMSDPYFWSP-FYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGK  958
             + ++    F+SP  Y+Q+T F+ GG++LG S  HL+ D  SAT     WA +  +GK
Sbjct  139   DKVLGPELFFSPLLYIQVTSFKCGGMALGFSWAHLIGDVASATACFNTWAQI-LSGK  194



>ref|XP_002873068.1| hypothetical protein ARALYDRAFT_324948 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49327.1| hypothetical protein ARALYDRAFT_324948 [Arabidopsis lyrata subsp. 
lyrata]
Length=355

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 94/178 (53%), Gaps = 18/178 (10%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVMENNFVR---IVFYYREF-DKDYTK-------LNESI  1306
             ++V+   V +  +   ++V+D V    F R   IV YY+E  D    +       + ES+
Sbjct  14    QSVMPVEVTRHREIRSISVVDPVGVGIFRRTLNIVTYYKEACDSGDERGWLAAGWIKESL  73

Query  1305  AETLNAYTIIMGRLLR---SPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK---E  1144
                L    ++ GRL R   S  +   +  ND+G+R++EA    S+ ++L  V RDK   E
Sbjct  74    GRALTEQPMLSGRLRRRTKSAEDGLELVANDSGIRMVEATFPASLPDFLEMVKRDKSRAE  133

Query  1143  LKLVHWEPMMSDPYFWSP-FYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              + V W+ +  D   +SP FYVQ+T FE GG S+G+SC+ L+AD +  T F+  WA +
Sbjct  134   AETVFWKDIDEDEPQYSPLFYVQVTNFESGGYSIGISCSILIADLLLGTDFLTKWAQI  191



>ref|XP_002974492.1| BAHD family acyltransferase, clade I [Selaginella moellendorffii]
 gb|EFJ24714.1| BAHD family acyltransferase, clade I [Selaginella moellendorffii]
Length=475

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 94/348 (27%), Positives = 151/348 (43%), Gaps = 40/348 (11%)
 Frame = -2

Query  1407  PLTVLDRVMEN--NFVRIVFYYRE------FDKDYTKLNESIAETLNAYTIIMGRLLRSP  1252
             PLT LD +  N     RI+FY  +      +D    KL  S+AETL  +  + GR     
Sbjct  27    PLTSLDFLNRNVACMQRILFYSLDLDSLDNYDSFVDKLKGSLAETLVRFYPLAGRFTDGE  86

Query  1251  GEQWLIKCNDAGLRVIEAKA-KGSVDEWL---HNVDRDKELKLVHWEPMMSDPYFWSPFY  1084
              E+  I CNDAG+  IEA   + S+ ++L   H +D   EL  V    +   P+  +P  
Sbjct  87    SEKPRINCNDAGVPFIEAAMLRKSLGDFLASPHCMDLCSELAHVESSELADAPHI-AP--  143

Query  1083  VQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplpprrpcnn  904
             V +T F+ GGL++G+S  H L D  S   F+K+W++++  G+ IS P  H          
Sbjct  144   VSVTRFKSGGLAVGVSYNHFLIDGYSFWHFMKSWSEVA-CGQSISLPPVHSREILISQPP  202

Query  903   nhnphhNSSGDLMNHYKKPTTDDGDKPPSQTS-SDRPKTISLLFTDEMVRACMSMA----  739
                        L  ++  P T   + P   ++   R  + S  F   +    M+ +    
Sbjct  203   VTYMS-----SLPRYFAIPATASMEAPIGFSNIQQRMYSFSAQFIRRLKLQAMAGSNGDI  257

Query  738   QTPDAFDALAGLLWTRISKAKNNVGLMD-----LAVGLDVRK--VLGLDKGFYGN--CMV  586
             Q   +F  L   +W  + +A+   GL +       VG+DVRK  V  L  G++GN  C V
Sbjct  258   QQVSSFRVLCAHIWRCLVRAR---GLEESEETRFFVGVDVRKRLVPCLPDGYFGNAVCAV  314

Query  585   YNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNN  442
             Y + +  +G ++  +   +     +           I  L+EW D+  
Sbjct  315   YAESR--AGELLSPEKGTAHGVRILSQAIAGATDGNIKSLLEWCDKQG  360



>gb|KDP41488.1| hypothetical protein JCGZ_15895 [Jatropha curcas]
Length=438

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 97/183 (53%), Gaps = 8/183 (4%)
 Frame = -2

Query  1500  IRSTMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYT  1324
             I  T+S  ++S  +   +VV   V    +   LT +D  ++ +++R V+++  E  +  T
Sbjct  2     ITPTLSTASLSG-VRLSSVVPAEVTSDKEDHKLTNIDLALKLHYIRGVYFFTAEAVQGLT  60

Query  1323  --KLNESIAETLNAYTIIMGRLLRSP-GEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDR  1153
               +L + +   L  Y  + GR+ RS  G +  IKCND G+R++EA    +++E +  + +
Sbjct  61    IYELKKPMFPWLAQYYTVSGRIRRSENGGRPFIKCNDGGVRIVEAYCDKTIEELMTAIAK  120

Query  1152  DKELK---LVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAW  982
             + E     LVH + +  D  F    Y+Q T F+ GG+S+GLS  HLL DP SA+ FI  W
Sbjct  121   NHEDHSRFLVHDQVLGPDLGFSPLVYIQFTWFKCGGMSVGLSWAHLLGDPFSASNFINMW  180

Query  981   ADM  973
                
Sbjct  181   GQF  183



>ref|XP_010042795.1| PREDICTED: acetyl-CoA-benzylalcohol acetyltransferase-like, partial 
[Eucalyptus grandis]
Length=322

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 80/151 (53%), Gaps = 13/151 (9%)
 Frame = -2

Query  1404  LTVLDRVMENNFVRIVFYYRE--------FDKDYTKLNESIAETLNAYTIIMGRLLRSPG  1249
             LT +D +   N+V ++FYYR+          +   ++ ES+++TL  +  + GR +    
Sbjct  26    LTSIDELQMPNYVGVIFYYRDNAGNPRVDISQRLHQMEESLSKTLTLFYPMAGRYIED-D  84

Query  1248  EQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYV-QLT  1072
             +   I CND G+  + AK  G +D+ LH   RD ++ L+ +     +    +P  V Q+ 
Sbjct  85    DGCFIDCNDLGVDFVHAKVDGQIDQLLH---RDPDMDLLEYLSQFPNNLVGNPLVVIQVN  141

Query  1071  EFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
              FE GG+++GL  TH ++D  +  +F+ +WA
Sbjct  142   TFECGGIAIGLRSTHRISDIYTMAIFVNSWA  172



>ref|XP_007039716.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY24217.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=365

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 94/172 (55%), Gaps = 25/172 (15%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYTK------LNESIAETLN  1291
             R V++  VV PG F              + +V YYR+ +++ +       + E++   L 
Sbjct  32    RQVLAGEVVDPGVF-----------QRCLNVVQYYRKENEEDSGWLVAGWIKETLGRALL  80

Query  1290  AYTIIMGRLLRSPGEQ----WLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK-ELKLVHW  1126
                +I GRL +  GEQ      I  ND G+R+IEA+ + ++ ++L    R++ E +LV W
Sbjct  81    EQPMICGRLRK--GEQNDGDLEIVSNDCGIRLIEARIQMNLSQFLDLKRREEAEAQLVFW  138

Query  1125  EPMMSD-PYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
             + +  + P F   FYVQ+T F+ GG S+G+SC+ LLAD +  T F+K WAD+
Sbjct  139   KDIDEESPQFSPLFYVQVTNFQCGGYSIGISCSILLADLMLGTEFLKTWADI  190



>ref|XP_002972181.1| hypothetical protein SELMODRAFT_441723 [Selaginella moellendorffii]
 gb|EFJ27098.1| hypothetical protein SELMODRAFT_441723 [Selaginella moellendorffii]
Length=439

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 89/168 (53%), Gaps = 13/168 (8%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFC--PLTVLDRVMENNFVRIVFYYRE------FDKDYTKLNESIAET  1297
             +TVVS   + P +    P++ LD ++ N ++  V Y+ +      ++ +  +LN S+AE 
Sbjct  37    KTVVS---IHPSQLAIHPVSKLDSILSNFYLHTVIYFDKVPTSSPWEVEREELNFSLAEV  93

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L+ +  + GRL         IK NDAG+RV+EA    S+ EWL         + +  E  
Sbjct  94    LDLFPSVSGRLRVLDNGNLGIKSNDAGIRVVEATCDSSLREWLEAEKDGSNRQQLLPEVR  153

Query  1116  MSDPYFWSPFY-VQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWAD  976
             +SD Y  SP   +Q T F  GGL+LGLS  H+LAD +S  + +K W +
Sbjct  154   ISD-YSVSPLLAIQYTLFRGGGLALGLSWCHILADFMSMDLLVKLWGE  200



>ref|XP_010042686.1| PREDICTED: acetyl-CoA-benzylalcohol acetyltransferase-like, partial 
[Eucalyptus grandis]
Length=322

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 80/151 (53%), Gaps = 13/151 (9%)
 Frame = -2

Query  1404  LTVLDRVMENNFVRIVFYYRE--------FDKDYTKLNESIAETLNAYTIIMGRLLRSPG  1249
             LT +D +   N+V ++FYYR+          +   ++ ES+++TL  +  + GR +    
Sbjct  26    LTSIDELQMPNYVGVIFYYRDNAGNPGVDISQRLHQMEESLSKTLTLFYPMAGRYIED-D  84

Query  1248  EQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYV-QLT  1072
             +   I CND G+  + AK  G +D+ LH   RD ++ L+ +     +    +P  V Q+ 
Sbjct  85    DGCFIDCNDLGVDFVHAKVDGQIDQLLH---RDPDMDLLEYLSQFPNNLVGNPLVVIQVN  141

Query  1071  EFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
              FE GG+++GL  TH ++D  +  +F+ +WA
Sbjct  142   TFECGGIAIGLRSTHRISDVHTMAIFVNSWA  172



>gb|AFG59486.1| hypothetical protein 2_4399_01, partial [Pinus taeda]
 gb|AFG59488.1| hypothetical protein 2_4399_01, partial [Pinus taeda]
 gb|AFG59489.1| hypothetical protein 2_4399_01, partial [Pinus taeda]
 gb|AFG59492.1| hypothetical protein 2_4399_01, partial [Pinus taeda]
 gb|AFG59495.1| hypothetical protein 2_4399_01, partial [Pinus taeda]
Length=160

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 86/166 (52%), Gaps = 15/166 (9%)
 Frame = -2

Query  711  AGLLWTRISKAKNNVGLMD--LAVGLDVRKVL--GLDKGFYGNCMVYNKVKWSSGSMVLG  544
            + L W   +KAK   G  +  L+V  + RK++   L  GF+GN + +++V  S+G +V G
Sbjct  1    SALFWIACTKAKGITGAEESKLSVCSEFRKIIIAPLPHGFFGNALHFSEVSSSAGDLV-G  59

Query  543  DDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNV-----LDGCDSLVCVNLEGV  379
            +DL S  A  I +    +DK+ +  ++EWLD+       +     L G + L  VN E  
Sbjct  60   NDL-SYPAKLIHDDIFRLDKDELRSVVEWLDKQKNSDGQLPPPFYLYGPN-LTAVNGEEF  117

Query  378  DPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTV  241
              Y A F   + P+HVSYYVEP  G G   LI+  P   G  SRTV
Sbjct  118  FTYDAVFEKELKPLHVSYYVEPVHGEG---LIMVLPSAEGGSSRTV  160



>ref|XP_010423797.1| PREDICTED: uncharacterized protein LOC104708853 [Camelina sativa]
Length=359

 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 93/178 (52%), Gaps = 18/178 (10%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVMENNFVR---IVFYYREF-DKDYTK-------LNESI  1306
             ++V+   V Q  K   ++V D V    F R   IV YY+E  D    K       + ES+
Sbjct  14    QSVMPVEVTQHRKVRSISVGDAVGAGIFRRTLNIVTYYKEAGDVSGEKAWLVAGWIKESL  73

Query  1305  AETLNAYTIIMGRLLR---SPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDK---E  1144
                L    ++ GRL R   +    + +  ND+G+R++EA+   S+ E+L  V +DK   E
Sbjct  74    GRALAEQPMLSGRLRRMKTAAEGGFEVVPNDSGVRLLEAQFPASLPEFLEMVKKDKSRAE  133

Query  1143  LKLVHWEPMMSDPYFWSP-FYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              + V W+ +  D   +SP FYVQ+T FE GG S+G+SC+ LLAD +  T F+  W  +
Sbjct  134   AETVFWKDIDEDEPQYSPLFYVQVTNFESGGYSVGISCSILLADLLLETDFLTKWVQI  191



>ref|XP_010068486.1| PREDICTED: acetyl-CoA-benzylalcohol acetyltransferase-like [Eucalyptus 
grandis]
Length=278

 Score = 80.1 bits (196),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 80/151 (53%), Gaps = 13/151 (9%)
 Frame = -2

Query  1404  LTVLDRVMENNFVRIVFYYRE--------FDKDYTKLNESIAETLNAYTIIMGRLLRSPG  1249
             LT +D +   N+V ++FYYR+          +   ++ ES+++TL  +  + GR ++   
Sbjct  26    LTSIDELQMPNYVGVIFYYRDNARNPGVDISQRLHQMEESLSKTLTLFYPMAGRYIKD-D  84

Query  1248  EQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFY-VQLT  1072
                 I CND G+  + AK  G +D+ LH   RD ++ L+ +     +    +P   +Q+ 
Sbjct  85    NGCFIDCNDLGVEFVHAKVDGQIDQLLH---RDPDMDLLEYLSQFPNNLVGNPLVLIQVN  141

Query  1071  EFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
              F+ GG+++GL  TH ++D  +  +F+ +WA
Sbjct  142   TFKCGGIAIGLRSTHRISDVCTIAIFVNSWA  172



>ref|XP_006283805.1| hypothetical protein CARUB_v10004904mg [Capsella rubella]
 gb|EOA16703.1| hypothetical protein CARUB_v10004904mg [Capsella rubella]
Length=421

 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 81/160 (51%), Gaps = 3/160 (2%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYT--KLNESIAETLNAYTI  1279
             TV +T   + G     T LD  M+ ++++ V+ Y  E  +D T  +L E++    +    
Sbjct  21    TVGATRPTEIGTTHEPTGLDLAMKLHYIKAVYIYSPETARDLTVRQLKEAMFMLFDQIAW  80

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
               GR  R    +  IKCND G R +E +   +V+EWL   DR  +  LV+ +P+  +  F
Sbjct  81    TTGRFSRRDSGRPYIKCNDCGTRFVEGQCNLTVEEWLSKPDRSVDEFLVYHQPIGPELTF  140

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
                 YVQ+T F+ GGLSLGLS  +++ D  S       WA
Sbjct  141   SPLIYVQMTRFKCGGLSLGLSWANIIGDSFSLFYAFNLWA  180



>ref|XP_008439396.1| PREDICTED: vinorine synthase-like [Cucumis melo]
Length=265

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 89/173 (51%), Gaps = 22/173 (13%)
 Frame = -2

Query  1455  KRTVVSTNVVQPGKFCP-------LTVLDRVMENNFVRIVFYYREFDKDYT----KLNES  1309
             K  ++ST  ++P    P       L+ LD+    ++  ++F+Y   D D+     KL ES
Sbjct  8     KIEIISTETIKPSSPTPSTHRHHKLSFLDQFAPASYTPLLFFYPG-DADHRDRCRKLKES  66

Query  1308  IAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKEL-KLV  1132
             +AETL+ + ++ G L+    E +L++CND G+   EA+  GS+ E + N +    L +L+
Sbjct  67    LAETLSRFYLLAGTLV----EDYLVECNDEGVAFSEARVSGSLSEVMENPNDVASLHRLL  122

Query  1131  HWEPMMSDPYFWSP--FYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
              + P   D          VQ   FE GG  +GL  TH + D  SA+MF KAWA
Sbjct  123   PFHP---DAVLERECILGVQYNVFECGGAVIGLCVTHKVVDGTSASMFTKAWA  172



>ref|XP_006648896.1| PREDICTED: uncharacterized protein LOC102705051 [Oryza brachyantha]
Length=252

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 63/103 (61%), Gaps = 3/103 (3%)
 Frame = -2

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVD-RDKELKLVHWEPMMSD-P  1105
             + GRL R     W +K ND G+R+++A     +DE+L   D   +EL L  W  + +D P
Sbjct  1     MAGRLRRRADRSWEVKLNDTGVRLLQATVDAPLDEFLAAKDLARRELALAPWTDVNADDP  60

Query  1104  YFWSPFYVQLTEFE-EGGLSLGLSCTHLLADPISATMFIKAWA  979
                 PF++QLT F+ +GG ++G+SC  LLADP+S   F+++WA
Sbjct  61    DMCPPFFMQLTRFQGDGGYAVGVSCALLLADPLSLARFLQSWA  103



>ref|XP_002977492.1| hypothetical protein SELMODRAFT_443493 [Selaginella moellendorffii]
 gb|EFJ21496.1| hypothetical protein SELMODRAFT_443493 [Selaginella moellendorffii]
Length=439

 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 89/168 (53%), Gaps = 13/168 (8%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFC--PLTVLDRVMENNFVRIVFYYRE------FDKDYTKLNESIAET  1297
             +TVVS   + P +    P++ LD ++ N ++  V Y+ +      ++ +  +LN S+AE 
Sbjct  37    KTVVS---IHPSQLAIHPVSKLDSILGNFYLHTVIYFDKVPTSSPWEVEREELNFSLAEV  93

Query  1296  LNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPM  1117
             L+ +  + GRL         IK NDAG+RV+EA    S+ EWL         + +  E  
Sbjct  94    LDLFPSVSGRLRVLDNGNLGIKSNDAGIRVVEATCDSSLREWLEAEKDGSNRQQLLPEVR  153

Query  1116  MSDPYFWSPFY-VQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWAD  976
             +SD Y  SP   +Q T F  GGL+LGLS  H+LAD +S  + +K W +
Sbjct  154   ISD-YSVSPLLAIQYTLFRGGGLALGLSWCHILADFMSMDLLVKLWGE  200



>emb|CBI29522.3| unnamed protein product [Vitis vinifera]
Length=282

 Score = 79.7 bits (195),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 75/125 (60%), Gaps = 7/125 (6%)
 Frame = -2

Query  1320  LNESIAETLNAYTIIMGRLLR---SPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRD  1150
             + ES+   L    ++ GRL R   S GE + I  ND+G+R++EA+   ++ E+L   D +
Sbjct  43    IRESLGRALVEQPLLGGRLRRVGDSEGE-FEIVSNDSGVRLMEARTSMALSEFLELKDWE  101

Query  1149  --KELKLVHWEPM-MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
               +  +LV W+ +   +P F+  FYVQ+T FE GG S+G+SC+ LLADP+    F+K WA
Sbjct  102   AVEADQLVFWKDIDGQNPQFYPLFYVQVTNFERGGYSIGISCSLLLADPLGMASFLKRWA  161

Query  978   DMSFT  964
              +  T
Sbjct  162   SIHNT  166



>ref|XP_010277517.1| PREDICTED: protein ECERIFERUM 1-like [Nelumbo nucifera]
Length=433

 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 85/165 (52%), Gaps = 9/165 (5%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE------FDKDYTKLNESIAETLNA  1288
             +VV  ++    +    + +D  ++ +++R +++++          DY K    + + L  
Sbjct  17    SVVPASITGEDRVHEFSSMDLALKLHYLRGLYFFKSNMVQGLTIYDYKK---HLFKWLEI  73

Query  1287  YTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSD  1108
               ++ GR+ RS   +  IKCND G+RVIEA+   ++D+WL   D     +L   + +  D
Sbjct  74    NGVLSGRIRRSESGRPSIKCNDGGVRVIEAQCSNTLDQWLEMNDYSLHRRLFPNQVLGPD  133

Query  1107  PYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
               F     VQ T F+ GG+S+GLS  H+L DP SA+  I  WA M
Sbjct  134   LGFSPLILVQFTWFKCGGVSVGLSWAHVLGDPFSASRLINIWAQM  178



>gb|ACF84244.1| unknown [Zea mays]
 gb|ACF85981.1| unknown [Zea mays]
Length=314

 Score = 79.7 bits (195),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 71/120 (59%), Gaps = 7/120 (6%)
 Frame = -2

Query  1317  NESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNV-DRDK--  1147
              ES++E +  +  + GRL R     W +K NDAG+R  EA A+ ++DE+L    D+D+  
Sbjct  4     KESLSEAVADHPEMGGRLRRHADGSWEVKLNDAGVRFTEATAEATLDEFLATAQDKDRAP  63

Query  1146  --ELKLVHWEPM-MSDPYFWSPFYVQLTEFE-EGGLSLGLSCTHLLADPISATMFIKAWA  979
               E  L  W  +   DP   +  YVQLT F+ +GG ++G+SC+ +L+DP+S   F+ +WA
Sbjct  64    SWEAALAPWADVNAEDPDVSALVYVQLTRFQGDGGFAVGVSCSLMLSDPLSLARFLASWA  123



>ref|XP_011084205.1| PREDICTED: protein ECERIFERUM 26-like [Sesamum indicum]
Length=434

 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 86/170 (51%), Gaps = 3/170 (2%)
 Frame = -2

Query  1491  TMSEDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY--REFDKDYT-K  1321
              M+ D +   I   +V   NV           +   M+ +++R ++Y+  + F+   T  
Sbjct  7     AMAADGLVYNIKISSVGPANVTGSDLIYEPETMGLAMKLHYIRGIYYFGSQAFEGLSTLV  66

Query  1320  LNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKEL  1141
             + E +   LN Y  + GR  R+   +  +KCND G+R +EAK   ++DEWL   D   E 
Sbjct  67    IKEPMFTWLNKYPQVCGRFRRTETGRAYLKCNDCGVRFVEAKCDKTLDEWLEMKDATLEK  126

Query  1140  KLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFI  991
              LV  + +  +  F    Y+QLT+F+ GG ++GLS +H+L D  SA  F+
Sbjct  127   LLVRDQALGPELGFSPLVYIQLTKFKCGGTAVGLSWSHVLGDAFSAAEFM  176



>gb|AEW08258.1| hypothetical protein 2_4399_01, partial [Pinus radiata]
Length=160

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 85/166 (51%), Gaps = 15/166 (9%)
 Frame = -2

Query  711  AGLLWTRISKAKNNVGLMD--LAVGLDVRKVL--GLDKGFYGNCMVYNKVKWSSGSMVLG  544
            + L W   +KAK   G  +  L+V  + RK++   L  GF+GN + +++V  S+G +V G
Sbjct  1    SALFWIACTKAKGITGAEESKLSVCSEFRKIIIAPLPHGFFGNALHFSEVSSSAGDLV-G  59

Query  543  DDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNV-----LDGCDSLVCVNLEGV  379
            +DL S  A  I +    +DK+ +  ++EWLD        +     L G + L  VN E  
Sbjct  60   NDL-SYPAKLIHDDIFRLDKDELRSVVEWLDNQKNSDGQLPPPFYLYGPN-LTAVNGEEF  117

Query  378  DPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTV  241
              Y A F   + P+HVSYYVEP  G G   LI+  P   G  SRTV
Sbjct  118  FTYDAVFEKELKPLHVSYYVEPVHGEG---LIMVLPSAEGGSSRTV  160



>ref|XP_006370897.1| hypothetical protein POPTR_0019s01520g [Populus trichocarpa]
 gb|ERP48694.1| hypothetical protein POPTR_0019s01520g [Populus trichocarpa]
Length=440

 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 79/151 (52%), Gaps = 13/151 (9%)
 Frame = -2

Query  1404  LTVLDRVMENNFVRIVFYYREFDKD---------YTKLNESIAETLNAYTIIMGRLLRSP  1252
             ++  D+  +N++V    +Y   +++           +L ES++E L  Y    GR     
Sbjct  26    ISSFDQHGQNHYVPSFHFYPANEEECGVISNAEKSLRLQESLSEVLTLYYPFAGRY---S  82

Query  1251  GEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLT  1072
              ++ LI+CND G   +EA+  GS+ + L + + + +L+  H+ P M DP    P  VQ  
Sbjct  83    SDEPLIECNDKGAEYLEAQVAGSLSQLLSDEELETQLQ-NHFVPPMFDPISSPPLVVQFN  141

Query  1071  EFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
              FE GG+++G+S TH + D  SA  FI AWA
Sbjct  142   RFECGGIAIGVSMTHKMVDAFSAFGFITAWA  172



>ref|XP_006418831.1| hypothetical protein EUTSA_v10002536mg [Eutrema salsugineum]
 gb|ESQ37267.1| hypothetical protein EUTSA_v10002536mg [Eutrema salsugineum]
Length=429

 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 75/144 (52%), Gaps = 3/144 (2%)
 Frame = -2

Query  1404  LTVLDRVMENNFVRIVFYYR-EFDKD--YTKLNESIAETLNAYTIIMGRLLRSPGEQWLI  1234
             LT LD  ++ ++++ V+ Y  E  +D   T +   +    +    I GR  R    +  I
Sbjct  34    LTGLDLALKLHYLKAVYIYSAETARDLTVTHVKGPLFTVFDQIPWITGRFRRHDSGRPFI  93

Query  1233  KCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGG  1054
             KCND G R +E+    +V+EWL   +R  +  LV+ +P+  +  +    Y+Q+T F+ GG
Sbjct  94    KCNDCGTRFVESHCDLTVEEWLRVPNRSVDESLVYHQPVGPELAYSPLVYIQMTRFKCGG  153

Query  1053  LSLGLSCTHLLADPISATMFIKAW  982
             L+ GLS  H++ DP S + F   W
Sbjct  154   LAFGLSWAHIMGDPFSLSHFFNLW  177



>gb|AFG59491.1| hypothetical protein 2_4399_01, partial [Pinus taeda]
Length=160

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 85/166 (51%), Gaps = 15/166 (9%)
 Frame = -2

Query  711  AGLLWTRISKAKNNVGLMD--LAVGLDVRKVL--GLDKGFYGNCMVYNKVKWSSGSMVLG  544
            + L W   +KAK   G  +  L V  + RK++   L  GF+GN + +++V  S+G +V G
Sbjct  1    SALFWIACTKAKGITGAEESKLLVCSEFRKIIIAPLPHGFFGNALHFSEVSSSAGDLV-G  59

Query  543  DDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNV-----LDGCDSLVCVNLEGV  379
            +DL S  A  I +    +DK+ +  ++EWLD+       +     L G + L  VN E  
Sbjct  60   NDL-SYPAKLIHDDIFRLDKDELRSVVEWLDKQKNSDGQLPPPFYLYGPN-LTAVNGEEF  117

Query  378  DPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTV  241
              Y A F   + P+HVSYYVEP  G G   LI+  P   G  SRTV
Sbjct  118  FTYDAVFEKELKPLHVSYYVEPVHGEG---LIMVLPSAEGGSSRTV  160



>gb|KCW63861.1| hypothetical protein EUGRSUZ_G01530, partial [Eucalyptus grandis]
Length=434

 Score = 80.9 bits (198),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 79/151 (52%), Gaps = 13/151 (9%)
 Frame = -2

Query  1404  LTVLDRVMENNFVRIVFYYRE--------FDKDYTKLNESIAETLNAYTIIMGRLLRSPG  1249
             LT +D +   N+V ++FYYR+          +   ++ ES+++TL  +  + GR +    
Sbjct  26    LTSIDELQMPNYVGVIFYYRDDAGNPRVDISQRLHQMEESLSKTLTLFYPMAGRYIED-D  84

Query  1248  EQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYV-QLT  1072
                 I CND G+  + AK  G +D+ LH   RD ++ L+ +     +    +P  V Q+ 
Sbjct  85    YGCFIDCNDLGVEFVHAKVDGQIDQLLH---RDPDMDLLEYLSQFPNNSVGNPLVVIQVN  141

Query  1071  EFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
              FE GG+++GL  TH ++D  +  +FI +WA
Sbjct  142   TFECGGIAIGLRSTHRISDVCTIAIFINSWA  172



>ref|XP_004247878.1| PREDICTED: protein ECERIFERUM 26-like [Solanum lycopersicum]
Length=427

 Score = 80.9 bits (198),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 87/345 (25%), Positives = 152/345 (44%), Gaps = 19/345 (6%)
 Frame = -2

Query  1395  LDRVMENNFVRIVFYY--REFDK-DYTKLNESIAETLNAYTIIMGRLLRSPGEQWLIKCN  1225
             +D  M+ +++R ++Y+  + F      K+ E I    N + +  GR  R+   +  IKCN
Sbjct  36    MDLAMKLHYLRGIYYFDSQAFQGVTIYKIKEPIFIWFNYFYMTNGRFRRAESGRPYIKCN  95

Query  1224  DAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSL  1045
             D G R IEA+   ++DEWL   D   E  LV  + +  +  F  P  +Q T+F+ GG+SL
Sbjct  96    DCGARFIEAQCDKTLDEWLEMKDTSLEKLLVSNQVLGPELAFSPPVLIQHTKFKCGGISL  155

Query  1044  GLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplpprrpcnnnhnphhNSSGDLM  865
             GLS  H+L D  SAT F   W   +F GK++                  N        + 
Sbjct  156   GLSWAHVLGDIFSATEF---W---NFLGKVVGGYQPPRPINLAHSLTKANSTETLQKIVE  209

Query  864   NHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMVRACMSMAQTPDAFDALAGLLWTRIS  685
             +       D  +      +S + ++ S+  +   +    S       F++L  ++W  IS
Sbjct  210   DPLSIKRVDPVEDHWVANASYKLESFSIHVSASKLGQLQSRIGIQGPFESLCSIIWQSIS  269

Query  684   KAKNNVGLMDLAVGLDVRKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRN  505
             + ++  G     V +  +     + G  GN  +   VK       + D   S+ A  I+N
Sbjct  270   RIRDGPG--PKVVTICKKGEEKKEGGLIGNTQLIGVVKVDDS---IRDANPSELARLIKN  324

Query  504   MRKEMDKEGIMDLIEWLDQNNCCASNVLDGCDSLVCVNLEGVDPY  370
               + +D+   +D  E +++ +  +  ++ G + L  V+LEGVD Y
Sbjct  325   --EIIDERLKID--EAIEKEHGVSDVIVYGAN-LTFVSLEGVDLY  364



>ref|XP_010448555.1| PREDICTED: protein ECERIFERUM 1-like [Camelina sativa]
Length=417

 Score = 80.5 bits (197),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 96/171 (56%), Gaps = 14/171 (8%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYT--KLNESIAETLNAYTII  1276
             +VV  +VV   K   LT +D  M+ ++VR V Y+ +  +D+T   L  ++   L +   +
Sbjct  13    SVVPASVVGENKPRALTPMDLAMKLHYVRAV-YFLKGKRDFTVSDLKSTMFTLLQSNYHV  71

Query  1275  MGRLLRSPGEQ--------WLIKCNDAGLRVIEAKAKG-SVDEWLHNVDRDKELKLVHWE  1123
              GR+ R P             I+CND+G+R++EA  +  +V++WL   DR  + + + ++
Sbjct  72    SGRI-RMPENDNDPSGLALPYIRCNDSGIRIVEANVEEFTVEKWLDLEDRSIDHRFLVYD  130

Query  1122  PMMSDPYFWSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              ++    F+SP  ++Q+T+F+ GG S+G+S TH+L D  SA+ F+K    +
Sbjct  131   HVLGPDLFFSPLVFLQITQFKCGGFSIGMSWTHVLGDVFSASTFMKTLGQL  181



>gb|ADL62855.1| hydroxycinnamoyl-CoA transferase 2 [Cynara cardunculus var. scolymus]
Length=432

 Score = 80.5 bits (197),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 86/351 (25%), Positives = 147/351 (42%), Gaps = 33/351 (9%)
 Frame = -2

Query  1446  VVSTNVVQPGKFCPLTV-----LDRVMENNFVRIVFYYRE------FDKDYTKLNESIAE  1300
             +  ++ VQP +  P +      LD V+    +  V++YR       FD D  K  +++A+
Sbjct  5     IKHSSFVQPSQPTPSSTIWTSNLDLVVGRIHILTVYFYRPNGASNFFDADVMK--KALAD  62

Query  1299  TLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEP  1120
              L ++  + GR+ R    +  I CN  G+  +EA+   ++D++       +  +L     
Sbjct  63    VLVSFYPMAGRISRDRNGRLEINCNGEGVLFVEAELDSTLDDFGEFTPSPELRRLTPTVD  122

Query  1119  MMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpph  940
                D   +  F+ Q+T F+ GG++LG    H LAD +S+  FI  W+DM+  G  I+   
Sbjct  123   YSGDISSYPLFFAQVTHFKCGGVALGCGVFHALADGLSSIHFINTWSDMA-RGLSIA---  178

Query  939   fhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDEMV  760
                 P               + D + ++  P+     + P   SS +P T  L  T + +
Sbjct  179   --IPPFIDRTLLRAREPPTPTFDHIEYHAPPSMKTISQNPE--SSRKPSTTVLKLTLDQL  234

Query  759   RACMSMAQ------TPDAFDALAGLLWTRISKAKN--NVGLMDLAVGLDVRKVLG--LDK  610
                 +  +      T   ++ LA  LW    KA+   +  L  L V  D R  L   L  
Sbjct  235   NVLKASTKNDGSNTTYSTYEILAAHLWRCACKARGLPDDQLTKLYVATDGRSRLSPQLPP  294

Query  609   GFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEW  457
             G+ GN +        SG +      LS AA+ IR    +MD   +   I++
Sbjct  295   GYLGNVVFTTTPVAKSGDLTTQS--LSNAASLIRTTLTKMDNNYLRSAIDY  343



>gb|EMS63107.1| Agmatine coumaroyltransferase-1 [Triticum urartu]
Length=342

 Score = 79.7 bits (195),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 86/168 (51%), Gaps = 22/168 (13%)
 Frame = -2

Query  1461  ICKRTVVSTNVVQPGKFCPLTV----LDRVMENNFVRIVFYYREFDKDYTK---LNESIA  1303
             +  +T + T VV+P +   + V    L   +  + +R V YYR  D  + +   + ES+ 
Sbjct  15    VSVQTGLPTRVVEPERTRLIAVATPPLSETVLQHRLRAVLYYRTDDAPWEEGIWVKESLG  74

Query  1302  ETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWE  1123
             E L  +  I GRL R     W +K NDAG+R  +A  + +++++L +  R+ E  L  W 
Sbjct  75    EVLCFFPEIAGRLRRGTSGSWGVKLNDAGVRFQQATVEVTMEDFLADQGRN-EAALAPW-  132

Query  1122  PMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
                          + L++F+ GG ++G+SCT LL+DP+S   F+  WA
Sbjct  133   -------------INLSQFQGGGYAIGVSCTVLLSDPLSLARFLLTWA  167



>ref|XP_010068488.1| PREDICTED: acetyl-CoA-benzylalcohol acetyltransferase-like [Eucalyptus 
grandis]
 gb|KCW63852.1| hypothetical protein EUGRSUZ_G01521 [Eucalyptus grandis]
Length=418

 Score = 80.5 bits (197),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 80/151 (53%), Gaps = 13/151 (9%)
 Frame = -2

Query  1404  LTVLDRVMENNFVRIVFYYRE--------FDKDYTKLNESIAETLNAYTIIMGRLLRSPG  1249
             LT +D +   N+V ++FYYR+          +   ++ ES+++TL  +  + GR +    
Sbjct  26    LTSIDELQMPNYVGVIFYYRDNAGNPRVDISQRLHQMEESLSKTLTLFYPMAGRYIED-D  84

Query  1248  EQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYV-QLT  1072
             +   I CND G+  + AK  G +D+ LH   RD ++ L+ +     +    +P  V Q+ 
Sbjct  85    DGCFIDCNDLGVDFVHAKVDGQIDQLLH---RDPDMDLLEYLSQFPNNLVGNPLVVIQVN  141

Query  1071  EFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
              FE GG+++GL  TH ++D  +  +F+ +WA
Sbjct  142   TFECGGIAIGLRSTHRISDIYTMAIFVNSWA  172



>gb|EPS62865.1| hypothetical protein M569_11925, partial [Genlisea aurea]
Length=417

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 93/181 (51%), Gaps = 8/181 (4%)
 Frame = -2

Query  1482  EDNISSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYT--KLNE  1312
             + +I S I   TVV  +V   G     T  D   + +++  +  +  E  KD T   L E
Sbjct  1     DGDIISGIRLSTVVPASVAGEGISHHFTNTDLAFKLHYLSTLHLFTGEAAKDLTIADLKE  60

Query  1311  SIAETLNAYTIIMGRLLRSPGE-QWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKL  1135
              + + L  Y  I GR+ R   + +  +KCND+G+R++EA    +V EW+   D  +   L
Sbjct  61    PMFQWLRVYYGICGRIRRDDSDGRLFLKCNDSGVRIVEAICSKTVAEWIDGGDYQR--GL  118

Query  1134  VHWEPMMSDPYFWSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGK  958
             V+ +P + D + ++P  ++QLT F+ GGL +G+   H++ D   A   IKAW  +   G+
Sbjct  119   VYHQPFLGDNFEFTPLVFLQLTRFKCGGLGVGMRWAHIIGDGFKALDSIKAWGKI-LAGE  177

Query  957   M  955
             M
Sbjct  178   M  178



>gb|KHF97666.1| Taxadien-5-alpha-ol O-acetyltransferase [Gossypium arboreum]
Length=362

 Score = 79.7 bits (195),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 95/170 (56%), Gaps = 21/170 (12%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYTKL-----NESIAETLNA  1288
             R V++  +V PG F       R +  N V+  +Y +E ++D   L      E++   L+ 
Sbjct  32    RQVLAGELVGPGIF------QRCL--NVVQ--YYMKEKEEDSGWLLAGWIKETLGRALHE  81

Query  1287  YTIIMGRLL---RSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDR-DKELKLVHWEP  1120
               +I GRL    R+ GE  ++  ND G+R+IEA+ + ++ ++L    R D E +LV W+ 
Sbjct  82    QPMISGRLRKGERNDGELEIVS-NDCGIRLIEARIQMNLSDFLDLKQREDAEAQLVFWKD  140

Query  1119  M-MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
             +   +P F   FYVQ+T F+ GG S+G+SC+ LLAD +    F+K WAD+
Sbjct  141   IDEQNPQFSPLFYVQVTNFQCGGYSIGISCSILLADLLLMKEFLKTWADI  190



>ref|XP_010068494.1| PREDICTED: acetyl-CoA-benzylalcohol acetyltransferase-like [Eucalyptus 
grandis]
Length=450

 Score = 80.5 bits (197),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 79/151 (52%), Gaps = 13/151 (9%)
 Frame = -2

Query  1404  LTVLDRVMENNFVRIVFYYRE--------FDKDYTKLNESIAETLNAYTIIMGRLLRSPG  1249
             LT +D +   N+V ++FYYR+          +   ++ ES+++TL  +  + GR +    
Sbjct  26    LTSIDELQMPNYVGVIFYYRDDAGNPRVDISQRLHQMEESLSKTLTLFYPMAGRYIED-D  84

Query  1248  EQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYV-QLT  1072
                 I CND G+  + AK  G +D+ LH   RD ++ L+ +     +    +P  V Q+ 
Sbjct  85    YGCFIDCNDLGVEFVHAKVDGQIDQLLH---RDPDMDLLEYLSQFPNNSVGNPLVVIQVN  141

Query  1071  EFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
              FE GG+++GL  TH ++D  +  +FI +WA
Sbjct  142   TFECGGIAIGLRSTHRISDVCTIAIFINSWA  172



>ref|XP_010677119.1| PREDICTED: protein ECERIFERUM 26-like [Beta vulgaris subsp. vulgaris]
Length=374

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 70/118 (59%), Gaps = 2/118 (2%)
 Frame = -2

Query  1320  LNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDR-DKE  1144
             + +S+   L  + I  GR+ RS      I  ND+G+R +EA+   S+ E+L   ++ D E
Sbjct  78    IKQSLGNALMEHPIAAGRIRRSENGGLEILSNDSGVRCVEARVSLSLVEFLQFQEKNDVE  137

Query  1143  LKLVHWEPM-MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              KLV+W  +  ++P F   FYVQ+T F+ GG S+G+S + LLADP+    F+ +WA +
Sbjct  138   TKLVYWNHVDETNPLFSPLFYVQVTNFQCGGYSIGISFSLLLADPLFMAKFLNSWAKI  195



>ref|XP_002991534.1| probable hydroxycinnamoyl transferase [Selaginella moellendorffii]
 gb|EFJ07456.1| probable hydroxycinnamoyl transferase [Selaginella moellendorffii]
Length=449

 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 93/367 (25%), Positives = 153/367 (42%), Gaps = 44/367 (12%)
 Frame = -2

Query  1446  VVSTNVVQPGKFCPLTVL-----DRVMENNFVRIVFYYR------EFDKDYTKLNESIAE  1300
             VV   +V+P    P  VL     D V+       V++YR      E   +   L E++A+
Sbjct  5     VVRETMVRPAGATPQRVLWNSNVDLVIPRIHTASVYFYRPDPSGGEGYFEGGVLREALAK  64

Query  1299  TLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKA-KGSVDEWLHNVDRDKEL-KLVHW  1126
              L  +  + GRL +    ++ I CN  G+ ++EA A   SVDE+  +   D    +L+  
Sbjct  65    ALVPFYPMAGRLKKDENGRFEINCNGEGVLLVEAAAANASVDEYARDFAPDVSFQRLIPS  124

Query  1125  EPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFT--GKMI  952
                  D   +    +Q+T F+ GG SLG+   H +AD +S   FI  WA M+     K++
Sbjct  125   VDYTQDIGSFPLLVLQITRFKCGGASLGVGMEHHVADGMSGITFINTWAAMARGEDPKIV  184

Query  951   SpphfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISL---  781
                    L   +P              L+ H          K   Q   D P  I++   
Sbjct  185   PYIDRTLLRANKPPIPKFPHVEYHPPPLLKHAAATNGHSNGKAKPQAGDDAPPRIAVGLF  244

Query  780   LFTDEMVRACMSMA------QTPDAFDALAGLLWTRISKAKNNVGLMD-------LAVGL  640
              FT E ++A  S A       T  +++ L+G +W  +  A+   GL D       +A   
Sbjct  245   KFTKEQLQALKSQATDEETNTTYSSYEMLSGHIWRSMCLAR---GLDDDQETKLYIATDG  301

Query  639   DVRKVLGLDKGFYGNCMVYNKVKWSSGSMVLGDDLLSQ----AANAIRNMRKEMDKEGIM  472
               R V  L K ++GN +      ++   M L  DL+S+    AA+ I +    M+ E + 
Sbjct  302   RARVVPPLPKHYFGNVI------FTCTPMALAGDLVSRPLYYAASVIHDAVSRMNDEYLR  355

Query  471   DLIEWLD  451
               +++L+
Sbjct  356   SALDYLE  362



>ref|XP_008668901.1| PREDICTED: protein ECERIFERUM 26-like [Zea mays]
 tpg|DAA36075.1| TPA: glossy2 [Zea mays]
Length=426

 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 96/173 (55%), Gaps = 13/173 (8%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYTK-LNESIAETLNAYTIIM  1273
             TVV ++V     +  L   D   + +++R V+YYR  D   TK L + +   L+ +  + 
Sbjct  23    TVVPSSVTGEVDYA-LADADLAFKLHYLRGVYYYRSGDGLATKVLKDPMFPWLDDHFPVA  81

Query  1272  GRLLRSPGE------QWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMS  1111
             GR+ R+  E      +  IKCND G+R++EA+    + EW+ +    + ++ + ++ ++ 
Sbjct  82    GRVRRAEAEGDGAPRRPYIKCNDCGVRIVEARCDRDMAEWIRDAAPGR-IRQLCYDKVLG  140

Query  1110  DPYFWSP-FYVQLTEFEEGGLSLGLSCTHLLAD-PISATMFIKAWADMSFTGK  958
                F+SP  YVQ+T F+ GGL+LG S  HL+ D P +AT F K WA +  +GK
Sbjct  141   PELFFSPLLYVQITNFKCGGLALGFSWAHLIGDIPSAATCFNK-WAQI-LSGK  191



>ref|XP_010023659.1| PREDICTED: protein ECERIFERUM 26-like [Eucalyptus grandis]
Length=437

 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 73/135 (54%), Gaps = 4/135 (3%)
 Frame = -2

Query  1392  DRVMENNFVRIVFYYREFDKD---YTKLNESIAETLNAYTIIMGRLLRSPGEQWLIKCND  1222
             D  M+ +++R V+++     +     ++ ES+      Y  + GR  RS   +  IKCND
Sbjct  36    DLAMKLHYLRGVYFFAGPAVEGLTVPRIKESMFSWCTDYYAVCGRFRRSDSGRPYIKCND  95

Query  1221  AGLRVIEAKAKGSVDEWLHNVDRDKEL-KLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSL  1045
              G+R +EA+   +VDEWL        L  LV  + +  +P+F     VQ+T F+ GG+SL
Sbjct  96    CGVRFVEAECDSTVDEWLEADGHGSLLGPLVSHQVVGPEPFFSPTCLVQVTRFKCGGMSL  155

Query  1044  GLSCTHLLADPISAT  1000
             GLS  H+L DP SA+
Sbjct  156   GLSWAHVLGDPFSAS  170



>gb|AFG59487.1| hypothetical protein 2_4399_01, partial [Pinus taeda]
 gb|AFG59490.1| hypothetical protein 2_4399_01, partial [Pinus taeda]
 gb|AFG59493.1| hypothetical protein 2_4399_01, partial [Pinus taeda]
 gb|AFG59494.1| hypothetical protein 2_4399_01, partial [Pinus taeda]
 gb|AFG59496.1| hypothetical protein 2_4399_01, partial [Pinus taeda]
Length=160

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 85/166 (51%), Gaps = 15/166 (9%)
 Frame = -2

Query  711  AGLLWTRISKAKNNVGLMD--LAVGLDVRKVL--GLDKGFYGNCMVYNKVKWSSGSMVLG  544
            + L W   +KAK   G  +  L+V  + RK++   L  GF+GN + +++V  S+G +V G
Sbjct  1    SALFWIACTKAKGITGAEESKLSVCSEFRKIIIAPLPHGFFGNALHFSEVSSSAGDLV-G  59

Query  543  DDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNV-----LDGCDSLVCVNLEGV  379
            +DL S  A  I +    +DK+ +  ++EWLD+       +     L G + L  VN E  
Sbjct  60   NDL-SYPAKLIHDDIFRLDKDELRSVVEWLDKQKNSDGQLPPPFYLYGPN-LTAVNGEEF  117

Query  378  DPYSACFGNNMDPVHVSYYVEPEIGPGNRLLILPSPPGTGALSRTV  241
              Y A F   + P+HVSYYVEP  G G   LI+  P      SRTV
Sbjct  118  FTYDAVFEKELKPLHVSYYVEPVHGEG---LIMVLPSAEAGSSRTV  160



>ref|XP_010243469.1| PREDICTED: protein ECERIFERUM 26-like [Nelumbo nucifera]
Length=434

 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 76/144 (53%), Gaps = 3/144 (2%)
 Frame = -2

Query  1395  LDRVMENNFVRIVFYYREFDKD---YTKLNESIAETLNAYTIIMGRLLRSPGEQWLIKCN  1225
             +D  M+ +++R V+++     +     K+ E++ + L  Y    GR  RS   +  IKCN
Sbjct  36    MDLAMKLHYLRGVYFFSSSSVEGFTIPKIKETMFQWLELYYHASGRFRRSESGRPFIKCN  95

Query  1224  DAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFYVQLTEFEEGGLSL  1045
             D G+R IEAK   ++DEWL   D     + V  + +  +  F     +Q+T F+ GG+++
Sbjct  96    DCGVRFIEAKCSQTLDEWLEIKDFSTHCRFVSNQVIGPELPFSPLVLLQITWFKCGGMAV  155

Query  1044  GLSCTHLLADPISATMFIKAWADM  973
             G+S  H+L D  SA+ FI  W  +
Sbjct  156   GVSWAHVLGDAFSASNFINMWGQV  179



>gb|KCW63851.1| hypothetical protein EUGRSUZ_G01520 [Eucalyptus grandis]
Length=411

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 80/151 (53%), Gaps = 13/151 (9%)
 Frame = -2

Query  1404  LTVLDRVMENNFVRIVFYYRE--------FDKDYTKLNESIAETLNAYTIIMGRLLRSPG  1249
             LT +D +   N+V ++FYYR+          +   ++ ES+++TL  +  + GR ++   
Sbjct  26    LTSIDELQMPNYVGVIFYYRDNARNPGVDISQRLHQMEESLSKTLTLFYPMAGRYIKD-D  84

Query  1248  EQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYFWSPFY-VQLT  1072
                 I CND G+  + AK  G +D+ LH   RD ++ L+ +     +    +P   +Q+ 
Sbjct  85    NGCFIDCNDLGVEFVHAKVDGQIDQLLH---RDPDMDLLEYLSQFPNNLVGNPLVLIQVN  141

Query  1071  EFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
              F+ GG+++GL  TH ++D  +  +F+ +WA
Sbjct  142   TFKCGGIAIGLRSTHRISDVCTIAIFVNSWA  172



>gb|EMT21936.1| Taxadien-5-alpha-ol O-acetyltransferase [Aegilops tauschii]
Length=425

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 78/137 (57%), Gaps = 7/137 (5%)
 Frame = -2

Query  1368  VRIVFYYREFDKDYTK---LNESIAETLNAYTIIMGRLLR-SPGE-QWLIKCNDAGLRVI  1204
             +R+V YY   D  + +   + ES+ E L  +  + GRL R + G+  W +K NDAG+R  
Sbjct  195   LRVVLYYSADDAPWEEGIWVRESLGEALCFFPEMAGRLRRRADGDGSWEVKLNDAGVRFQ  254

Query  1203  EAKAKGSVDEWLHNVDR-DKELKLVHW-EPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCT  1030
             +A  + S++ +L + DR  KE  L  W +    DP   S  ++QL  F++GG ++G+SCT
Sbjct  255   QATVEMSMEAFLADKDRARKEAALAPWVDVSAEDPDMCSLLFMQLNRFQDGGYAMGVSCT  314

Query  1029  HLLADPISATMFIKAWA  979
              LL DP+S   F+  WA
Sbjct  315   VLLCDPLSLARFLLTWA  331



>emb|CDX80844.1| BnaC03g00980D [Brassica napus]
Length=362

 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 70/126 (56%), Gaps = 10/126 (8%)
 Frame = -2

Query  1320  LNESIAETLNAYTIIMGRL-----LRSPGEQWL-IKCNDAGLRVIEAKAKGSVDEWLHNV  1159
             + ES+   L ++ +I GRL       +  E  L +  ND G+R++EA+   S+ E+   V
Sbjct  68    MKESLGRALTSHPMIAGRLRWRRKTTAADEDGLEVVANDCGVRLVEARFPASLPEFFEMV  127

Query  1158  DRDK---ELKLVHWEPMMS-DPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFI  991
              RDK   E + V W  +   DP F   FYVQ+T FE GG S+G+SC+ LLAD +  T F+
Sbjct  128   KRDKGRAEAETVFWTDIDEIDPQFSPLFYVQVTSFESGGYSIGISCSILLADILLETDFL  187

Query  990   KAWADM  973
               WA +
Sbjct  188   TKWAQI  193



>ref|NP_001169239.1| hypothetical protein [Zea mays]
 gb|ACN32052.1| unknown [Zea mays]
 tpg|DAA43759.1| TPA: hypothetical protein ZEAMMB73_834619 [Zea mays]
Length=443

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 87/350 (25%), Positives = 145/350 (41%), Gaps = 19/350 (5%)
 Frame = -2

Query  1470  SSTICKRTVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYTKLNESIAETLN  1291
             +ST+ K  V ST     G+  PLTV DR   + FV IVF Y         L E +   + 
Sbjct  7     ASTMVK-PVYSTPHPLAGEKVPLTVFDRAAFDIFVPIVFAYPAPAPSNEALKEGLRRAVA  65

Query  1290  AYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMS  1111
              Y  + GRL      +     ND G+ V+EA   G + + L +      +  ++  P   
Sbjct  66    LYPHLAGRLAVDGRGRRFFHLNDEGVLVVEAAVSGDLADVLGDGMATANVDELYPTP-PE  124

Query  1110  DPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhp  931
             D +  +   ++L  ++ GGL +G++  H +AD  S + F+  WA+    GK  S P    
Sbjct  125   DNFGAALLQIKLNRYKCGGLVIGITSHHQVADGHSMSTFLTTWANAVRAGKDFSVPAAAK  184

Query  930   lpprrpcnnnhnphhNSSG-DLMNHYKKPTTDDG---DKPPSQTSSDRPKTISLLFTDEM  763
              P              +   D  +   K   DDG    KP +    D+ K +++ FTDE 
Sbjct  185   APFLNRAATAVPRAAPAPAFDHRSIEFKGGDDDGARASKPYTVVPMDKIKNVTVHFTDEF  244

Query  762   VRACMSMAQTP-DAFDALAGLLWTRISKAKN----NVGLMDLAVGLDVRKVLGLDKGFYG  598
             +    +        F  L   +W +I+ A++     +  + +AV    R    +   F+G
Sbjct  245   IAGLKARVGVRCSTFQCLLAHVWKKITAARDLDLEELTQVRVAVNCRGRASPAVPTDFFG  304

Query  597   NCMVYNKVKWSSGSMVLGDDL---LSQAANAIRNMRKEMDKEGIMDLIEW  457
             N      V W+   + + D L    S+  +AIR+    +D E I   +++
Sbjct  305   NM-----VLWAFPRLQVRDLLNSSYSRVVDAIRDAVARVDGEYIQSFVDF  349



>emb|CAA61258.1| orf [Zea mays]
Length=426

 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 96/173 (55%), Gaps = 13/173 (8%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDKDYTK-LNESIAETLNAYTIIM  1273
             TVV ++V     +  L   D   + +++R V+YYR  D   TK L + +   L+ +  + 
Sbjct  23    TVVPSSVTGEVDYA-LADADLAFKLHYLRGVYYYRSGDGLATKVLKDPMLPWLDDHFPVA  81

Query  1272  GRLLRSPGE------QWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMS  1111
             GR+ R+  E      +  IKCND G+R++EA+    + EW+ +    + ++ + ++ ++ 
Sbjct  82    GRVRRAETEGDGAPRRPYIKCNDCGVRIVEARCDRDMAEWIRDAAPGR-IRQLCYDKVLG  140

Query  1110  DPYFWSP-FYVQLTEFEEGGLSLGLSCTHLLAD-PISATMFIKAWADMSFTGK  958
                F+SP  YVQ+T F+ GGL+LG S  HL+ D P +AT F K WA +  +GK
Sbjct  141   PELFFSPLLYVQITNFKCGGLALGFSWAHLIGDIPSAATCFNK-WAQI-LSGK  191



>ref|XP_004252810.1| PREDICTED: protein ECERIFERUM 1 [Solanum lycopersicum]
Length=445

 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 97/183 (53%), Gaps = 19/183 (10%)
 Frame = -2

Query  1443  VSTNVVQPGKFC-------PLTVLDRVMENNFVRIVFYYREFDKDYTKLNE---SIAETL  1294
             V  + V PG+           T +D +M+ ++++ +++++    +   +++    +   L
Sbjct  11    VKLSSVVPGRITGDDKLQHEFTNMDLIMKLHYIKALYFFKNDVVEGLHIHDLKLPMFNLL  70

Query  1293  NAYTIIMGRLLR-------SPGEQWLIKCNDAGLRVIEAKAKG-SVDEWLHNVDRDKELK  1138
               Y  I GR+ R         G +  +KCND+G+RV+EAK K  ++DEWL   D D + +
Sbjct  71    ELYYPISGRIRRYDGGDGGGGGGRPFMKCNDSGVRVVEAKCKNKTIDEWLAMNDNDHDEE  130

Query  1137  LVHWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGK  958
             LV+ + +  D  F    ++Q T F+ GG+S+GLS  H+L D  SA+ F+  WA +   G+
Sbjct  131   LVYDQLLGPDLGFSPLVFIQFTWFKCGGMSIGLSWAHILGDSFSASNFLNIWAKI-MVGQ  189

Query  957   MIS  949
              IS
Sbjct  190   QIS  192



>ref|XP_008457218.1| PREDICTED: protein ECERIFERUM 26-like [Cucumis melo]
Length=450

 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 78/151 (52%), Gaps = 5/151 (3%)
 Frame = -2

Query  1404  LTVLDRVMENNFVRIVFYYREFDKDYTKLNESIAETL---NAYTIIMGRLLRSPGEQWLI  1234
             LT LD  M+ +++  ++++         L +  A T    N Y    GRL R    +  I
Sbjct  33    LTGLDLAMKLHYINGIYFFDSEASQRVTLPQIKAATFVIFNDYNFTCGRLRREDSGRPFI  92

Query  1233  KCNDAGLRVIEAKAKGSVDEWLHNVDRD-KELK-LVHWEPMMSDPYFWSPFYVQLTEFEE  1060
             KCND G R +EA+   +V EWL  +  D   +K LV  + +  + +F  P Y+Q+T F+ 
Sbjct  93    KCNDCGARFVEAECDSTVSEWLEMIGDDWSSMKLLVSQKVIGPELHFSPPIYMQVTRFKC  152

Query  1059  GGLSLGLSCTHLLADPISATMFIKAWADMSF  967
              G+S+GL+  H+L+D  S   F+ +  +M F
Sbjct  153   KGMSIGLTWAHVLSDAFSPAAFMNSLTNMLF  183



>ref|XP_010053525.1| PREDICTED: uncharacterized protein LOC104441955 [Eucalyptus grandis]
 gb|KCW77842.1| hypothetical protein EUGRSUZ_D02122 [Eucalyptus grandis]
Length=383

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 59/90 (66%), Gaps = 2/90 (2%)
 Frame = -2

Query  1236  IKCNDAGLRVIEAKAKGSVDEWLHNVDR-DKELKLVHWEPM-MSDPYFWSPFYVQLTEFE  1063
             I  ND+G R+IEA+   ++DE+L +  R D E +LVHW+ +   +P F   FY+Q+T F+
Sbjct  121   IVSNDSGARLIEARIGVTLDEFLGSERRADGEAELVHWKDIDAQNPQFCPLFYIQVTNFQ  180

Query  1062  EGGLSLGLSCTHLLADPISATMFIKAWADM  973
              GG S+G+SC+ LL DPIS    IK WA +
Sbjct  181   CGGYSIGISCSLLLLDPISTINLIKRWATI  210



>ref|XP_008238389.1| PREDICTED: anthranilate N-benzoyltransferase protein 3 [Prunus 
mume]
Length=366

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 90/174 (52%), Gaps = 16/174 (9%)
 Frame = -2

Query  1452  RTVVSTNVVQPGKFCPLTVLDRVMENNF---VRIVFYYREFDKDYTK------LNESIAE  1300
             +TV    + +P +   +   D + +  F   + I+ Y+ +  +D  +      L ES+A 
Sbjct  18    QTVTPLRITEPRQARQVLTADPIGKGIFKHCLHILLYHAKASQDDARWFHVGWLKESLAR  77

Query  1299  TLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWL----HNVDRDKELKLV  1132
              L    I+ GR     G++  I  ND+G+R++E +   S+ E+L        +D E +LV
Sbjct  78    ALLEQPILAGRFRE--GDELEIVSNDSGIRLLETRIPTSLSEFLDFRGSRGRKDAEAELV  135

Query  1131  HWEPM-MSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
              W+ +   +P F    YVQ+T F+ GG S+G+SC+ LLAD +    FIK WAD+
Sbjct  136   FWKDIDEQNPQFSPLVYVQVTNFQCGGCSIGISCSLLLADILLKENFIKKWADI  189



>gb|ACJ23164.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 81/356 (23%), Positives = 151/356 (42%), Gaps = 32/356 (9%)
 Frame = -2

Query  1446  VVSTNVVQPGKF---CPLTV----LDRVMENNFVRIVFYYRE------FDKDYTKLNESI  1306
             ++ +++V P +    CP  +    LD V+    +  V++YR       FD +  K  +++
Sbjct  13    IMKSSIVPPSELIADCPKQLWTSNLDLVVGRIHILTVYFYRPNGSSKFFDPNVMK--KAL  70

Query  1305  AETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHW  1126
             A+ L ++  + GRL R   ++ +I CN+ G+  +EA++  ++D++       +  +L   
Sbjct  71    ADVLVSFYPMAGRLGRDETDRIVINCNNEGVLFVEAESDSTLDDFGELKPSPEFRQLTPS  130

Query  1125  EPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISp  946
                  D   +  F+ Q+T F+ GG++LG    H L+D +S+  FI  W+DM+        
Sbjct  131   VDYSGDISSYPLFFAQVTHFKCGGVALGCGVHHTLSDGLSSLHFINTWSDMA------RG  184

Query  945   phfhplpprrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTISLLFTDE  766
                   P               + D + ++  P+ +   + P   S  +  T  L  T +
Sbjct  185   LSVAIPPFIERTLLRAREPPTPTYDHVEYHSPPSMNTTAQKPGSGSLSKSSTTMLKLTLD  244

Query  765   MVRACMSMAQ-----TPDAFDALAGLLWTRISKAKN--NVGLMDLAVGLDVRKVLG--LD  613
              + +  + A+     T   ++ LA  +W    KA+   +  L  L V  D R  L   L 
Sbjct  245   QLNSLKAKAKSESGSTHSTYEILAAHIWRCACKARGLPDDQLSKLYVATDGRSRLSPRLP  304

Query  612   KGFYGNCMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQN  445
              G+ GN +        SG   L    LS  A  I     +MD + +   I++L+  
Sbjct  305   PGYLGNVVFTATPVAKSGD--LTSKSLSNTAKLIHTTLTKMDDDYLRSAIDYLESQ  358



>ref|NP_194182.1| fatty acid elongation machinery component ECERIFERUM2 [Arabidopsis 
thaliana]
 sp|Q39048.1|CER2_ARATH RecName: Full=Protein ECERIFERUM 1 [Arabidopsis thaliana]
 emb|CAA63618.1| cer2 [Arabidopsis thaliana]
 gb|AAB17946.1| CER2 [Arabidopsis thaliana]
 emb|CAA23012.1| CER2 [Arabidopsis thaliana]
 emb|CAB79361.1| CER2 [Arabidopsis thaliana]
 gb|AAM64817.1| CER2 [Arabidopsis thaliana]
 gb|ABH04588.1| At4g24510 [Arabidopsis thaliana]
 gb|AEE84918.1| fatty acid elongation machinery component ECERIFERUM2 [Arabidopsis 
thaliana]
Length=421

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 94/172 (55%), Gaps = 13/172 (8%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYY---REFD-KDYTKLNESIAETLNAYT  1282
             +VV  +VV   K   LT +D  M+ ++VR V+++   R+F   D      ++   L +Y 
Sbjct  13    SVVPASVVGENKPRQLTPMDLAMKLHYVRAVYFFKGARDFTVADVKNTMFTLQSLLQSYH  72

Query  1281  IIMGRLLRSPGEQ-------WLIKCNDAGLRVIEAKAKG-SVDEWLHNVDRDKELKLVHW  1126
              + GR+  S  +          I+CND+G+RV+EA  +  +V++WL   DR  + + + +
Sbjct  73    HVSGRIRMSDNDNDTSAAAIPYIRCNDSGIRVVEANVEEFTVEKWLELDDRSIDHRFLVY  132

Query  1125  EPMMSDPYFWSPF-YVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADM  973
             + ++     +SP  ++Q+T+F+ GGL +GLS  H+L D  SA+ F+K    +
Sbjct  133   DHVLGPDLTFSPLVFLQITQFKCGGLCIGLSWAHILGDVFSASTFMKTLGQL  184



>ref|XP_006366422.1| PREDICTED: protein ECERIFERUM 1-like [Solanum tuberosum]
Length=438

 Score = 79.0 bits (193),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 96/181 (53%), Gaps = 17/181 (9%)
 Frame = -2

Query  1443  VSTNVVQPGKFC-------PLTVLDRVMENNFVRIVFYYREFDKDYTKLNE---SIAETL  1294
             V  + V PG+           T +D +M+ ++++ +++++    +   +++    +   L
Sbjct  11    VKLSSVVPGRITGDDKLQHEFTNMDLIMKLHYIKALYFFKNDAVEGLHIHDLKLPMFNLL  70

Query  1293  NAYTIIMGRLLR-----SPGEQWLIKCNDAGLRVIEAKAKG-SVDEWLHNVDRDKELKLV  1132
               Y    GR+ R       G +  IKCND G+R++EAK K  ++DEWL   D D + +LV
Sbjct  71    ELYYPTSGRIRRCDDGDGGGGRPFIKCNDGGVRIVEAKCKNKTIDEWLAMNDNDHDEELV  130

Query  1131  HWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMI  952
             + + +  +  F    ++Q T F+ GG+S+GLS  H+L D  SA+ F+  WA +   G++I
Sbjct  131   YDQLLGPELGFSPLVFIQFTWFKCGGMSIGLSWAHILGDSFSASNFLNMWAKI-MVGQLI  189

Query  951   S  949
             S
Sbjct  190   S  190



>ref|XP_006477570.1| PREDICTED: pelargonidin 3-O-(6-caffeoylglucoside) 5-O-(6-O-malonylglucoside) 
4'''-malonyltransferase-like [Citrus sinensis]
 gb|KDO57087.1| hypothetical protein CISIN_1g017451mg [Citrus sinensis]
Length=371

 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 83/141 (59%), Gaps = 12/141 (9%)
 Frame = -2

Query  1362  IVFYYREFDKD-----YTKLNESIAETLNAYTIIMGRLLRSP---GEQWLIKCNDAGLRV  1207
             I++Y +  D+D        + ES+++ L    ++ GRL R     GE  ++  ND+G R+
Sbjct  51    ILYYNKVVDEDSGWIVAGWIKESLSKVLAEQPMLGGRLRRREDGNGELEVVS-NDSGARL  109

Query  1206  IEAKAKGSVDEWLHNVDR--DKELKLVHWEPM-MSDPYFWSPFYVQLTEFEEGGLSLGLS  1036
             IEAK   ++ E+L + +R  D E +LV W+ +   +P +   FYVQ+T FE GG S+G+S
Sbjct  110   IEAKMAMTLSEFLGSKERSEDAEAELVFWKDIDEQNPQYSPLFYVQVTNFECGGHSVGIS  169

Query  1035  CTHLLADPISATMFIKAWADM  973
             C+ LLAD +    F+K WAD+
Sbjct  170   CSILLADLLLKEDFLKKWADI  190



>sp|A0PDV5.1|RAS_PLESU RecName: Full=Rosmarinate synthase; Short=CbRAS; AltName: Full=Hydroxycinnamoyl 
transferase; Short=CbHCT1 [Solenostemon scutellarioides]
 emb|CAK55166.1| hydroxycinnamoyl transferase [Solenostemon scutellarioides]
Length=430

 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 88/369 (24%), Positives = 153/369 (41%), Gaps = 29/369 (8%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYREFDK-----DYTKLNESIAETLNAY  1285
             T++  +   PG    L+ LD +   N+  +  ++   D      D   L ES++  L  +
Sbjct  9     TMIKPSAETPGGSLWLSNLDLLSPANYHTLSVHFYSHDGSDNFFDAAGLKESLSRALVEF  68

Query  1284  TIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDP  1105
                 GRL +  G +  I CN+ GL ++EA+  G++DE L +     EL L+         
Sbjct  69    YPYAGRL-KLNGNRLEIDCNNEGLLLVEAECDGALDE-LGDFAPRPELNLIPKVDYSRGI  126

Query  1104  YFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWADMSFTGKMISpphfhplp  925
               +     QLT F+ GG++LG++  H L+D ++A  FI  WA +S      +P       
Sbjct  127   STYPLMVFQLTRFKCGGVALGVANEHHLSDGVAALHFINTWAHLSRGAPAPTPLPHFDRS  186

Query  924   prrpcnnnhnphhNSSGDLMNHYKKPTTDDGDKPPSQTSSDRPKTI-----SLLFTDEMV  760
                  N       ++       Y+ P T +   P +  +  R K       SL    +  
Sbjct  187   SLSARNPPQPQFSHAE------YQPPPTLENPLPHTDIAHSRFKLTRDQLNSLKSKFKTA  240

Query  759   RACMSMAQTPDAFDALAGLLWTRISKAKNNVGLMD-----LAVGLDVRKVLGLDKGFYGN  595
              A     ++   F+ LAG +W  +  A+   GL +     L +  D R  L L  GF+GN
Sbjct  241   PADGGAGKSYSTFEVLAGHIWRSVCIAR---GLPEGQETKLHIPFDGRGRLQLPPGFFGN  297

Query  594   CMVYNKVKWSSGSMVLGDDLLSQAANAIRNMRKEMDKEGIMDLIEWLDQNNCCASNVLDG  415
              + +     + G +    + L+ A   + +    +D++ +   I++L+      S +  G
Sbjct  298   AIFFATPIATCGEIE--SNSLNYAVRRVSDGVSRLDEDYLRSSIDFLELQEDI-SKLAQG  354

Query  414   CDSLVCVNL  388
               S  C NL
Sbjct  355   AHSFRCPNL  363



>gb|KDO45041.1| hypothetical protein CISIN_1g0140002mg, partial [Citrus sinensis]
Length=123

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 63/110 (57%), Gaps = 7/110 (6%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYRE-----FDKDYTKLNESIAETLNAY  1285
             T VS+      +  PLT LD  M ++ + ++FYY +     FD D  ++  +++E L++Y
Sbjct  15    TQVSSRPSASDETYPLTRLDHAMGHHTIHVIFYYEKSPFGSFDMDPIRV--TLSEVLSSY  72

Query  1284  TIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKL  1135
               +  RL R     W +KCNDAG+RV+ A+   ++DEWL + D ++E  L
Sbjct  73    PPVTARLTRDDAGNWAVKCNDAGVRVLRARVGITLDEWLRSADGNEERDL  122



>ref|XP_011011265.1| PREDICTED: pelargonidin 3-O-(6-caffeoylglucoside) 5-O-(6-O-malonylglucoside) 
4'''-malonyltransferase-like [Populus euphratica]
Length=440

 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 66/116 (57%), Gaps = 6/116 (5%)
 Frame = -2

Query  1323  KLNESIAETLNAYTIIMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKE  1144
             +L +S++E L  Y  + GR      ++ LI+CND G   +EA+  GS+ + L   D + E
Sbjct  62    RLQKSLSEVLTLYYPLAGRY---SSDEPLIECNDKGAEYLEAQVAGSLSQLLS--DEELE  116

Query  1143  LKLV-HWEPMMSDPYFWSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
             ++L  H+ P M DP    P  VQ   FE GG+++G+S TH + D  SA  FI AWA
Sbjct  117   IQLQNHFVPPMFDPINSPPLVVQFNRFECGGIAIGVSMTHKMVDAFSAFGFITAWA  172



>ref|XP_006414850.1| hypothetical protein EUTSA_v10025273mg [Eutrema salsugineum]
 gb|ESQ56303.1| hypothetical protein EUTSA_v10025273mg [Eutrema salsugineum]
Length=427

 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 80/160 (50%), Gaps = 3/160 (2%)
 Frame = -2

Query  1449  TVVSTNVVQPGKFCPLTVLDRVMENNFVRIVFYYR-EFDKDYT--KLNESIAETLNAYTI  1279
             TV +T   + G     T LD  M+ ++++  + Y  E  +D T   + E++    +    
Sbjct  21    TVGATRPSKTGATREPTGLDLAMKLHYLKAAYIYSSETARDLTVKHVKEAMFMLFDQIAW  80

Query  1278  IMGRLLRSPGEQWLIKCNDAGLRVIEAKAKGSVDEWLHNVDRDKELKLVHWEPMMSDPYF  1099
               GR  R    +  IKCND+G R +E +   +V+EWL   DR  +  LV+ +P+  +  F
Sbjct  81    TTGRFWRRDSGRPYIKCNDSGTRFVEGQCNLTVEEWLSKPDRSIDEVLVYHQPIGPELSF  140

Query  1098  WSPFYVQLTEFEEGGLSLGLSCTHLLADPISATMFIKAWA  979
                 YVQ+T F+ GGL+LGL+  H++ D  S       WA
Sbjct  141   SPLIYVQMTRFKCGGLALGLNWAHIMGDSFSLLYAFNFWA  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4424773723216