BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23616_g1_i1 len=1220 path=[1928:0-381 2308:382-512 3638:513-513
2440:514-714 581:715-897 @240@!:898-1110 738:1111-1219]

Length=1220
                                                                      Score     E

ref|XP_009605565.1|  PREDICTED: putative cyclin-D6-1                    322   7e-104   
ref|XP_009763360.1|  PREDICTED: putative cyclin-D6-1                    318   1e-102   
ref|XP_010316643.1|  PREDICTED: putative cyclin-D6-1 isoform X1         317   6e-102   
ref|XP_006347185.1|  PREDICTED: putative cyclin-D6-1-like               313   1e-100   
ref|XP_010316644.1|  PREDICTED: putative cyclin-D6-1 isoform X2         311   4e-100   
ref|XP_009603725.1|  PREDICTED: putative cyclin-D6-1 isoform X1         305   1e-97    
ref|XP_009603726.1|  PREDICTED: putative cyclin-D6-1 isoform X2         301   5e-96    
ref|XP_009757646.1|  PREDICTED: putative cyclin-D6-1 isoform X1         290   1e-91    
ref|XP_009757648.1|  PREDICTED: putative cyclin-D6-1 isoform X3         288   6e-91    
ref|XP_009757647.1|  PREDICTED: putative cyclin-D6-1 isoform X2         285   7e-90    
ref|XP_006343269.1|  PREDICTED: putative cyclin-D6-1-like               277   1e-86    
ref|XP_011096183.1|  PREDICTED: putative cyclin-D6-1                    272   1e-84    
emb|CDP19718.1|  unnamed protein product                                263   3e-81    
ref|XP_010268904.1|  PREDICTED: putative cyclin-D6-1                    263   6e-81    
ref|XP_002524706.1|  cyclin d, putative                                 261   2e-80    Ricinus communis
ref|XP_007215712.1|  hypothetical protein PRUPE_ppa008931mg             260   6e-80    
ref|XP_004234136.1|  PREDICTED: putative cyclin-D6-1                    260   6e-80    
gb|KHG12532.1|  Putative cyclin-D6-1 -like protein                      258   9e-79    
emb|CAN88868.1|  D6-type cyclin                                         257   2e-78    Populus trichocarpa [western balsam poplar]
ref|XP_002326106.2|  hypothetical protein POPTR_0019s14110g             256   3e-78    Populus trichocarpa [western balsam poplar]
ref|XP_011047492.1|  PREDICTED: putative cyclin-D6-1                    256   3e-78    
gb|AEV41137.1|  D6-type cyclin                                          256   3e-78    
ref|XP_002305644.1|  hypothetical protein POPTR_0004s03220g             253   2e-77    Populus trichocarpa [western balsam poplar]
ref|XP_006449188.1|  hypothetical protein CICLE_v10015968mg             254   2e-77    
emb|CBI40871.3|  unnamed protein product                                256   4e-77    
ref|XP_010277890.1|  PREDICTED: putative cyclin-D6-1                    249   1e-75    
gb|KDO75678.1|  hypothetical protein CISIN_1g021047mg                   249   2e-75    
ref|XP_011043321.1|  PREDICTED: putative cyclin-D6-1                    248   3e-75    
ref|XP_011001161.1|  PREDICTED: putative cyclin-D6-1                    248   4e-75    
emb|CAN65140.1|  hypothetical protein VITISV_034614                     251   5e-75    Vitis vinifera
ref|XP_006467923.1|  PREDICTED: putative cyclin-D6-1-like               247   1e-74    
ref|XP_006466146.1|  PREDICTED: putative cyclin-D6-1-like               244   5e-74    
ref|XP_002316670.1|  hypothetical protein POPTR_0011s04060g             243   2e-73    Populus trichocarpa [western balsam poplar]
ref|XP_004293473.1|  PREDICTED: putative cyclin-D6-1-like               243   3e-73    
gb|EYU27882.1|  hypothetical protein MIMGU_mgv1a010303mg                242   1e-72    
ref|XP_010646366.1|  PREDICTED: putative cyclin-D6-1                    241   1e-72    
ref|XP_008379584.1|  PREDICTED: putative cyclin-D6-1                    240   5e-72    
ref|XP_008348124.1|  PREDICTED: putative cyclin-D6-1                    240   6e-72    
ref|XP_009353212.1|  PREDICTED: putative cyclin-D6-1                    239   2e-71    
ref|XP_011048476.1|  PREDICTED: putative cyclin-D6-1                    238   2e-71    
gb|KHG08121.1|  Putative cyclin-D6-1 -like protein                      237   8e-71    
ref|XP_007025844.1|  D6-type cyclin isoform 1                           236   1e-70    
ref|XP_010927924.1|  PREDICTED: cyclin-D6-1 isoform X1                  234   4e-70    
ref|XP_007025848.1|  D6-type cyclin isoform 5                           233   3e-69    
ref|XP_007025849.1|  D6-type cyclin isoform 6                           230   4e-68    
ref|XP_007025845.1|  D6-type cyclin isoform 2                           230   4e-68    
ref|XP_010927931.1|  PREDICTED: cyclin-D6-1 isoform X2                  229   5e-68    
gb|KDO55820.1|  hypothetical protein CISIN_1g019748mg                   228   5e-67    
ref|XP_002276869.1|  PREDICTED: putative cyclin-D6-1 isoform X2         226   9e-67    Vitis vinifera
ref|XP_007025846.1|  D6-type cyclin isoform 3                           226   1e-66    
emb|CDP11895.1|  unnamed protein product                                225   3e-66    
ref|XP_006469812.1|  PREDICTED: putative cyclin-D6-1-like isoform X1    225   4e-66    
ref|XP_009405922.1|  PREDICTED: cyclin-D6-1-like isoform X1             224   4e-66    
emb|CBI18003.3|  unnamed protein product                                224   5e-66    
ref|XP_007025847.1|  D6-type cyclin isoform 4                           224   8e-66    
ref|XP_010051475.1|  PREDICTED: putative cyclin-D6-1                    224   9e-66    
ref|XP_010035645.1|  PREDICTED: putative cyclin-D6-1                    223   1e-65    
ref|XP_008371237.1|  PREDICTED: putative cyclin-D6-1                    224   3e-65    
ref|XP_010657381.1|  PREDICTED: putative cyclin-D6-1 isoform X1         221   9e-65    
ref|XP_007149914.1|  hypothetical protein PHAVU_005G109600g             220   2e-64    
ref|XP_006469813.1|  PREDICTED: putative cyclin-D6-1-like isoform X2    221   2e-64    
ref|XP_002317253.1|  hypothetical protein POPTR_0011s04030g             218   2e-64    Populus trichocarpa [western balsam poplar]
ref|XP_007025850.1|  D6-type cyclin, putative isoform 7                 217   5e-64    
ref|XP_009405923.1|  PREDICTED: cyclin-D6-1-like isoform X2             218   6e-64    
gb|KHN36588.1|  Putative cyclin-D6-1                                    219   8e-64    
ref|XP_008812858.1|  PREDICTED: cyclin-D6-1 isoform X1                  218   1e-63    
ref|NP_001242717.1|  uncharacterized protein LOC100799951               218   2e-63    
ref|XP_003540333.1|  PREDICTED: putative cyclin-D6-1-like               216   1e-62    
ref|XP_006366940.1|  PREDICTED: putative cyclin-D6-1-like               216   1e-62    
ref|XP_007043433.1|  D6-type cyclin                                     214   2e-62    
ref|XP_003541753.1|  PREDICTED: putative cyclin-D6-1-like isoform X1    211   1e-61    
ref|XP_008812859.1|  PREDICTED: cyclin-D6-1 isoform X2                  212   2e-61    
ref|XP_011100327.1|  PREDICTED: putative cyclin-D6-1                    213   2e-61    
ref|XP_009417261.1|  PREDICTED: cyclin-D6-1-like                        212   2e-61    
ref|XP_008448224.1|  PREDICTED: putative cyclin-D6-1 isoform X1         212   3e-61    
ref|XP_008362282.1|  PREDICTED: putative cyclin-D6-1                    210   4e-61    
ref|XP_004243793.1|  PREDICTED: putative cyclin-D6-1                    211   8e-61    
ref|XP_009373810.1|  PREDICTED: putative cyclin-D6-1                    212   1e-60    
ref|XP_010924029.1|  PREDICTED: cyclin-D6-1-like isoform X1             210   1e-60    
ref|XP_007212474.1|  hypothetical protein PRUPE_ppa015093mg             211   2e-60    
ref|XP_004485690.1|  PREDICTED: putative cyclin-D6-1-like isoform X1    208   2e-60    
ref|XP_003547127.1|  PREDICTED: putative cyclin-D6-1-like               207   3e-60    
ref|XP_006447413.1|  hypothetical protein CICLE_v10017833mg             208   1e-59    
ref|XP_004140053.1|  PREDICTED: putative cyclin-D6-1-like               207   2e-59    
ref|XP_009775328.1|  PREDICTED: putative cyclin-D6-1                    207   3e-59    
ref|XP_003526300.1|  PREDICTED: putative cyclin-D6-1-like isoform X1    207   4e-59    
ref|XP_008224919.1|  PREDICTED: putative cyclin-D6-1                    208   4e-59    
gb|KHG11621.1|  Putative cyclin-D6-1 -like protein                      206   5e-59    
ref|XP_004485691.1|  PREDICTED: putative cyclin-D6-1-like isoform X2    203   1e-58    
gb|KHN41174.1|  Putative cyclin-D6-1                                    205   1e-58    
ref|XP_010924030.1|  PREDICTED: cyclin-D6-1-like isoform X2             203   4e-58    
ref|XP_008800348.1|  PREDICTED: cyclin-D6-1-like                        203   5e-58    
gb|KEH36489.1|  carboxy-terminal domain cyclin                          203   6e-58    
ref|XP_003597084.1|  Cyclin-D5-2                                        202   1e-57    
ref|XP_004487348.1|  PREDICTED: putative cyclin-D6-1-like               202   1e-57    
ref|XP_007132615.1|  hypothetical protein PHAVU_011G110000g             202   2e-57    
ref|NP_192236.1|  cyclin D6-1                                           199   1e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006582337.1|  PREDICTED: putative cyclin-D6-1-like isoform X2    200   2e-56    
gb|KHG23395.1|  Putative cyclin-D6-1 -like protein                      199   2e-56    
ref|XP_006396556.1|  hypothetical protein EUTSA_v10028844mg             199   2e-56    
ref|XP_008448225.1|  PREDICTED: putative cyclin-D6-1 isoform X2         196   2e-56    
gb|KGN46679.1|  hypothetical protein Csa_6G121960                       196   3e-56    
ref|XP_009615739.1|  PREDICTED: putative cyclin-D6-1                    199   4e-56    
ref|XP_003540877.1|  PREDICTED: putative cyclin-D6-1-like               198   8e-56    
ref|XP_007025851.1|  D6-type cyclin isoform 8                           196   2e-55    
ref|XP_009348016.1|  PREDICTED: putative cyclin-D6-1                    195   3e-55    
ref|XP_004172660.1|  PREDICTED: putative cyclin-D6-1-like               193   4e-55    
gb|KEH39029.1|  carboxy-terminal domain cyclin                          195   5e-55    
ref|XP_006377297.1|  hypothetical protein POPTR_0011s04060g             192   7e-55    
ref|XP_007132616.1|  hypothetical protein PHAVU_011G110000g             195   8e-55    
ref|XP_009418753.1|  PREDICTED: cyclin-D6-1-like                        194   1e-54    
gb|KHN22882.1|  Putative cyclin-D6-1                                    190   1e-53    
ref|XP_007025852.1|  D6-type cyclin isoform 9                           189   8e-53    
ref|XP_006376532.1|  hypothetical protein POPTR_0013s14540g             183   1e-51    
ref|XP_002872788.1|  CYCD6_1                                            184   5e-51    
ref|XP_010931897.1|  PREDICTED: cyclin-D6-1-like                        182   4e-50    
ref|XP_006833121.1|  hypothetical protein AMTR_s00072p00074880          181   2e-49    
ref|XP_010543066.1|  PREDICTED: LOW QUALITY PROTEIN: putative cyc...    179   5e-49    
ref|XP_010430819.1|  PREDICTED: putative cyclin-D6-1                    176   1e-47    
ref|XP_010522647.1|  PREDICTED: putative cyclin-D6-1                    174   2e-47    
ref|XP_008230196.1|  PREDICTED: putative cyclin-D6-1                    172   3e-47    
ref|XP_010422479.1|  PREDICTED: putative cyclin-D6-1                    174   4e-47    
ref|XP_006288328.1|  hypothetical protein CARUB_v10001575mg             169   5e-45    
ref|XP_010455908.1|  PREDICTED: putative cyclin-D6-1                    167   3e-44    
ref|XP_004293603.1|  PREDICTED: putative cyclin-D6-1-like               163   7e-44    
ref|XP_010106726.1|  Putative cyclin-D6-1                               166   7e-44    
ref|XP_011079045.1|  PREDICTED: putative cyclin-D6-1                    165   1e-43    
ref|XP_006594638.1|  PREDICTED: putative cyclin-D6-1-like isoform X2    160   1e-42    
gb|KHG16890.1|  Putative cyclin-D6-1 -like protein                      160   3e-42    
gb|KFK30921.1|  hypothetical protein AALP_AA6G043400                    155   3e-40    
gb|AFK48182.1|  unknown                                                 150   3e-39    
ref|XP_009121963.1|  PREDICTED: putative cyclin-D6-1                    153   3e-39    
gb|KCW89471.1|  hypothetical protein EUGRSUZ_A01768                     151   4e-39    
ref|NP_001059961.1|  Os07g0556000                                       153   4e-39    Oryza sativa Japonica Group [Japonica rice]
emb|CDY22116.1|  BnaA09g01450D                                          152   5e-39    
ref|XP_006426676.1|  hypothetical protein CICLE_v10027195mg             148   8e-39    
gb|KDP20866.1|  hypothetical protein JCGZ_21337                         147   3e-38    
emb|CAO00120.1|  D6-type cyclin                                         145   5e-38    Populus trichocarpa [western balsam poplar]
emb|CDY21951.1|  BnaC09g00570D                                          149   7e-38    
gb|ADE76356.1|  unknown                                                 150   1e-37    
gb|EEC82258.1|  hypothetical protein OsI_26449                          142   2e-35    Oryza sativa Indica Group [Indian rice]
ref|XP_004957987.1|  PREDICTED: cyclin-D6-1-like                        143   2e-35    
dbj|BAK07784.1|  predicted protein                                      142   4e-35    
gb|EMS53686.1|  Cyclin-D6-1                                             139   3e-34    
ref|NP_001149068.1|  CYCD6                                              137   2e-33    Zea mays [maize]
ref|XP_006841234.1|  hypothetical protein AMTR_s00135p00066200          138   3e-33    
ref|XP_009381479.1|  PREDICTED: cyclin-D3-1-like                        135   1e-32    
gb|EMT22750.1|  Cyclin-D6-1                                             132   1e-31    
ref|XP_008782336.1|  PREDICTED: cyclin-D3-1-like                        133   2e-31    
ref|XP_009390267.1|  PREDICTED: cyclin-D4-1-like                        130   9e-31    
ref|XP_008651459.1|  PREDICTED: CYCD6 isoform X1                        129   1e-30    
gb|AEK20778.1|  cyclin dependent kinase regulator                       130   1e-30    
ref|XP_006657822.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-D6-1-...    129   3e-30    
ref|XP_009410124.1|  PREDICTED: cyclin-D3-1-like                        129   4e-30    
ref|XP_008795181.1|  PREDICTED: cyclin-D4-1-like                        128   7e-30    
ref|XP_010926356.1|  PREDICTED: cyclin-D4-1-like isoform X1             127   2e-29    
ref|XP_003576488.1|  PREDICTED: cyclin-D2-1-like isoform X1             126   3e-29    
ref|XP_002510103.1|  cyclin d, putative                                 126   3e-29    Ricinus communis
ref|XP_002462322.1|  hypothetical protein SORBIDRAFT_02g023800          126   4e-29    Sorghum bicolor [broomcorn]
ref|XP_006856973.1|  hypothetical protein AMTR_s00190p00017930          125   5e-29    
ref|XP_006836691.1|  hypothetical protein AMTR_s00088p00097010          125   6e-29    
ref|XP_007018513.1|  D5-type cyclin, putative                           124   8e-29    
ref|XP_010238138.1|  PREDICTED: cyclin-D2-1-like isoform X2             124   8e-29    
ref|NP_001234758.1|  CycD3;3 protein                                    125   8e-29    
emb|CDP00205.1|  unnamed protein product                                125   1e-28    
ref|XP_010272455.1|  PREDICTED: cyclin-D5-1-like                        124   2e-28    
ref|XP_009401229.1|  PREDICTED: cyclin-D4-1-like                        124   2e-28    
ref|XP_009403082.1|  PREDICTED: cyclin-D4-1-like                        124   2e-28    
gb|KDP41628.1|  hypothetical protein JCGZ_16035                         124   2e-28    
ref|XP_009127780.1|  PREDICTED: cyclin-D1-1-like                        124   2e-28    
ref|XP_003519458.1|  PREDICTED: cyclin-D1-1-like                        124   2e-28    
ref|NP_001275138.1|  D-type cyclin family 3 subgroup 3                  123   3e-28    
ref|XP_009391337.1|  PREDICTED: cyclin-D3-1-like isoform X1             123   3e-28    
ref|XP_009801107.1|  PREDICTED: cyclin-D2-1-like                        123   5e-28    
ref|XP_003562933.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-D6-1        121   6e-28    
ref|XP_004141404.1|  PREDICTED: cyclin-D5-1-like                        121   9e-28    
ref|XP_009394048.1|  PREDICTED: cyclin-D3-1-like                        122   9e-28    
ref|XP_009381630.1|  PREDICTED: cyclin-D2-1-like isoform X1             121   9e-28    
emb|CAA71244.1|  cyclin-D like protein                                  122   2e-27    Oxybasis rubra [pigweed]
ref|XP_002283315.1|  PREDICTED: cyclin-D5-1                             120   2e-27    Vitis vinifera
ref|XP_010675548.1|  PREDICTED: cyclin-D4-1                             121   2e-27    
ref|XP_009417607.1|  PREDICTED: cyclin-D4-1-like                        120   3e-27    
ref|XP_006390912.1|  hypothetical protein EUTSA_v10018896mg             120   3e-27    
ref|XP_010939736.1|  PREDICTED: cyclin-D3-1-like                        120   3e-27    
ref|XP_006338089.1|  PREDICTED: cyclin-D2-1-like                        120   4e-27    
ref|XP_004956724.1|  PREDICTED: cyclin-D2-1-like isoform X3             120   4e-27    
ref|XP_007157500.1|  hypothetical protein PHAVU_002G074800g             121   4e-27    
ref|XP_008802301.1|  PREDICTED: cyclin-D4-1-like                        120   6e-27    
ref|XP_008452642.1|  PREDICTED: cyclin-D5-2-like                        119   7e-27    
emb|CDY67142.1|  BnaAnng23660D                                          119   7e-27    
ref|XP_010272942.1|  PREDICTED: cyclin-D3-1-like                        119   7e-27    
ref|XP_004237975.1|  PREDICTED: cyclin-D2-1-like                        119   9e-27    
ref|XP_010531357.1|  PREDICTED: cyclin-D2-1-like                        119   1e-26    
ref|XP_004143552.1|  PREDICTED: cyclin-D2-1-like                        119   1e-26    
ref|XP_008440562.1|  PREDICTED: cyclin-D4-1-like isoform X1             119   1e-26    
ref|XP_002268394.1|  PREDICTED: cyclin-D1-1 isoform X2                  118   1e-26    Vitis vinifera
ref|XP_010272026.1|  PREDICTED: cyclin-D1-1-like isoform X3             118   2e-26    
ref|XP_004956725.1|  PREDICTED: cyclin-D2-1-like isoform X4             118   2e-26    
ref|XP_009598219.1|  PREDICTED: cyclin-D3-1-like                        118   2e-26    
ref|XP_004238706.1|  PREDICTED: cyclin-D1-1                             118   2e-26    
ref|XP_009409296.1|  PREDICTED: cyclin-D4-1-like                        118   2e-26    
ref|XP_010653055.1|  PREDICTED: cyclin-D1-1 isoform X1                  117   2e-26    
ref|XP_009627754.1|  PREDICTED: cyclin-D1-1                             117   2e-26    
gb|KFK41441.1|  hypothetical protein AALP_AA2G130900                    117   3e-26    
gb|KFK41442.1|  hypothetical protein AALP_AA2G130900                    117   3e-26    
ref|XP_009380230.1|  PREDICTED: cyclin-D4-1-like                        117   3e-26    
emb|CDY59943.1|  BnaAnng16340D                                          118   3e-26    
gb|EYU36377.1|  hypothetical protein MIMGU_mgv1a022525mg                117   3e-26    
ref|XP_006355943.1|  PREDICTED: cyclin-D1-1-like                        117   4e-26    
ref|XP_009800525.1|  PREDICTED: cyclin-D3-3-like                        117   4e-26    
gb|KHN08249.1|  Cyclin-D3-1                                             117   4e-26    
ref|XP_006849324.1|  hypothetical protein AMTR_s00164p00026810          117   4e-26    
ref|XP_002463007.1|  hypothetical protein SORBIDRAFT_02g036130          117   4e-26    Sorghum bicolor [broomcorn]
ref|XP_003544823.1|  PREDICTED: cyclin-D4-1-like isoform X1             117   4e-26    
ref|XP_010512099.1|  PREDICTED: cyclin-D1-1-like isoform X1             117   5e-26    
ref|XP_011074359.1|  PREDICTED: cyclin-D5-3-like                        117   5e-26    
ref|XP_010551453.1|  PREDICTED: cyclin-D1-1                             117   5e-26    
ref|XP_010254697.1|  PREDICTED: cyclin-D1-1                             116   5e-26    
ref|XP_009410280.1|  PREDICTED: cyclin-D2-1-like                        116   5e-26    
ref|XP_002981056.1|  hypothetical protein SELMODRAFT_420671             117   5e-26    
ref|XP_010512100.1|  PREDICTED: cyclin-D1-1-like isoform X2             117   5e-26    
ref|XP_009631276.1|  PREDICTED: cyclin-D2-1-like                        117   6e-26    
ref|XP_003518252.1|  PREDICTED: cyclin-D4-1                             117   6e-26    
ref|XP_009380893.1|  PREDICTED: cyclin-D4-1-like                        116   8e-26    
ref|XP_009401443.1|  PREDICTED: cyclin-D4-1-like                        116   9e-26    
ref|XP_004289346.1|  PREDICTED: cyclin-D5-1-like                        116   1e-25    
ref|XP_008811014.1|  PREDICTED: cyclin-D4-1-like isoform X1             116   1e-25    
ref|XP_006302511.1|  hypothetical protein CARUB_v10020608mg             115   1e-25    
ref|NP_001149823.1|  cyclin delta-2                                     115   1e-25    Zea mays [maize]
ref|XP_006302510.1|  hypothetical protein CARUB_v10020608mg             115   1e-25    
ref|XP_010530194.1|  PREDICTED: cyclin-D4-1-like                        115   2e-25    
ref|XP_003555300.1|  PREDICTED: cyclin-D4-1-like isoform X1             115   2e-25    
gb|KDO81113.1|  hypothetical protein CISIN_1g045125mg                   115   2e-25    
ref|XP_004143797.1|  PREDICTED: cyclin-D1-1-like                        114   2e-25    
ref|XP_003607665.1|  Cyclin d2                                          114   3e-25    
gb|AAL47480.1|  cyclin D3                                               114   4e-25    Helianthus tuberosus [Jerusalem artichoke]
ref|NP_201345.1|  cyclin-D4-1                                           114   4e-25    Arabidopsis thaliana [mouse-ear cress]
gb|ACU21437.1|  unknown                                                 114   4e-25    Glycine max [soybeans]
ref|XP_010419132.1|  PREDICTED: cyclin-D1-1                             113   5e-25    
ref|XP_006596367.1|  PREDICTED: cyclin-D4-1-like isoform X2             114   5e-25    
emb|CAB61221.1|  cyclin D1                                              114   5e-25    Antirrhinum majus [garden snapdragon]
ref|XP_001756858.1|  predicted protein                                  114   5e-25    
ref|XP_009106467.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-D1-1        115   6e-25    
ref|XP_010928562.1|  PREDICTED: cyclin-D2-1-like isoform X1             113   6e-25    
tpg|DAA61294.1|  TPA: cyclin delta-2                                    113   6e-25    
ref|XP_011097500.1|  PREDICTED: cyclin-D4-1-like                        114   7e-25    
ref|XP_006647938.1|  PREDICTED: cyclin-D3-1-like                        113   7e-25    
ref|XP_006433861.1|  hypothetical protein CICLE_v10001581mg             114   7e-25    
ref|XP_011025651.1|  PREDICTED: cyclin-D1-1-like                        113   8e-25    
emb|CDY11608.1|  BnaC06g31310D                                          113   8e-25    
emb|CAA58285.1|  cyclin delta-1                                         113   8e-25    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887287.1|  cyclin delta-1                                     113   8e-25    
ref|XP_006342646.1|  PREDICTED: cyclin-D3-3-like isoform X1             113   8e-25    
ref|XP_004953991.1|  PREDICTED: cyclin-D3-1-like                        113   9e-25    
gb|ABR18175.1|  unknown                                                 113   1e-24    Picea sitchensis
ref|XP_004501614.1|  PREDICTED: cyclin-D2-1-like                        113   1e-24    
emb|CAD43141.1|  cyclin D2                                              113   1e-24    Daucus carota [carrots]
gb|AGH32903.1|  cyclin D4                                               112   1e-24    
gb|AAL47479.1|  cyclin D1                                               112   1e-24    Helianthus tuberosus [Jerusalem artichoke]
ref|XP_009392017.1|  PREDICTED: cyclin-D2-1-like                        112   1e-24    
ref|XP_006472509.1|  PREDICTED: cyclin-D2-1-like                        113   1e-24    
ref|XP_010942651.1|  PREDICTED: cyclin-D3-1-like                        112   1e-24    
gb|KDO82574.1|  hypothetical protein CISIN_1g020177mg                   112   2e-24    
ref|XP_006342647.1|  PREDICTED: cyclin-D3-3-like isoform X2             112   2e-24    
ref|XP_003523620.1|  PREDICTED: cyclin-D5-1-like                        112   2e-24    
sp|Q0J233.2|CCD21_ORYSJ  RecName: Full=Cyclin-D2-1; AltName: Full...    111   2e-24    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010520762.1|  PREDICTED: cyclin-D4-1-like isoform X1             112   2e-24    
gb|AAM60963.1|  D-type cyclin                                           111   2e-24    Arabidopsis thaliana [mouse-ear cress]
gb|KHG30228.1|  Cyclin-D4-1 -like protein                               112   2e-24    
ref|XP_009773645.1|  PREDICTED: cyclin-D1-1                             112   2e-24    
ref|XP_011007838.1|  PREDICTED: cyclin-D1-1-like                        111   2e-24    
ref|XP_008651483.1|  PREDICTED: cyclin delta-2 isoform X1               111   2e-24    
ref|XP_007222540.1|  hypothetical protein PRUPE_ppa008337mg             112   3e-24    
gb|AEV41133.1|  D1-type cyclin                                          111   3e-24    
ref|XP_003527735.1|  PREDICTED: cyclin-D5-1-like isoform X1             111   3e-24    
ref|XP_004288506.1|  PREDICTED: cyclin-D2-1-like                        112   3e-24    
dbj|BAH15074.1|  cyclin D3                                              112   3e-24    Ipomoea batatas [batate]
ref|XP_010520763.1|  PREDICTED: cyclin-D4-1-like isoform X2             112   3e-24    
ref|XP_002982531.1|  hypothetical protein SELMODRAFT_421971             111   3e-24    
ref|XP_002312511.1|  cyclin delta-1 family protein                      111   3e-24    
ref|NP_177178.1|  cyclin-D1-1                                           111   3e-24    
ref|XP_008465687.1|  PREDICTED: cyclin-D1-1-like                        111   4e-24    
emb|CDY38800.1|  BnaA07g28720D                                          111   4e-24    
ref|NP_001190620.1|  cyclin-D4-1                                        110   4e-24    
ref|XP_004973707.1|  PREDICTED: cyclin-D4-2-like                        111   4e-24    
ref|XP_010928563.1|  PREDICTED: cyclin-D2-1-like isoform X2             110   4e-24    
ref|XP_010916679.1|  PREDICTED: cyclin-D4-1-like                        111   5e-24    
gb|KHN09012.1|  Cyclin-D3-1                                             111   5e-24    
ref|XP_002525288.1|  cyclin d, putative                                 110   6e-24    
ref|XP_006483788.1|  PREDICTED: cyclin-D1-1-like                        110   6e-24    
ref|XP_008355412.1|  PREDICTED: cyclin-D4-1-like                        110   6e-24    
ref|XP_004509867.1|  PREDICTED: cyclin-D1-1-like                        110   6e-24    
ref|XP_009419239.1|  PREDICTED: cyclin-D1-2-like                        110   6e-24    
ref|XP_003613330.1|  Cyclin-D1-1                                        110   7e-24    
ref|XP_003522757.1|  PREDICTED: cyclin-D4-2-like                        110   7e-24    
ref|XP_008385676.1|  PREDICTED: cyclin-D4-1                             110   7e-24    
ref|XP_008245470.1|  PREDICTED: cyclin-D1-1                             110   7e-24    
ref|XP_008440563.1|  PREDICTED: cyclin-D2-1-like isoform X2             109   7e-24    
gb|EYU29703.1|  hypothetical protein MIMGU_mgv1a010022mg                110   8e-24    
ref|XP_004252752.1|  PREDICTED: cyclin-D3-3-like                        110   8e-24    
gb|KFK32810.1|  hypothetical protein AALP_AA6G290800                    110   8e-24    
ref|XP_008368595.1|  PREDICTED: cyclin-D4-1-like                        110   8e-24    
ref|XP_008339993.1|  PREDICTED: cyclin-D1-1                             110   9e-24    
ref|XP_009789780.1|  PREDICTED: cyclin-D4-1-like                        110   1e-23    
ref|XP_006438465.1|  hypothetical protein CICLE_v10032080mg             110   1e-23    
ref|XP_002513243.1|  cyclin d, putative                                 105   1e-23    
ref|XP_002880446.1|  CYCD2_1                                            110   1e-23    
ref|NP_001234753.1|  CycD3;2 protein                                    110   1e-23    
gb|KHG29481.1|  Cyclin-D4-1 -like protein                               110   1e-23    
gb|KDP21306.1|  hypothetical protein JCGZ_21777                         110   1e-23    
gb|KHG07149.1|  Cyclin-D4-1 -like protein                               110   1e-23    
ref|XP_010323910.1|  PREDICTED: cycD3;2 protein isoform X1              110   1e-23    
ref|XP_007156481.1|  hypothetical protein PHAVU_003G289500g             110   1e-23    
ref|XP_009606822.1|  PREDICTED: cyclin-D3-1-like                        110   1e-23    
ref|XP_006472986.1|  PREDICTED: cyclin-D5-1-like                        109   1e-23    
ref|XP_010555401.1|  PREDICTED: cyclin-D2-1-like                        109   1e-23    
ref|XP_006433630.1|  hypothetical protein CICLE_v10003170mg             109   1e-23    
ref|XP_010107298.1|  hypothetical protein L484_008550                   110   1e-23    
gb|KDP47128.1|  hypothetical protein JCGZ_22124                         110   1e-23    
ref|XP_006650160.1|  PREDICTED: putative cyclin-D2-3-like               110   1e-23    
ref|XP_010521055.1|  PREDICTED: cyclin-D4-1-like                        109   2e-23    
ref|XP_009404028.1|  PREDICTED: cyclin-D3-1-like                        110   2e-23    
ref|XP_008440318.1|  PREDICTED: cyclin-D3-3                             109   2e-23    
emb|CAO00119.1|  D6-type cyclin                                         104   2e-23    
ref|XP_002866670.1|  predicted protein                                  108   2e-23    
ref|XP_007205537.1|  hypothetical protein PRUPE_ppa008565mg             108   2e-23    
ref|XP_011017120.1|  PREDICTED: cyclin-D5-2-like                        108   2e-23    
ref|XP_007017140.1|  D3-type cyclin isoform 1                           109   2e-23    
gb|KHG04117.1|  Cyclin-D3-2 -like protein                               109   2e-23    
ref|XP_002530701.1|  cyclin d, putative                                 109   2e-23    
gb|KFK28243.1|  hypothetical protein AALP_AA8G490800                    108   2e-23    
ref|XP_008440384.1|  PREDICTED: cyclin-D5-1-like                        108   2e-23    
gb|KHG01551.1|  Cyclin-D3-1 -like protein                               109   3e-23    
sp|Q8H339.2|CCD12_ORYSJ  RecName: Full=Cyclin-D1-2; AltName: Full...    109   3e-23    
gb|EYU39320.1|  hypothetical protein MIMGU_mgv1a009666mg                108   3e-23    
ref|XP_006589616.1|  PREDICTED: cyclin-D4-1-like                        108   3e-23    
ref|XP_004142001.1|  PREDICTED: cyclin-D3-2-like                        109   3e-23    
ref|XP_010102772.1|  hypothetical protein L484_009401                   108   3e-23    
ref|XP_008235419.1|  PREDICTED: cyclin-D2-1                             109   3e-23    
ref|XP_002510161.1|  cyclin d, putative                                 109   3e-23    
gb|AAR87269.1|  putative cyclin                                         108   3e-23    
ref|XP_010472238.1|  PREDICTED: cyclin-D2-1 isoform X2                  108   3e-23    
ref|XP_010484368.1|  PREDICTED: cyclin-D4-1-like                        108   4e-23    
emb|CAB41347.1|  D-type cyclin                                          108   4e-23    
ref|XP_009769846.1|  PREDICTED: cyclin-D3-2-like                        108   4e-23    
ref|XP_009348245.1|  PREDICTED: cyclin-D4-1-like                        108   4e-23    
dbj|BAE93058.1|  cyclin                                                 108   4e-23    
ref|XP_010244252.1|  PREDICTED: cyclin-D3-2                             108   4e-23    
ref|XP_010444531.1|  PREDICTED: cyclin-D4-1-like isoform X2             107   4e-23    
ref|XP_002302410.2|  hypothetical protein POPTR_0002s11980g             108   4e-23    
ref|XP_004172256.1|  PREDICTED: cyclin-D5-1-like                        106   5e-23    
gb|EEC83751.1|  hypothetical protein OsI_29617                          107   5e-23    
ref|XP_008795637.1|  PREDICTED: cyclin-D2-1-like isoform X2             108   5e-23    
ref|XP_010043815.1|  PREDICTED: cyclin-D1-1                             108   5e-23    
ref|XP_007137638.1|  hypothetical protein PHAVU_009G143200g             108   5e-23    
ref|XP_006386422.1|  cyclin d2 family protein                           108   5e-23    
ref|XP_007141249.1|  hypothetical protein PHAVU_008G180000g             108   6e-23    
ref|XP_006426085.1|  hypothetical protein CICLE_v10026015mg             107   6e-23    
ref|XP_010417008.1|  PREDICTED: cyclin-D2-1-like isoform X2             108   6e-23    
gb|AIE52096.1|  D-type cyclin                                           107   6e-23    
emb|CDP11478.1|  unnamed protein product                                108   6e-23    
ref|XP_007044533.1|  Cyclin-D1-1 isoform 1                              108   6e-23    
ref|XP_007017142.1|  D3-type cyclin isoform 3                           107   6e-23    
ref|XP_009360072.1|  PREDICTED: cyclin-D3-1-like                        108   7e-23    
ref|XP_010695891.1|  PREDICTED: cyclin-D1-1                             107   7e-23    
emb|CAN88864.1|  D5-type cyclin                                         107   7e-23    
ref|NP_001062054.1|  Os08g0479300                                       108   7e-23    
ref|XP_010266361.1|  PREDICTED: cyclin-D3-1-like                        107   8e-23    
ref|XP_010913507.1|  PREDICTED: cyclin-D2-1-like isoform X1             107   9e-23    
gb|KFK32809.1|  hypothetical protein AALP_AA6G290800                    107   9e-23    
ref|XP_009360468.1|  PREDICTED: cyclin-D1-1-like                        107   9e-23    
ref|XP_008795638.1|  PREDICTED: cyclin-D2-1-like isoform X3             107   9e-23    
ref|XP_010269719.1|  PREDICTED: cyclin-D4-1-like isoform X2             107   9e-23    
ref|XP_010061509.1|  PREDICTED: cyclin-D4-2-like                        107   9e-23    
ref|XP_007160883.1|  hypothetical protein PHAVU_001G024900g             107   1e-22    
gb|KHG22908.1|  Cyclin-D3-1 -like protein                               107   1e-22    
ref|XP_010540382.1|  PREDICTED: cyclin-D3-3-like                        107   1e-22    
ref|XP_004141868.1|  PREDICTED: cyclin-D5-1-like                        107   1e-22    
ref|XP_006466470.1|  PREDICTED: cyclin-D5-1-like                        107   1e-22    
ref|XP_006404706.1|  hypothetical protein EUTSA_v10000215mg             107   1e-22    
ref|XP_010272024.1|  PREDICTED: cyclin-D1-1-like isoform X1             107   1e-22    
ref|XP_010236088.1|  PREDICTED: cyclin-D3-1-like                        107   1e-22    
ref|XP_010095859.1|  hypothetical protein L484_022216                   104   1e-22    
ref|XP_003578259.1|  PREDICTED: cyclin-D4-1-like                        107   1e-22    
ref|XP_004155401.1|  PREDICTED: cyclin-D1-1-like                        106   1e-22    
ref|XP_004135474.1|  PREDICTED: cyclin-D1-1-like                        106   2e-22    
emb|CDP21104.1|  unnamed protein product                                107   2e-22    
ref|XP_004297663.1|  PREDICTED: cyclin-D1-1-like                        106   2e-22    
gb|EMT15062.1|  Cyclin-D3-1                                             107   2e-22    
ref|XP_010519253.1|  PREDICTED: cyclin-D4-1-like isoform X2             106   2e-22    
ref|XP_007047562.1|  Cyclin d1,1, putative isoform 1                    105   2e-22    
gb|KDO82576.1|  hypothetical protein CISIN_1g020177mg                   105   2e-22    
ref|XP_002314728.1|  cyclin delta-1 family protein                      106   2e-22    
emb|CDY25602.1|  BnaA04g12940D                                          106   2e-22    
ref|XP_010269718.1|  PREDICTED: cyclin-D4-1-like isoform X1             106   2e-22    
ref|XP_008446249.1|  PREDICTED: cyclin-D1-1                             106   2e-22    
ref|XP_008793830.1|  PREDICTED: cyclin-D2-1-like isoform X1             105   2e-22    
ref|XP_008795636.1|  PREDICTED: cyclin-D2-1-like isoform X1             106   2e-22    
dbj|BAD25836.1|  putative cyclin D1                                     105   2e-22    
ref|XP_007047563.1|  Cyclin d1,1, putative isoform 2                    105   2e-22    
ref|XP_010530750.1|  PREDICTED: cyclin-D3-1                             106   2e-22    
ref|XP_006280836.1|  hypothetical protein CARUB_v10026812mg             105   3e-22    
ref|XP_010463118.1|  PREDICTED: cyclin-D4-1 isoform X3                  105   3e-22    
ref|XP_003611595.1|  Cyclin-D5-1                                        106   3e-22    
ref|XP_011016888.1|  PREDICTED: cyclin-D2-1-like                        105   3e-22    
ref|NP_001280982.1|  cyclin-D3-1-like                                   106   3e-22    
emb|CAB61222.1|  cyclin D3a                                             105   3e-22    
ref|XP_008389592.1|  PREDICTED: cyclin-D1-1-like                        105   3e-22    
gb|KHN45294.1|  Cyclin-D1-1                                             105   3e-22    
ref|XP_002454584.1|  hypothetical protein SORBIDRAFT_04g033870          105   3e-22    
ref|NP_001105048.1|  LOC541915                                          105   3e-22    
ref|XP_003550970.1|  PREDICTED: cyclin-D1-1-like                        105   3e-22    
gb|AFW64381.1|  D-type cyclin                                           105   3e-22    
ref|XP_008341408.1|  PREDICTED: cyclin-D5-1                             104   3e-22    
ref|XP_007042498.1|  Cyclin-D3-1                                        106   3e-22    
ref|XP_007047384.1|  D3-type cyclin isoform 2                           106   3e-22    
ref|XP_011021642.1|  PREDICTED: cyclin-D1-1-like                        105   3e-22    
sp|Q10K98.1|CCD23_ORYSJ  RecName: Full=Putative cyclin-D2-3; AltN...    106   3e-22    
ref|XP_004489765.1|  PREDICTED: cyclin-D4-1-like isoform X2             105   4e-22    
gb|EMS45836.1|  Cyclin-D4-1                                             105   4e-22    
ref|XP_010472237.1|  PREDICTED: cyclin-D2-1 isoform X1                  105   4e-22    
ref|XP_009597995.1|  PREDICTED: cyclin-D4-1-like                        105   4e-22    
ref|XP_010279525.1|  PREDICTED: cyclin-D4-1-like                        105   4e-22    
gb|KHG22216.1|  Cyclin-D3-2 -like protein                               105   4e-22    
gb|KHN23256.1|  Cyclin-D1-1                                             105   4e-22    
gb|EEE68699.1|  hypothetical protein OsJ_27347                          105   4e-22    
ref|XP_003628656.1|  Cyclin-D1-1                                        105   4e-22    
gb|AAV41032.1|  cyclin D-like protein                                   105   5e-22    
ref|XP_009140361.1|  PREDICTED: cyclin-D2-1-like                        105   5e-22    
ref|XP_003517843.2|  PREDICTED: cyclin-D1-1-like                        105   5e-22    
gb|AAV28533.2|  D-type cyclin                                           105   5e-22    
ref|XP_009795658.1|  PREDICTED: cyclin-D3-2-like                        105   5e-22    
ref|XP_007047383.1|  Cyclin d3,3 isoform 1                              106   5e-22    
ref|XP_006353186.1|  PREDICTED: cyclin-D4-1-like                        105   6e-22    
ref|XP_009773363.1|  PREDICTED: cyclin-D4-1-like                        105   6e-22    
ref|XP_009354156.1|  PREDICTED: cyclin-D3-1-like                        105   6e-22    
ref|XP_006426084.1|  hypothetical protein CICLE_v10026015mg             103   6e-22    
ref|XP_009340977.1|  PREDICTED: cyclin-D4-2                             105   6e-22    
ref|XP_004159904.1|  PREDICTED: cyclin-D3-1-like                        105   6e-22    
ref|XP_004136965.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-D3-1-...    105   6e-22    
gb|KDP41457.1|  hypothetical protein JCGZ_15864                         105   6e-22    
gb|EMS61976.1|  Cyclin-D2-1                                             104   6e-22    
gb|KDP41686.1|  hypothetical protein JCGZ_16093                         105   7e-22    
ref|XP_010646327.1|  PREDICTED: cyclin-D4-2                             105   7e-22    
ref|XP_010913508.1|  PREDICTED: cyclin-D2-1-like isoform X2             104   7e-22    
pir||S51651  cyclin delta-2 - Arabidopsis thaliana                      105   7e-22 
ref|NP_001275355.1|  D-type cyclin family 3 subgroup 1                  105   7e-22    
ref|XP_010101662.1|  hypothetical protein L484_006781                   105   7e-22    
ref|XP_008338924.1|  PREDICTED: cyclin-D2-1-like                        104   7e-22    
ref|XP_008338435.1|  PREDICTED: cyclin-D5-1-like                        104   7e-22    
ref|XP_007222170.1|  hypothetical protein PRUPE_ppa007754mg             105   7e-22    
gb|KDP32089.1|  hypothetical protein JCGZ_12550                         106   7e-22    
ref|XP_010417007.1|  PREDICTED: cyclin-D2-1-like isoform X1             105   8e-22    
ref|XP_011017157.1|  PREDICTED: cyclin-D3-1-like                        105   8e-22    
gb|EEC75397.1|  hypothetical protein OsI_11885                          106   8e-22    
ref|XP_009342571.1|  PREDICTED: cyclin-D2-1-like                        104   8e-22    
ref|NP_179835.1|  cyclin-D2-1                                           104   9e-22    
ref|XP_007047815.1|  Cyclin d4,2, putative                              104   9e-22    
ref|XP_006426083.1|  hypothetical protein CICLE_v10026015mg             103   9e-22    
ref|XP_009373772.1|  PREDICTED: cyclin-D2-1-like                        104   9e-22    
ref|XP_009622041.1|  PREDICTED: cyclin-D3-1-like                        104   1e-21    
dbj|BAA76478.1|  NtcycD3-1                                              104   1e-21    
ref|XP_004489764.1|  PREDICTED: cyclin-D4-1-like isoform X1             104   1e-21    
ref|XP_007155814.1|  hypothetical protein PHAVU_003G234000g             103   1e-21    
ref|XP_010464289.1|  PREDICTED: cyclin-D3-2-like                        104   1e-21    
dbj|BAE80324.1|  cyclin D3-1                                            104   1e-21    
ref|XP_003613088.1|  Cyclin D2                                          103   1e-21    
ref|XP_011071059.1|  PREDICTED: cyclin-D1-1-like                        103   1e-21    
ref|XP_011029308.1|  PREDICTED: cyclin-D3-3-like                        104   1e-21    
ref|XP_003574644.1|  PREDICTED: cyclin-D4-2-like                        103   1e-21    
ref|XP_001783314.1|  predicted protein                                  104   1e-21    
ref|XP_009379329.1|  PREDICTED: cyclin-D5-1                             103   1e-21    
gb|AEZ35254.1|  cyclin D-type                                           103   1e-21    
emb|CDX89480.1|  BnaC04g34990D                                          103   1e-21    
emb|CAD32542.1|  cyclin D protein                                       103   1e-21    
gb|KHN20612.1|  Cyclin-D3-1                                             103   2e-21    
ref|XP_009620630.1|  PREDICTED: cyclin-D3-2-like                        103   2e-21    
gb|AAN87006.1|  cyclin D                                                103   2e-21    
ref|XP_007018180.1|  D2/4-type cyclin                                   103   2e-21    
ref|XP_011069720.1|  PREDICTED: cyclin-D3-3-like isoform X2             103   2e-21    
ref|XP_007136753.1|  hypothetical protein PHAVU_009G071400g             103   2e-21    
ref|XP_010547997.1|  PREDICTED: cyclin-D3-1-like                        104   2e-21    
ref|XP_010444529.1|  PREDICTED: cyclin-D4-1-like isoform X1             103   2e-21    
ref|NP_001237137.1|  cyclin d2                                          103   2e-21    
ref|XP_009614202.1|  PREDICTED: cyclin-D4-2-like                        103   2e-21    
ref|XP_006366431.1|  PREDICTED: cyclin-D2-2-like                        103   2e-21    
ref|XP_010463113.1|  PREDICTED: cyclin-D4-1 isoform X2                  103   2e-21    
gb|AEV41135.1|  D3-type cyclin                                          103   2e-21    
ref|XP_003635232.1|  PREDICTED: cyclin-D4-1 isoform X1                  102   2e-21    
ref|XP_008373097.1|  PREDICTED: cyclin-D3-1                             103   2e-21    
ref|XP_009335011.1|  PREDICTED: cyclin-D3-1                             103   2e-21    
ref|XP_006659503.1|  PREDICTED: cyclin-D4-2-like                        103   2e-21    
ref|XP_008360986.1|  PREDICTED: cyclin-D3-1-like                        103   2e-21    
ref|XP_003551241.1|  PREDICTED: cyclin-D2-1-like                        103   2e-21    
dbj|BAF00198.1|  putative cyclin D                                      103   2e-21    
ref|NP_001275275.1|  D-type cyclin family 3 subgroup 2                  103   3e-21    
ref|XP_006288266.1|  hypothetical protein CARUB_v10001512mg             102   3e-21    
ref|XP_011069719.1|  PREDICTED: cyclin-D3-3-like isoform X1             103   3e-21    
ref|XP_007206299.1|  hypothetical protein PRUPE_ppa008396mg             102   3e-21    
ref|XP_004509784.1|  PREDICTED: cyclin-D4-2-like                        103   3e-21    



>ref|XP_009605565.1| PREDICTED: putative cyclin-D6-1 [Nicotiana tomentosiformis]
Length=312

 Score =   322 bits (825),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 171/297 (58%), Positives = 214/297 (72%), Gaps = 14/297 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-QISFSIRREAFSLTYRTQ  893
             MEF+LENPLT    + HH DAV ALFA ESDHMPS L+F    + F +RR++ SL  +TQ
Sbjct  13    MEFDLENPLTGF--EEHHFDAVSALFASESDHMPSFLAFKSTDVRFCLRRDSLSLISQTQ  70

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
               YKFDR +AYLA+NYIDRFLS Q V EN+PW+VRILVI+ LSLAAKM   +L LSDIQR
Sbjct  71    SAYKFDRYMAYLAVNYIDRFLSEQVVTENRPWIVRILVIASLSLAAKMTNFNLSLSDIQR  130

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTI  533
             D G++FD+QSI RME +IL+ L+WRLRSITPFSFLHF  SL+ L D S+ Q L  RAS I
Sbjct  131   DVGVIFDAQSIPRMESLILTTLEWRLRSITPFSFLHFCMSLFQLGDSSLTQPLKRRASDI  190

Query  532   IFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM  353
             IF++ Y+ KLFEY PS+IAASALL  A++LIPL+F SF  AI  C+Y+  +E++N L+V+
Sbjct  191   IFSTQYETKLFEYKPSIIAASALLCAADELIPLRFSSFLAAISECQYLTKEELMNALAVI  250

Query  352   RETVTRGIESSIDAISDCSLTPRSVLH-----RESGMMPERDG-GMKRRRLNNFCDD  200
             RE +  G ES++D      LTP+SVL       E       DG  MKRR+LN+F D+
Sbjct  251   REMLIEGRESTVD-----KLTPKSVLECECTTSECEKPTNLDGDSMKRRKLNDFRDE  302



>ref|XP_009763360.1| PREDICTED: putative cyclin-D6-1 [Nicotiana sylvestris]
Length=306

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 215/300 (72%), Gaps = 9/300 (3%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-QISFSIRREAFSLTYRTQ  893
             MEF+LENPLT      HH DAV ALFA ESDH+PS L+F    + F +RR + SL  +TQ
Sbjct  1     MEFDLENPLTGC--GEHHFDAVSALFASESDHLPSFLAFKSTDVRFCLRRHSLSLISQTQ  58

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
                KFD  +AYLA+NYIDRFLS Q V EN+PW+VRILVI+ LSLAAKM   +L LSDIQR
Sbjct  59    SACKFDPYMAYLAVNYIDRFLSEQVVTENRPWIVRILVIASLSLAAKMTNFNLSLSDIQR  118

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTI  533
             D G++FD+QSI RME +IL+ L+WRLRSITPFSFLHF  SL+ L D S+ Q L  RAS I
Sbjct  119   DVGIIFDAQSIPRMESLILTTLEWRLRSITPFSFLHFCMSLFQLGDSSLTQPLKRRASDI  178

Query  532   IFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM  353
             IF++ Y+IKLFEY PS+IAASALL  A++L+PLQF SF  AI  C+Y+  +E++N L+V+
Sbjct  179   IFSTQYEIKLFEYKPSIIAASALLCAADELMPLQFSSFLAAISACQYLTKEELMNALAVV  238

Query  352   RETVTRGIESSIDAISDCSLTPRSVLH-----RESGMMPERDG-GMKRRRLNNFCDDQEY  191
             RE +  G ES++D+ S  +L P+S+L       E       DG  +KRR+LN+F DDQ +
Sbjct  239   REMLIEGRESTVDSESCSTLPPKSILDCECTTSECEKPTNLDGDSIKRRKLNDFRDDQTF  298



>ref|XP_010316643.1| PREDICTED: putative cyclin-D6-1 isoform X1 [Solanum lycopersicum]
Length=297

 Score =   317 bits (811),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 173/298 (58%), Positives = 208/298 (70%), Gaps = 14/298 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-QISFSIRREAFSLTYRTQ  893
             MEF+L+NPLT    + +H DAV ALFA ESDHMPS L F    + FS+RR +  L  + Q
Sbjct  1     MEFDLQNPLTGF--EEYHFDAVSALFANESDHMPSFLDFKSTDVRFSLRRHSVFLISQVQ  58

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
               YKFD  IAYLA+NYIDRFLS+QAVLENKPW+VRILVI  LSLAAKMR +DL LSDIQR
Sbjct  59    SSYKFDGYIAYLAVNYIDRFLSKQAVLENKPWIVRILVIVSLSLAAKMRNVDLSLSDIQR  118

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTI  533
             D GL FD++SIHRME +IL  LKWRLRSITPFSFLHFF S   L D S+ +SL  RAS I
Sbjct  119   DVGLNFDARSIHRMESLILDTLKWRLRSITPFSFLHFFNSFLKLGDSSLTRSLKQRASDI  178

Query  532   IFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM  353
             IF++ Y+IKLF Y PS+IAASALL  AE+LIPLQ+ S   AI   +Y   +E++N L+VM
Sbjct  179   IFSTQYEIKLFVYKPSIIAASALLRAAEELIPLQYSSCLAAISENQYSNKEELMNALAVM  238

Query  352   RETVTRGIESSIDAISDCS-LTPRSVL---HRESGMMPERDGGMKRRRLNNFCDDQEY  191
             RE    G E        CS LTP+SVL   H  S    +    +K+RRL++  DDQ +
Sbjct  239   REMPIEGREY-------CSKLTPKSVLECEHTSSQCETQDKDNIKKRRLSDIRDDQTF  289



>ref|XP_006347185.1| PREDICTED: putative cyclin-D6-1-like [Solanum tuberosum]
Length=300

 Score =   313 bits (803),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 209/302 (69%), Gaps = 19/302 (6%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-QISFSIRREAFSLTYRTQ  893
             MEF+L NPLT    + +H DAV ALFA ESDHMPS L F    + FS+RR +  L  + Q
Sbjct  1     MEFDLHNPLTGF--EEYHFDAVSALFANESDHMPSFLDFKSTDVRFSLRRHSVFLISQVQ  58

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
               YKFD  IAYLA+NYIDRFLS+QAVLENKPW+VRILVI  LSLAAKMR +DL LSDIQR
Sbjct  59    SSYKFDGYIAYLAVNYIDRFLSKQAVLENKPWIVRILVIVSLSLAAKMRNVDLSLSDIQR  118

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTI  533
             D GL FD+QSIHRME +IL  LKWRLRSITPFSFLHFF S   L D S+ QSL  RAS I
Sbjct  119   DVGLNFDAQSIHRMESLILDTLKWRLRSITPFSFLHFFNSFLKLVDSSLTQSLKQRASDI  178

Query  532   IFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM  353
             IF++ Y+IKLFEY PS+IAASALL  AE+LI LQF S   AI   +Y   +E++N L+VM
Sbjct  179   IFSTQYEIKLFEYKPSIIAASALLCAAEELITLQFSSCLTAISESQYSNKEELMNALAVM  238

Query  352   RETVTRGIESSIDAISDCS-LTPRSVL-------HRESGMMPERDGGMKRRRLNNFCDDQ  197
             RE    G E        CS LTP+SVL         E+    +RD  +K+RRL++  DD+
Sbjct  239   REMPIEGREY-------CSMLTPKSVLKCEHTSSQCETHTNQDRD-TIKKRRLSDSRDDR  290

Query  196   EY  191
              +
Sbjct  291   TF  292



>ref|XP_010316644.1| PREDICTED: putative cyclin-D6-1 isoform X2 [Solanum lycopersicum]
Length=296

 Score =   311 bits (798),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 173/298 (58%), Positives = 208/298 (70%), Gaps = 15/298 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-QISFSIRREAFSLTYRTQ  893
             MEF+L+NPLT    + +H DAV ALFA ESDHMPS L F    + FS+RR +  L  + Q
Sbjct  1     MEFDLQNPLTGF--EEYHFDAVSALFANESDHMPSFLDFKSTDVRFSLRRHSVFLISQVQ  58

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
               YKFD  IAYLA+NYIDRFLS+QAVLENKPW+VRILVI  LSLAAKMR +DL LSDIQR
Sbjct  59    SSYKFDGYIAYLAVNYIDRFLSKQAVLENKPWIVRILVIVSLSLAAKMRNVDLSLSDIQR  118

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTI  533
             D GL FD++SIHRME +IL  LKWRLRSITPFSFLHFF S   L D S+ +SL  RAS I
Sbjct  119   DVGLNFDARSIHRMESLILDTLKWRLRSITPFSFLHFFNSFLKLGDSSLTRSLKQRASDI  178

Query  532   IFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM  353
             IF++ Y+IKLF Y PS+IAASALL  AE+LIPLQ+ S   AI   +Y  + E++N L+VM
Sbjct  179   IFSTQYEIKLFVYKPSIIAASALLRAAEELIPLQYSSCLAAISENQY-SNKELMNALAVM  237

Query  352   RETVTRGIESSIDAISDCS-LTPRSVL---HRESGMMPERDGGMKRRRLNNFCDDQEY  191
             RE    G E        CS LTP+SVL   H  S    +    +K+RRL++  DDQ +
Sbjct  238   REMPIEGREY-------CSKLTPKSVLECEHTSSQCETQDKDNIKKRRLSDIRDDQTF  288



>ref|XP_009603725.1| PREDICTED: putative cyclin-D6-1 isoform X1 [Nicotiana tomentosiformis]
Length=295

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 210/294 (71%), Gaps = 5/294 (2%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-QISFSIRREAFSLTYRTQ  893
             M+F+LENPL+SS  + H  D V ALFA ESDHMPS  SF    I F IRR AFSL  + Q
Sbjct  1     MKFDLENPLSSS--NEHENDTVSALFAAESDHMPSFFSFKSTDIPFFIRRHAFSLISQVQ  58

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
             F Y  D+   YLA+NYIDRFLS+Q V  NKPW+VRIL I+ LSLAAKMR I L L D QR
Sbjct  59    FSYNLDQFTTYLAVNYIDRFLSKQPVPGNKPWIVRILAIASLSLAAKMRSISLSLFDFQR  118

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTI  533
             DEGL+FDSQSI RME +IL+ L WRLRSITPF+FL FF SL+ L + S++Q L  RA+ I
Sbjct  119   DEGLIFDSQSIQRMEVLILTTLNWRLRSITPFAFLQFFESLFELSESSLSQILKDRATDI  178

Query  532   IFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM  353
             IF+SHY++KLFEY  S++AASALL  A +L+P QF  F +A+ + E++  DE+LNC  +M
Sbjct  179   IFSSHYEVKLFEYKQSILAASALLCAAHELVPQQFSFFLDAVSKWEHINKDELLNCWELM  238

Query  352   RETVTRGIESSIDAISDCSLTPRSVLHRESGMMPERDGGMKRRRLNNFCDDQEY  191
             R+ VT   +S+ID +S  SLTP++VL  E    P+ +   KRRRL+ F +DQ +
Sbjct  239   RD-VTDAGKSTIDEMSSISLTPKTVLDYEVT-SPQNENNSKRRRLSGFRNDQTF  290



>ref|XP_009603726.1| PREDICTED: putative cyclin-D6-1 isoform X2 [Nicotiana tomentosiformis]
Length=293

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 210/294 (71%), Gaps = 7/294 (2%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-QISFSIRREAFSLTYRTQ  893
             M+F+LENPL+SS  + H  D V ALFA ESDHMPS  SF    I F IRR AFSL   +Q
Sbjct  1     MKFDLENPLSSS--NEHENDTVSALFAAESDHMPSFFSFKSTDIPFFIRRHAFSLI--SQ  56

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
             F Y  D+   YLA+NYIDRFLS+Q V  NKPW+VRIL I+ LSLAAKMR I L L D QR
Sbjct  57    FSYNLDQFTTYLAVNYIDRFLSKQPVPGNKPWIVRILAIASLSLAAKMRSISLSLFDFQR  116

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTI  533
             DEGL+FDSQSI RME +IL+ L WRLRSITPF+FL FF SL+ L + S++Q L  RA+ I
Sbjct  117   DEGLIFDSQSIQRMEVLILTTLNWRLRSITPFAFLQFFESLFELSESSLSQILKDRATDI  176

Query  532   IFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM  353
             IF+SHY++KLFEY  S++AASALL  A +L+P QF  F +A+ + E++  DE+LNC  +M
Sbjct  177   IFSSHYEVKLFEYKQSILAASALLCAAHELVPQQFSFFLDAVSKWEHINKDELLNCWELM  236

Query  352   RETVTRGIESSIDAISDCSLTPRSVLHRESGMMPERDGGMKRRRLNNFCDDQEY  191
             R+ VT   +S+ID +S  SLTP++VL  E    P+ +   KRRRL+ F +DQ +
Sbjct  237   RD-VTDAGKSTIDEMSSISLTPKTVLDYE-VTSPQNENNSKRRRLSGFRNDQTF  288



>ref|XP_009757646.1| PREDICTED: putative cyclin-D6-1 isoform X1 [Nicotiana sylvestris]
Length=293

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/293 (54%), Positives = 206/293 (70%), Gaps = 12/293 (4%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-QISFSIRREAFSLTYRTQ  893
             M+F+LENPLTSS    H  D V ALFA +SDHMPS  SF    I FSIR  AFSL  + +
Sbjct  1     MKFDLENPLTSS--KEHENDTVSALFAAQSDHMPSFFSFKSTDILFSIRHHAFSLISQAR  58

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
             F Y  D    YLA+NYIDRFLS+Q V +NKPW++R+LVI+ LSLAAKMR I+L L D QR
Sbjct  59    FSYNLDEFSTYLAVNYIDRFLSKQPVPQNKPWILRLLVIASLSLAAKMRSINLSLFDFQR  118

Query  712   -DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAST  536
              D GL+FD +SI RME +IL+ L WRLRSITPF+FL F  SL+ L D S++Q+L  RA+ 
Sbjct  119   EDVGLIFDVESIQRMEVLILTTLNWRLRSITPFAFLDFINSLFELSDSSLSQTLKDRATD  178

Query  535   IIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSV  356
             IIF SHY++KLFEY PS++AA ALL  A++LIP QF  F +A+ +CEY+  +E++NC +V
Sbjct  179   IIFNSHYEVKLFEYKPSILAAWALLCAAQELIPQQFSFFLDAVSKCEYINKEELVNCWAV  238

Query  355   MRETVTRGIESSIDAISDCSLTPRSVLHRESGMMPERDGGMKRRRLNNFCDDQ  197
             MR       +++I+ ++  S TP+SVL  E    PE +   KRRRL++  +DQ
Sbjct  239   MR-------DATINEMTSSSFTPKSVLDYE-DTSPENENNSKRRRLSDLRNDQ  283



>ref|XP_009757648.1| PREDICTED: putative cyclin-D6-1 isoform X3 [Nicotiana sylvestris]
Length=291

 Score =   288 bits (736),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 159/293 (54%), Positives = 206/293 (70%), Gaps = 14/293 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-QISFSIRREAFSLTYRTQ  893
             M+F+LENPLTSS    H  D V ALFA +SDHMPS  SF    I FSIR  AFSL   +Q
Sbjct  1     MKFDLENPLTSS--KEHENDTVSALFAAQSDHMPSFFSFKSTDILFSIRHHAFSLI--SQ  56

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
             F Y  D    YLA+NYIDRFLS+Q V +NKPW++R+LVI+ LSLAAKMR I+L L D QR
Sbjct  57    FSYNLDEFSTYLAVNYIDRFLSKQPVPQNKPWILRLLVIASLSLAAKMRSINLSLFDFQR  116

Query  712   -DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAST  536
              D GL+FD +SI RME +IL+ L WRLRSITPF+FL F  SL+ L D S++Q+L  RA+ 
Sbjct  117   EDVGLIFDVESIQRMEVLILTTLNWRLRSITPFAFLDFINSLFELSDSSLSQTLKDRATD  176

Query  535   IIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSV  356
             IIF SHY++KLFEY PS++AA ALL  A++LIP QF  F +A+ +CEY+  +E++NC +V
Sbjct  177   IIFNSHYEVKLFEYKPSILAAWALLCAAQELIPQQFSFFLDAVSKCEYINKEELVNCWAV  236

Query  355   MRETVTRGIESSIDAISDCSLTPRSVLHRESGMMPERDGGMKRRRLNNFCDDQ  197
             MR       +++I+ ++  S TP+SVL  E    PE +   KRRRL++  +DQ
Sbjct  237   MR-------DATINEMTSSSFTPKSVLDYE-DTSPENENNSKRRRLSDLRNDQ  281



>ref|XP_009757647.1| PREDICTED: putative cyclin-D6-1 isoform X2 [Nicotiana sylvestris]
Length=292

 Score =   285 bits (730),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 158/293 (54%), Positives = 205/293 (70%), Gaps = 13/293 (4%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-QISFSIRREAFSLTYRTQ  893
             M+F+LENPLTSS    H  D V ALFA +SDHMPS  SF    I FSIR  AFSL  + +
Sbjct  1     MKFDLENPLTSS--KEHENDTVSALFAAQSDHMPSFFSFKSTDILFSIRHHAFSLISQAR  58

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
             F Y  D    YLA+NYIDRFLS+Q V  NKPW++R+LVI+ LSLAAKMR I+L L D QR
Sbjct  59    FSYNLDEFSTYLAVNYIDRFLSKQPV-PNKPWILRLLVIASLSLAAKMRSINLSLFDFQR  117

Query  712   -DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAST  536
              D GL+FD +SI RME +IL+ L WRLRSITPF+FL F  SL+ L D S++Q+L  RA+ 
Sbjct  118   EDVGLIFDVESIQRMEVLILTTLNWRLRSITPFAFLDFINSLFELSDSSLSQTLKDRATD  177

Query  535   IIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSV  356
             IIF SHY++KLFEY PS++AA ALL  A++LIP QF  F +A+ +CEY+  +E++NC +V
Sbjct  178   IIFNSHYEVKLFEYKPSILAAWALLCAAQELIPQQFSFFLDAVSKCEYINKEELVNCWAV  237

Query  355   MRETVTRGIESSIDAISDCSLTPRSVLHRESGMMPERDGGMKRRRLNNFCDDQ  197
             MR       +++I+ ++  S TP+SVL  E    PE +   KRRRL++  +DQ
Sbjct  238   MR-------DATINEMTSSSFTPKSVLDYE-DTSPENENNSKRRRLSDLRNDQ  282



>ref|XP_006343269.1| PREDICTED: putative cyclin-D6-1-like [Solanum tuberosum]
Length=303

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 158/305 (52%), Positives = 203/305 (67%), Gaps = 22/305 (7%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             M+F+LENPLT+ F+ H   DAV ALFA ESDH PS  S +  +  SIR   F+L  + QF
Sbjct  1     MKFDLENPLTA-FDGHDDNDAVSALFAAESDHTPSFKSTD--VHSSIRNHCFTLISQAQF  57

Query  889   IYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMR---------CID  737
              Y  DR  AYLA+NYIDRFLS+Q VLENKPW+VRILV + LSLAAKMR            
Sbjct  58    SYDIDRFTAYLAVNYIDRFLSKQVVLENKPWIVRILVTASLSLAAKMRNINNLSISNNSS  117

Query  736   LCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPL-EDPSIAQ  560
             +  S+ + DEGL+F+ QS+HRME +IL+ L WRLRSITPF+ L FF SL+ L  D S++Q
Sbjct  118   MDQSEQRNDEGLIFNLQSVHRMENLILTTLNWRLRSITPFALLQFFNSLFELSNDQSLSQ  177

Query  559   SLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAI-FRCEYVKS  383
             SL  RAS IIF+SHY+IKL EY PS++AASA L  A +LIP Q   F  AI  +C ++  
Sbjct  178   SLEDRASDIIFSSHYEIKLLEYKPSILAASAFLCAAHELIPQQVPFFLVAINSKCGHIYK  237

Query  382   DEILNCLSVMRETVTRGIESSIDAISDCSLTPRSVL-HRESGMMPERDGGMKRRRLNNFC  206
             +E+LNC SVMRE     +      +S  SLTP SVL  + +    +R+ G K+RRLN+F 
Sbjct  238   EEVLNCWSVMREITVDEV------VSFSSLTPNSVLDQKRTSENADRNNG-KKRRLNDFR  290

Query  205   DDQEY  191
             ++Q +
Sbjct  291   NNQTF  295



>ref|XP_011096183.1| PREDICTED: putative cyclin-D6-1 [Sesamum indicum]
Length=310

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 157/303 (52%), Positives = 193/303 (64%), Gaps = 19/303 (6%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHL--DAVPALFAGESDHMPSLLSFNHQISF--SIRREAFSLTY  902
             ME +L+NPLT+    H  L  D VP+LFA ESDHMPSLLSF H   F  SIRR A SL  
Sbjct  1     MELDLQNPLTT----HQDLQYDGVPSLFANESDHMPSLLSF-HASGFRCSIRRTALSLIS  55

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLC--L  728
             + +F Y  D  + YL+ NY+DRFLS Q +LE +PW+  ILV++ LSLAAKMR  DL   L
Sbjct  56    QVKFAYNLDPFLVYLSFNYVDRFLSTQEILEKRPWIAHILVVASLSLAAKMRNSDLSISL  115

Query  727   SDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIH  548
             SD+QR++G  FDSQS+ RME ++LS L+WR+RSITPFSFL +F SL  +ED S+ Q L H
Sbjct  116   SDLQREDGFEFDSQSVRRMERILLSTLRWRMRSITPFSFLQYFISLLEIEDHSLTQCLKH  175

Query  547   RASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILN  368
             RAS IIFT   ++KL EY PS IAASALL     L P  F S  +AI  CEYV  D +  
Sbjct  176   RASEIIFTVQQELKLLEYKPSTIAASALLCAIHDLTPPAFSSSHSAITSCEYVDKDTLSE  235

Query  367   CLSVMRETVTRGIESSIDAISDCSLTPRSVLH------RESG-MMPERDGGMKRRRLNNF  209
             C  VM+E    G   S+D  +  ++T  SVL         SG   PE D  +KRRRLN F
Sbjct  236   CFGVMQEMTREGYGLSLDESACATVTQISVLDTSVEGTSSSGPGFPESD-NVKRRRLNGF  294

Query  208   CDD  200
              D+
Sbjct  295   YDN  297



>emb|CDP19718.1| unnamed protein product [Coffea canephora]
Length=308

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 145/303 (48%), Positives = 196/303 (65%), Gaps = 17/303 (6%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMP---SLLSFN----HQISFSIRREAFS  911
             ME +LE PL +S  +    +AVPALFA E DHMP     L FN    H + FS+RREAFS
Sbjct  1     MELDLEYPLMASSEE----EAVPALFAQEIDHMPLQSIFLPFNSSDDHHV-FSVRREAFS  55

Query  910   LTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLC  731
             L    +  Y+ +    YLA+NY+DRF+S+  + E K W+V IL IS LSLAAKMR  D+ 
Sbjct  56    LISHAKHCYELNPFTTYLAVNYMDRFISKTNIREQKRWIVGILAISSLSLAAKMRNTDIS  115

Query  730   --LSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQS  557
               LS +QR+EG  F  + +HRME +IL+ L WR+RSITPFSFL+FF SL+ ++D S+ + 
Sbjct  116   ISLSHVQREEGFAFHPRWVHRMEALILTTLGWRMRSITPFSFLNFFISLFKIQDSSLTRP  175

Query  556   LIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDE  377
             L  RA  II  +HY++KL EY PS+I+ASALL     LIP++F S ++AI  CE+V+ ++
Sbjct  176   LKFRAFDIILDTHYEMKLLEYKPSLISASALLCATLDLIPMEFPSLRDAILSCEHVEKEK  235

Query  376   ILNCLSVMRETVTRGIESSIDAISDCSLTPRSVLHRESGMMPER---DGGMKRRRLNNFC  206
             +L CL+ MRE V      +  A+S C+ TP S+L + +    E       +KRRRLN FC
Sbjct  236   LLQCLNAMREMVMDNSLKASGAVSICTSTPGSILRQFTSSETEEATAKDKIKRRRLNGFC  295

Query  205   DDQ  197
             DDQ
Sbjct  296   DDQ  298



>ref|XP_010268904.1| PREDICTED: putative cyclin-D6-1 [Nelumbo nucifera]
Length=321

 Score =   263 bits (672),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 191/310 (62%), Gaps = 21/310 (7%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSF----NHQISFSIRREAFSLTYR  899
             EF+LENPLTS     H  D +P+LFA ESDHMP    F          SIRRE  SL  +
Sbjct  3     EFDLENPLTSL--QEHQADTIPSLFAAESDHMPFQNYFLDMKARDFDVSIRREIISLILQ  60

Query  898   TQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDI  719
              QF   FD  I YLA+NY+DRF+SRQ + + KPW++R++ +SCLSLAAKM+  D    D 
Sbjct  61    AQFSCNFDPFIPYLAVNYLDRFISRQGLPQGKPWILRLVAMSCLSLAAKMKKTDFSFPDF  120

Query  718   QRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAS  539
             Q +EG +FD+++I RME +IL  L WR+RSITPFSF+H+F SL+ L+ P +   L  RA+
Sbjct  121   QLEEGFIFDTRTIQRMELLILGALNWRMRSITPFSFVHYFLSLFKLKHPLLRHDLKARAT  180

Query  538   TIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLS  359
              IIF +  +IKL E+ PS+IAASALL  + +  PLQF  FK AI  C +V  + + +C  
Sbjct  181   EIIFKAQNEIKLLEFKPSIIAASALLSASHEFFPLQFPCFKKAISSCAHVNKENLFDCCK  240

Query  358   VMRETVTRGIESSIDAISDCSLTPRSVLHRE-SGMMPERDGG-------------MKRRR  221
             VM++ V  G  S+ D +S  S TP +VL ++ S    E+ G              +KRR+
Sbjct  241   VMQDVVIDGYGSAFDIVS-SSDTPDNVLDQQYSSTESEKTGSTIATTVIRAAERDIKRRK  299

Query  220   LNNFCDDQEY  191
             +N+FC D  +
Sbjct  300   INDFCSDNTF  309



>ref|XP_002524706.1| cyclin d, putative [Ricinus communis]
 gb|EEF37725.1| cyclin d, putative [Ricinus communis]
Length=305

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/272 (51%), Positives = 186/272 (68%), Gaps = 8/272 (3%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS--LLSFNHQISF--SIRREAFSLTY  902
             MEF+LENPLTSS  + H  D +P LFA ESDHMPS   L       F  S R+EA SL  
Sbjct  1     MEFDLENPLTSS--NEHQSDTIPDLFASESDHMPSRDFLKCLKTCDFYSSFRQEAISLIL  58

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             + Q+   F+   AYLA+NY+DR +SRQ + + KPW++R+L ISCLSLAAKM+     LS+
Sbjct  59    QAQYTCNFEPFFAYLAINYMDRCVSRQEIPQGKPWLLRLLAISCLSLAAKMKDTHFPLSN  118

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
             +QR+E   FD Q++ RME +IL  L WR+RSITPFSFLHFF SL+ L+DP + Q+L  RA
Sbjct  119   LQREESFNFDMQTVSRMELLILGALNWRMRSITPFSFLHFFISLFELKDPPLTQALKDRA  178

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
             + IIF +H++IKL E+ PSVIAASALL  + +L PLQ+ SFK +IF CE V  + +L CL
Sbjct  179   TEIIFKAHHEIKLLEFRPSVIAASALLVASHELFPLQYPSFKCSIFSCECVNKENLLRCL  238

Query  361   SVMRETVTR-GIESSIDAISDCSLTPRSVLHR  269
             + +++ V     ES +D +S  + TP S+L R
Sbjct  239   NALQQMVEMVWYESMLDTVSS-TRTPLSILDR  269



>ref|XP_007215712.1| hypothetical protein PRUPE_ppa008931mg [Prunus persica]
 gb|EMJ16911.1| hypothetical protein PRUPE_ppa008931mg [Prunus persica]
Length=313

 Score =   260 bits (665),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 138/307 (45%), Positives = 197/307 (64%), Gaps = 22/307 (7%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFN----HQISFSIRREAFSLTY  902
             MEF+LENPLT S + H   D + ++F+ ESDHMPS + F          SIRREA +   
Sbjct  1     MEFDLENPLTISHDIHS--DTLTSMFSLESDHMPSEIYFQTVQARDFDISIRREAIASI-  57

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
              +Q    +D  + YLA+NY+DRFLS Q +L+ KPW++++L ISC+SLAAKM+  D  L+D
Sbjct  58    -SQLCCNYDNLLQYLAVNYLDRFLSCQGMLQPKPWLIKLLAISCVSLAAKMKKADFSLAD  116

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
             +Q D  ++FD+Q+I RME +IL  LKWR+RSITPFSF+ FF SL+ LEDP + Q+L  RA
Sbjct  117   VQGDGRIIFDTQTIQRMEVLILGALKWRMRSITPFSFISFFNSLFKLEDPPLLQALKARA  176

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
             + IIF S  D++L  + PS+IAASALL  + +L P+Q+  FK A+  C YV  + +L C 
Sbjct  177   AQIIFKSQKDVELLGFKPSIIAASALLSASHELFPMQYPCFKKALSNCSYVNKENMLQCY  236

Query  361   SVMRETVTRGIESSIDAISDCSLTPRSVLHRE------------SGMMPER-DGGMKRRR  221
             S M++ V  G +S ++ +S  S+T  +VL               +GM P R +  MKRR+
Sbjct  237   SAMQDIVADGFDSVLEMVSS-SVTAANVLDHNFSSSAESGTTTVTGMTPLRLEKDMKRRK  295

Query  220   LNNFCDD  200
             ++ +C D
Sbjct  296   ISEYCKD  302



>ref|XP_004234136.1| PREDICTED: putative cyclin-D6-1 [Solanum lycopersicum]
Length=311

 Score =   260 bits (665),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 151/311 (49%), Positives = 199/311 (64%), Gaps = 26/311 (8%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             M+F+LENPLT+   D    + V ALFA ESDH PS  S +  +  SIR   F+L  + QF
Sbjct  1     MKFDLENPLTAFDGDDDDDNDVSALFAAESDHTPSFKSTD--VHSSIRNHCFTLISQAQF  58

Query  889   IYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCID---------  737
                 DR  AYLA+NYIDRFLS+Q +LENKPW++RILV + LSLAAKMR I+         
Sbjct  59    SCDIDRFAAYLAVNYIDRFLSKQLILENKPWIIRILVTASLSLAAKMRNINNLPISHIII  118

Query  736   -------LCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPL-  581
                    L  S+ + +EGL+F+ QS+HRME +IL+ L WRLRSITPF+FL FF SL+ L 
Sbjct  119   PVSNNSSLDQSEHRDNEGLIFNLQSVHRMENLILTTLNWRLRSITPFAFLQFFNSLFELS  178

Query  580   EDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAI-F  404
              + S++QSL  RAS +IF SHY+IKL EY PSV+A+SA L  A +LIP Q   F +AI  
Sbjct  179   NNQSLSQSLEDRASDVIFISHYEIKLVEYKPSVLASSAFLCAAHELIPQQVPFFLDAINS  238

Query  403   RCEYVKSDEILNCLSVMRETVTRGIESSIDAISDCSLTPRSVLHRESGMMPERDGGMKRR  224
             +C ++  +E+LNC +VMRE       S  + +   SLTP SVL +ES          K+R
Sbjct  239   KCGHIYKEEVLNCWNVMREV------SVDEVVCSSSLTPNSVLDQESTSENADRNNSKKR  292

Query  223   RLNNFCDDQEY  191
             RLN+F ++Q +
Sbjct  293   RLNDFRNNQTF  303



>gb|KHG12532.1| Putative cyclin-D6-1 -like protein [Gossypium arboreum]
Length=322

 Score =   258 bits (658),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 139/309 (45%), Positives = 190/309 (61%), Gaps = 24/309 (8%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFN----HQISFSIRREAFSLTYR  899
             +F+LE+PLTS   D H  D + ALF+ ESDHMPS   F          S R+EA SL  +
Sbjct  3     KFDLEDPLTSL--DGHQSDTISALFSSESDHMPSYNYFQCLKTSDFYVSFRQEAISLILQ  60

Query  898   TQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDI  719
              Q+    D    YLA+NY+DRF+S Q + +  PW+VR+LVI+C+SLAAKM+ I    SD 
Sbjct  61    AQYSSNLDPYTQYLAVNYMDRFISWQEIPQGNPWIVRLLVIACISLAAKMKEIHFSFSDF  120

Query  718   QRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAS  539
             QRDEG MFD  +I RME ++L  L WR+RSITPFSF+ FF SL+ L+DP + Q+L  RA+
Sbjct  121   QRDEGFMFDPPAIQRMELLVLDALNWRMRSITPFSFITFFVSLFQLKDPPLTQALKDRAT  180

Query  538   TIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLS  359
              IIF +  +I L E+ PS+I ASALL    +L PLQF SF+ ++  CEYV  ++++ C +
Sbjct  181   NIIFQARNEINLLEFKPSIIGASALLLACHELFPLQFPSFETSVLSCEYVNEEKVMECFN  240

Query  358   VMRETVTRGI-ESSIDAISDCS--LTPRSVLH--------------RESGMMPERDGGMK  230
              M+E V   + ES +D +S  S   TP SVL                 + + PE +  +K
Sbjct  241   EMQEMVNNEMSESIVDMVSSSSSTRTPVSVLDCHCSKSENEGTNSTMATTVTPE-NREIK  299

Query  229   RRRLNNFCD  203
             RR+LN FC+
Sbjct  300   RRKLNGFCN  308



>emb|CAN88868.1| D6-type cyclin [Populus trichocarpa]
Length=324

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 192/317 (61%), Gaps = 34/317 (11%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHH-HLDAVPALFAGESDHMPS--LLSFNHQISF--SIRREAFSLT  905
             M+FNLENPLT   N H  H D  P+LF  ESDHMPS   L    +I F  S RREA S  
Sbjct  1     MDFNLENPLT---NSHELHFDTTPSLFLIESDHMPSKNYLKTLKEIDFDVSFRREAISSV  57

Query  904   YRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS  725
              R      FD S++YLA+NY+DRFLS Q + + KPWV ++L ++C+SLAAKM+  +  ++
Sbjct  58    LRVS--CNFDPSLSYLAVNYLDRFLSSQGIPQPKPWVFKLLAVACVSLAAKMKEAEFYVT  115

Query  724   DIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHR  545
             DIQ D G +FD Q+I +ME +IL  L WR+RSITPFSF+ FF SL+  +DP + Q+L  R
Sbjct  116   DIQGDGGFVFDPQTIQKMEVLILGALNWRMRSITPFSFISFFISLFKPKDPPLRQALKAR  175

Query  544   ASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNC  365
             A  IIF +  DI L E+ PS+ AASALLY   +L P+QFL F+ AI  C YV  + +L C
Sbjct  176   ACEIIFKAQNDINLLEFRPSLTAASALLYACHELFPMQFLCFRKAISICSYVNKENLLQC  235

Query  364   LSVMRETVTRGIESSIDAISDCSLTPRSVLHRE---------------------SGMMPE  248
              + M+ET   G +S  D +S  S TP +VL R                      +   PE
Sbjct  236   YNAMQETAMDGYKSQFDMVSS-SDTPVNVLDRHFSSSESENTNGTVVMISSNGSNKTWPE  294

Query  247   RDGGMKRRRLNNFCDDQ  197
             +  G+KRR+++  C++Q
Sbjct  295   K--GIKRRKISALCNNQ  309



>ref|XP_002326106.2| hypothetical protein POPTR_0019s14110g [Populus trichocarpa]
 gb|EEF00488.2| hypothetical protein POPTR_0019s14110g [Populus trichocarpa]
Length=324

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 192/317 (61%), Gaps = 34/317 (11%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHH-HLDAVPALFAGESDHMPS--LLSFNHQISF--SIRREAFSLT  905
             M+FNLENPLT   N H  H D  P+LF  ESDHMPS   L    +I F  S RREA S  
Sbjct  1     MDFNLENPLT---NSHELHFDTTPSLFLIESDHMPSKNYLKTLKEIDFDVSFRREAISSV  57

Query  904   YRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS  725
              R      FD S++YLA+NY+DRFLS Q + + KPWV ++L ++C+SLAAKM+  +  ++
Sbjct  58    LRVS--CNFDPSLSYLAVNYLDRFLSSQGIPQPKPWVFKLLAVACVSLAAKMKEAEFYVT  115

Query  724   DIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHR  545
             DIQ D G +FD Q+I +ME +IL  L WR+RSITPFSF+ FF SL+  +DP + Q+L  R
Sbjct  116   DIQGDGGFVFDPQTIQKMEVLILGALNWRMRSITPFSFISFFISLFKPKDPPLRQALKAR  175

Query  544   ASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNC  365
             A  IIF +  DI L E+ PS+ AASALLY   +L P+QFL F+ AI  C YV  + +L C
Sbjct  176   ACEIIFKAQNDINLLEFRPSLTAASALLYACHELFPMQFLCFRKAISICSYVNKENLLQC  235

Query  364   LSVMRETVTRGIESSIDAISDCSLTPRSVLHRE---------------------SGMMPE  248
              + M+ET   G +S  D +S  S TP +VL R                      +   PE
Sbjct  236   YNAMQETAMDGYKSQFDMVSS-SDTPVNVLDRHFSSSESENTNGTVVMISSNGSNKTWPE  294

Query  247   RDGGMKRRRLNNFCDDQ  197
             +  G+KRR+++  C++Q
Sbjct  295   K--GIKRRKISALCNNQ  309



>ref|XP_011047492.1| PREDICTED: putative cyclin-D6-1 [Populus euphratica]
Length=324

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 193/317 (61%), Gaps = 34/317 (11%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHH-HLDAVPALFAGESDHMPS--LLSFNHQISF--SIRREAFSLT  905
             M+FNLENPLT   N H  H D  P+LF  ESDHMPS   L    +I F  S RREA S  
Sbjct  1     MDFNLENPLT---NSHELHFDTTPSLFHIESDHMPSKNYLKTLKEIDFDVSFRREAISSV  57

Query  904   YRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS  725
              R      FD S++YLA+NY+DRFLS Q + + KPWV ++L ++C+SLAAKM+  +  ++
Sbjct  58    LRVS--CNFDPSLSYLAVNYLDRFLSSQGIPQPKPWVFKLLAVACVSLAAKMKEAEFYIT  115

Query  724   DIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHR  545
             DIQ D G +FDSQ+I +ME ++L  L WR+RSITPFSF+ FF SL+  +DP + Q+L  R
Sbjct  116   DIQGDGGFVFDSQTIQKMEVLLLGALNWRMRSITPFSFISFFISLFKPKDPPLRQALKAR  175

Query  544   ASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNC  365
             A  IIF +  DI L E+ PS+ AASALLY   +L P+QFL F+ AI  C YV  + +L C
Sbjct  176   ACEIIFKAQNDINLLEFRPSLTAASALLYACHELFPMQFLCFRKAISICSYVNKENLLEC  235

Query  364   LSVMRETVTRGIESSIDAISDCSLTPRSVLHRE---------------------SGMMPE  248
              + M+ET   G +S  D +S  S TP +VL R                      +   PE
Sbjct  236   YNAMQETAIDGYKSQFDMVSS-SDTPVNVLDRHFSSSESENTNGTVVMISSNGSNKTWPE  294

Query  247   RDGGMKRRRLNNFCDDQ  197
             +D  +KRR+++  C++Q
Sbjct  295   KD--IKRRKISALCNNQ  309



>gb|AEV41137.1| D6-type cyclin [Populus x canadensis]
Length=324

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 142/317 (45%), Positives = 194/317 (61%), Gaps = 34/317 (11%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHH-HLDAVPALFAGESDHMPS--LLSFNHQISF--SIRREAFSLT  905
             M+FNLENPLT   N H  H D  P+LF  ESDHMPS   L    +I F  S RREA S  
Sbjct  1     MDFNLENPLT---NSHELHFDTTPSLFLIESDHMPSKNYLKTLKEIDFDVSFRREAISSV  57

Query  904   YRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS  725
             +R      FD S++YLA+NY+DRFLS Q + + KPWV+++L ++C+SLAAKM+  +  ++
Sbjct  58    FRVS--CNFDPSLSYLAVNYLDRFLSSQGIPQPKPWVLKLLAVACVSLAAKMKEAEFYVT  115

Query  724   DIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHR  545
             DIQ D G +FD Q+I +ME +IL  L WR+RSITPFSF+ FF SL+  +DP + Q+L  R
Sbjct  116   DIQGDGGFVFDPQTIQKMEVLILGALNWRMRSITPFSFISFFISLFKPKDPPLRQALKAR  175

Query  544   ASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNC  365
             A  IIF +  DI L E+ PS+ AASALLY   +L P+QFL F+ AI  C +V  + +L C
Sbjct  176   ACEIIFKAQNDINLLEFRPSLTAASALLYACHELFPMQFLCFRKAISICSHVNKENLLQC  235

Query  364   LSVMRETVTRGIESSIDAISDCSLTPRSVLHRE---------------------SGMMPE  248
              + M+ET   G +S  D +S  S TP +VL R                      +   PE
Sbjct  236   YNAMQETAMDGYKSQFDMVSS-SDTPVNVLDRHFLSSESENTNGTVVMISSDGSNKTWPE  294

Query  247   RDGGMKRRRLNNFCDDQ  197
             +D  +KRR+++  C++Q
Sbjct  295   KD--IKRRKISALCNNQ  309



>ref|XP_002305644.1| hypothetical protein POPTR_0004s03220g [Populus trichocarpa]
 emb|CAN88866.1| D6-type cyclin [Populus trichocarpa]
 gb|EEE86155.1| hypothetical protein POPTR_0004s03220g [Populus trichocarpa]
Length=305

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 198/309 (64%), Gaps = 31/309 (10%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQIS-----FSIRREAFSLT  905
             MEF+LEN LTS   + H  D VP LFA ESDHMPS  +F H +       S R+EA SL 
Sbjct  1     MEFDLENSLTSL--EEHQSDTVPNLFASESDHMPSR-NFLHCLKTSGFYVSFRQEAISLI  57

Query  904   YRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS  725
              + Q+   +D  I YLA+NY+DRF+S+Q + + KPW++R++VISCLSLAAKM+     +S
Sbjct  58    LQAQYSCNYDAFIPYLAVNYMDRFISKQEIPQGKPWILRLVVISCLSLAAKMKNAHFSVS  117

Query  724   DIQRDE-GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIH  548
             D Q +E G +FD+Q+I+RME +IL  L WR+RSITPFSF+HFF S+  L+DPS +Q L  
Sbjct  118   DFQGEEAGFIFDTQTINRMELLILDALNWRMRSITPFSFVHFFISVLELKDPSSSQPLKD  177

Query  547   RASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILN  368
             RA+ IIF +  +IK  E+ PS++AASALL  + +L+PLQF  FK +I  C +V  +++L+
Sbjct  178   RATEIIFKAQNEIKFLEFKPSIVAASALLVASNELLPLQFPLFKCSISSCAFVNKEKLLS  237

Query  367   CLSVMRETVT-RGIESSIDAISDCSLTPRSVLHRE----------------SGMMPERDG  239
             C + ++E V     ES +D +S C+ TP SVL R+                   +PE   
Sbjct  238   CFNAVQEMVEMEWYESMLDTMS-CTRTPLSVLDRQCTKSESETTSTTSINNGSTVPE---  293

Query  238   GMKRRRLNN  212
              +KRRRLN 
Sbjct  294   -IKRRRLNG  301



>ref|XP_006449188.1| hypothetical protein CICLE_v10015968mg [Citrus clementina]
 gb|ESR62428.1| hypothetical protein CICLE_v10015968mg [Citrus clementina]
Length=318

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/315 (46%), Positives = 199/315 (63%), Gaps = 27/315 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISF-----SIRREAFSLT  905
             MEF+LENP TS   + H  D +  LFA ESDHMPS  +F   +       S+R+E  SL 
Sbjct  1     MEFDLENPFTSF--EEHQSDTLLDLFATESDHMPSH-NFVQCLKITDFYVSLRQETVSLI  57

Query  904   YRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS  725
              + QF   F+  I+YLA+ Y+DRF+SRQ + + KPWV+R+L +SC+SLAAKM+     LS
Sbjct  58    LQIQFACNFEPFISYLAVTYLDRFISRQEIPQGKPWVLRLLAVSCISLAAKMKNTHFPLS  117

Query  724   DIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHR  545
              +Q D+ L+FD+Q+IHRME +IL  L WR+RSITPFSFL FF SL+  +DP + Q+L  R
Sbjct  118   KLQGDQELIFDAQTIHRMELLILDALNWRMRSITPFSFLCFFISLFEPKDPPLTQALKDR  177

Query  544   ASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNC  365
             A+ IIF +H +IKL E+ PSVIAASA+L  + +L PLQF SFK +I   +YV  +++  C
Sbjct  178   ATDIIFRAHSEIKLLEFKPSVIAASAVLLSSYELFPLQFPSFKTSILSSDYVNKEDLSKC  237

Query  364   LSVMRETVT-RGIESSIDAISDCSLTPRSVLHRE----------------SGMMPERDGG  236
                M+E V   G ES +D +S  S T  SV+  +                + MMPE+   
Sbjct  238   FDTMQEMVEMDGCESILDTLSS-SRTQFSVVDYKCTKSESQQITNSGITTTTMMPEK-RE  295

Query  235   MKRRRLNNFCDDQEY  191
             +KRR++N FC + E+
Sbjct  296   IKRRKMNGFCSEGEF  310



>emb|CBI40871.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/254 (52%), Positives = 173/254 (68%), Gaps = 1/254 (0%)
 Frame = -2

Query  1027  DHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMN  848
             +    D V ALF  ESDHM S +      +  +RREA +L  + Q+    D  I+YLA+N
Sbjct  88    EEEQYDTVSALFDSESDHMVSQIFLRRFHAEPLRREAIALILQAQYSCNLDNFISYLAVN  147

Query  847   YIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRDEGLMFDSQSIHRME  668
             Y+DRF+S++ V E KPW++R+LVISCLSLAAKM+ ID   SD Q+DEG +FD+Q IHRME
Sbjct  148   YVDRFISKKEVPEEKPWILRLLVISCLSLAAKMKKIDFSYSDFQKDEGFIFDAQRIHRME  207

Query  667   GMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNP  488
              +ILS L WR+RSITPFSF++FF SL+ L+DP++ ++L  RA+ +IF +  +IKL EY P
Sbjct  208   LLILSTLNWRMRSITPFSFVYFFISLFELKDPALTKALKDRATELIFKARDEIKLLEYKP  267

Query  487   SVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVTRGIESSI-DA  311
             S+IAASALL  + +L PLQF SFK AI  CEY+  + + NC  VM E VT   + SI DA
Sbjct  268   SIIAASALLCASYELFPLQFSSFKAAISSCEYINQESLNNCYHVMEEMVTNEWDESIFDA  327

Query  310   ISDCSLTPRSVLHR  269
                 + TP  VL R
Sbjct  328   AVSSTKTPICVLDR  341



>ref|XP_010277890.1| PREDICTED: putative cyclin-D6-1 [Nelumbo nucifera]
Length=319

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 137/312 (44%), Positives = 194/312 (62%), Gaps = 23/312 (7%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSF----NHQISFSIRREAFSLTYR  899
             EF+LENPLTS   + H  D +PALFA ESDHMP    F          S+RRE  SL  +
Sbjct  3     EFDLENPLTSL--EEHQADTIPALFAAESDHMPCENYFRSFKTRDFDISVRREIISLILQ  60

Query  898   TQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDI  719
              QF   FD  I YLA+NY+DRF+S Q + + KPW++R++ +SCLSLAAKM+  +  L+D 
Sbjct  61    AQFSSNFDPFITYLAINYLDRFISGQGMPKGKPWILRLVAMSCLSLAAKMKKTEFSLTDF  120

Query  718   QRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAS  539
             QR+EG +FD+Q+I RME +IL  LKWR+RSITPFSF+ +F SL+ +++P +   L  RA+
Sbjct  121   QREEGFIFDTQTIQRMELLILGALKWRMRSITPFSFICYFLSLFKIKEPPLIHDLKTRAT  180

Query  538   TIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLS  359
              IIF +  +IKL E+ PS++AA+A+L  + +  PLQF  FK  I  C YV  + + +C  
Sbjct  181   EIIFKAQNEIKLLEFKPSIVAAAAVLSASHEFFPLQFPCFKKEISSCVYVNKENLFDCCR  240

Query  358   VMRETVTRGIESSIDAISDCSLTPRSVLHR-ESGMMPERDGG---------------MKR  227
             +M++ V  G ES  D +S  S TP +VL +  S    E+ G                +KR
Sbjct  241   MMQDIVIDGYESVFDMVSS-SDTPVNVLDQYYSSSESEKTGSSISIATPTIKTAERDIKR  299

Query  226   RRLNNFCDDQEY  191
             R+L++FC+D  +
Sbjct  300   RKLSDFCNDNAF  311



>gb|KDO75678.1| hypothetical protein CISIN_1g021047mg [Citrus sinensis]
Length=318

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 198/315 (63%), Gaps = 27/315 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISF-----SIRREAFSLT  905
             MEF+LENP TS   + H  D +  LFA ESDHMPS  +F   +       S+R+E  SL 
Sbjct  1     MEFDLENPFTSF--EEHQSDTLLDLFATESDHMPSH-NFVQCLKITDFYVSLRQETVSLI  57

Query  904   YRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS  725
              + QF   F+  I+YLA+ Y+DRF+SRQ + + KPWV+R+L +SC+SLAAKM+     LS
Sbjct  58    LQIQFACNFEPFISYLAVTYLDRFISRQEIPQGKPWVLRLLAVSCISLAAKMKNTHFPLS  117

Query  724   DIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHR  545
               Q D+ L+FD+Q+IHRME +IL  L WR+RSITPFSFL FF SL+  +DP + Q+L  R
Sbjct  118   KFQGDQKLIFDAQTIHRMELLILDALNWRMRSITPFSFLCFFISLFEPKDPPLTQALKDR  177

Query  544   ASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNC  365
             A+ IIF +H +IKL E+ PSVIAASA+L  + +L PLQF SFK +I   +YV  +++  C
Sbjct  178   ATDIIFRAHSEIKLLEFRPSVIAASAVLLSSYELFPLQFPSFKTSILSSDYVNKEDLSKC  237

Query  364   LSVMRETVT-RGIESSIDAISDCSLTPRSVLHRE----------------SGMMPERDGG  236
                ++E V   G ES +D +S  S T  SV+  +                + MMPE+   
Sbjct  238   YDTVQEMVEMDGCESILDTLSS-SRTQFSVVDYKCTKSESQQITNSSITTTTMMPEK-RE  295

Query  235   MKRRRLNNFCDDQEY  191
             +KRR++N FC + E+
Sbjct  296   IKRRKMNGFCSEGEF  310



>ref|XP_011043321.1| PREDICTED: putative cyclin-D6-1 [Populus euphratica]
Length=309

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/315 (45%), Positives = 195/315 (62%), Gaps = 37/315 (12%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSL  908
             MEF+LENPLTS     +  D +P LF  ESDHMPS      L + +  +SF  R EA S 
Sbjct  1     MEFDLENPLTSL--KEYLSDTIPDLFVSESDHMPSRNFLHCLKTSDFYVSF--REEAISR  56

Query  907   TYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCL  728
               + Q+   +D  I YLA+NY+DRF+SRQ + + KPW++R+LVISCLSLAAKM+     +
Sbjct  57    ILQAQYSCNYDLFIPYLAVNYMDRFISRQEIPQGKPWIIRLLVISCLSLAAKMKNKHFSI  116

Query  727   SDIQRDE-GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLI  551
             S+ Q  E G +FD+Q+I+RME ++L  L WR+RSITPFSF+HFF SL+ L+DPS +Q L 
Sbjct  117   SNSQEAEAGFIFDTQTINRMELLVLDALNWRMRSITPFSFVHFFISLFELKDPSSSQPLK  176

Query  550   HRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEIL  371
              RA+ IIF +  +IK  E+ PS+IAASALL  + +  PLQF  FK +I+ CE+V  +++L
Sbjct  177   DRATEIIFKAQNEIKFLEFKPSIIAASALLVASNERFPLQFPCFKCSIYSCEFVNEEKLL  236

Query  370   NCLSVMRETVT-RGIESSIDAISDCSLTPRSVLHRE--------------------SGMM  254
              C + ++E V     ES +D +S C+ TP SVL R                        +
Sbjct  237   ECFNALQEMVEMEWYESMLDTMS-CTRTPLSVLDRHFTKSESETASIITNTTTITNGSTV  295

Query  253   PERDGGMKRRRLNNF  209
             PE    +KRR+LN +
Sbjct  296   PE----IKRRKLNGY  306



>ref|XP_011001161.1| PREDICTED: putative cyclin-D6-1 [Populus euphratica]
 ref|XP_011003408.1| PREDICTED: putative cyclin-D6-1 [Populus euphratica]
Length=305

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 194/310 (63%), Gaps = 33/310 (11%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSL  908
             MEF+LEN +TS   +    D VP LFA ESDHMPS      L +    +SF  R+EA SL
Sbjct  1     MEFDLENTMTSL--EEQQFDTVPNLFASESDHMPSRNLLHCLKTSGFYVSF--RQEAISL  56

Query  907   TYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCL  728
               + Q+    D  I YLA+NY+DRF+S+Q + + KPW++R+LVISCLSLAAKM+     +
Sbjct  57    ILQAQYSCNHDAFIPYLAVNYMDRFISKQEIPQGKPWIIRLLVISCLSLAAKMKNAHFSV  116

Query  727   SDIQRDE-GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLI  551
             SD Q +E G +FD+Q+I+RME +IL  L WR+RSITPFSF+HFF S+  L+DPS +Q L 
Sbjct  117   SDFQGEEAGFIFDTQTINRMELLILDALNWRMRSITPFSFVHFFISVLELKDPSTSQPLK  176

Query  550   HRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEIL  371
              RA+ IIF +  +IK  E+ PS++AASALL  + +L+PLQF  FK +   C +V  +++L
Sbjct  177   DRATEIIFKAQNEIKFLEFKPSIVAASALLVASNELLPLQFPLFKCSFSSCAFVNKEKLL  236

Query  370   NCLSVMRETVT-RGIESSIDAISDCSLTPRSVLHR----------------ESGMMPERD  242
             +C + ++E V     ES +D +S C+ TP SVL R                    +PE  
Sbjct  237   SCFNAVQEMVEMEWYESMLDTMS-CTRTPLSVLDRLCTKSESETTSTTSITNGSTVPE--  293

Query  241   GGMKRRRLNN  212
               +KRRRLN 
Sbjct  294   --IKRRRLNG  301



>emb|CAN65140.1| hypothetical protein VITISV_034614 [Vitis vinifera]
Length=435

 Score =   251 bits (642),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 139/295 (47%), Positives = 182/295 (62%), Gaps = 30/295 (10%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             ME +LENPLT    +    D V ALF  ESDHM S +      +  +RREA +L  + Q+
Sbjct  77    MELDLENPLTCV--EEEQYDTVSALFDSESDHMVSQIFLRRFHAEPLRREAIALILQAQY  134

Query  889   IYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRD  710
                 D  I+YLA+NY+DRF+S++ V E KPW++R+LVISCLSLAAKM+ ID   SD Q+D
Sbjct  135   SCNLDNFISYLAVNYVDRFISKKEVPEEKPWILRLLVISCLSLAAKMKKIDFSYSDFQKD  194

Query  709   EGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTII  530
             EG +FD+Q IHRME +ILS L WR+RSITPFSF++FF SL+ L+DP++ ++L  RA+ +I
Sbjct  195   EGFIFDAQRIHRMELLILSTLNWRMRSITPFSFVYFFISLFELKDPALTKALKDRATELI  254

Query  529   FTSH---------------------------YDIKLFEYNPSVIAASALLYVAEKLIPLQ  431
             F +                             +IKL EY PS+IAASALL  + +L PLQ
Sbjct  255   FKARDGKIGYRFFKLIFEEARFLRNIIVVYIAEIKLLEYKPSIIAASALLCASYELFPLQ  314

Query  430   FLSFKNAIFRCEYVKSDEILNCLSVMRETVTRGIESSI-DAISDCSLTPRSVLHR  269
             F SFK AI  CEY+  + + NC  VM E VT   + SI DA    + TP  VL R
Sbjct  315   FSSFKAAISSCEYINQESLNNCYHVMEEMVTNEWDESIFDAAVSSTKTPICVLDR  369



>ref|XP_006467923.1| PREDICTED: putative cyclin-D6-1-like [Citrus sinensis]
Length=318

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/315 (45%), Positives = 198/315 (63%), Gaps = 27/315 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISF-----SIRREAFSLT  905
             MEF+LENP TS   + H  D +  LFA ESDHMPS  +F   +       S+R+E  SL 
Sbjct  1     MEFDLENPFTSF--EEHQSDTLLDLFATESDHMPSH-NFVQCLKITDFYVSLRQETVSLI  57

Query  904   YRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS  725
              + QF   F+  I+YLA+ Y+DRF+SRQ + + KPWV+R+L +SC+SLAAKM+     LS
Sbjct  58    LQIQFACNFEPFISYLAVTYLDRFISRQEIPQGKPWVLRLLAVSCISLAAKMKNTHFPLS  117

Query  724   DIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHR  545
               Q D+ L+FD+++IHRME +IL  L WR+RSITPFSFL FF SL+  +DP + Q+L  R
Sbjct  118   KFQGDQKLIFDARTIHRMELLILDALNWRMRSITPFSFLCFFISLFEPKDPPLTQALKDR  177

Query  544   ASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNC  365
             A+ IIF +H +IKL E+ PSVIAASA+L  + +L PLQF SFK +I   +YV  +++  C
Sbjct  178   ATDIIFRAHSEIKLLEFRPSVIAASAVLLSSYELFPLQFPSFKTSILSSDYVNKEDLSKC  237

Query  364   LSVMRETVT-RGIESSIDAISDCSLTPRSVLHRE----------------SGMMPERDGG  236
                ++E V   G ES +D +S  S T  SV+  +                + MMPE+   
Sbjct  238   YDTVQEMVEMDGCESILDTLSS-SRTQFSVVDYKCTKSESQQITNSSITTTTMMPEK-RE  295

Query  235   MKRRRLNNFCDDQEY  191
             +KRR++N FC + E+
Sbjct  296   IKRRKMNGFCSEGEF  310



>ref|XP_006466146.1| PREDICTED: putative cyclin-D6-1-like [Citrus sinensis]
Length=306

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 194/308 (63%), Gaps = 25/308 (8%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS--LLSFNHQISF--SIRREAFSLTY  902
             MEF+LENP TS   + H  D +  LFA ESDHMPS   + +     F  S+R+EA SL  
Sbjct  1     MEFDLENPFTSF--EEHQSDTLLDLFAIESDHMPSHNFIQYLKITDFYVSLRQEAVSLAL  58

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             + QF   F+  I+YLA+ Y+ RF+SRQ + + KPWV+R+L +SC+SLAAKM+     LS 
Sbjct  59    QIQFSCNFEPFISYLAVTYLGRFISRQEIPQRKPWVLRLLAVSCISLAAKMKNTHFPLSK  118

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              Q D+ L+FD+Q+IHRME +IL  L WR+RSITPFSFL FF SL+  +DP + Q+L  RA
Sbjct  119   FQGDQELIFDAQTIHRMELLILDALNWRMRSITPFSFLCFFISLFEPKDPPLTQALKDRA  178

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
             + I+F +H +IKL E+ PSVIAASA+L  + +L PLQF SFK +I   +YV  +++  C 
Sbjct  179   TDIVFRAHSEIKLLEFKPSVIAASAVLLSSHELFPLQFPSFKTSILSSDYVNKEDLPKCF  238

Query  361   SVMRETV-TRGIESSIDAISDCSLTPRSVLHRE----------------SGMMPERDGGM  233
               M+E V T G ES +  +S  S T  SV+  +                + MMPER   +
Sbjct  239   DTMQEMVETDGCESILITLS-SSRTQFSVVDYKCTKSESQQITNSSITTTTMMPER-REI  296

Query  232   KRRRLNNF  209
             KRR++N F
Sbjct  297   KRRKMNGF  304



>ref|XP_002316670.1| hypothetical protein POPTR_0011s04060g [Populus trichocarpa]
 emb|CAN88867.1| D6-type cyclin [Populus trichocarpa]
 gb|EEE97282.1| hypothetical protein POPTR_0011s04060g [Populus trichocarpa]
Length=309

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/275 (48%), Positives = 183/275 (67%), Gaps = 13/275 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSL  908
             MEF+LENPLTS     +  D +P LF  ESDHMPS      L + +  +SF  R EA S 
Sbjct  1     MEFDLENPLTSL--KEYVSDTIPDLFVSESDHMPSRNFLHCLKTSDFYVSF--REEAISR  56

Query  907   TYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCL  728
               + Q+   +D  I YLA+NY+DRF+SRQ + + KPW++R+LVISCLSLAAKM+     +
Sbjct  57    ILQAQYSCNYDLFIPYLAVNYMDRFISRQEIPQGKPWILRLLVISCLSLAAKMKNKHFSI  116

Query  727   SDIQRDE-GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLI  551
             S+ Q  E G +FD+Q+I+RME ++L  L WR+RSITPFSF+HFF SL+ L+DPS +Q L 
Sbjct  117   SNSQEAEAGFIFDTQTINRMELLVLDALNWRMRSITPFSFVHFFVSLFELKDPSSSQPLK  176

Query  550   HRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEIL  371
              RA+ IIF +  +IK  E+ PS+IAASALL  + +  PLQF  FK +I+ CE+V  +++L
Sbjct  177   DRATEIIFKAQNEIKFLEFKPSIIAASALLVASNERFPLQFPCFKCSIYSCEFVNEEKLL  236

Query  370   NCLSVMRETVT-RGIESSIDAISDCSLTPRSVLHR  269
              C + ++E V     ES +D +S  + TP SVL R
Sbjct  237   ECFNALQEMVEMEWYESMLDTMS-WTRTPLSVLDR  270



>ref|XP_004293473.1| PREDICTED: putative cyclin-D6-1-like [Fragaria vesca subsp. vesca]
Length=322

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 138/310 (45%), Positives = 196/310 (63%), Gaps = 26/310 (8%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFN----HQISFSIRREAFSLTY  902
             MEFNLENPLT S + H   D+V +LF+ ESDHMPS   F          SIRREA +   
Sbjct  1     MEFNLENPLTISHDIHS--DSVTSLFSIESDHMPSENYFQTLQAGDFDISIRREAIASI-  57

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
              +Q     D+ ++YLA+NY+DRFLS Q  L+ KPW++++L ISC+SLAAKM+     + D
Sbjct  58    -SQLCCNSDKFLSYLAVNYLDRFLSCQEKLQPKPWIIKLLAISCVSLAAKMKKTAFSILD  116

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              Q D G++FD+++I RME +IL  LKWR+RSITPFSF+ FF SL+ LEDP + Q+L  RA
Sbjct  117   FQSDGGIIFDTRTIERMEFLILGALKWRMRSITPFSFILFFISLFKLEDPPLRQALKARA  176

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
             + IIF +  D+KL  + PS+IAAS LL+ + +L P+Q   FK A+  C YV    +L C 
Sbjct  177   TQIIFKAQNDMKLLVFKPSIIAASGLLFASHELFPMQSPCFKKALSNCSYVNKVTLLQCY  236

Query  361   SVMRETVTRGIESSIDAISDCSLTPRSVLHR------ESG---------MMPERDGGMKR  227
             + M+++V    +S ++ +S  S+TP +VL +      ESG         +  ERD  +KR
Sbjct  237   NCMQDSVVDEYDSVLEMVSS-SVTPANVLDQTFSSSAESGRTTVTSVTTLKLERD--IKR  293

Query  226   RRLNNFCDDQ  197
             R+++ +C D 
Sbjct  294   RKISEYCKDH  303



>gb|EYU27882.1| hypothetical protein MIMGU_mgv1a010303mg [Erythranthe guttata]
Length=316

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 140/305 (46%), Positives = 187/305 (61%), Gaps = 17/305 (6%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFS--IRREAFSLTYRT  896
             ME +L+NPLT+S+ D  + D VP+LF+ ESDHM S L           IRR A +L    
Sbjct  1     MELDLQNPLTTSYEDLQY-DGVPSLFSNESDHMSSSLLSFDSSDSRFSIRRSAVALLSHA  59

Query  895   QFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCL--SD  722
             +F Y  D  + YL++NY+DRFLS+Q  LE KPW+ +ILV++ LSLAAKMR  DL L  SD
Sbjct  60    KFSYNLDPFLVYLSVNYVDRFLSKQRTLEKKPWIAQILVVASLSLAAKMRNSDLSLPISD  119

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYP-----LEDPSIAQS  557
             +QR+EG  F+SQS+ RME ++LS L+WR+RSITPFSFL +F SL        +D S+ Q 
Sbjct  120   LQREEGFEFESQSVRRMETILLSTLQWRMRSITPFSFLQYFISLIKTDNDDDDDSSLTQC  179

Query  556   LIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDE  377
             L  RAS +IF   ++++L EY PS+I+ASALL     L PL F S + AI   EYV    
Sbjct  180   LNRRASDLIFNVQHEMELLEYKPSIISASALLCAVHGLTPLMFSSCEEAISSSEYVNRGV  239

Query  376   ILNCLSVMRETVTRGIE-SSIDAISDCSLTPRSVLHRESGMMPERDG----GMKRRRLNN  212
             +L C+  M+E    G E SS+ A +  ++TP SV   +       +G     +KRRRLN 
Sbjct  240   LLECVGAMQEITREGYEQSSVQASASGTVTPISVFDWQGTSTVSEEGTTDNSVKRRRLNG  299

Query  211   --FCD  203
                CD
Sbjct  300   SSICD  304



>ref|XP_010646366.1| PREDICTED: putative cyclin-D6-1 [Vitis vinifera]
Length=302

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 159/222 (72%), Gaps = 1/222 (0%)
 Frame = -2

Query  931  IRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAK  752
            +RREA +L  + Q+    D  I+YLA+NY+DRF+S++ V E KPW++R+LVISCLSLAAK
Sbjct  15   LRREAIALILQAQYSCNLDNFISYLAVNYVDRFISKKEVPEEKPWILRLLVISCLSLAAK  74

Query  751  MRCIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDP  572
            M+ ID   SD Q+DEG +FD+Q IHRME +ILS L WR+RSITPFSF++FF SL+ L+DP
Sbjct  75   MKKIDFSYSDFQKDEGFIFDAQRIHRMELLILSTLNWRMRSITPFSFVYFFISLFELKDP  134

Query  571  SIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEY  392
            ++ ++L  RA+ +IF +  +IKL EY PS+IAASALL  + +L PLQF SFK AI  CEY
Sbjct  135  ALTKALKDRATELIFKARDEIKLLEYKPSIIAASALLCASYELFPLQFSSFKAAISSCEY  194

Query  391  VKSDEILNCLSVMRETVTRGIESSI-DAISDCSLTPRSVLHR  269
            +  + + NC  VM E VT   + SI DA    + TP  VL R
Sbjct  195  INQESLNNCYHVMEEMVTNEWDESIFDAAVSSTKTPICVLDR  236



>ref|XP_008379584.1| PREDICTED: putative cyclin-D6-1 [Malus domestica]
Length=319

 Score =   240 bits (612),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 135/310 (44%), Positives = 191/310 (62%), Gaps = 25/310 (8%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS---LLSFN-HQISFSIRREAFSLTY  902
             M+F+LENPLT S +     + + +LFA ESDHMPS   L S        SIRREA     
Sbjct  1     MDFDLENPLTISHD--FQPETITSLFAIESDHMPSETYLQSLKARNFDISIRREAIGSI-  57

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
              +Q     D  + YLA+NY+DRFLS Q VL  KPW++++L +SC+SLA+KM+  +  L D
Sbjct  58    -SQLCCNSDDLLLYLAVNYLDRFLSCQGVLXPKPWLIKLLAMSCISLASKMKKSEFSLLD  116

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
             +Q D G++FD+Q+I RME +IL  LKWR+RSITPFSF+ F  SL+ LEDP +  +L  RA
Sbjct  117   VQGDGGIIFDTQTIQRMELLILGALKWRMRSITPFSFMSFVISLFKLEDPPLLHALKARA  176

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
             + IIF S  D++L  + PS+IAASA+L  +++L+P+QF  FK A+  C YV  + +L C 
Sbjct  177   TQIIFKSQKDVELLVFKPSIIAASAVLSASDELLPMQFPCFKKALSNCSYVNKENMLQCY  236

Query  361   SVMRETVTRGIESSIDAISDCSLTPRSVLHR------ESGMMP---------ERDGGMKR  227
             S M++ V  G +S ++ +    +TP +VL        ESG            ERD  +KR
Sbjct  237   SAMQDIVVDGFDSVLERVCSSFVTPANVLDHTFSSSAESGKTTVTSISTLRLERD--LKR  294

Query  226   RRLNNFCDDQ  197
             R+ + +C D 
Sbjct  295   RKNSEYCKDH  304



>ref|XP_008348124.1| PREDICTED: putative cyclin-D6-1 [Malus domestica]
Length=319

 Score =   240 bits (612),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 135/310 (44%), Positives = 192/310 (62%), Gaps = 25/310 (8%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS---LLSFN-HQISFSIRREAFSLTY  902
             M+F+LENPLT S +     + + +LFA ESDHMPS   L S        SIRREA  +  
Sbjct  1     MDFDLENPLTISHD--FQPETITSLFAIESDHMPSETYLQSLKARNFDISIRREA--IXS  56

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
              +Q     D  + YLA+NY+DRFLS Q VL  KPW++++L +SC+SLA+KM+  +  L D
Sbjct  57    ISQLCCNSDDLLLYLAVNYLDRFLSCQGVLXPKPWLIKLLAMSCISLASKMKKSEFSLLD  116

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
             +Q D G++FD+Q+I RME +IL  LKWR+RSITPFSF+ F  SL+ LEDP +  +L  RA
Sbjct  117   VQGDGGIIFDTQTIQRMELLILGALKWRMRSITPFSFMSFVISLFKLEDPPLLHALKARA  176

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
             + IIF S  D++L  + PS+IAASA+L  +++L+P+QF  FK A+  C YV  + +L C 
Sbjct  177   TQIIFKSQKDVELLVFKPSIIAASAVLSASDELLPMQFPCFKKALSNCSYVNKENMLQCY  236

Query  361   SVMRETVTRGIESSIDAISDCSLTPRSVLHR------ESGMMP---------ERDGGMKR  227
             S M++ V  G +S ++ +    +TP +VL        ESG            ERD  +KR
Sbjct  237   SAMQDIVVDGFDSVLERVCSSFVTPANVLDHTFSSSAESGKTTVTSISTLRLERD--LKR  294

Query  226   RRLNNFCDDQ  197
             R+ + +C D 
Sbjct  295   RKNSEYCKDH  304



>ref|XP_009353212.1| PREDICTED: putative cyclin-D6-1 [Pyrus x bretschneideri]
Length=319

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 135/310 (44%), Positives = 191/310 (62%), Gaps = 25/310 (8%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS---LLSFN-HQISFSIRREAFSLTY  902
             M+F+LENPLT S +     + + +LFA ESDHMPS   L S        SIRREA +   
Sbjct  1     MDFDLENPLTISHD--FPPETITSLFAIESDHMPSETYLQSLKARNFDISIRREAIASI-  57

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
              +Q     D  + YLA+NY+DRFLS Q +L+ KPW++++L ISC+SLA+KMR  +  L D
Sbjct  58    -SQLCCNSDDLLLYLAVNYLDRFLSCQGMLQPKPWLIKLLAISCISLASKMRKSEFSLLD  116

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
             +Q D G++FD+Q+I RME +IL  LKWR+RSITPFSF+ F  SL+ LEDP +  +L  RA
Sbjct  117   VQGDGGIIFDTQTIQRMELLILGALKWRMRSITPFSFMSFVISLFKLEDPPLLHALKARA  176

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
             + IIF S  D++L  + PS+IAASA+L  ++ L+P+QF  FK A+  C YV  + +L C 
Sbjct  177   TQIIFKSQKDVELLVFKPSIIAASAVLSASDALLPMQFPCFKKALSNCSYVNKENMLQCY  236

Query  361   SVMRETVTRGIESSIDAISDCSLTPRSVLHR------ESGMMP---------ERDGGMKR  227
               M++ V  G +S ++ +    +TP +VL        ESG            ERD  +KR
Sbjct  237   RAMQDIVVDGFDSVLERVCSSFVTPANVLDHTFSSSAESGKTTVTRIATLRLERD--LKR  294

Query  226   RRLNNFCDDQ  197
             R+ + +C D 
Sbjct  295   RKNSEYCKDH  304



>ref|XP_011048476.1| PREDICTED: putative cyclin-D6-1 [Populus euphratica]
Length=306

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/284 (46%), Positives = 179/284 (63%), Gaps = 11/284 (4%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPA-LFAGESDHMPSLLSFN--HQISF--SIRREAFSLT  905
             M+FNLE PL +S +   H D +P+ LF  ESDHMPS    N   ++ F  S RREA S  
Sbjct  1     MDFNLETPLANSHD--FHFDTIPSDLFLIESDHMPSNNYLNTLKEMDFDGSFRREAISSV  58

Query  904   YRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS  725
              R      FD S++YLA+NY+DR LS Q + + KPW+ R+L ++C+SLAAKM+  +  +S
Sbjct  59    LRVS--CNFDPSLSYLAVNYLDRLLSSQGIPQPKPWLFRLLAVACVSLAAKMKEAEFYIS  116

Query  724   DIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHR  545
             D Q D G +FD+Q+I +ME +IL  L WR+RSITPFSF+ +F SL+  +DP + Q+L  R
Sbjct  117   DTQGDGGFVFDTQTIQKMEVLILGALNWRMRSITPFSFISYFISLFKPKDPPLRQALKAR  176

Query  544   ASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNC  365
             AS IIF +  DI L E+ PS+IAASALLY + +L P+QFL F+ AI  C +V  + +L C
Sbjct  177   ASEIIFKAQNDINLLEFKPSLIAASALLYASHELFPMQFLCFRKAISNCSHVNKENLLQC  236

Query  364   LSVMRETVTRGIESSIDAISDCSLTPRSVLHRE-SGMMPERDGG  236
              + M+E    G  S  D ++  S TP  VL +  S    E+  G
Sbjct  237   YNAMQEIAMDGYRSQFDMVT-SSDTPVKVLDQHFSSSESEKTNG  279



>gb|KHG08121.1| Putative cyclin-D6-1 -like protein [Gossypium arboreum]
Length=317

 Score =   237 bits (604),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 136/303 (45%), Positives = 185/303 (61%), Gaps = 17/303 (6%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSF----NHQISFSIRREAFSLTYRT  896
             F+LENP TS   D+   D + ALF+ ESDHMPS   F    ++ +  S R+EA SL  R 
Sbjct  4     FDLENPFTSL--DNQESDIISALFSSESDHMPSHNYFLSLKSNDLFVSFRQEAISLILRA  61

Query  895   QFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQ  716
             Q+    D    YLA NY+DRF+SRQ + +  PWV+R+LVI+ +SLA+KM+      S+ Q
Sbjct  62    QYSCNIDPYTTYLATNYMDRFVSRQEIPQGNPWVLRLLVIATISLASKMKEQHFSSSNFQ  121

Query  715   RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAST  536
             RDEGL+FD+ +I RME +IL  L WR+RS+TP SF+ FF SL+ L+DP + Q+L  RA+ 
Sbjct  122   RDEGLIFDAPAIQRMELLILDALNWRMRSVTPLSFICFFISLFELKDPPLRQALKDRATN  181

Query  535   IIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSV  356
             IIF +  +IKL E+ PS+IAASALL  + +L PLQF SF+ +I    +V  +  L C + 
Sbjct  182   IIFQACNEIKLLEFKPSIIAASALLMASHELFPLQFPSFETSILSYRHVNKENQLKCFNA  241

Query  355   MRETVTRGIESSI--DAISDCSLTPRSVL----HRESGMM-----PERDGGMKRRRLNNF  209
             M+E V      SI     S  + TP SVL     R S  M     PE+    KR++LN F
Sbjct  242   MQEMVANETSDSIIETVSSSSTTTPMSVLDCHCERSSSSMAAIAVPEKREQRKRQKLNGF  301

Query  208   CDD  200
             C +
Sbjct  302   CSE  304



>ref|XP_007025844.1| D6-type cyclin isoform 1 [Theobroma cacao]
 gb|EOY28466.1| D6-type cyclin isoform 1 [Theobroma cacao]
Length=321

 Score =   236 bits (603),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 194/311 (62%), Gaps = 29/311 (9%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSLTY  902
             F+LE+P TS     H  D + ALF+ ESDHMPS      L + +  +SF  R+EA SL  
Sbjct  4     FDLEDPFTSL--KEHQSDTISALFSSESDHMPSQNYLQCLKTSDFYVSF--RQEAISLIL  59

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             + Q+    D    YLA+NY+DRF+SRQ + +  PWV+R+LVI+C+SLAAKM+ I    S+
Sbjct  60    QAQYSCNLDPYTPYLAVNYMDRFISRQDIPQGNPWVLRLLVIACISLAAKMKEIHFSSSN  119

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              QR+EG +FD+ +I RME +IL  L WR+RS+TPFSF+ FF SL+ L+DP + Q+L  RA
Sbjct  120   FQREEGFIFDAPAIQRMELLILDALNWRMRSVTPFSFICFFMSLFELKDPPLTQALKDRA  179

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
             S IIF +H +I L E+ PS++AASALL  + +L PLQF S + +I  CEYV  + +L C 
Sbjct  180   SNIIFQAHGEINLLEFKPSILAASALLLASHELFPLQFPSVETSILSCEYVNKESLLKCF  239

Query  361   SVMRETVTRGI-ESSIDAISDCSL-TPRSVLH---------------RESGMMPERDGGM  233
             +  ++ V   I ES +D +S  S  TP SVL                  + M  +R+  +
Sbjct  240   NATQDMVVNQISESIVDTVSSSSTRTPLSVLDCHCTKAESESTTSTMGATAMAEKRE--I  297

Query  232   KRRRLNNFCDD  200
             KRR+LN+FC +
Sbjct  298   KRRKLNDFCSE  308



>ref|XP_010927924.1| PREDICTED: cyclin-D6-1 isoform X1 [Elaeis guineensis]
Length=304

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 133/293 (45%), Positives = 191/293 (65%), Gaps = 12/293 (4%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHL-DAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFI  887
             F+LENPLTSS  + HH  +++ ALFA ESDHM S L+  H +  S RR+A SL  + QF 
Sbjct  7     FDLENPLTSSDEEQHHFSNSIAALFAAESDHM-SPLAGGH-LDLSARRDAISLILQAQFS  64

Query  886   YKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRDE  707
                D S+AYLA+NY+DRFLS++ +   KPWVVR+L ISCLS+A+KM+ +D  L+D QR+E
Sbjct  65    CNLDPSVAYLAINYVDRFLSKREIPREKPWVVRLLSISCLSIASKMKKLDFSLTDFQREE  124

Query  706   GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIF  527
             G +FD+++I RME ++L  L WR+RSITPFSFL +F S +    P +  +L  RAS  +F
Sbjct  125   GFIFDAKTIRRMELLVLGALDWRMRSITPFSFLPYFLSFFSPAQPPLLHALKARASRTLF  184

Query  526   TSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE  347
              +  +IK+ E+ PSVIAA+ALL  A +L P+QF SF++AI  CE+V  + +  C + + +
Sbjct  185   KAQNEIKMLEFKPSVIAAAALLSAAHELFPIQFASFRSAISSCEFVNKEILGECCNAIGD  244

Query  346   TVTRGIESSIDAISDCSLTPRSVLHRE-SGMMPER-------DGGMKRRRLNN  212
                 G +S+ + +   S TP +VL R  S    ER       D  +K+RR++ 
Sbjct  245   VAMDGCDSTFEMLLS-SNTPVTVLGRHCSSSESERTVGSSSGDHDLKKRRISE  296



>ref|XP_007025848.1| D6-type cyclin isoform 5 [Theobroma cacao]
 gb|EOY28470.1| D6-type cyclin isoform 5 [Theobroma cacao]
Length=320

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 194/311 (62%), Gaps = 30/311 (10%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSLTY  902
             F+LE+P TS     H  D + ALF+ ESDHMPS      L + +  +SF  R+EA SL  
Sbjct  4     FDLEDPFTSL--KEHQSDTISALFSSESDHMPSQNYLQCLKTSDFYVSF--RQEAISLIL  59

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             + Q+    D    YLA+NY+DRF+SRQ + +  PWV+R+LVI+C+SLAAKM+ I    S+
Sbjct  60    QAQYSCNLDPYTPYLAVNYMDRFISRQDIPQGNPWVLRLLVIACISLAAKMKEIHFSSSN  119

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              QR+EG +FD+ +I RME +IL  L WR+RS+TPFSF+ FF SL+ L+DP + Q+L  RA
Sbjct  120   FQREEGFIFDAPAIQRMELLILDALNWRMRSVTPFSFICFFMSLFELKDPPLTQALKDRA  179

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
             S IIF +H +I L E+ PS++AASALL  + +L PLQF S + +I  CEYV  + +L C 
Sbjct  180   SNIIFQAH-EINLLEFKPSILAASALLLASHELFPLQFPSVETSILSCEYVNKESLLKCF  238

Query  361   SVMRETVTRGI-ESSIDAISDCSL-TPRSVLH---------------RESGMMPERDGGM  233
             +  ++ V   I ES +D +S  S  TP SVL                  + M  +R+  +
Sbjct  239   NATQDMVVNQISESIVDTVSSSSTRTPLSVLDCHCTKAESESTTSTMGATAMAEKRE--I  296

Query  232   KRRRLNNFCDD  200
             KRR+LN+FC +
Sbjct  297   KRRKLNDFCSE  307



>ref|XP_007025849.1| D6-type cyclin isoform 6 [Theobroma cacao]
 gb|EOY28471.1| D6-type cyclin isoform 6 [Theobroma cacao]
Length=310

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 134/299 (45%), Positives = 190/299 (64%), Gaps = 16/299 (5%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSLTY  902
             F+LE+P TS     H  D + ALF+ ESDHMPS      L + +  +SF  R+EA SL  
Sbjct  4     FDLEDPFTSL--KEHQSDTISALFSSESDHMPSQNYLQCLKTSDFYVSF--RQEAISLIL  59

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             + Q+    D    YLA+NY+DRF+SRQ + +  PWV+R+LVI+C+SLAAKM+ I    S+
Sbjct  60    QAQYSCNLDPYTPYLAVNYMDRFISRQDIPQGNPWVLRLLVIACISLAAKMKEIHFSSSN  119

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              QR+EG +FD+ +I RME +IL  L WR+RS+TPFSF+ FF SL+ L+DP + Q+L  RA
Sbjct  120   FQREEGFIFDAPAIQRMELLILDALNWRMRSVTPFSFICFFMSLFELKDPPLTQALKDRA  179

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
             S IIF +H +I L E+ PS++AASALL  + +L PLQF S + +I  CEYV  D ++N +
Sbjct  180   SNIIFQAHGEINLLEFKPSILAASALLLASHELFPLQFPSVETSILSCEYVNKDMVVNQI  239

Query  361   S-VMRETVTRGIESSIDAISDCSLTPRSVLHRESGM----MPERDGGMKRRRLNNFCDD  200
             S  + +TV+     +  ++ DC  T        S M    M E+   +KRR+LN+FC +
Sbjct  240   SESIVDTVSSSSTRTPLSVLDCHCTKAESESTTSTMGATAMAEK-REIKRRKLNDFCSE  297



>ref|XP_007025845.1| D6-type cyclin isoform 2 [Theobroma cacao]
 gb|EOY28467.1| D6-type cyclin isoform 2 [Theobroma cacao]
Length=327

 Score =   230 bits (587),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 194/317 (61%), Gaps = 35/317 (11%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSL--  908
             F+LE+P TS     H  D + ALF+ ESDHMPS      L + +  +SF  R+EA SL  
Sbjct  4     FDLEDPFTSL--KEHQSDTISALFSSESDHMPSQNYLQCLKTSDFYVSF--RQEAISLIL  59

Query  907   ----TYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCI  740
                   + Q+    D    YLA+NY+DRF+SRQ + +  PWV+R+LVI+C+SLAAKM+ I
Sbjct  60    QLVLVGQAQYSCNLDPYTPYLAVNYMDRFISRQDIPQGNPWVLRLLVIACISLAAKMKEI  119

Query  739   DLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQ  560
                 S+ QR+EG +FD+ +I RME +IL  L WR+RS+TPFSF+ FF SL+ L+DP + Q
Sbjct  120   HFSSSNFQREEGFIFDAPAIQRMELLILDALNWRMRSVTPFSFICFFMSLFELKDPPLTQ  179

Query  559   SLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSD  380
             +L  RAS IIF +H +I L E+ PS++AASALL  + +L PLQF S + +I  CEYV  +
Sbjct  180   ALKDRASNIIFQAHGEINLLEFKPSILAASALLLASHELFPLQFPSVETSILSCEYVNKE  239

Query  379   EILNCLSVMRETVTRGI-ESSIDAISDCSL-TPRSVLH---------------RESGMMP  251
              +L C +  ++ V   I ES +D +S  S  TP SVL                  + M  
Sbjct  240   SLLKCFNATQDMVVNQISESIVDTVSSSSTRTPLSVLDCHCTKAESESTTSTMGATAMAE  299

Query  250   ERDGGMKRRRLNNFCDD  200
             +R+  +KRR+LN+FC +
Sbjct  300   KRE--IKRRKLNDFCSE  314



>ref|XP_010927931.1| PREDICTED: cyclin-D6-1 isoform X2 [Elaeis guineensis]
Length=301

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 135/294 (46%), Positives = 191/294 (65%), Gaps = 17/294 (6%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHL-DAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFI  887
             F+LENPLTSS  + HH  +++ ALFA ESDHM S L+  H +  S RR+A SL  + QF 
Sbjct  7     FDLENPLTSSDEEQHHFSNSIAALFAAESDHM-SPLAGGH-LDLSARRDAISLILQAQFS  64

Query  886   YKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRDE  707
                D S+AYLA+NY+DRFLS++ +   KPWVVR+L ISCLS+A+KM+ +D  L+D QR+E
Sbjct  65    CNLDPSVAYLAINYVDRFLSKREIPREKPWVVRLLSISCLSIASKMKKLDFSLTDFQREE  124

Query  706   GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIF  527
             G +FD+++I RME ++L  L WR+RSITPFSFL +F S +    P +  +L  RAS  +F
Sbjct  125   GFIFDAKTIRRMELLVLGALDWRMRSITPFSFLPYFLSFFSPAQPPLLHALKARASRTLF  184

Query  526   TSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILN-CLSVMR  350
              +  +IK+ E+ PSVIAA+ALL  A +L P+QF SF++AI  CE+    EIL  C + + 
Sbjct  185   KAQNEIKMLEFKPSVIAAAALLSAAHELFPIQFASFRSAISSCEF----EILGECCNAIG  240

Query  349   ETVTRGIESSIDAISDCSLTPRSVLHRE-SGMMPER-------DGGMKRRRLNN  212
             +    G +S+ + +   S TP +VL R  S    ER       D  +K+RR++ 
Sbjct  241   DVAMDGCDSTFEMLLS-SNTPVTVLGRHCSSSESERTVGSSSGDHDLKKRRISE  293



>gb|KDO55820.1| hypothetical protein CISIN_1g019748mg [Citrus sinensis]
Length=336

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 129/276 (47%), Positives = 176/276 (64%), Gaps = 14/276 (5%)
 Frame = -2

Query  1069  MEFNLENPLTS---SFNDHHHLDA---VPALFAGESDHMPSLLSF----NHQISFSIRRE  920
             M+F+LENP T+    FND         + +LF  ESDHMPS           +  S+R  
Sbjct  1     MDFSLENPFTNFHELFNDDDEDSTETILESLFLVESDHMPSKSYIKTLKGRDLDNSLRSR  60

Query  919   AFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCI  740
             A S     QF  KFD  ++YLA+NY+DR+LS Q + + KPW +R+L +SC SLAAKMR I
Sbjct  61    AVSSIL--QFSCKFDPFLSYLAVNYMDRYLSSQEMPQPKPWKLRLLAVSCFSLAAKMRQI  118

Query  739   DLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQ  560
             +   +  Q D GL+FD+Q+I RME +IL  LKWR+RSITPF+FL FF SL+ L+D ++ +
Sbjct  119   EFSYTQFQADGGLIFDTQTIQRMECLILGALKWRMRSITPFTFLSFFISLFKLKDLTVQR  178

Query  559   SLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSD  380
             +L  RAS +IF +  DIKL E+ PS+IAASALL+ + +L PLQF  F+ AI  C YV  +
Sbjct  179   ALKTRASEVIFQAQIDIKLIEFKPSIIAASALLFASRELFPLQFHCFRKAISNCPYVNKE  238

Query  379   EILNCLSVMRET-VTRGIESSIDAISDCSLTPRSVL  275
              +L C + M++T +    ES ID +S  S TP +VL
Sbjct  239   NLLRCYNAMQDTSMDDEYESEIDLVS-SSYTPVNVL  273



>ref|XP_002276869.1| PREDICTED: putative cyclin-D6-1 isoform X2 [Vitis vinifera]
Length=294

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 166/255 (65%), Gaps = 12/255 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSL  908
             MEF+LENPLTSS + H H  AV +LF  E+ HMPS      L S +  +SF  RR+A S 
Sbjct  1     MEFDLENPLTSSQDLHSH--AVASLFQAENHHMPSIDYCGSLDSVDCDVSF--RRQAISS  56

Query  907   TYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCL  728
                 Q    FD  ++YLA+NY+DRFLSR  +   KPW++R+L +SC+SLAAKM+  +  L
Sbjct  57    IL--QMSSSFDPFLSYLAINYLDRFLSRSEMPSEKPWILRLLAVSCVSLAAKMKKTEFSL  114

Query  727   SDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIH  548
             +D Q + G +FDS++I RME ++L  LKWR+RS+TPFSF+ FF SL+ L+DP + ++L  
Sbjct  115   ADFQGEGGFIFDSETIMRMEILVLGALKWRMRSVTPFSFISFFISLFKLKDPPLLEALKA  174

Query  547   RASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILN  368
             R   II  S  +IKL ++ PS+IAAS LLY   +L PLQF  F  AI  C YV  +++L 
Sbjct  175   RVIEIILKSQKEIKLLQFKPSIIAASTLLYACHELFPLQFPCFMTAISNCPYVNKEKMLC  234

Query  367   CLSVMRETVTRGIES  323
             C S +RE   +  +S
Sbjct  235   CYSAVREMEIKEFDS  249



>ref|XP_007025846.1| D6-type cyclin isoform 3 [Theobroma cacao]
 gb|EOY28468.1| D6-type cyclin isoform 3 [Theobroma cacao]
Length=326

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 194/317 (61%), Gaps = 36/317 (11%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSL--  908
             F+LE+P TS     H  D + ALF+ ESDHMPS      L + +  +SF  R+EA SL  
Sbjct  4     FDLEDPFTSL--KEHQSDTISALFSSESDHMPSQNYLQCLKTSDFYVSF--RQEAISLIL  59

Query  907   ----TYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCI  740
                   + Q+    D    YLA+NY+DRF+SRQ + +  PWV+R+LVI+C+SLAAKM+ I
Sbjct  60    QLVLVGQAQYSCNLDPYTPYLAVNYMDRFISRQDIPQGNPWVLRLLVIACISLAAKMKEI  119

Query  739   DLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQ  560
                 S+ QR+EG +FD+ +I RME +IL  L WR+RS+TPFSF+ FF SL+ L+DP + Q
Sbjct  120   HFSSSNFQREEGFIFDAPAIQRMELLILDALNWRMRSVTPFSFICFFMSLFELKDPPLTQ  179

Query  559   SLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSD  380
             +L  RAS IIF +H +I L E+ PS++AASALL  + +L PLQF S + +I  CEYV  +
Sbjct  180   ALKDRASNIIFQAH-EINLLEFKPSILAASALLLASHELFPLQFPSVETSILSCEYVNKE  238

Query  379   EILNCLSVMRETVTRGI-ESSIDAISDCSL-TPRSVLH---------------RESGMMP  251
              +L C +  ++ V   I ES +D +S  S  TP SVL                  + M  
Sbjct  239   SLLKCFNATQDMVVNQISESIVDTVSSSSTRTPLSVLDCHCTKAESESTTSTMGATAMAE  298

Query  250   ERDGGMKRRRLNNFCDD  200
             +R+  +KRR+LN+FC +
Sbjct  299   KRE--IKRRKLNDFCSE  313



>emb|CDP11895.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 169/268 (63%), Gaps = 7/268 (3%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLL---SFNH-QISFSIRREAFSLTYR  899
             EFNLENPL  S         V +LF  E+DHMPS     S  H  + +++R +  SL   
Sbjct  4     EFNLENPLPISQELLKEDSTVTSLFNIEADHMPSETYSQSLKHLSLQYNVREKIVSLIL-  62

Query  898   TQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDI  719
               F   FD  ++YLA+NY+DRFLS Q + E KPW++ ++ +SC+SLA KMR  +  +SDI
Sbjct  63    -NFSQNFDPLLSYLAINYLDRFLSSQPLSEEKPWILGLVAVSCVSLAMKMRKTESSVSDI  121

Query  718   QRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAS  539
             Q D G +FD+Q+I RME  IL  LKWR+RSITPF F++ F SL+  +D    Q+L  RA+
Sbjct  122   QHDGGFIFDAQTIERMELFILGALKWRMRSITPFCFINCFISLFKFKDLPSTQALKSRAT  181

Query  538   TIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLS  359
              II  +  +IKL+E+ PSVI+ASALL  + +L PLQF  F+NAI  C YV  + +LNC  
Sbjct  182   KIILKAQNEIKLWEFKPSVISASALLSASHELFPLQFPCFRNAISSCSYVNKENLLNCCK  241

Query  358   VMRETVTRGIESSIDAISDCSLTPRSVL  275
             +M+E      ES +D +S  S TP +VL
Sbjct  242   MMQEMAMEDYESVLDMVSS-SNTPANVL  268



>ref|XP_006469812.1| PREDICTED: putative cyclin-D6-1-like isoform X1 [Citrus sinensis]
Length=336

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 176/276 (64%), Gaps = 14/276 (5%)
 Frame = -2

Query  1069  MEFNLENPLTS---SFNDHHHLDA---VPALFAGESDHMPSLLSF----NHQISFSIRRE  920
             M+F+LENP T+    FND         + +LF  ESDHMPS           +  S+R  
Sbjct  1     MDFSLENPFTNFHELFNDDDEDSTETILESLFLVESDHMPSKSYIKTLKGRDLDNSLRSR  60

Query  919   AFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCI  740
             A S     QF  KFD  ++YLA++Y+DR+LS Q + + KPW +R+L +SC SLAAKMR I
Sbjct  61    AVSSIL--QFSCKFDPFLSYLAVSYMDRYLSSQEMPQPKPWKLRLLAVSCFSLAAKMRQI  118

Query  739   DLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQ  560
             +   +  Q D GL+FD+Q+I RME +IL  LKWR+RSITPF+FL FF SL+ L+D ++ +
Sbjct  119   EFSYTQFQADGGLIFDTQTIQRMECLILGALKWRMRSITPFTFLSFFISLFKLKDLTVQR  178

Query  559   SLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSD  380
             +L  RAS +IF +  DIKL E+ PS+IAASALL+ + +L PLQF  F+ AI  C YV  +
Sbjct  179   ALKTRASEVIFQAQIDIKLIEFKPSIIAASALLFASRELFPLQFHCFRKAISNCPYVNKE  238

Query  379   EILNCLSVMRET-VTRGIESSIDAISDCSLTPRSVL  275
              +L C + M++T +    ES ID +S  S TP +VL
Sbjct  239   NLLRCYNAMQDTSMDDEYESEIDLVS-SSYTPVNVL  273



>ref|XP_009405922.1| PREDICTED: cyclin-D6-1-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=304

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 184/297 (62%), Gaps = 15/297 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             MEF+LENPLTS  ++    D++  LFA ESDHM S +     I    RR A SL  + QF
Sbjct  1     MEFDLENPLTSGEDEQQRRDSISDLFASESDHMISTVG---TIDLHARRNAESLILQAQF  57

Query  889   IYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRD  710
              Y  D  +AYLA+NY+DRFLS++ +   K W+VR+L ISCLSLA+KMR     L+DIQ +
Sbjct  58    DYGLDPLVAYLAINYVDRFLSKRKIPRGKSWIVRLLSISCLSLASKMRKTSFALADIQGE  117

Query  709   EGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTII  530
             EG +FD+Q+I RME ++L  L WR+RS+TPFSFL FF S +    P + ++L  RA+ I+
Sbjct  118   EGCIFDAQTIRRMELLVLGALDWRMRSVTPFSFLRFFISFFSPAQPPLLRALRARATQIL  177

Query  529   FTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMR  350
               +  +IK+ E+ PSV+AASALL  A +L P+Q+ +F+ A+  CE V +D++L+C S M 
Sbjct  178   LKAQKEIKMMEFQPSVVAASALLSAAYELFPIQYPAFRAAVSSCELVNNDKLLDCSSAMG  237

Query  349   ETVTRGIESSID----AISDCSLTPRSVL-HRESGMMPERDGG-------MKRRRLN  215
             +      +   D     ++  SLTP +VL H  S    E   G       +K+RR++
Sbjct  238   DAEAAATDGCDDLAAMGMASSSLTPVTVLGHHCSSFESEPAAGSSSDVRELKKRRIS  294



>emb|CBI18003.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 166/255 (65%), Gaps = 12/255 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSL  908
             MEF+LENPLTSS + H H  AV +LF  E+ HMPS      L S +  +SF  RR+A S 
Sbjct  1     MEFDLENPLTSSQDLHSH--AVASLFQAENHHMPSIDYCGSLDSVDCDVSF--RRQAISS  56

Query  907   TYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCL  728
                 Q    FD  ++YLA+NY+DRFLSR  +   KPW++R+L +SC+SLAAKM+  +  L
Sbjct  57    I--LQMSSSFDPFLSYLAINYLDRFLSRSEMPSEKPWILRLLAVSCVSLAAKMKKTEFSL  114

Query  727   SDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIH  548
             +D Q + G +FDS++I RME ++L  LKWR+RS+TPFSF+ FF SL+ L+DP + ++L  
Sbjct  115   ADFQGEGGFIFDSETIMRMEILVLGALKWRMRSVTPFSFISFFISLFKLKDPPLLEALKA  174

Query  547   RASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILN  368
             R   II  S  +IKL ++ PS+IAAS LLY   +L PLQF  F  AI  C YV  +++L 
Sbjct  175   RVIEIILKSQKEIKLLQFKPSIIAASTLLYACHELFPLQFPCFMTAISNCPYVNKEKMLC  234

Query  367   CLSVMRETVTRGIES  323
             C S +RE   +  +S
Sbjct  235   CYSAVREMEIKEFDS  249



>ref|XP_007025847.1| D6-type cyclin isoform 4 [Theobroma cacao]
 gb|EOY28469.1| D6-type cyclin isoform 4 [Theobroma cacao]
Length=316

 Score =   224 bits (570),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 134/305 (44%), Positives = 190/305 (62%), Gaps = 22/305 (7%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSL--  908
             F+LE+P TS     H  D + ALF+ ESDHMPS      L + +  +SF  R+EA SL  
Sbjct  4     FDLEDPFTSL--KEHQSDTISALFSSESDHMPSQNYLQCLKTSDFYVSF--RQEAISLIL  59

Query  907   ----TYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCI  740
                   + Q+    D    YLA+NY+DRF+SRQ + +  PWV+R+LVI+C+SLAAKM+ I
Sbjct  60    QLVLVGQAQYSCNLDPYTPYLAVNYMDRFISRQDIPQGNPWVLRLLVIACISLAAKMKEI  119

Query  739   DLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQ  560
                 S+ QR+EG +FD+ +I RME +IL  L WR+RS+TPFSF+ FF SL+ L+DP + Q
Sbjct  120   HFSSSNFQREEGFIFDAPAIQRMELLILDALNWRMRSVTPFSFICFFMSLFELKDPPLTQ  179

Query  559   SLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSD  380
             +L  RAS IIF +H +I L E+ PS++AASALL  + +L PLQF S + +I  CEYV  D
Sbjct  180   ALKDRASNIIFQAHGEINLLEFKPSILAASALLLASHELFPLQFPSVETSILSCEYVNKD  239

Query  379   EILNCLS-VMRETVTRGIESSIDAISDCSLTPRSVLHRESGM----MPERDGGMKRRRLN  215
              ++N +S  + +TV+     +  ++ DC  T        S M    M E+   +KRR+LN
Sbjct  240   MVVNQISESIVDTVSSSSTRTPLSVLDCHCTKAESESTTSTMGATAMAEK-REIKRRKLN  298

Query  214   NFCDD  200
             +FC +
Sbjct  299   DFCSE  303



>ref|XP_010051475.1| PREDICTED: putative cyclin-D6-1 [Eucalyptus grandis]
 gb|KCW89470.1| hypothetical protein EUGRSUZ_A01768 [Eucalyptus grandis]
Length=332

 Score =   224 bits (571),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 167/274 (61%), Gaps = 19/274 (7%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             MEF+LENPL          + + +LF  E DHMP       Q    +R   F +  R   
Sbjct  1     MEFDLENPLPLCS------ETLASLFLVEPDHMP-----GEQYVRGLRDGGFDVAVRRDI  49

Query  889   IYKF-------DRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLC  731
             +          D   +YLA+NY+DRFLS Q++    PWV+R+L + C+SLAAKMR  D  
Sbjct  50    VSSISRLSSRLDPLSSYLAVNYLDRFLSCQSLPHLSPWVLRLLAVCCVSLAAKMRNTDFS  109

Query  730   LSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLI  551
             L+D Q D G + DS++I RME +IL  LKWR+RS+TPFSF+ FFTSL+ L+DP + Q+L 
Sbjct  110   LADFQGDGGFVHDSRTIQRMEVLILGALKWRMRSVTPFSFVAFFTSLFKLKDPPLRQALN  169

Query  550   HRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEIL  371
              RA+ IIF S  D++L ++ PSVIAASALL  + +L PLQF  F+ AI  C YV  DE+L
Sbjct  170   ARATEIIFKSQNDVELMDFRPSVIAASALLSASHELFPLQFSCFRTAILNCSYVNKDELL  229

Query  370   NCLSVMRETVTRGIESSIDAISDCSLTPRSVLHR  269
             +C S M++    G ES  D IS  S TP +VL +
Sbjct  230   DCYSAMQDVAMEGYESVFDVISR-SDTPINVLDQ  262



>ref|XP_010035645.1| PREDICTED: putative cyclin-D6-1 [Eucalyptus grandis]
 gb|KCW47089.1| hypothetical protein EUGRSUZ_K00895 [Eucalyptus grandis]
Length=297

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/272 (46%), Positives = 174/272 (64%), Gaps = 13/272 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSL  908
             M+F+LENPLT+ F+D         LF  ESDHMPS      L S       S+RR+  SL
Sbjct  1     MDFDLENPLTN-FDDRFPDKTF--LFLVESDHMPSEKYLAGLRSVGCSDDLSVRRDIVSL  57

Query  907   TYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCL  728
                +Q     D +++YLA+NY+DRFLS   +   KPWV+R+L +SC++LAAKM   ++ L
Sbjct  58    I--SQLCCNLDPTLSYLAINYVDRFLSSHKLQRPKPWVLRLLAVSCVALAAKMLKTEISL  115

Query  727   SDIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLI  551
             +D+Q D G  +FD+ SI RME ++L  L+WR+RSITPF F+ FF SL  L DP + Q++ 
Sbjct  116   ADVQSDGGGFIFDAHSIQRMELLVLGTLQWRMRSITPFCFISFFVSLLKLRDPPLRQAIR  175

Query  550   HRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEIL  371
              RAS II  +  DIKL E+ PS+ AASALL  +++L PLQF +FK+ I  C +V  D +L
Sbjct  176   ARASEIILKAQNDIKLLEFKPSITAASALLRASQELCPLQFATFKSDISSCSFVNKDILL  235

Query  370   NCLSVMRETVTRGIESSIDAISDCSLTPRSVL  275
             +C + M++  T G ES++D +   S TP +VL
Sbjct  236   HCYNEMQDAATEGFESALD-VHSSSDTPINVL  266



>ref|XP_008371237.1| PREDICTED: putative cyclin-D6-1 [Malus domestica]
Length=369

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/255 (47%), Positives = 165/255 (65%), Gaps = 8/255 (3%)
 Frame = -2

Query  1021  HHLDAVPALFAGESDHMPS--LLSFNHQISF--SIRREAFSLTYRTQFIYKFDRSIAYLA  854
             H+ DA+P LF  E+DHMPS   LS +    F  + R EA SL  + Q+    D  I YLA
Sbjct  60    HNSDAIPDLFTSETDHMPSQNFLSSSKHTGFYYTFRLEAISLFXQVQYSCNLDPFIPYLA  119

Query  853   MNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRDEGLMFDSQSIHR  674
             +NY+DRF+S++ + + KPWV R++ +SCLSLAAKM+ I    SD QR E  +FD Q++H+
Sbjct  120   INYLDRFISKRDIPQGKPWVSRLVKVSCLSLAAKMKNIPFSSSDFQRGESFVFDVQTVHK  179

Query  673   MEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEY  494
             ME +IL+ L WR+RSITPFSFLHFF S   L D    Q+L +RAS IIF +H +IK  E+
Sbjct  180   MELLILNTLDWRMRSITPFSFLHFFLSSLDLNDRPFTQALKNRASDIIFNAHTEIKFVEF  239

Query  493   NPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVTRGIESSID  314
              PS+IAASA+L    +L+PL+F  FK ++   + V  + +L C +VM+E V       +D
Sbjct  240   KPSIIAASAVLSACHELLPLKFPFFKVSLSSFQNVNKESLLKCFNVMQEMVE---NEGLD  296

Query  313   AISDCSLTPRSVLHR  269
              +S C+ TP SVL R
Sbjct  297   TMS-CTRTPASVLDR  310



>ref|XP_010657381.1| PREDICTED: putative cyclin-D6-1 isoform X1 [Vitis vinifera]
Length=297

 Score =   221 bits (562),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 169/258 (66%), Gaps = 15/258 (6%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSL  908
             MEF+LENPLTSS + H H  AV +LF  E+ HMPS      L S +  +SF  RR+A S 
Sbjct  1     MEFDLENPLTSSQDLHSH--AVASLFQAENHHMPSIDYCGSLDSVDCDVSF--RRQAISS  56

Query  907   TYRTQFIYKFDRSIAYLAMNYIDRFLSRQ--AVLEN-KPWVVRILVISCLSLAAKMRCID  737
                 Q    FD  ++YLA+NY+DRFLSR    +L++ KPW++R+L +SC+SLAAKM+  +
Sbjct  57    IL--QMSSSFDPFLSYLAINYLDRFLSRSEMPILQSEKPWILRLLAVSCVSLAAKMKKTE  114

Query  736   LCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQS  557
               L+D Q + G +FDS++I RME ++L  LKWR+RS+TPFSF+ FF SL+ L+DP + ++
Sbjct  115   FSLADFQGEGGFIFDSETIMRMEILVLGALKWRMRSVTPFSFISFFISLFKLKDPPLLEA  174

Query  556   LIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDE  377
             L  R   II  S  +IKL ++ PS+IAAS LLY   +L PLQF  F  AI  C YV  ++
Sbjct  175   LKARVIEIILKSQKEIKLLQFKPSIIAASTLLYACHELFPLQFPCFMTAISNCPYVNKEK  234

Query  376   ILNCLSVMRETVTRGIES  323
             +L C S +RE   +  +S
Sbjct  235   MLCCYSAVREMEIKEFDS  252



>ref|XP_007149914.1| hypothetical protein PHAVU_005G109600g [Phaseolus vulgaris]
 gb|ESW21908.1| hypothetical protein PHAVU_005G109600g [Phaseolus vulgaris]
Length=312

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/309 (40%), Positives = 192/309 (62%), Gaps = 29/309 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMP------SLLSFNHQISFSIRREAFSL  908
             M+FNLENPL  +F+D    DA+P+LF  ESDH+P      +L + +  IS  +RR   SL
Sbjct  1     MDFNLENPL-GNFHDLP-WDALPSLFLIESDHIPPPNYCQTLKASDFDIS--VRRNVVSL  56

Query  907   TYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCL  728
                +Q    FD  + YLA+NY+DRFL+ Q +L+ KPW  ++L ISC SLAAKM   +   
Sbjct  57    I--SQLSCTFDPVLPYLAINYLDRFLANQGILQPKPWANKLLAISCFSLAAKMLKAEYSA  114

Query  727   SDIQ-----RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIA  563
             +D+Q      + G++F++Q++ RMEG++L  L+WR+RSITPFSF+ FF  L+ L+DP+  
Sbjct  115   TDVQVLLNHGEGGVVFETQTVQRMEGIVLGALQWRMRSITPFSFIPFFVDLFRLKDPAFR  174

Query  562   QSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKS  383
             Q L  RAS II  S  +IK+ E+ PS++AASALLY + +L P Q+  F  AI  C YV  
Sbjct  175   QVLKDRASEIILKSQREIKVLEFKPSIVAASALLYASHELFPFQYPCFLRAISDCSYVNK  234

Query  382   DEILNCLSVMRETVTRGIESSIDAISDCSLTPRSVL---------HRESGMMPERDGGMK  230
             + ++ C +V+++      ES ++ I+  S TP +VL          + +G++ E++   K
Sbjct  235   ETVVQCYNVIQDIAREEYESVLN-INSTSDTPVNVLDEHFLSLESEKTNGVIQEQE--FK  291

Query  229   RRRLNNFCD  203
             RR++ ++ +
Sbjct  292   RRKITDYGN  300



>ref|XP_006469813.1| PREDICTED: putative cyclin-D6-1-like isoform X2 [Citrus sinensis]
Length=335

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 175/276 (63%), Gaps = 15/276 (5%)
 Frame = -2

Query  1069  MEFNLENPLTS---SFNDHHHLDA---VPALFAGESDHMPSLLSF----NHQISFSIRRE  920
             M+F+LENP T+    FND         + +LF  ESDHMPS           +  S+R  
Sbjct  1     MDFSLENPFTNFHELFNDDDEDSTETILESLFLVESDHMPSKSYIKTLKGRDLDNSLRSR  60

Query  919   AFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCI  740
             A S     QF  KFD  ++YLA++Y+DR+LS Q  +  KPW +R+L +SC SLAAKMR I
Sbjct  61    AVSSIL--QFSCKFDPFLSYLAVSYMDRYLSSQE-MPPKPWKLRLLAVSCFSLAAKMRQI  117

Query  739   DLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQ  560
             +   +  Q D GL+FD+Q+I RME +IL  LKWR+RSITPF+FL FF SL+ L+D ++ +
Sbjct  118   EFSYTQFQADGGLIFDTQTIQRMECLILGALKWRMRSITPFTFLSFFISLFKLKDLTVQR  177

Query  559   SLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSD  380
             +L  RAS +IF +  DIKL E+ PS+IAASALL+ + +L PLQF  F+ AI  C YV  +
Sbjct  178   ALKTRASEVIFQAQIDIKLIEFKPSIIAASALLFASRELFPLQFHCFRKAISNCPYVNKE  237

Query  379   EILNCLSVMRET-VTRGIESSIDAISDCSLTPRSVL  275
              +L C + M++T +    ES ID +S  S TP +VL
Sbjct  238   NLLRCYNAMQDTSMDDEYESEIDLVS-SSYTPVNVL  272



>ref|XP_002317253.1| hypothetical protein POPTR_0011s04030g [Populus trichocarpa]
 emb|CAN88865.1| D6-type cyclin [Populus trichocarpa]
 gb|EEE97865.1| hypothetical protein POPTR_0011s04030g [Populus trichocarpa]
Length=257

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 163/235 (69%), Gaps = 10/235 (4%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS--LLSF----NHQISFSIRREAFSL  908
             M+ +LENPLTSS  + H  D +  LFA E DHMPS  LL+F    +H    S R EA SL
Sbjct  1     MKLDLENPLTSS--EEHQSDTITYLFASEFDHMPSRNLLNFLETCDH-FYVSFRHEAISL  57

Query  907   TYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCL  728
               + Q+       I YLA+N++DRF+SR  + + KPW++R++V+SCLSLAAKM   D  +
Sbjct  58    ILQAQYSCNCGPFIPYLAVNFMDRFISRMEIPQGKPWILRLVVVSCLSLAAKMENTDFSI  117

Query  727   SDIQRDE-GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLI  551
             S+ Q DE G +FD+++I+RME +IL  L WR+RSITPFSF+HFF SL  L+DP++ Q+L 
Sbjct  118   SNFQGDEAGFIFDNKTINRMELLILDTLDWRMRSITPFSFVHFFISLSQLKDPALTQTLK  177

Query  550   HRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVK  386
              RA+ IIF +  +IKL ++ PS+IAASALL  +++L+PLQF SFK +I   E VK
Sbjct  178   DRATEIIFKAQNEIKLLKFKPSIIAASALLVASKELLPLQFPSFKFSISAFECVK  232



>ref|XP_007025850.1| D6-type cyclin, putative isoform 7, partial [Theobroma cacao]
 gb|EOY28472.1| D6-type cyclin, putative isoform 7, partial [Theobroma cacao]
Length=261

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 128/270 (47%), Positives = 175/270 (65%), Gaps = 22/270 (8%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSLTY  902
             F+LE+P TS     H  D + ALF+ ESDHMPS      L + +  +SF  R+EA SL  
Sbjct  4     FDLEDPFTSL--KEHQSDTISALFSSESDHMPSQNYLQCLKTSDFYVSF--RQEAISLIL  59

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             + Q+    D    YLA+NY+DRF+SRQ + +  PWV+R+LVI+C+SLAAKM+ I    S+
Sbjct  60    QAQYSCNLDPYTPYLAVNYMDRFISRQDIPQGNPWVLRLLVIACISLAAKMKEIHFSSSN  119

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              QR+EG +FD+ +I RME +IL  L WR+RS+TPFSF+ FF SL+ L+DP + Q+L  RA
Sbjct  120   FQREEGFIFDAPAIQRMELLILDALNWRMRSVTPFSFICFFMSLFELKDPPLTQALKDRA  179

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
             S IIF +H +I L E+ PS++AASALL  + +L PLQF S + +I  CEYV  D ++N +
Sbjct  180   SNIIFQAH-EINLLEFKPSILAASALLLASHELFPLQFPSVETSILSCEYVNKDMVVNQI  238

Query  361   SVMRETVTRGIESSIDAISDCSL-TPRSVL  275
             S          ES +D +S  S  TP SVL
Sbjct  239   S----------ESIVDTVSSSSTRTPLSVL  258



>ref|XP_009405923.1| PREDICTED: cyclin-D6-1-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 183/297 (62%), Gaps = 17/297 (6%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             MEF+LENPLTS  ++    D++  LFA ESDHM S +     I    RR A SL    QF
Sbjct  1     MEFDLENPLTSGEDEQQRRDSISDLFASESDHMISTVG---TIDLHARRNAESLIL--QF  55

Query  889   IYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRD  710
              Y  D  +AYLA+NY+DRFLS++ +   K W+VR+L ISCLSLA+KMR     L+DIQ +
Sbjct  56    DYGLDPLVAYLAINYVDRFLSKRKIPRGKSWIVRLLSISCLSLASKMRKTSFALADIQGE  115

Query  709   EGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTII  530
             EG +FD+Q+I RME ++L  L WR+RS+TPFSFL FF S +    P + ++L  RA+ I+
Sbjct  116   EGCIFDAQTIRRMELLVLGALDWRMRSVTPFSFLRFFISFFSPAQPPLLRALRARATQIL  175

Query  529   FTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMR  350
               +  +IK+ E+ PSV+AASALL  A +L P+Q+ +F+ A+  CE V +D++L+C S M 
Sbjct  176   LKAQKEIKMMEFQPSVVAASALLSAAYELFPIQYPAFRAAVSSCELVNNDKLLDCSSAMG  235

Query  349   ETVTRGIESSID----AISDCSLTPRSVL-HRESGMMPERDGG-------MKRRRLN  215
             +      +   D     ++  SLTP +VL H  S    E   G       +K+RR++
Sbjct  236   DAEAAATDGCDDLAAMGMASSSLTPVTVLGHHCSSFESEPAAGSSSDVRELKKRRIS  292



>gb|KHN36588.1| Putative cyclin-D6-1 [Glycine soja]
Length=316

 Score =   219 bits (557),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 124/315 (39%), Positives = 190/315 (60%), Gaps = 33/315 (10%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHL--DAVPALFAGESDHMP------SLLSFNHQISFSIRREAF  914
             M+F+LENPL     + H L  DAVP+LF  ESDH+P      SL + +  IS  +RR+  
Sbjct  1     MDFDLENPL----GNFHDLPCDAVPSLFLIESDHIPPPNYCQSLKASDFDIS--VRRDVV  54

Query  913   SLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL  734
             SL   +Q    FD  + YLA+NY+DRFL+ Q +L+ KPW  ++L +SC SLAAKM   + 
Sbjct  55    SLI--SQLSCTFDPVLPYLAINYLDRFLANQGILQPKPWANKLLAVSCFSLAAKMLKTEY  112

Query  733   CLSDIQ-----RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPS  569
               +D+Q      D G +F++Q+I RMEG++L  L+WR+RSITPFSF+ FF +L+ L+DP+
Sbjct  113   SATDVQVLMNHGDGGAIFETQTIQRMEGIVLGALQWRMRSITPFSFIPFFVNLFRLKDPA  172

Query  568   IAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYV  389
             + Q L  RAS II  S  +IK+ E+ PS +AASALLY + +L P Q+  F  AI  C Y+
Sbjct  173   LRQVLKDRASEIILKSQREIKVLEFKPSTVAASALLYASHELFPFQYPCFLRAISDCSYI  232

Query  388   KSDEILNCLSVMRETVTRGIESSIDAISDCSLTPRSVLHRE-----------SGMMPERD  242
               + ++ C +V+++      ES ++ I+  S TP +VL              + ++  ++
Sbjct  233   NKETVVQCYNVIQDIAREEYESVLN-INSTSDTPVNVLDEHFLSLESEKTNGTNVVVTQE  291

Query  241   GGMKRRRLNNFCDDQ  197
                KRR+  ++ +++
Sbjct  292   QDFKRRKTTDYGNNR  306



>ref|XP_008812858.1| PREDICTED: cyclin-D6-1 isoform X1 [Phoenix dactylifera]
Length=304

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 134/294 (46%), Positives = 194/294 (66%), Gaps = 12/294 (4%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHL-DAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFI  887
             F+LENPLTS+  + H   D++ ALFA ESDHM S ++  H +  S RR+A SL  + QF 
Sbjct  7     FDLENPLTSADEEQHPFSDSIAALFAAESDHM-SPIAGGH-LDLSARRDAVSLILQAQFS  64

Query  886   YKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRDE  707
                D S+AYLA+NY+DRFLS++ +  +KPWVVR+L ISCLS+A+KM+  DL L+D QR+E
Sbjct  65    CNLDPSVAYLAINYVDRFLSKRQIPSDKPWVVRLLSISCLSIASKMKKTDLFLTDFQREE  124

Query  706   GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIF  527
             G +FD+++I RME ++L  L WR+RSITPFSFL FF S +    P +  +L  RAS I+F
Sbjct  125   GFIFDAKTIRRMELLVLGALDWRMRSITPFSFLPFFLSFFSPAQPPLLHALKARASRILF  184

Query  526   TSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE  347
              +  +IK+ E+ PSVIAA+ALL  A +L P+QF SF++A+  CE+V  +++  C + + +
Sbjct  185   KAQNEIKMLEFKPSVIAAAALLSAAHELFPIQFASFRSAMSSCEFVNKEKLGECCNAVGD  244

Query  346   TVTRGIESSIDAISDCSLTPRSVLHRE-SGMMPER-------DGGMKRRRLNNF  209
                 G +S+ + +S  S TP +VL R  S    ER       D  +K+RR++  
Sbjct  245   VAMDGCDSTFEMVS-SSNTPVTVLGRHCSSSESERTVGSSSDDHDLKKRRISEL  297



>ref|NP_001242717.1| uncharacterized protein LOC100799951 [Glycine max]
 gb|ACU17821.1| unknown [Glycine max]
Length=316

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/315 (39%), Positives = 190/315 (60%), Gaps = 33/315 (10%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHL--DAVPALFAGESDHMP------SLLSFNHQISFSIRREAF  914
             M+F+LENPL     + H L  DAVP+LF  ESDH+P      SL + +  IS  +RR+  
Sbjct  1     MDFDLENPL----GNFHDLPCDAVPSLFLIESDHIPPPNYCQSLKASDFDIS--VRRDVV  54

Query  913   SLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL  734
             SL   +Q    FD  + YLA+NY+DRFL+ Q +L+ KPW  ++L +SC SLAAKM   + 
Sbjct  55    SLI--SQLSCTFDPVLPYLAINYLDRFLANQGILQPKPWANKLLAVSCFSLAAKMLKTEY  112

Query  733   CLSDIQ-----RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPS  569
               +D+Q      D G +F++Q+I RMEG++L  L+WR+RSITPFSF+ FF +L+ L+DP+
Sbjct  113   SATDVQVLMNHGDGGAIFETQTIQRMEGIVLGALQWRMRSITPFSFIPFFVNLFRLKDPA  172

Query  568   IAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYV  389
             + Q L  RAS II  S  +IK+ E+ PS +AASALLY + +L P Q+  F  AI  C Y+
Sbjct  173   LRQVLKDRASEIILKSQREIKVLEFKPSTVAASALLYASHELFPFQYPCFLRAISDCSYI  232

Query  388   KSDEILNCLSVMRETVTRGIESSIDAISDCSLTPRSVLHRE-----------SGMMPERD  242
               + ++ C +V+++ + R    S+  I+  S TP +VL              + ++  ++
Sbjct  233   NKETVVQCYNVIQD-IAREEYKSVLNINSTSDTPVNVLDEHFLSLESEKTNGTNVVVTQE  291

Query  241   GGMKRRRLNNFCDDQ  197
                KRR+  ++ +++
Sbjct  292   QDFKRRKTTDYGNNR  306



>ref|XP_003540333.1| PREDICTED: putative cyclin-D6-1-like [Glycine max]
 gb|KHN04300.1| Putative cyclin-D6-1 [Glycine soja]
Length=315

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/310 (41%), Positives = 186/310 (60%), Gaps = 24/310 (8%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS---LLSFN-HQISFSIRREAFSLTY  902
             M+F+LENPL  +F+D    DAVP+LF  ESDH+P      SF       S+RR+  SL  
Sbjct  1     MDFDLENPL-GNFHDLP-CDAVPSLFLIESDHIPPPNYCQSFKASDFDISVRRDVVSLI-  57

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
              +Q    FD  + YLA+NY+DRFL+ Q +L+ KPW  ++L ISC SLAAKM   +   +D
Sbjct  58    -SQLSCTFDPVLPYLAINYLDRFLAHQGILQPKPWANKLLAISCFSLAAKMLKTEYSATD  116

Query  721   IQ-----RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQS  557
             +Q      D G +F++Q+I RMEG++L  L+WR+RSITPFSF+ FF +L+ L+DP++ Q 
Sbjct  117   VQVLMNHGDGGAIFEAQTIQRMEGIVLGALQWRMRSITPFSFIPFFVNLFRLKDPALRQV  176

Query  556   LIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDE  377
             L   AS II  S  +IK+ E+ PS +AASALLY + +L P Q+  F  AI  C Y+  + 
Sbjct  177   LKDGASEIILKSQREIKVLEFKPSTVAASALLYASHELFPFQYPCFLRAISDCSYINKET  236

Query  376   ILNCLSVMRETVTRGIESSIDAISDCSLTPRSVLHRE-SGMMPERDGG---------MKR  227
             ++ C +V+ + +TR    S+  I+  S TP +VL      +  E+  G          KR
Sbjct  237   VVQCYNVIHD-ITREEYESVLNINSTSDTPVNVLDEHFLSLESEKTNGTNVVTQEQDFKR  295

Query  226   RRLNNFCDDQ  197
             R+  ++ +++
Sbjct  296   RKTTDYGNNR  305



>ref|XP_006366940.1| PREDICTED: putative cyclin-D6-1-like [Solanum tuberosum]
Length=311

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/270 (43%), Positives = 174/270 (64%), Gaps = 12/270 (4%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS----LLSFNHQISFSIRREAFSLTY  902
             M+F+LENPL  S    H  D +  LF  E+ HMPS     +  N     +IR    S+  
Sbjct  1     MDFDLENPLPFS----HDEDTISPLFNIETHHMPSKTYLQILINSDFLINIRESTISIIL  56

Query  901   RTQFIYKFDR-SIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS  725
               Q    FD  S++YLA+NY+DRFLS  ++ + KPW+++++ +SC+SLA KM+  +  ++
Sbjct  57    --QISQPFDSPSLSYLAINYLDRFLSFHSLPDAKPWILKLIAVSCVSLAFKMKKTEYSVT  114

Query  724   DIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHR  545
             DIQ+D G +FD ++I RME +IL  LKWR+RSIT F+F++FF SL+  +D  + Q+L  R
Sbjct  115   DIQQDGGTIFDIETIKRMELLILGGLKWRMRSITAFAFINFFVSLFKFKDLPLQQALKDR  174

Query  544   ASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNC  365
             A+ IIFT+  +IK+ ++ PS+I+ASALL  + +L PLQF  +K AI  C YV  D++L+C
Sbjct  175   ATEIIFTAQNEIKILQFKPSIISASALLSASHELFPLQFSCYKTAILNCSYVHEDDLLSC  234

Query  364   LSVMRETVTRGIESSIDAISDCSLTPRSVL  275
               VM+E   +  ES ++ +S  S TP +VL
Sbjct  235   YDVMQEIAKKEYESILEMVSSTS-TPVNVL  263



>ref|XP_007043433.1| D6-type cyclin [Theobroma cacao]
 gb|EOX99264.1| D6-type cyclin [Theobroma cacao]
Length=288

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 131/283 (46%), Positives = 173/283 (61%), Gaps = 10/283 (4%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFN----HQISFSIRREAFSLTY  902
             MEF+LENPLT+ FND      +P+LF  ES HMP            +  S+RR A SL  
Sbjct  1     MEFDLENPLTN-FNDFCPGTTIPSLFLVESHHMPKENYVKTLKARDLDISVRRGAISLI-  58

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
              +Q   K    ++YLA+NY+DRFLS Q + + K WV+R+L ISC+SLAAKM+  +  ++ 
Sbjct  59    -SQLSCKSSPFLSYLAVNYLDRFLSIQGIPQPKTWVLRLLAISCVSLAAKMKKTEFSIAH  117

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              Q D G +FD+Q+I RME +IL  LKWR+RSITPFSF+ FF S + L+DP + Q+L  RA
Sbjct  118   FQGDGGFIFDAQTIERMEYLILGALKWRMRSITPFSFISFFISFFKLKDPPLRQALKARA  177

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
               IIF S  D+KL  + PS+ AASALL  + +L PLQF  F+ AI  C YV  D +L C 
Sbjct  178   LEIIFKSQTDVKLLVFKPSITAASALLSASHELFPLQFPCFRKAISSCSYVNKDNMLECY  237

Query  361   SVMRETVTRGIESSIDAISDCSLTPRSVL--HRESGMMPERDG  239
             + M++    G ES  D +S  S TP +VL  H  S      DG
Sbjct  238   NSMQDIAKEGYESIFDMVS-TSNTPVNVLDQHFSSSESETTDG  279



>ref|XP_003541753.1| PREDICTED: putative cyclin-D6-1-like isoform X1 [Glycine max]
 gb|KHN19095.1| Putative cyclin-D6-1 [Glycine soja]
Length=272

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 159/243 (65%), Gaps = 7/243 (3%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS--LLSFNHQISFSIRREAFSLTYRT  896
             MEF+LE+PL S   +      +  LFA ES+H+PS   LS  H   F    EA SL  + 
Sbjct  1     MEFDLEDPLVSL--EEEQTFTISELFASESEHVPSPNCLSSTHFHVFC--GEAISLILQV  56

Query  895   QFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQ  716
             Q   K D+ +AYLA+NY+ RF+S Q + + KPW +R+LVISCLSLA+KM+   L + D+Q
Sbjct  57    QVSCKLDQFVAYLAINYLHRFMSCQEIPQGKPWFLRLLVISCLSLASKMKNTTLSILDMQ  116

Query  715   RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAST  536
             + EG  F +QSI RME +IL  LKWR+RSITPFSFLHFF SL  ++D S+ Q+L +RAS 
Sbjct  117   K-EGCYFKAQSIQRMELLILGALKWRMRSITPFSFLHFFISLAEIKDQSLKQTLKNRASE  175

Query  535   IIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSV  356
             IIF +   IK  EY PS IAA++L++ + +L P Q+ + + +I  CEY+  + +  C  +
Sbjct  176   IIFNAQNGIKFLEYKPSTIAATSLIFASHELFPQQYSTLRASITACEYLDEETLSKCFDL  235

Query  355   MRE  347
             M++
Sbjct  236   MQD  238



>ref|XP_008812859.1| PREDICTED: cyclin-D6-1 isoform X2 [Phoenix dactylifera]
Length=301

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 135/294 (46%), Positives = 192/294 (65%), Gaps = 15/294 (5%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHL-DAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFI  887
             F+LENPLTS+  + H   D++ ALFA ESDHM S ++  H +  S RR+A SL  + QF 
Sbjct  7     FDLENPLTSADEEQHPFSDSIAALFAAESDHM-SPIAGGH-LDLSARRDAVSLILQAQFS  64

Query  886   YKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRDE  707
                D S+AYLA+NY+DRFLS++ +  +KPWVVR+L ISCLS+A+KM+  DL L+D QR+E
Sbjct  65    CNLDPSVAYLAINYVDRFLSKRQIPSDKPWVVRLLSISCLSIASKMKKTDLFLTDFQREE  124

Query  706   GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIF  527
             G +FD+++I RME ++L  L WR+RSITPFSFL FF S +    P +  +L  RAS I+F
Sbjct  125   GFIFDAKTIRRMELLVLGALDWRMRSITPFSFLPFFLSFFSPAQPPLLHALKARASRILF  184

Query  526   TSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE  347
              +  +IK+ E+ PSVIAA+ALL  A +L P+QF SF++A+  CE+ K  E   C + + +
Sbjct  185   KAQNEIKMLEFKPSVIAAAALLSAAHELFPIQFASFRSAMSSCEFEKLGE---CCNAVGD  241

Query  346   TVTRGIESSIDAISDCSLTPRSVLHRE-SGMMPER-------DGGMKRRRLNNF  209
                 G +S+ + +S  S TP +VL R  S    ER       D  +K+RR++  
Sbjct  242   VAMDGCDSTFEMVS-SSNTPVTVLGRHCSSSESERTVGSSSDDHDLKKRRISEL  294



>ref|XP_011100327.1| PREDICTED: putative cyclin-D6-1 [Sesamum indicum]
Length=311

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/313 (40%), Positives = 176/313 (56%), Gaps = 29/313 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS---LLSFNHQIS-FSIRREAFSLTY  902
             MEF+LENPL  S      ++  P+LF  E +HMPS   L + N   S  SIRRE  S  +
Sbjct  1     MEFDLENPLPPS------MEKFPSLFHIEDEHMPSKTYLQALNSADSNLSIRREIVSSIF  54

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
                F   FD   +YLA NY+DRFLS  ++ + KPW+++++ ISC+SLA KMR  +  +SD
Sbjct  55    --CFSRGFDAFTSYLATNYMDRFLSTHSIPDGKPWILKVVAISCISLALKMRKTEFSVSD  112

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
             +    G M D  +I RME +IL  LKWR+RS+ PFSF ++F + +  +D S  Q+L  RA
Sbjct  113   LLNAGGFMIDFLTIERMEMLILGSLKWRMRSVNPFSFANYFVTFFKFKDDSSIQALKTRA  172

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
               IIF +  D+KL E+ PSVI+ASALL  A +L P+Q  SF++AI  C YV  + ++ C 
Sbjct  173   FEIIFKAQNDVKLLEFKPSVISASALLVAAHELFPVQLPSFRDAICSCSYVNKENLVQCY  232

Query  361   SVMRETVTRGIESSIDAISDCSLTPRSVLH----------------RESGMMPERDGGMK  230
              +M+E       S +  +S  S TP +VL                  E+       GG+K
Sbjct  233   DLMQEVAMERYGSVLGMVSS-SCTPANVLDLHCFSSSISSSQTNQTSETASNAAGIGGLK  291

Query  229   RRRLNNFCDDQEY  191
             R +L +F  D  +
Sbjct  292   RPKLQDFATDNSF  304



>ref|XP_009417261.1| PREDICTED: cyclin-D6-1-like [Musa acuminata subsp. malaccensis]
Length=305

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/305 (40%), Positives = 183/305 (60%), Gaps = 19/305 (6%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             MEF+LENPLTSS ++H    ++ ALFA ESDHM S +     I  S RR+A SL  + QF
Sbjct  1     MEFDLENPLTSSEDEHQGWGSISALFAAESDHMISTVGL---IDLSSRRDAVSLVLQAQF  57

Query  889   IYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRD  710
                 D  +AYLA+NYIDRFLS++ +   KPW++++L I+CLSLA+KM+  +  L++ Q  
Sbjct  58    DCNLDPFVAYLAINYIDRFLSKRKIQREKPWIIQLLSIACLSLASKMKKTNFMLANFQGK  117

Query  709   EGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTII  530
             EG +FD+Q+I RME ++L  L WR+RS+TPFSFL FF S +    P + Q+L   A+ I+
Sbjct  118   EGFIFDAQTIRRMELLVLGTLDWRMRSVTPFSFLSFFISFFSPARPPLLQALKAHATQIL  177

Query  529   FTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMR  350
               +  +IK+ E+ PSV+AAS+LL  A ++ P+QF +F+ A+  C +V  +++  C  V+ 
Sbjct  178   LKAKNEIKMLEFKPSVVAASSLLSAAYEIFPIQFPAFRAAVSSCNFVNEEKLWECSIVIG  237

Query  349   ETVTRGIESSIDAI----SDCSLTPRSVLHR-------ESGMMPERDG-GMKRRR----L  218
                   ++   D+          TP +VL R       E+ +    DG  +K+RR    L
Sbjct  238   AATATAMDGCDDSAGMGEGSSPETPVTVLGRHSSSSESETAVGSSSDGRELKKRRTTSTL  297

Query  217   NNFCD  203
                CD
Sbjct  298   RASCD  302



>ref|XP_008448224.1| PREDICTED: putative cyclin-D6-1 isoform X1 [Cucumis melo]
Length=316

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 132/311 (42%), Positives = 188/311 (60%), Gaps = 25/311 (8%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHM--PSLLS--FNHQISFSIRREAFSLTY  902
             M+F+LENPLT   +  H  DA  +LF  ESDHM  PS L    +    F++R++  S   
Sbjct  1     MDFDLENPLTH-LHQLHSDDA--SLFLTESDHMLSPSYLHTLLSSPSDFAVRQDTVSFIS  57

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             +       D  ++YLA+NY+DRF S Q V + KPWV+R+L +SC+SLAAKM+ I+  L D
Sbjct  58    QCCSNSNIDPHLSYLAVNYLDRFFSSQGVPQPKPWVLRLLAVSCVSLAAKMKQIEHNLFD  117

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              Q +EG +FD Q++HRME +IL  LKWR+RSITPFSF+ FF SL+ L DP + Q+L  RA
Sbjct  118   FQGNEGFIFDPQTVHRMEVLILGALKWRMRSITPFSFIPFFISLFKLRDPPLLQALKGRA  177

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYV-----KSDE  377
             + IIF +   I+L E+  SVIAA+ALL  A +L P+Q+  F+ AI  C YV     + ++
Sbjct  178   TEIIFIAQNGIELLEFKASVIAAAALLSAAHELFPIQYPCFRKAIINCSYVKKEENEEEK  237

Query  376   ILNCLSVMRETVTRGIESSIDAISDCSLTPRSVL---------HRESGMM--PERDGGMK  230
             ++ CL  + E V  G E  +D + + S T  +VL            S M    ++DGG K
Sbjct  238   LVRCLKAVEEIVINGHERGMDEMEERSETAGNVLDHHFSSSESENTSAMKNRGDKDGGKK  297

Query  229   RRRLNNFCDDQ  197
             R+    +C++Q
Sbjct  298   RKV--GYCNNQ  306



>ref|XP_008362282.1| PREDICTED: putative cyclin-D6-1 [Malus domestica]
Length=276

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 155/245 (63%), Gaps = 17/245 (7%)
 Frame = -2

Query  904  YRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS  725
            +R       D  + YLA+NY+DRFLS Q +L+ KPW++++L ISC+SLA+KM   +  L 
Sbjct  32   FRATLCCNSDELLLYLAVNYLDRFLSCQGMLKPKPWLIKLLAISCISLASKMMKSEFSLH  91

Query  724  DIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHR  545
            D+Q D G++FD+Q+I RME +IL  LKWR+RSITPFSF+ FF SL+ LEDP + Q+L  R
Sbjct  92   DVQGDGGIIFDTQTIQRMEVLILGALKWRMRSITPFSFMSFFISLFKLEDPPLLQALKAR  151

Query  544  ASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNC  365
            A+ IIF S  D++L  + PS+IAA+AL   + +L P+QF  FK A+  C YV  + +L C
Sbjct  152  ATQIIFKSQKDVELLVFKPSIIAAAALFSASHELFPMQFSCFKKALXHCSYVNKENMLQC  211

Query  364  LSVMRETVTRGIESSIDAISDCSLTPRSVLHR------ESG---------MMPERDGGMK  230
             S M+  V  G +S ++ +    +TP +VL        ESG         M  ERD  +K
Sbjct  212  YSAMQGIVVDGFDSMLERVCSSVVTPANVLDHTFSSSAESGKTRVTSITTMRMERD--LK  269

Query  229  RRRLN  215
            RR+++
Sbjct  270  RRKIS  274



>ref|XP_004243793.1| PREDICTED: putative cyclin-D6-1 [Solanum lycopersicum]
Length=310

 Score =   211 bits (536),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 172/268 (64%), Gaps = 5/268 (2%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQIS--FSIRREAFSLTYRT  896
             MEF+LENPL  S +D  H D +  LF  E+ HMPS   F   I+  F I     +++   
Sbjct  1     MEFDLENPLPFS-HDETHFDTISPLFNIEAHHMPSKTYFQILINSNFLINIREATISKIL  59

Query  895   QFIYKFDRS-IAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDI  719
             Q    FD   + YLA+NY+DRFLS  ++ + KPW++ ++ +SC+SLA KM+  +  ++DI
Sbjct  60    QISQPFDSHFLPYLAINYLDRFLSFHSLSDAKPWILNLIGVSCVSLAFKMKKTEYSVTDI  119

Query  718   QRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAS  539
             Q+D G +FD ++I RME +IL  LKWR+RSIT F+F++FF S +  +D    Q+L  RA+
Sbjct  120   QQDAGSIFDIETIKRMELLILGSLKWRMRSITAFAFINFFISSFKFKDLPFQQALKARAT  179

Query  538   TIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLS  359
              IIFTS  +IK+ ++ PS I+ASALL  + +L PLQF  +K AI  C YV  D++L+C +
Sbjct  180   EIIFTSQNEIKILQFKPSTISASALLCASHELFPLQFSCYKTAIINCSYVHKDDLLSCCN  239

Query  358   VMRETVTRGIESSIDAISDCSLTPRSVL  275
             V++E   +  ES ++ +S  S TP +VL
Sbjct  240   VIQEITKKEYESILEIVSSTS-TPVNVL  266



>ref|XP_009373810.1| PREDICTED: putative cyclin-D6-1 [Pyrus x bretschneideri]
Length=369

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/255 (45%), Positives = 161/255 (63%), Gaps = 8/255 (3%)
 Frame = -2

Query  1021  HHLDAVPALFAGESDHMPSL----LSFNHQISFSIRREAFSLTYRTQFIYKFDRSIAYLA  854
             H+ DA+P LFA E+DHMPS      S +    ++ R EA S+  + Q+    D  I YLA
Sbjct  60    HNSDAIPDLFASETDHMPSQNFPSSSKHTGFYYTFRLEAISMFLQFQYSCNLDPFIPYLA  119

Query  853   MNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRDEGLMFDSQSIHR  674
             +NY+DRF+S++ + + KPWV R++ +SCLSLAAKM+      SD QR EG +FD Q++ +
Sbjct  120   INYLDRFISKRDIPQGKPWVSRLVKVSCLSLAAKMKNTPFSSSDFQRGEGFVFDVQTVRK  179

Query  673   MEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEY  494
             ME +IL+ L WR+RSITPFSFLHFF S   L D    Q+L +RAS IIF +H +IK   +
Sbjct  180   MELLILNTLDWRMRSITPFSFLHFFLSSLDLNDRPFTQALKNRASDIIFNAHAEIKFVGF  239

Query  493   NPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVTRGIESSID  314
              PS+IAASA+L    +L+PL+F   K ++   + V  + +L C + M+E V       +D
Sbjct  240   KPSIIAASAVLSACHELLPLKFPFLKVSLSSFQNVNKESLLKCFNFMQEMVK---SERLD  296

Query  313   AISDCSLTPRSVLHR  269
              +S C+ TP SVL R
Sbjct  297   TMS-CTRTPVSVLER  310



>ref|XP_010924029.1| PREDICTED: cyclin-D6-1-like isoform X1 [Elaeis guineensis]
Length=302

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 135/296 (46%), Positives = 188/296 (64%), Gaps = 12/296 (4%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHL-DAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQ  893
             MEF+LENPLT S  + H   D + ALFA ESDHM S L+  H +  S RR+A S+  + Q
Sbjct  1     MEFDLENPLTLSNEEQHPFSDPIEALFAVESDHM-SPLAGGH-LDLSARRDAVSVILQAQ  58

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
             F    D  +AYLA+NY+DRFLS++ +   KPW+VR+L ISCLSLA+KM+  DL L+D QR
Sbjct  59    FGCNLDPFVAYLAVNYLDRFLSKREIPSGKPWIVRLLSISCLSLASKMKKTDLNLADFQR  118

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTI  533
             +EG +FDSQ+I RME ++L  L WR+RSITPFSFL FF S +         +L  RAS  
Sbjct  119   EEGFIFDSQTIQRMELIVLGALDWRMRSITPFSFLRFFLSFFSPAQAPFLHALKARASQT  178

Query  532   IFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM  353
             +F +  +IK+ E+ PSVIAA+ALL  A +L+P+QF SF++AI  CE+V  +++  C + +
Sbjct  179   LFKAQNEIKMLEFKPSVIAAAALLSAAHELLPIQFASFRSAISSCEFVNKEKLWECCNAI  238

Query  352   RETVTRGIESSIDAISDCSLTPRSVLHRE-SGMMPERDGG-------MKRRRLNNF  209
              +    G   + + +S  S TP +VL R  S    ER  G       +K+RR++  
Sbjct  239   GDVAMDGCNLTFEMVSS-SNTPVTVLGRHCSRSESERTVGSSSVECDLKKRRISKL  293



>ref|XP_007212474.1| hypothetical protein PRUPE_ppa015093mg [Prunus persica]
 gb|EMJ13673.1| hypothetical protein PRUPE_ppa015093mg [Prunus persica]
Length=350

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 188/302 (62%), Gaps = 19/302 (6%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSF----NHQISFSIRREAFSLTYR  899
             EF L+ P + +    H+LD +P LFA ESDHMPS  S     +    ++ R EA SL  +
Sbjct  3     EFGLQEPHSLASFQEHNLDTIPDLFASESDHMPSHNSLSCSKDSDFYYAFRLEAISLFLQ  62

Query  898   TQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDI  719
              Q+    D  I YLA+NY+DRFLS++ + E KPWV R+L +SCLSLAAKM+      +D 
Sbjct  63    AQYSCNLDPFIPYLAINYLDRFLSKRDIPEGKPWVSRLLEVSCLSLAAKMKNTPFSATDF  122

Query  718   QRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAS  539
             QR EG +FD+Q+IH+ME +IL  L WR+RSITPFSFL FF S   L D ++ ++L  RAS
Sbjct  123   QRGEGFIFDAQTIHKMELLILDTLDWRMRSITPFSFLSFFLSFLDLNDQTLTKALKSRAS  182

Query  538   TIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLS  359
              +IF +H +IK+ E+ PS+IAASA L   ++L+PLQF SFK +I   +YV  + +  CL+
Sbjct  183   DVIFNAHNEIKIVEFKPSIIAASAALSACQELLPLQFPSFKASISSFQYVNKESLFKCLT  242

Query  358   VMRE-TVTRGIESSIDAISDCSLTPRSVLHRE-------------SGMMPERDGGMKRRR  221
             +++E  V  G ES ++ +S  + T  SV+ R+             S ++ E+    KRRR
Sbjct  243   LVQEMMVNEGYESMLETLSCTTRTAMSVVDRQLTKSDQSQNTYTSSTIIAEKRDS-KRRR  301

Query  220   LN  215
             LN
Sbjct  302   LN  303



>ref|XP_004485690.1| PREDICTED: putative cyclin-D6-1-like isoform X1 [Cicer arietinum]
Length=256

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/241 (45%), Positives = 158/241 (66%), Gaps = 12/241 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             MEF+LE+PL ++F +  +   +  LFA E++HMPS   FN     S   EA SL ++ Q 
Sbjct  1     MEFDLEDPL-ANFKEQQNY-TISELFASETNHMPSPNCFN-----STHCEAISLIFQVQL  53

Query  889   IYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRD  710
                 +  +AYLA+NY +RF+SRQ + + KPW++R++V SCLSLA+KM    L  S++QR 
Sbjct  54    SCNLEPFVAYLAINYFNRFMSRQEIPQGKPWLIRLIVTSCLSLASKMNSTHLSFSNLQR-  112

Query  709   EGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTII  530
             EG  FD +SI +ME +IL  L WR+RSITPF FLHFF SL  ++D    QSL  RAS II
Sbjct  113   EGCKFDGESIQKMELVILGALDWRMRSITPFPFLHFFISLAEIKD----QSLKERASEII  168

Query  529   FTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMR  350
             F +H +IKL EY PS +AA++L+Y + +L P Q+   ++ I  C+++  + +  C+ +M+
Sbjct  169   FNAHNEIKLLEYKPSTVAAASLIYASYELFPQQYSIMRDTITACKHIDQETLEKCVDLMQ  228

Query  349   E  347
             E
Sbjct  229   E  229



>ref|XP_003547127.1| PREDICTED: putative cyclin-D6-1-like [Glycine max]
 gb|KHN33637.1| Putative cyclin-D6-1 [Glycine soja]
Length=272

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 120/272 (44%), Positives = 167/272 (61%), Gaps = 8/272 (3%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS--LLSFNHQISFSIRREAFSLTYRT  896
             MEF+LE+PL S   +      +  LFA ES+H+PS   L+  H   F    EA SL  + 
Sbjct  1     MEFDLEDPLVSL--EEEQTFTISELFASESEHVPSPNCLTSTHFRVFCC--EAISLILQV  56

Query  895   QFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQ  716
             Q   K D  +AYLA+NY+ RF+S Q + + KPW +R++VISCLSLA+KM+   L    IQ
Sbjct  57    QVSCKLDPFVAYLAINYLHRFMSSQEIPQGKPWFLRLVVISCLSLASKMKNTTLSFLVIQ  116

Query  715   RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAST  536
             + EG  F +QSI RME +IL  LKWR+RSITPFSFLHFF SL  ++D S+ Q+L  RAS 
Sbjct  117   K-EGCYFKAQSIQRMELLILGALKWRMRSITPFSFLHFFISLAEIKDQSLKQALKSRASE  175

Query  535   IIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSV  356
             IIF +  DIKL EY PS +AA+AL++ + +L P Q+   + +I   EY+  + +  C  +
Sbjct  176   IIFNAQNDIKLLEYKPSTVAATALIFASHELFPQQYSILRASITASEYLDGETLSKCFDL  235

Query  355   MRETV-TRGIESSIDAISDCSLTPRSVLHRES  263
             M++ +     E  ID     + TP S+L R +
Sbjct  236   MQDMMRMEAKELMIDTSFLSTETPVSMLERNT  267



>ref|XP_006447413.1| hypothetical protein CICLE_v10017833mg [Citrus clementina]
 gb|ESR60653.1| hypothetical protein CICLE_v10017833mg [Citrus clementina]
Length=322

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 146/208 (70%), Gaps = 2/208 (1%)
 Frame = -2

Query  895  QFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQ  716
            QF  KFD  ++YLA++Y+DR+LS Q + + KPW +R+L +SC SLAAKMR I+   +  Q
Sbjct  53   QFSCKFDPFLSYLAVSYMDRYLSSQEMPQPKPWKLRLLAVSCFSLAAKMRQIEFSYTQFQ  112

Query  715  RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAST  536
             D GL+FD+Q+I RME +IL  LKWR+RSITPF+FL FF SL+ L+D ++ ++L  RAS 
Sbjct  113  ADGGLIFDTQTIQRMECLILGALKWRMRSITPFTFLSFFISLFKLKDLTVQRALKTRASE  172

Query  535  IIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSV  356
            +IF +  DIKL E+ PS+IAASALL+ + +L PLQF  F+ AI  C YV  + +L C + 
Sbjct  173  VIFQAQIDIKLIEFKPSIIAASALLFASRELFPLQFHCFRKAISNCPYVNKENLLRCYNA  232

Query  355  MRET-VTRGIESSIDAISDCSLTPRSVL  275
            M++T +    ES ID +S  S TP +VL
Sbjct  233  MQDTSMDDEYESEIDLVSS-SYTPVNVL  259



>ref|XP_004140053.1| PREDICTED: putative cyclin-D6-1-like [Cucumis sativus]
Length=316

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 131/309 (42%), Positives = 183/309 (59%), Gaps = 21/309 (7%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHM--PSLLS--FNHQISFSIRREAFSLTY  902
             M+F+LENPLT   +  H  DA  +LF  ESDHM  PS L         F++RR+      
Sbjct  1     MDFDLENPLTH-LHQLHSDDA--SLFLTESDHMLSPSYLHTLLTSPSDFAVRRDTIYFIS  57

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             +       D  ++YLA+NY+DRF S Q + + KPWV+R+L +SC+SLAAKM+ I+  LSD
Sbjct  58    QCCSNSNIDPHLSYLAVNYLDRFFSFQGMPQPKPWVLRLLAVSCVSLAAKMKQIEHNLSD  117

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              Q  EG +FD Q++HRME +IL  LKWR+RSITPFSF+ FF+SL+ L DP + Q+L  RA
Sbjct  118   FQGSEGFIFDPQTVHRMEVLILGALKWRMRSITPFSFIPFFSSLFKLRDPPLLQALKGRA  177

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYV-----KSDE  377
             + IIF +   I+L E+  SVIAA+ALL  A +L P+Q+  F+ AI  C YV     + ++
Sbjct  178   TEIIFIAQNGIELLEFKASVIAAAALLSAAHELFPIQYPCFRKAIINCSYVKKEEEEEEK  237

Query  376   ILNCLSVMRETVTRGIESSIDAISDCSLTPRSVL-HRESGMMPERDGGMKRR--------  224
             ++ CL  + E V  G E  +D + + S T  +VL H  S    E     K R        
Sbjct  238   LVRCLKAVEEIVINGHERRMDEMEERSETAGNVLDHHFSSSESENTSATKNRGDKDEGKM  297

Query  223   RLNNFCDDQ  197
             R   +C++Q
Sbjct  298   RKVGYCNNQ  306



>ref|XP_009775328.1| PREDICTED: putative cyclin-D6-1 [Nicotiana sylvestris]
Length=326

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 121/270 (45%), Positives = 181/270 (67%), Gaps = 11/270 (4%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFS-----IRREAFSLT  905
             MEF+LENPL  S + +   D +  LF  E+DHMPS  +++ ++  S     IR+   S+ 
Sbjct  1     MEFDLENPLPLSHDSN--ADIISPLFNIETDHMPSK-TYHQKLEHSDFHSSIRQATISII  57

Query  904   YRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS  725
             +  Q  + FD  ++YLA+NY+DRFLS  ++ E KPW++R++ +SC+SLA KMR  +   +
Sbjct  58    F--QMSHPFDPFLSYLAINYLDRFLSFHSLSEGKPWMLRLIAVSCVSLALKMRKTEYSAT  115

Query  724   DIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHR  545
             DIQ+D G++FD ++I RME +ILS LKWR+RSIT FSF++FF S +  +D  + Q+L  R
Sbjct  116   DIQQDGGMIFDIETIKRMEFLILSGLKWRMRSITAFSFINFFISFFKFKDLPLQQALKAR  175

Query  544   ASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNC  365
             A+ IIF +  DIK+ ++ PS+I+ASALL  + +L PLQF  +K AI  C +V  D++L+C
Sbjct  176   ATEIIFRAQNDIKILQFKPSLISASALLCASHELFPLQFPCYKAAILNCSHVHKDDLLSC  235

Query  364   LSVMRETVTRGIESSIDAISDCSLTPRSVL  275
              +VM+E    G ES +D +S  S TP +VL
Sbjct  236   YNVMQEIAKEGYESVLDIVSSTS-TPVNVL  264



>ref|XP_003526300.1| PREDICTED: putative cyclin-D6-1-like isoform X1 [Glycine max]
Length=329

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 171/278 (62%), Gaps = 24/278 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-------QISFSIRREAFS  911
             MEF+LENP      ++ H DAV  LF  ESDH PS    NH        +  S+RRE  S
Sbjct  1     MEFDLENPF-----ENLHSDAVSYLFLIESDHTPSQ---NHSQTLKARDLDISVRRELIS  52

Query  910   LTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLC  731
             L   +Q     D  ++YLA+NY+DRFL+ Q +L+ KPWV+R++ +SC+SLA KM   +  
Sbjct  53    LI--SQLSCALDPVLSYLAINYLDRFLANQGILQPKPWVLRLIAVSCISLAVKMMRTEYP  110

Query  730   LSDIQ-----RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI  566
              +D+Q      D G++F++Q+I RME +IL  L+WR+RSITPFSF+ FF +L  L+D  +
Sbjct  111   FTDVQALLNQSDGGIIFETQTIQRMEALILGALQWRMRSITPFSFVAFFIALMGLKDLPM  170

Query  565   AQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVK  386
              Q L +RAS IIF S  +I+L+ + PS+IAASALL  + +L P Q+ SF  AI    YV 
Sbjct  171   GQVLKNRASEIIFKSQREIRLWGFKPSIIAASALLCASHELFPFQYPSFLKAISDSSYVN  230

Query  385   SDEILNCLSVMRE-TVTRGIESSIDAISDCSLTPRSVL  275
              + +  C  V+++  +     S+++ +S  S TP +VL
Sbjct  231   KESVEQCYKVIQDIAIEEEYSSALNGVS-SSDTPINVL  267



>ref|XP_008224919.1| PREDICTED: putative cyclin-D6-1 [Prunus mume]
Length=366

 Score =   208 bits (529),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 132/302 (44%), Positives = 185/302 (61%), Gaps = 17/302 (6%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSF----NHQISFSIRREAFSLTYR  899
             EF L+ P + +    ++ D +P LFA ESDHMPS  S     +    F+ R EA SL  +
Sbjct  48    EFGLQEPHSLASFQEYNPDTIPDLFASESDHMPSHNSLSCSKDSDFYFAFRLEAISLFLQ  107

Query  898   TQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDI  719
              Q+    D  I YLA+NY+DRFLS++ + E KPWV R+L +SCLSLAAKM+      +D 
Sbjct  108   AQYSCNLDPFIPYLAINYLDRFLSKRDIPEGKPWVSRLLEVSCLSLAAKMKNTPFSATDF  167

Query  718   QRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAS  539
             QR EG +FD+Q+IH+ME +IL  L WR+RSITPFSFL FF S   L D ++A++L  RAS
Sbjct  168   QRGEGFIFDAQTIHKMELLILDTLDWRMRSITPFSFLPFFLSFLDLNDQTLAKALKSRAS  227

Query  538   TIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLS  359
              +IF +H +IK+ E+ PS+IAASA L   ++L+PLQF SFK ++   +YV  + +  CL+
Sbjct  228   DVIFNAHNEIKIVEFKPSIIAASAALSACQELLPLQFPSFKASVSSFQYVNKESLFKCLT  287

Query  358   VMRE-TVTRGIESSIDAISDCSLTPRSVLHRESGMMPERDG------------GMKRRRL  218
             +++E  V  G ES +D +S  + T  SV+ R+     +R                KRRRL
Sbjct  288   LVQEMMVNEGCESMLDTLSCTTRTTMSVVDRQLTKSDQRQNTHTSSTIIAEKRDSKRRRL  347

Query  217   NN  212
             N 
Sbjct  348   NG  349



>gb|KHG11621.1| Putative cyclin-D6-1 -like protein [Gossypium arboreum]
Length=310

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 122/269 (45%), Positives = 169/269 (63%), Gaps = 12/269 (4%)
 Frame = -2

Query  1072  LMEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQ  893
             LM+FNLENPLT       + + +P+LF  ESDHMP+L + +       R EA  L   +Q
Sbjct  7     LMKFNLENPLT-------NFNTIPSLFLLESDHMPTLKATD---DVCFREEAICLI--SQ  54

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
             F  KF   I+YLA+NY+DRFLS Q + +NK WV+R++ ISC+SLAAKM   D  L+D Q 
Sbjct  55    FSCKFHPFISYLAVNYLDRFLSSQPMPQNKKWVLRLIAISCVSLAAKMNRTDFSLADFQG  114

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTI  533
             D G MFD+++I RME +IL  LKWR+RSITPFSF+ FF     L+DP++ Q++  RA  I
Sbjct  115   DGGFMFDARTIERMEYLILGALKWRMRSITPFSFISFFIPFLKLKDPALRQAIKARAVEI  174

Query  532   IFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM  353
             IF +    KL E+ PS+IAASALL+ + +L PLQF  +  AI  C YV  + +L C   M
Sbjct  175   IFKAQTVTKLLEFKPSIIAASALLFASHELFPLQFPCYHKAISSCLYVHKENLLKCYKWM  234

Query  352   RETVTRGIESSIDAISDCSLTPRSVLHRE  266
             ++      E S+  ++    T  +VL ++
Sbjct  235   QKIGKEREEGSMMDMASSWDTAVNVLDQQ  263



>ref|XP_004485691.1| PREDICTED: putative cyclin-D6-1-like isoform X2 [Cicer arietinum]
Length=255

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/241 (45%), Positives = 157/241 (65%), Gaps = 13/241 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             MEF+LE+PL ++F +  +   +  LFA E++HMPS   FN     S   EA SL ++ Q 
Sbjct  1     MEFDLEDPL-ANFKEQQNY-TISELFASETNHMPSPNCFN-----STHCEAISLIFQVQL  53

Query  889   IYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRD  710
                 +  +AYLA+NY +RF+SRQ +   KPW++R++V SCLSLA+KM    L  S++QR 
Sbjct  54    SCNLEPFVAYLAINYFNRFMSRQEI-PGKPWLIRLIVTSCLSLASKMNSTHLSFSNLQR-  111

Query  709   EGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTII  530
             EG  FD +SI +ME +IL  L WR+RSITPF FLHFF SL  ++D    QSL  RAS II
Sbjct  112   EGCKFDGESIQKMELVILGALDWRMRSITPFPFLHFFISLAEIKD----QSLKERASEII  167

Query  529   FTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMR  350
             F +H +IKL EY PS +AA++L+Y + +L P Q+   ++ I  C+++  + +  C+ +M+
Sbjct  168   FNAHNEIKLLEYKPSTVAAASLIYASYELFPQQYSIMRDTITACKHIDQETLEKCVDLMQ  227

Query  349   E  347
             E
Sbjct  228   E  228



>gb|KHN41174.1| Putative cyclin-D6-1 [Glycine soja]
Length=329

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 170/278 (61%), Gaps = 24/278 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-------QISFSIRREAFS  911
             MEF+LENP      ++ H DAV  LF  ESDH PS    NH        +  S+RRE  S
Sbjct  1     MEFDLENPF-----ENLHSDAVSYLFLIESDHTPSQ---NHSQTLKARDLDISVRRELIS  52

Query  910   LTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLC  731
             L   +Q     D  ++YLA+NY+DRFL+ Q +L+ KPW +R++ +SC+SLA KM   +  
Sbjct  53    LI--SQLSCALDPVLSYLAINYLDRFLANQGILQPKPWALRLIAVSCISLAVKMMRTEYP  110

Query  730   LSDIQ-----RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI  566
              +D+Q      D G++F++Q+I RME +IL  L+WR+RSITPFSF+ FF +L  L+D  +
Sbjct  111   FTDVQALLNQSDGGIIFETQTIQRMEALILGALQWRMRSITPFSFVAFFIALVGLKDLPM  170

Query  565   AQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVK  386
              Q L +RAS IIF S  +I+L+ + PS+IAASALL  + +L P Q+ SF  AI    YV 
Sbjct  171   GQVLKNRASEIIFKSQREIRLWGFKPSIIAASALLCASHELFPFQYPSFLKAISDSSYVN  230

Query  385   SDEILNCLSVMRE-TVTRGIESSIDAISDCSLTPRSVL  275
              + +  C  V+++  +     S+++ +S  S TP +VL
Sbjct  231   KESVEQCYKVIQDIAIEEEYSSALNGVS-SSDTPINVL  267



>ref|XP_010924030.1| PREDICTED: cyclin-D6-1-like isoform X2 [Elaeis guineensis]
Length=299

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 135/296 (46%), Positives = 186/296 (63%), Gaps = 15/296 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHL-DAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQ  893
             MEF+LENPLT S  + H   D + ALFA ESDHM S L+  H +  S RR+A S+  + Q
Sbjct  1     MEFDLENPLTLSNEEQHPFSDPIEALFAVESDHM-SPLAGGH-LDLSARRDAVSVILQAQ  58

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
             F    D  +AYLA+NY+DRFLS++ +   KPW+VR+L ISCLSLA+KM+  DL L+D QR
Sbjct  59    FGCNLDPFVAYLAVNYLDRFLSKREIPSGKPWIVRLLSISCLSLASKMKKTDLNLADFQR  118

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTI  533
             +EG +FDSQ+I RME ++L  L WR+RSITPFSFL FF S +         +L  RAS  
Sbjct  119   EEGFIFDSQTIQRMELIVLGALDWRMRSITPFSFLRFFLSFFSPAQAPFLHALKARASQT  178

Query  532   IFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM  353
             +F +  +IK+ E+ PSVIAA+ALL  A +L+P+QF SF++AI  CE+ K   +  C + +
Sbjct  179   LFKAQNEIKMLEFKPSVIAAAALLSAAHELLPIQFASFRSAISSCEFEK---LWECCNAI  235

Query  352   RETVTRGIESSIDAISDCSLTPRSVLHRE-SGMMPERDGG-------MKRRRLNNF  209
              +    G   + + +S  S TP +VL R  S    ER  G       +K+RR++  
Sbjct  236   GDVAMDGCNLTFEMVSS-SNTPVTVLGRHCSRSESERTVGSSSVECDLKKRRISKL  290



>ref|XP_008800348.1| PREDICTED: cyclin-D6-1-like [Phoenix dactylifera]
Length=302

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 186/296 (63%), Gaps = 12/296 (4%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHL-DAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQ  893
             MEF+LENPL  S  +     D++ ALFA ESDHM S L+  H +  S RR+A SL  + Q
Sbjct  1     MEFDLENPLMISDEEQDCFSDSIAALFAVESDHM-SPLAGGH-LDLSARRDAVSLILQAQ  58

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
             F    D  +AYLA+NY+DRFLS++ +   KPW+VR+L ISCLSLA+KM   D  ++D QR
Sbjct  59    FGCNLDPFVAYLAVNYVDRFLSKREIPSEKPWIVRLLSISCLSLASKMTKTDFNVTDFQR  118

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTI  533
             +EG +FDSQ+I RME +IL  L WR+RSITPF+FL FF S +      +  +L  R S  
Sbjct  119   EEGFIFDSQTIRRMELIILGALDWRMRSITPFAFLRFFLSFFSPAQAPLLHALKARTSQT  178

Query  532   IFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM  353
             +F +  +IK+ E+ PSVIAA+ALL  A +L+P+QF SF++AI  CE V  + + +C   +
Sbjct  179   LFKAQTEIKMLEFKPSVIAAAALLSAAHELLPIQFASFRSAISSCESVNKERLWDCCDAI  238

Query  352   RETVTRGIESSIDAISDCSLTPRSVLHRE-SGMMPERDGG-------MKRRRLNNF  209
              +    G +S+ + +S+ S TP +VL R  S    +R  G       +K+RR++  
Sbjct  239   GDAAMDGCDSTFEMVSN-SNTPMTVLGRHCSSSESDRTVGSSSNERDLKKRRISEL  293



>gb|KEH36489.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=306

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 115/270 (43%), Positives = 166/270 (61%), Gaps = 13/270 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             M+F+L+NPL +SF +  +   +  LFA E+DHMPS    N     SI  EA SL  + Q 
Sbjct  44    MDFDLDNPL-ASFKEQQNC-TITELFASETDHMPSPNCLN-----SIHCEAISLILQVQH  96

Query  889   IYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRD  710
                 D  IAYLA+NY+ RF+S+Q   + KPW++R++VISCLSLA+KM+   L  S +Q+ 
Sbjct  97    SCNLDPFIAYLAINYLHRFMSKQEFPQGKPWLIRLIVISCLSLASKMKNTHLPFSKLQK-  155

Query  709   EGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTII  530
             EG  F+ ++I +ME +IL  L WR+RSITPF FL+FF SL  ++D    +SL  RA+ II
Sbjct  156   EGCNFNGETIQKMELVILGALDWRMRSITPFPFLNFFISLAQIKD----RSLKDRAAEII  211

Query  529   FTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMR  350
             F  H DIK  EY PS +AA++L+Y + +L P Q+   +  I   EY+  D +  C+ +M+
Sbjct  212   FNVHNDIKFLEYKPSTVAAASLIYASYELFPQQYYILRATITTSEYIDQDTLAKCIDMMQ  271

Query  349   ETVTRGIESSIDAISDCSL-TPRSVLHRES  263
             +     ++ S+   S  S  TP SVL R +
Sbjct  272   DIWRNEVKGSMKDTSFLSTETPVSVLERST  301



>ref|XP_003597084.1| Cyclin-D5-2 [Medicago truncatula]
 gb|AES67335.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=302

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/277 (40%), Positives = 167/277 (60%), Gaps = 20/277 (7%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             MEF+LENPL   F+D  +   V +LF  ESDH+P L  F +     ++   F  + RT F
Sbjct  1     MEFDLENPL-EYFHDLPNSQDVSSLFLIESDHIPPLNYFQN-----LKSNEFDASVRTDF  54

Query  889   IY-------KFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLC  731
             I         FD  + YLA+NY+DRFL+ Q +L+ KPW  ++L ++C SLA KM   +  
Sbjct  55    ISLISQLSCNFDPFVTYLAINYLDRFLANQGILQPKPWANKLLAVTCFSLAVKMLKTEYS  114

Query  730   LSDIQ-----RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI  566
              +D+Q      D G +F++Q+I RME ++L  L+WR+RSITPFSF+ +FT+L+ L+D ++
Sbjct  115   ATDVQALMNHGDGGFIFETQTIKRMEALVLGALQWRMRSITPFSFIPYFTNLFMLDDITL  174

Query  565   AQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVK  386
              + L  RAS II  S  D+K+ E+ PS++AAS+LLY + +L P Q+  F   I  C YV 
Sbjct  175   -KVLKDRASEIILKSQKDVKVMEFKPSIVAASSLLYSSHELFPFQYPCFLGIISNCSYVN  233

Query  385   SDEILNCLSVMRETVTRGIESSIDAISDCSLTPRSVL  275
              + ++ C +V+++      ES  + +   S TP +VL
Sbjct  234   KESVMECYNVIQDIAKEEYESMFN-VHSSSGTPVNVL  269



>ref|XP_004487348.1| PREDICTED: putative cyclin-D6-1-like [Cicer arietinum]
Length=303

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/274 (40%), Positives = 165/274 (60%), Gaps = 14/274 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSF----NHQISFSIRREAFSLTY  902
             MEF+LENPL +  +   H   V + F  ESDH+P    F    ++    S+R +  SL  
Sbjct  1     MEFDLENPLENFHDLPSH--GVSSFFLIESDHIPPQNYFQILKSNDFDISLRSDIISLI-  57

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
              +     FD  + YLA+NY+DRFL+ Q +L  KPW  ++L ++C SLA KM   +   +D
Sbjct  58    -SHLSCTFDPFVTYLAINYLDRFLANQGILHPKPWANKLLAVTCFSLAVKMLKTEYSATD  116

Query  721   IQ-----RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQS  557
             +Q      D G +F++Q+I RME ++L  L+WR+RSITPFSF+ +FT+L+ L+D S+ + 
Sbjct  117   VQALLNNGDGGFIFETQTIKRMEAVVLGALQWRMRSITPFSFIPYFTNLFNLDDQSLRKV  176

Query  556   LIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDE  377
             L  RAS IIF S  DIK+ E+ PS++AAS+LLY + +L P Q+  F   I  C YV  + 
Sbjct  177   LKDRASEIIFKSQNDIKVLEFKPSIVAASSLLYASHELFPFQYPCFLGTISDCSYVNKES  236

Query  376   ILNCLSVMRETVTRGIESSIDAISDCSLTPRSVL  275
             ++ C +V+++      ES  + ++  S TP +VL
Sbjct  237   VMQCYNVIQDIAKEEYESMFN-VNSSSGTPVNVL  269



>ref|XP_007132615.1| hypothetical protein PHAVU_011G110000g [Phaseolus vulgaris]
 gb|ESW04609.1| hypothetical protein PHAVU_011G110000g [Phaseolus vulgaris]
Length=313

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/308 (40%), Positives = 182/308 (59%), Gaps = 34/308 (11%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSL-LSFNHQ---ISFSIRREAFSLTY  902
             MEF+LENPL     ++ H DAV  LF  ESDH PS   S  H+   +  SIR E  SL  
Sbjct  1     MEFDLENPL-----ENLHSDAVSYLFLIESDHTPSQNHSHTHKPKDLDISIRGELVSLI-  54

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKM---RCIDLC  731
              +Q     D +++YLA NY+DRFL+ Q + + KPW++R++ +SC+SLA KM    C D+ 
Sbjct  55    -SQLSCILDPALSYLATNYLDRFLASQGISQPKPWILRLIAVSCISLAVKMMRTECSDVQ  113

Query  730   LSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLI  551
                 Q D G+MF++Q++ RME +IL  L+WR+RSITPFSF+ FF +L  L+   +   L 
Sbjct  114   ALLNQSDGGIMFETQTVRRMEALILGALQWRMRSITPFSFIPFFIALMGLKGSPMGTVLK  173

Query  550   HRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEIL  371
             +RAS IIF S  +I+L+E+ PS+IAA+ALL  + +L P Q+ SF  AI    YV  + + 
Sbjct  174   NRASEIIFMSQGEIRLWEFKPSIIAATALLCASHELFPFQYPSFLKAIIDSSYVNKESVE  233

Query  370   NCLSVMRE-TVTRGIESSIDAISDCSLTPRSVLHR----------------ESGMMPERD  242
              C  V+++  +    ES+++ +S  S TP +VL                  +S +  ERD
Sbjct  234   QCYKVIQDIAIEEEYESALNGVSR-SDTPINVLDHHFLSSESEKSNGITVADSPLRQERD  292

Query  241   GGMKRRRL  218
               +KRR++
Sbjct  293   --LKRRKI  298



>ref|NP_192236.1| cyclin D6-1 [Arabidopsis thaliana]
 sp|Q9ZR04.1|CCD61_ARATH RecName: Full=Putative cyclin-D6-1; AltName: Full=G1/S-specific 
cyclin-D6-1; Short=CycD6;1 [Arabidopsis thaliana]
 gb|AAD14455.1| putative D-type cyclin [Arabidopsis thaliana]
 emb|CAB77812.1| putative D-type cyclin [Arabidopsis thaliana]
 gb|AEE82300.1| cyclin D6-1 [Arabidopsis thaliana]
Length=302

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/258 (45%), Positives = 165/258 (64%), Gaps = 23/258 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSS-----FNDHHHLDAVP-ALFAGESDHMPSLLSFNHQISFSIRREAFSL  908
             MEF+LE+PL+ S     FND    + +P +LF  E  HMPS   F+     S++  AF L
Sbjct  1     MEFHLEHPLSHSSLHNNFNDDTDYETLPHSLFLVEFQHMPSSHYFH-----SLKSSAFLL  55

Query  907   TYR-------TQFIYKFDR-SIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAK  752
             + R       TQ+  KFD  S+ YLA+NY+DRFLS + + ++KPW+++++ +SC+SL+AK
Sbjct  56    SNRNQAISSITQYSRKFDDPSLTYLAVNYLDRFLSSEDMPQSKPWILKLISLSCVSLSAK  115

Query  751   MRCIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPL--E  578
             MR  D+ +SD+   EG  FD+Q I RME +IL  LKWR+RS+TPFSFL FF SL+ L  E
Sbjct  116   MRKPDMSVSDLPV-EGEFFDAQMIERMENVILGALKWRMRSVTPFSFLAFFISLFELKEE  174

Query  577   DPSI-AQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFR  401
             DP +   SL  + S + F+  +DI   E+ PSVIA +ALL+ + +L PLQF  F N I +
Sbjct  175   DPLLLKHSLKSQTSDLTFSLQHDISFLEFKPSVIAGAALLFASFELCPLQFPCFSNRINQ  234

Query  400   CEYVKSDEILNCLSVMRE  347
             C YV  DE++ C   ++E
Sbjct  235   CTYVNKDELMECYKAIQE  252



>ref|XP_006582337.1| PREDICTED: putative cyclin-D6-1-like isoform X2 [Glycine max]
Length=326

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 170/278 (61%), Gaps = 27/278 (10%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-------QISFSIRREAFS  911
             MEF+LENP      ++ H DAV  LF  ESDH PS    NH        +  S+RRE  S
Sbjct  1     MEFDLENPF-----ENLHSDAVSYLFLIESDHTPSQ---NHSQTLKARDLDISVRRELIS  52

Query  910   LTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLC  731
             L   +Q     D  ++YLA+NY+DRFL+ Q +L+ KPWV+R++ +SC+SLA KM   +  
Sbjct  53    LI--SQLSCALDPVLSYLAINYLDRFLANQGILQPKPWVLRLIAVSCISLAVKMMRTEYP  110

Query  730   LSDIQ-----RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI  566
              +D+Q      D G++F++Q+I RME +IL  L+WR+RSITPFSF+ FF +L  L+D  +
Sbjct  111   FTDVQALLNQSDGGIIFETQTIQRMEALILGALQWRMRSITPFSFVAFFIALMGLKDLPM  170

Query  565   AQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVK  386
              Q L +RAS IIF S  +I+L+ + PS+IAASALL  + +L P Q+ SF  AI    Y  
Sbjct  171   GQVLKNRASEIIFKSQREIRLWGFKPSIIAASALLCASHELFPFQYPSFLKAISDSSY--  228

Query  385   SDEILNCLSVMRE-TVTRGIESSIDAISDCSLTPRSVL  275
              + +  C  V+++  +     S+++ +S  S TP +VL
Sbjct  229   -ESVEQCYKVIQDIAIEEEYSSALNGVS-SSDTPINVL  264



>gb|KHG23395.1| Putative cyclin-D6-1 -like protein [Gossypium arboreum]
Length=313

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 134/314 (43%), Positives = 184/314 (59%), Gaps = 34/314 (11%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPA-----LFAGESDHMPSLLSFNHQISFSIRREAF---  914
             MEF+LENPLT+S    +HL   P+     LF  ESDHMPS     H    S++  AF   
Sbjct  1     MEFDLENPLTNS----NHLCPPPSPNSTSLFLLESDHMPS-----HHYVQSLKAGAFPTS  51

Query  913   ----SLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLEN-KPWVVRILVISCLSLAAKM  749
                 ++ Y + F  +F   + YLA+NY+DRFLS Q + +  K WVVR++  SC+SLAAKM
Sbjct  52    VRRHAIAYISLFCCRFGPFLPYLAVNYLDRFLSSQGIPQQPKTWVVRLVACSCVSLAAKM  111

Query  748   RCIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPS  569
                +  L D Q D G  FD+Q+I RME +IL  LKWR+RSITPFSF+ FF S + L+DP 
Sbjct  112   TKTEFSLIDFQGDGGFNFDAQTIERMEYLILGALKWRMRSITPFSFISFFISFFNLKDPP  171

Query  568   IAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYV  389
             + Q+L  RA  +I  +  D +L E  PS+IAASALL  + +L PLQF  F+ AI  C YV
Sbjct  172   LRQALKARAVELILKAQKDTRLMELRPSIIAASALLSASHQLFPLQFPCFRKAISSCSYV  231

Query  388   KSDEILNCLSVMRETVTRGIESS-IDAI-SDCSLTPRSVLHRE--------SGMMPERDG  239
               + +L C + M+E    G +S  +D I +  S TP +VL +         +    +RD 
Sbjct  232   NKENMLKCCNWMQEMEKEGEQSEPVDEIMASSSNTPVNVLDQHFSCWESEIAADATKRD-  290

Query  238   GMKRRRLNNFCDDQ  197
              MKR R+N++ D+ 
Sbjct  291   -MKRPRINDYPDNH  303



>ref|XP_006396556.1| hypothetical protein EUTSA_v10028844mg [Eutrema salsugineum]
 gb|ESQ38009.1| hypothetical protein EUTSA_v10028844mg [Eutrema salsugineum]
Length=300

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 165/257 (64%), Gaps = 22/257 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSS-----FNDHHHLDAVP-ALFAGESDHMPSLLSFNHQISFSIRREAFSL  908
             MEF LE+PL+ S     FND     ++P +LF  E  HMPS   FN     S++  AF L
Sbjct  1     MEFLLEHPLSHSSLDNNFNDESDDYSLPLSLFLVEFQHMPSSHYFN-----SLKSSAFLL  55

Query  907   TYRT-------QFIYKFDR-SIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAK  752
             + R        Q+  KFD  S+ YLA+NY+DRFLS + + ++KPW+++++ +SC+SL+AK
Sbjct  56    SNRNHAVSSIVQYSRKFDDPSLTYLAVNYLDRFLSSEDMPQSKPWILKLISLSCVSLSAK  115

Query  751   MRCIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDP  572
             MR  D+ + D+   EG +FD+Q I RME +IL  LKWR+RS+TPFSF  FF SL+ L++ 
Sbjct  116   MRKPDVFVCDLPV-EGEIFDAQMIERMENVILGALKWRMRSVTPFSFFAFFISLFELKED  174

Query  571   SIA--QSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRC  398
             S+A   S+  +A+ + F   +DIK  E+ PSVIA +ALL+V+ +L PLQF  F N I +C
Sbjct  175   SLALKHSIKSQATDLTFNLQHDIKFLEFKPSVIAGAALLFVSSELCPLQFPCFSNRINQC  234

Query  397   EYVKSDEILNCLSVMRE  347
              YV  DE++ C   ++E
Sbjct  235   TYVNKDELMECYKAIKE  251



>ref|XP_008448225.1| PREDICTED: putative cyclin-D6-1 isoform X2 [Cucumis melo]
Length=237

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 153/232 (66%), Gaps = 7/232 (3%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHM--PSLLS--FNHQISFSIRREAFSLTY  902
             M+F+LENPLT   +  H  DA  +LF  ESDHM  PS L    +    F++R++  S   
Sbjct  1     MDFDLENPLTH-LHQLHSDDA--SLFLTESDHMLSPSYLHTLLSSPSDFAVRQDTVSFIS  57

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             +       D  ++YLA+NY+DRF S Q V + KPWV+R+L +SC+SLAAKM+ I+  L D
Sbjct  58    QCCSNSNIDPHLSYLAVNYLDRFFSSQGVPQPKPWVLRLLAVSCVSLAAKMKQIEHNLFD  117

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              Q +EG +FD Q++HRME +IL  LKWR+RSITPFSF+ FF SL+ L DP + Q+L  RA
Sbjct  118   FQGNEGFIFDPQTVHRMEVLILGALKWRMRSITPFSFIPFFISLFKLRDPPLLQALKGRA  177

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVK  386
             + IIF +   I+L E+  SVIAA+ALL  A +L P+Q+  F+ AI  C YVK
Sbjct  178   TEIIFIAQNGIELLEFKASVIAAAALLSAAHELFPIQYPCFRKAIINCSYVK  229



>gb|KGN46679.1| hypothetical protein Csa_6G121960 [Cucumis sativus]
Length=247

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 152/232 (66%), Gaps = 7/232 (3%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHM--PSLLS--FNHQISFSIRREAFSLTY  902
             M+F+LENPLT   +  H  DA  +LF  ESDHM  PS L         F++RR+      
Sbjct  1     MDFDLENPLTH-LHQLHSDDA--SLFLTESDHMLSPSYLHTLLTSPSDFAVRRDTIYFIS  57

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             +       D  ++YLA+NY+DRF S Q + + KPWV+R+L +SC+SLAAKM+ I+  LSD
Sbjct  58    QCCSNSNIDPHLSYLAVNYLDRFFSFQGMPQPKPWVLRLLAVSCVSLAAKMKQIEHNLSD  117

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              Q  EG +FD Q++HRME +IL  LKWR+RSITPFSF+ FF+SL+ L DP + Q+L  RA
Sbjct  118   FQGSEGFIFDPQTVHRMEVLILGALKWRMRSITPFSFIPFFSSLFKLRDPPLLQALKGRA  177

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVK  386
             + IIF +   I+L E+  SVIAA+ALL  A +L P+Q+  F+ AI  C YVK
Sbjct  178   TEIIFIAQNGIELLEFKASVIAAAALLSAAHELFPIQYPCFRKAIINCSYVK  229



>ref|XP_009615739.1| PREDICTED: putative cyclin-D6-1 [Nicotiana tomentosiformis]
Length=326

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 171/271 (63%), Gaps = 13/271 (5%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDA--VPALFAGESDHMPSLLSF----NHQISFSIRREAFSL  908
             MEF+LENPL  S    H  DA  +  LF  E+DHMPS +      N     SIR+   S+
Sbjct  1     MEFDLENPLPLS----HDFDADTISPLFNIETDHMPSKIYHQNVENSDFHISIRQATISI  56

Query  907   TYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCL  728
              +  Q  + FD  ++YLA+NY+DRFLS  ++ E KPW++R++ +SC+SLA KM+  +   
Sbjct  57    IF--QISHHFDPFLSYLAINYLDRFLSFHSLSEGKPWMLRLIAVSCVSLALKMKETEYSA  114

Query  727   SDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIH  548
             +DIQ+  G++FD ++I RME +IL  LKWR+RSIT FSF+ FF S +  +D  + Q+L  
Sbjct  115   TDIQQVGGMIFDIETIKRMEFLILGELKWRMRSITAFSFISFFISFFKFKDLPLQQALKA  174

Query  547   RASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILN  368
             RA+ II  +  DIK+ ++ PS+I+ASALL    +L PLQF  +K AI  C +V  D++L 
Sbjct  175   RATDIILRAQNDIKILQFKPSLISASALLSACHELFPLQFPCYKTAILNCSHVHKDDLLR  234

Query  367   CLSVMRETVTRGIESSIDAISDCSLTPRSVL  275
             C  VM+E    G ES +D +S  S TP +VL
Sbjct  235   CYDVMQEIAKEGYESILDKVSSTS-TPVNVL  264



>ref|XP_003540877.1| PREDICTED: putative cyclin-D6-1-like [Glycine max]
Length=324

 Score =   198 bits (503),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 115/278 (41%), Positives = 168/278 (60%), Gaps = 24/278 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-------QISFSIRREAFS  911
             MEF+LENPL     ++ H D V  LF  ESDH PS    NH        +  S+RRE  S
Sbjct  1     MEFDLENPL-----ENLHSDDVSYLFLIESDHTPSQ---NHSQTLKARDLDISVRRELIS  52

Query  910   LTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLC  731
             L   +Q     D  ++YLA+NY+DRFL+ Q +L+ KPW +R++ +SC+SL  KM   +  
Sbjct  53    LI--SQLSCALDPVLSYLAINYLDRFLTNQGILQPKPWALRLVAVSCISLTVKMMGTEYP  110

Query  730   LSDIQ-----RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI  566
              +DIQ      D G++F++Q+I RME +IL  L+WR+RSITPFSF+ FF +L  L++  +
Sbjct  111   ATDIQALLNQSDGGIIFETQTIQRMEALILGALQWRMRSITPFSFVAFFIALMGLKESPM  170

Query  565   AQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVK  386
              Q L +RAS IIF S  +I+L+ + PS+IAASALL  + +L P Q+  F  AI    YV 
Sbjct  171   GQVLKNRASEIIFKSQREIRLWGFKPSIIAASALLCASHELFPFQYPFFLKAISDSSYVN  230

Query  385   SDEILNCLSVMRE-TVTRGIESSIDAISDCSLTPRSVL  275
              + +  C  V+++  +     S+++ +S  S TP +VL
Sbjct  231   KEIVEQCYKVIQDIAIEEEYSSALNGVSR-SDTPINVL  267



>ref|XP_007025851.1| D6-type cyclin isoform 8 [Theobroma cacao]
 gb|EOY28473.1| D6-type cyclin isoform 8 [Theobroma cacao]
Length=292

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 176/311 (57%), Gaps = 58/311 (19%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSLTY  902
             F+LE+P TS     H  D + ALF+ ESDHMPS      L + +  +SF  R+EA SL  
Sbjct  4     FDLEDPFTSL--KEHQSDTISALFSSESDHMPSQNYLQCLKTSDFYVSF--RQEAISLIL  59

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             +                             +  PWV+R+LVI+C+SLAAKM+ I    S+
Sbjct  60    Q-----------------------------QGNPWVLRLLVIACISLAAKMKEIHFSSSN  90

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              QR+EG +FD+ +I RME +IL  L WR+RS+TPFSF+ FF SL+ L+DP + Q+L  RA
Sbjct  91    FQREEGFIFDAPAIQRMELLILDALNWRMRSVTPFSFICFFMSLFELKDPPLTQALKDRA  150

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
             S IIF +H +I L E+ PS++AASALL  + +L PLQF S + +I  CEYV  + +L C 
Sbjct  151   SNIIFQAHGEINLLEFKPSILAASALLLASHELFPLQFPSVETSILSCEYVNKESLLKCF  210

Query  361   SVMRETVTRGI-ESSIDAISDCSL-TPRSVLH---------------RESGMMPERDGGM  233
             +  ++ V   I ES +D +S  S  TP SVL                  + M  +R+  +
Sbjct  211   NATQDMVVNQISESIVDTVSSSSTRTPLSVLDCHCTKAESESTTSTMGATAMAEKRE--I  268

Query  232   KRRRLNNFCDD  200
             KRR+LN+FC +
Sbjct  269   KRRKLNDFCSE  279



>ref|XP_009348016.1| PREDICTED: putative cyclin-D6-1, partial [Pyrus x bretschneideri]
Length=275

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 147/236 (62%), Gaps = 13/236 (6%)
 Frame = -2

Query  1081  SDLLMEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSL----LSFNHQISFSIRREAF  914
             +D+  EF+L+          H+ D +P LFA E+DHMPS      S +    F+ R +A 
Sbjct  48    ADMDYEFDLQ---------EHNSDTIPDLFASENDHMPSQNFPNSSKHTDFYFTFRLKAI  98

Query  913   SLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL  734
             S   + Q+    D  I YLA+NY+DRF+S+  + + KPWV R++ +SCLSLAAKM+    
Sbjct  99    SRFLQVQYSCNLDPFIPYLAINYLDRFVSKCDIPQGKPWVSRLVEVSCLSLAAKMKNTPF  158

Query  733   CLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSL  554
                D QR EG +FD Q++ +ME +IL+ L WR+RSITPFSFLHFF S   L D  + Q+L
Sbjct  159   SCCDFQRGEGFVFDVQTVRKMELLILNTLDWRMRSITPFSFLHFFLSSLDLNDRPLTQAL  218

Query  553   IHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVK  386
              +RAS IIF +H +IK  E+ PS+IAASA+L    +L+P +F  FK ++   +YV 
Sbjct  219   RNRASDIIFNAHNEIKFVEFKPSIIAASAVLSACHELLPPKFPPFKASLSSFQYVN  274



>ref|XP_004172660.1| PREDICTED: putative cyclin-D6-1-like [Cucumis sativus]
Length=230

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 151/232 (65%), Gaps = 7/232 (3%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHM--PSLLS--FNHQISFSIRREAFSLTY  902
             M+F+LENPLT   +  H  DA  +LF  ESDHM  PS L         F++RR+      
Sbjct  1     MDFDLENPLTH-LHQLHSDDA--SLFLTESDHMLSPSYLHTLLTSPSDFAVRRDTIYFIS  57

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             +       D  ++YLA+NY+DRF S Q + + KPWV+R+L +SC+SLAAKM+ I+  L D
Sbjct  58    QCCSNSNIDPHLSYLAVNYLDRFFSFQGMPQPKPWVLRLLAVSCVSLAAKMKQIEHNLFD  117

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              Q  EG +FD Q++HRME +IL  LKWR+RSITPFSF+ FF+SL+ L DP + Q+L  RA
Sbjct  118   FQGSEGFIFDPQTVHRMEVLILGALKWRMRSITPFSFIPFFSSLFKLRDPPLLQALKGRA  177

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVK  386
             + IIF +   I+L E+  SVIAA+ALL  A +L P+Q+  F+ AI  C YVK
Sbjct  178   TEIIFIAQNGIELLEFKASVIAAAALLSAAHELFPIQYPCFRKAIINCSYVK  229



>gb|KEH39029.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=299

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/277 (39%), Positives = 166/277 (60%), Gaps = 23/277 (8%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             MEF+LENPL   F+D  +   V +LF  ESDH+P L  F +     ++   F  + RT F
Sbjct  1     MEFDLENPL-EYFHDLPNSQDVSSLFLIESDHIPPLNYFQN-----LKSNEFDASVRTDF  54

Query  889   IY-------KFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLC  731
             I         FD  + YLA+NY+DRFL+ Q +L+ KPW  ++L ++C SLA KM   +  
Sbjct  55    ISLISQLSCNFDPFVTYLAINYLDRFLANQGILQPKPWANKLLAVTCFSLAVKMLKTEYS  114

Query  730   LSDIQ-----RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI  566
              +D+Q      D G +F++Q+I RME ++L  L+WR+RSITPFSF+ +FT+L+ L+D ++
Sbjct  115   ATDVQALMNHGDGGFIFETQTIKRMEALVLGALQWRMRSITPFSFIPYFTNLFMLDDITL  174

Query  565   AQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVK  386
              + L  RAS II  S  D+K+ E+ PS++AAS+LLY + +L P Q+  F   I  C Y  
Sbjct  175   -KVLKDRASEIILKSQKDVKVMEFKPSIVAASSLLYSSHELFPFQYPCFLGIISNCSY--  231

Query  385   SDEILNCLSVMRETVTRGIESSIDAISDCSLTPRSVL  275
              + ++ C +V+++      ES  + +   S TP +VL
Sbjct  232   -ESVMECYNVIQDIAKEEYESMFN-VHSSSGTPVNVL  266



>ref|XP_006377297.1| hypothetical protein POPTR_0011s04060g [Populus trichocarpa]
 gb|ERP55094.1| hypothetical protein POPTR_0011s04060g [Populus trichocarpa]
Length=232

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 137/194 (71%), Gaps = 3/194 (2%)
 Frame = -2

Query  844  IDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRDE-GLMFDSQSIHRME  668
            +DRF+SRQ + + KPW++R+LVISCLSLAAKM+     +S+ Q  E G +FD+Q+I+RME
Sbjct  1    MDRFISRQEIPQGKPWILRLLVISCLSLAAKMKNKHFSISNSQEAEAGFIFDTQTINRME  60

Query  667  GMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNP  488
             ++L  L WR+RSITPFSF+HFF SL+ L+DPS +Q L  RA+ IIF +  +IK  E+ P
Sbjct  61   LLVLDALNWRMRSITPFSFVHFFVSLFELKDPSSSQPLKDRATEIIFKAQNEIKFLEFKP  120

Query  487  SVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVT-RGIESSIDA  311
            S+IAASALL  + +  PLQF  FK +I+ CE+V  +++L C + ++E V     ES +D 
Sbjct  121  SIIAASALLVASNERFPLQFPCFKCSIYSCEFVNEEKLLECFNALQEMVEMEWYESMLDT  180

Query  310  ISDCSLTPRSVLHR  269
            +S  + TP SVL R
Sbjct  181  MS-WTRTPLSVLDR  193



>ref|XP_007132616.1| hypothetical protein PHAVU_011G110000g [Phaseolus vulgaris]
 gb|ESW04610.1| hypothetical protein PHAVU_011G110000g [Phaseolus vulgaris]
Length=310

 Score =   195 bits (495),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 123/308 (40%), Positives = 181/308 (59%), Gaps = 37/308 (12%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSL-LSFNHQ---ISFSIRREAFSLTY  902
             MEF+LENPL     ++ H DAV  LF  ESDH PS   S  H+   +  SIR E  SL  
Sbjct  1     MEFDLENPL-----ENLHSDAVSYLFLIESDHTPSQNHSHTHKPKDLDISIRGELVSLI-  54

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKM---RCIDLC  731
              +Q     D +++YLA NY+DRFL+ Q + + KPW++R++ +SC+SLA KM    C D+ 
Sbjct  55    -SQLSCILDPALSYLATNYLDRFLASQGISQPKPWILRLIAVSCISLAVKMMRTECSDVQ  113

Query  730   LSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLI  551
                 Q D G+MF++Q++ RME +IL  L+WR+RSITPFSF+ FF +L  L+   +   L 
Sbjct  114   ALLNQSDGGIMFETQTVRRMEALILGALQWRMRSITPFSFIPFFIALMGLKGSPMGTVLK  173

Query  550   HRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEIL  371
             +RAS IIF S  +I+L+E+ PS+IAA+ALL  + +L P Q+ SF  AI    Y   + + 
Sbjct  174   NRASEIIFMSQGEIRLWEFKPSIIAATALLCASHELFPFQYPSFLKAIIDSSY---ESVE  230

Query  370   NCLSVMRE-TVTRGIESSIDAISDCSLTPRSVLHR----------------ESGMMPERD  242
              C  V+++  +    ES+++ +S  S TP +VL                  +S +  ERD
Sbjct  231   QCYKVIQDIAIEEEYESALNGVSR-SDTPINVLDHHFLSSESEKSNGITVADSPLRQERD  289

Query  241   GGMKRRRL  218
               +KRR++
Sbjct  290   --LKRRKI  295



>ref|XP_009418753.1| PREDICTED: cyclin-D6-1-like [Musa acuminata subsp. malaccensis]
Length=300

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 168/268 (63%), Gaps = 4/268 (1%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHH-HLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQ  893
             MEF+LEN ++SS ++      ++ ALFA E+DH   ++S    I  S RR A SL  + Q
Sbjct  1     MEFDLENQMSSSDDEQQPRRGSISALFAAEADH---IISTVGAIDPSARRNAVSLVLQAQ  57

Query  892   FIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQR  713
             F    D  +A LA+NYIDR+LS++ +   KPW+VR+L ISCLSLA+KM+     L+D  R
Sbjct  58    FNCNLDPFVACLAINYIDRYLSKREIPIEKPWIVRLLSISCLSLASKMKKTCKPLADFLR  117

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTI  533
             +E  +FD+Q+I RME ++L  L WR+RSITPFSFL FFTS +    P + Q+L   A+ I
Sbjct  118   EEYFVFDAQTIRRMELLVLEALDWRMRSITPFSFLRFFTSFFSPAQPPLLQALQAHATEI  177

Query  532   IFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM  353
             +  +  ++K+ E+ PSV+AASALL  A +  P+QF +F++A+  CE+V  +E+  C S M
Sbjct  178   LLKTQNEMKVLEFKPSVVAASALLSAAFEFFPVQFPAFRSALASCEFVNEEELRECSSAM  237

Query  352   RETVTRGIESSIDAISDCSLTPRSVLHR  269
                      S+  A+   S TP +VL R
Sbjct  238   GIATDGCGGSAATALVSSSNTPPTVLGR  265



>gb|KHN22882.1| Putative cyclin-D6-1 [Glycine soja]
Length=259

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/244 (44%), Positives = 149/244 (61%), Gaps = 22/244 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH-------QISFSIRREAFS  911
             MEF+LENPL     ++ H D V  LF  ESDH PS    NH        +  S+RRE  S
Sbjct  1     MEFDLENPL-----ENLHSDDVSYLFLIESDHTPSQ---NHSQTLKARDLDISVRRELIS  52

Query  910   LTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLC  731
             L   +Q     D  ++YLA+NY+DRFL+ Q +L+ KPW +R++ +SC+SL  KM   +  
Sbjct  53    LI--SQLSCALDPVLSYLAINYLDRFLTNQGILQPKPWALRLVAVSCISLTVKMMGTEYP  110

Query  730   LSDIQ-----RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI  566
              +DIQ      D G++F++Q+I RME +IL  L+WR+RSITPFSF+ FF +L  L++  +
Sbjct  111   ATDIQALLNQSDGGIIFETQTIQRMEALILGALQWRMRSITPFSFVAFFIALMGLKESPM  170

Query  565   AQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVK  386
              Q L +RAS IIF S  +I+L+ + PS+IAASALL  + +L P Q+  F  AI    YV 
Sbjct  171   GQVLKNRASEIIFKSQREIRLWGFKPSIIAASALLCASHELFPFQYPFFLKAISDSSYVN  230

Query  385   SDEI  374
                I
Sbjct  231   KVHI  234



>ref|XP_007025852.1| D6-type cyclin isoform 9 [Theobroma cacao]
 gb|EOY28474.1| D6-type cyclin isoform 9 [Theobroma cacao]
Length=281

 Score =   189 bits (479),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 124/310 (40%), Positives = 173/310 (56%), Gaps = 67/310 (22%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSLTY  902
             F+LE+P TS     H  D + ALF+ ESDHMPS      L + +  +SF  R+EA SL  
Sbjct  4     FDLEDPFTSL--KEHQSDTISALFSSESDHMPSQNYLQCLKTSDFYVSF--RQEAISLIL  59

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             +                             +  PWV+R+LVI+C+SLAAKM+ I    S+
Sbjct  60    Q-----------------------------QGNPWVLRLLVIACISLAAKMKEIHFSSSN  90

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              QR+EG +FD+ +I RME +IL  L WR+RS+TPFSF+ FF SL+ L+DP + Q+L  RA
Sbjct  91    FQREEGFIFDAPAIQRMELLILDALNWRMRSVTPFSFICFFMSLFELKDPPLTQALKDRA  150

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCL  362
             S IIF +H +I L E+ PS++AASALL  + +L PLQF S + +I  CEYV  D ++N +
Sbjct  151   SNIIFQAHGEINLLEFKPSILAASALLLASHELFPLQFPSVETSILSCEYVNKDMVVNQI  210

Query  361   SVMRETVTRGIESSIDAISDCSL-TPRSVLH---------------RESGMMPERDGGMK  230
             S          ES +D +S  S  TP SVL                  + M  +R+  +K
Sbjct  211   S----------ESIVDTVSSSSTRTPLSVLDCHCTKAESESTTSTMGATAMAEKRE--IK  258

Query  229   RRRLNNFCDD  200
             RR+LN+FC +
Sbjct  259   RRKLNDFCSE  268



>ref|XP_006376532.1| hypothetical protein POPTR_0013s14540g, partial [Populus trichocarpa]
 gb|ERP54329.1| hypothetical protein POPTR_0013s14540g, partial [Populus trichocarpa]
Length=212

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/233 (45%), Positives = 141/233 (61%), Gaps = 27/233 (12%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPA-LFAGESDHMPSLLSFN--HQISF--SIRREAFSLT  905
             M+FNLENPL +S +   H D +P+ LF  ESDHMPS    N   ++ F  S RREA S  
Sbjct  1     MDFNLENPLANSHD--FHFDTIPSDLFLIESDHMPSNNYLNTLKEMDFDGSFRREAISSV  58

Query  904   YRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS  725
              R      FD S++YLA+NY+DR LS Q + + KPW+ R+L ++C               
Sbjct  59    LRVS--CNFDPSLSYLAVNYLDRLLSSQGIPQPKPWLFRLLAVAC---------------  101

Query  724   DIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHR  545
                 D G +FD+Q+I +ME +IL  L WR+RSITPFSF+ FF SL+  +DP + Q+L  R
Sbjct  102   ---GDGGFVFDTQTIQKMEVLILGALNWRMRSITPFSFISFFISLFKPKDPPLRQALKAR  158

Query  544   ASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVK  386
             A+   +    DI L E+ PS+IAASALLY + +L P+QFL F+ AI  C +V 
Sbjct  159   ATDCWYIFCADINLLEFKPSLIAASALLYASHELFPMQFLCFRKAISNCSHVN  211



>ref|XP_002872788.1| CYCD6_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49047.1| CYCD6_1 [Arabidopsis lyrata subsp. lyrata]
Length=300

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 114/277 (41%), Positives = 171/277 (62%), Gaps = 26/277 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSS------FNDHHHLDAVP-ALFAGESDHMPSLLSFNHQISFSIRREAFS  911
             MEF+LE+PL+ S       +D    + +P +LF  E  HMPS   F+     S++  AF 
Sbjct  1     MEFHLEHPLSHSSLHNNFNDDTDDDETLPHSLFLVEFQHMPSSHYFH-----SLKSSAFL  55

Query  910   LTYRT-------QFIYKFDR-SIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAA  755
             L+ R        Q+  KFD  S+ YLA+NY+DRFLS + + ++KPW++R++ +SC+SL+A
Sbjct  56    LSNRNHAISSIIQYSRKFDDPSLTYLAVNYLDRFLSSEDMPQSKPWILRLISLSCVSLSA  115

Query  754   KMRCIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPL-E  578
             KMR  ++ +S +   EG  FD+Q I RME +IL  LKWR+RS+TPFSFL FF SL+ L E
Sbjct  116   KMRKPEMSVSHLPV-EGEFFDAQMIERMENVILGALKWRMRSVTPFSFLAFFISLFELKE  174

Query  577   DPSI-AQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFR  401
             DP +   SL  +A  + F   +DI+  E+ PSVIA +ALL+ + +L PL+F  F N I++
Sbjct  175   DPLVLKHSLKSQAIDLTFNLQHDIRFLEFKPSVIAGAALLFASFELCPLKFPCFSNRIYQ  234

Query  400   CEYVKSDEILNCLSVMRETVTRGIESSIDAISDCSLT  290
             C +V  DE++ C   ++E   R I    +A S+ ++ 
Sbjct  235   CTFVNKDELMKCYKAIQE---RDIVGENEASSETAVN  268



>ref|XP_010931897.1| PREDICTED: cyclin-D6-1-like [Elaeis guineensis]
Length=287

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 107/268 (40%), Positives = 154/268 (57%), Gaps = 6/268 (2%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             MEF LENPL  S  D  H D++ +LFA E++    L+S    I  S R +A S+ +   F
Sbjct  1     MEFVLENPLMFSDEDARHPDSISSLFAAENNF---LISHRGAIILSARHDAASVAH--VF  55

Query  889   IYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRD  710
                   S+ YLA+NYIDRFLS + +   KP +  +L I+CLS+AAKM      L+D+Q  
Sbjct  56    SPNLGPSVIYLAINYIDRFLSSREIPLVKPCIASLLSIACLSIAAKMTINGFSLADLQGS  115

Query  709   EGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTII  530
             E   F + +I RME ++LS L WR+RSITPF+FL FF   +PL D ++ Q+L  RAS  +
Sbjct  116   EQPQFTTATIERMEMVVLSALGWRMRSITPFAFLDFFLHSFPLADAALRQALKDRASKTL  175

Query  529   FTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM-  353
             F    + K  E+ PS+IAASALL  A +L P  FLSF++ +   ++V  + +  C   M 
Sbjct  176   FRIQNEGKFLEFKPSMIAASALLTAAFELFPTHFLSFRSTVLSSKFVDKETLSACCDAML  235

Query  352   RETVTRGIESSIDAISDCSLTPRSVLHR  269
                +  G + ++      S +P +VL R
Sbjct  236   PAAMDGGSKQTVKKPGSSSDSPVTVLGR  263



>ref|XP_006833121.1| hypothetical protein AMTR_s00072p00074880 [Amborella trichopoda]
 gb|ERM98399.1| hypothetical protein AMTR_s00072p00074880 [Amborella trichopoda]
Length=326

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 115/321 (36%), Positives = 171/321 (53%), Gaps = 40/321 (12%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH----QISFSIRREAFSLTY  902
             M+ +LE P+          + +  LFA ES+HMP    F       +  S R+E+ SL  
Sbjct  1     MDLDLEFPV---LLPEDQPECISELFASESEHMPLQNYFERYKTRDLRLSTRQESISLIL  57

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             + Q +   D  + YLA++Y+DRF+SRQ + + K W+ +++ +SCLSLAAKM+ +  CLSD
Sbjct  58    KAQSLCNLDPFVPYLAISYLDRFMSRQEMPKGKAWISKLISLSCLSLAAKMKNVAFCLSD  117

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRA  542
              Q +E  MFD+Q+I RME +IL  L WRLRS+TPFSF++FF S   LED    ++L +R 
Sbjct  118   FQSEERFMFDTQTIKRMELLILRILDWRLRSVTPFSFINFFLSSIKLEDRPSIEALKNRT  177

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVA-EKLIPLQFLSFKNAIFRCEYVKSDEILNC  365
               II  +  +I L E+ PS+IAA+ALL  + E L+PL     K AI  CEYV  +++  C
Sbjct  178   VEIIIKTQQEINLLEFKPSIIAAAALLCASQEPLLPL----LKKAISACEYVNKEKLARC  233

Query  364   LSVMRETVTRGIESSIDAISDCSLTPRSVLHRESG-------------------------  260
               ++  T+     S +   +   LTP  VL ++                           
Sbjct  234   YHLINNTLITSYSSPLPTTTSSRLTPACVLDQQHCCSSNCSSSEITTTSASHNIADNISL  293

Query  259   ---MMPERDGGMKRRRLNNFC  206
                + P+     KRR+LN+ C
Sbjct  294   HQLLYPQPAPPQKRRKLNDLC  314



>ref|XP_010543066.1| PREDICTED: LOW QUALITY PROTEIN: putative cyclin-D6-1 [Tarenaya 
hassleriana]
Length=302

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 116/301 (39%), Positives = 176/301 (58%), Gaps = 21/301 (7%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPA-LFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQ  893
             MEF+LE P + S   H+  D +P+ LF  ES HMPS    +H +   I+  AF L+ R Q
Sbjct  1     MEFHLERPFSHSLL-HNSADTLPSSLFLLESQHMPS----SHYLQ-RIKSSAFRLSDRRQ  54

Query  892   FIYKF--------DRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCID  737
              I           D S+ YLA+NY+DRFLS Q + ++KPW+VR++ +SC+SLA KMR  +
Sbjct  55    AISSISQCSRQFHDPSLTYLAVNYLDRFLSCQGMAQSKPWIVRLISLSCVSLAVKMRKPE  114

Query  736   LCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQS  557
               + ++Q + G++F +++I RME +IL  LKWR+RSITPFSF  FF  L+  +D     +
Sbjct  115   SSVQNLQVEGGVIFSAKTIERMENVILGALKWRMRSITPFSFSSFFLDLFEPKDSLSRHA  174

Query  556   LIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDE  377
             L  RA  ++F   ++    E+ PSV+AA+ALL  + +  PLQF  F+N   +C YV  DE
Sbjct  175   LKARAHDLVFNLQHETMFLEFKPSVVAAAALLAASSEXCPLQFPRFRNTFSQCSYVNKDE  234

Query  376   ILNCLSVMRETVTRGIESSIDAISDCSLT--PRSVLHRESGM-MPERDGGMKRRRLNNFC  206
             +++C + M+E VT   E   +  +D ++    +  L  ES   +   D   KRR+ ++  
Sbjct  235   LMDCYNSMQENVT---EEENEGSTDTAMNVLDQQFLSSESDKSVTAADSPPKRRKTSSVA  291

Query  205   D  203
             D
Sbjct  292   D  292



>ref|XP_010430819.1| PREDICTED: putative cyclin-D6-1 [Camelina sativa]
Length=306

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/260 (40%), Positives = 157/260 (60%), Gaps = 24/260 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHL-------DAVP-ALFAGESDHMPSLLSFNHQISFSIRREAF  914
             MEF+LE+PL+ S +  +         + +P +LF  E  HMPS   F+     +++  AF
Sbjct  1     MEFHLEHPLSHSSHHSNSSNDDDTDDETLPHSLFLVEFQHMPSSHYFH-----TLKSSAF  55

Query  913   SLTYRT-------QFIYKFDR-SIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLA  758
              L+ R        Q+  KFD  S+ YLA+NY+DRFLS + + + KPW+++++ +SC+SL+
Sbjct  56    LLSNRNHSISSIIQYSRKFDDPSLTYLAVNYLDRFLSSEDMPQPKPWILKLISLSCVSLS  115

Query  757   AKMRCIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLE  578
             AKMR  D+ +S +  +EG  F +Q I RME ++L  LKWR+RS+TPFSF  FF SL+ L+
Sbjct  116   AKMRKPDMSVSHLPVEEGEFFYAQMIERMENVVLGALKWRMRSVTPFSFFAFFISLFELK  175

Query  577   DPS---IAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAI  407
             +        SL  +A  + F    DI+  E+ PSV+A +ALL+ + +L PLQF  F N I
Sbjct  176   EEDSLVTKHSLKSQAIDLTFNLQQDIRFLEFKPSVVAGAALLFASFQLCPLQFPCFSNRI  235

Query  406   FRCEYVKSDEILNCLSVMRE  347
              +C YV  DE++ C   ++E
Sbjct  236   CQCTYVNKDELMECYKAIQE  255



>ref|XP_010522647.1| PREDICTED: putative cyclin-D6-1 [Tarenaya hassleriana]
Length=263

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/238 (47%), Positives = 154/238 (65%), Gaps = 14/238 (6%)
 Frame = -2

Query  1072  LMEFNLENPLTSSFNDHHHLDA---VP-ALFAGESDHMPSLLSFNHQIS-----FSIRRE  920
             + EF LE+PL+ S   H+  DA   +P ALF  ES HMPS L + H+I      FS RR+
Sbjct  7     MEEFQLEHPLSHSLI-HNPTDANGPLPSALFLVESQHMPSSL-YLHRIKSSPSHFSNRRQ  64

Query  919   AFSLTYRTQFIYKF-DRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRC  743
             A S  +  Q+  KF D S+ YLA+NY+DRFLS   V ++KPW +R++ +SC+SL+AKMR 
Sbjct  65    AISSIF--QYSGKFHDPSLTYLAVNYLDRFLSCHEVPQSKPWCLRLISLSCVSLSAKMRK  122

Query  742   IDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIA  563
              +  +SD+Q + G++FD+Q+I RM+ +IL  LKWR+RSITPFSF  FF  L+   D    
Sbjct  123   PNSSVSDLQGEGGVIFDTQTIERMDNVILGALKWRMRSITPFSFSSFFLHLFESGDSFSR  182

Query  562   QSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYV  389
              SL  RA  ++F   +DIK  E+ PSV+AASALL  + +L PLQF  F   + +C YV
Sbjct  183   HSLKARAHDLVFHFQHDIKFLEFKPSVMAASALLVASAELCPLQFPRFFTTVSQCSYV  240



>ref|XP_008230196.1| PREDICTED: putative cyclin-D6-1 [Prunus mume]
Length=207

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 126/199 (63%), Gaps = 18/199 (9%)
 Frame = -2

Query  751  MRCIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDP  572
            M+  D  L+D+Q D G++FD+Q+I RME +IL  LKWR+RSITPFSF+ FF SL+ LEDP
Sbjct  1    MKKADFSLADVQGDGGIIFDTQTIQRMEVLILGALKWRMRSITPFSFISFFNSLFKLEDP  60

Query  571  SIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEY  392
             + Q+L  RA+ IIF S  D++L  + PS+IAASALL  + +L P+Q+  FK A+  C Y
Sbjct  61   PLLQALKARAAQIIFKSQKDVELLGFKPSIIAASALLSASHELFPMQYPCFKKALSNCSY  120

Query  391  VKSDEILNCLSVMRETVTRGIESSIDAISDCSLTPRSVLHRE------------SGMMP-  251
            V  + +L C S M++ V  G +S ++ +S  ++T  +VL               +GM P 
Sbjct  121  VNKENMLQCYSAMQDIVADGFDSVLETVSS-AVTAANVLDHNFSSSAESGKTTVTGMTPL  179

Query  250  --ERDGGMKRRRLNNFCDD  200
              ERD  MKRR+++ +C D
Sbjct  180  RLERD--MKRRKISEYCKD  196



>ref|XP_010422479.1| PREDICTED: putative cyclin-D6-1 [Camelina sativa]
Length=305

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/259 (39%), Positives = 156/259 (60%), Gaps = 23/259 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHL-------DAVP-ALFAGESDHMPSLLSFNHQISFSIRREAF  914
             MEF+LE+PL+ S    +         + +P +LF  E  HMPS   F+     +++  AF
Sbjct  1     MEFHLEHPLSHSSLHSNSSNDDDTDDETLPHSLFLVEFQHMPSSHYFH-----TLKSSAF  55

Query  913   SLTYRT-------QFIYKFDR-SIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLA  758
              ++ R        Q+  K D  S+ YLA+NY+DRFLS + + + KPW+++++ +SC+SL+
Sbjct  56    LISNRNHAISSIIQYSRKLDDPSLTYLAVNYLDRFLSSEDMPQPKPWILKLISLSCVSLS  115

Query  757   AKMRCIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLE  578
             AKMR  D+ +S +  +EG  FD+  I RME +IL  LKWR+RS+TPFSF   F SL+ L+
Sbjct  116   AKMRKPDMSVSHLPAEEGEFFDAHMIERMENVILGALKWRMRSVTPFSFFALFISLFELK  175

Query  577   DPSIA--QSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIF  404
             D S+    SL  +A  + F   +D +  E+ PSV+A +ALL+ + +L PLQF  F N I 
Sbjct  176   DDSLVTKHSLKSQAIDLTFNLQHDFRFLEFKPSVVAGAALLFASFQLCPLQFPCFSNRIC  235

Query  403   RCEYVKSDEILNCLSVMRE  347
             +C YV  DE++ C   ++E
Sbjct  236   QCTYVDKDELMECYKAIQE  254



>ref|XP_006288328.1| hypothetical protein CARUB_v10001575mg [Capsella rubella]
 gb|EOA21226.1| hypothetical protein CARUB_v10001575mg [Capsella rubella]
Length=300

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 113/269 (42%), Positives = 166/269 (62%), Gaps = 21/269 (8%)
 Frame = -2

Query  1069  MEFNLENPLT-SSFNDHHHLD---AVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTY  902
             MEF+LE+PL+ SS ++++  D   A  +LF  E  HMPS   F+     S++  AF L+ 
Sbjct  1     MEFHLEHPLSHSSLHNNNSNDDETAPHSLFLVEFQHMPSSHYFH-----SLKSSAFLLSN  55

Query  901   RT-------QFIYKFDR-SIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMR  746
             R        Q+  KFD  S+ YLA+NY+DRFLS + + + KPW+++++ +SC+SL+AKMR
Sbjct  56    RHHAISSILQYSRKFDDPSLTYLAVNYLDRFLSSEDMPQPKPWILKLISLSCVSLSAKMR  115

Query  745   CIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI  566
               ++ +S     EG  FD+Q I RME +IL  LKWR+RS+TPFSF  FF SL+ L++ S 
Sbjct  116   KPEMSVSHHLPVEGEFFDAQMIERMENVILGALKWRMRSVTPFSFFSFFISLFELKEDSF  175

Query  565   A--QSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEY  392
             A   SL  +A  + F   +DI+  E+ PSV+A +ALL+ + +L PLQF  F N I +C Y
Sbjct  176   ALKHSLKSQAIDLTFHLQHDIRFLEFKPSVVAGAALLFASFELCPLQFPCFSNRICQCTY  235

Query  391   VKSDEILNCLSVM--RETVTRGIESSIDA  311
             V  DE++ C   +  R+TV    E S + 
Sbjct  236   VNKDELMECYKGIQERDTVVEENEGSTET  264



>ref|XP_010455908.1| PREDICTED: putative cyclin-D6-1 [Camelina sativa]
Length=304

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 164/268 (61%), Gaps = 16/268 (6%)
 Frame = -2

Query  1069  MEFNLENPLT-------SSFNDHHHLDAVP-ALFAGESDHMPSLLSFNHQISFS---IRR  923
             MEF+LE+PL+       SS +D    + +P +LF  E  HMP    F H + +S   +  
Sbjct  1     MEFHLEHPLSYSSHHSNSSNDDDTDDETLPRSLFLVEFQHMPYSHYF-HSLKYSAFLVSN  59

Query  922   EAFSLTYRTQFIYKFDR-SIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMR  746
                S++   Q+  KFD  S+ YLA+NY+DRFLS + + + KPW+++++ +SC+SL+AKMR
Sbjct  60    RNHSISSIIQYSRKFDDPSLTYLAVNYLDRFLSSEDMPQPKPWILKLISLSCVSLSAKMR  119

Query  745   CIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI  566
               D+ +S +  +EG  FD+Q I RME +IL  LKWR+RS+TPFSF  FF SL+ L D S+
Sbjct  120   KPDMSVSHLPVEEGEFFDAQMIERMENVILGALKWRMRSVTPFSFFSFFISLFELNDDSL  179

Query  565   A--QSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEY  392
                 SL  +A  + F   +DI+  E+ PSV+A +ALL+ + +L PLQF  F N I +C Y
Sbjct  180   VTKHSLKSQAIDLTFNLQHDIRFLEFKPSVVAGAALLFASFQLCPLQFPCFSNRICQCTY  239

Query  391   VKSDEILNCLSVMRE-TVTRGIESSIDA  311
             V  DE++ C   ++E  +    E S +A
Sbjct  240   VNKDELMECYKAIQERDIVEENEGSTEA  267



>ref|XP_004293603.1| PREDICTED: putative cyclin-D6-1-like [Fragaria vesca subsp. vesca]
Length=224

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 115/175 (66%), Gaps = 5/175 (3%)
 Frame = -2

Query  1027  DHHHLDAVPALFAGESDHMPSLL----SFNHQISFSIRREAFSLTYRTQFIYKFDRSIAY  860
             + H+ D++P  FA E+DHMPS      S +     S R EA SL  + Q+    D   +Y
Sbjct  7     EEHNPDSIPDFFASEADHMPSQTFLTSSIHSDFYRSFRLEAISLFLQAQYSCNLDPFTSY  66

Query  859   LAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQ-RDEGLMFDSQS  683
             +A+NY+DRF+S+  + + KPWV R++ ++CLSLAAKM+     LSD Q R+EG MF +Q+
Sbjct  67    IALNYLDRFISKHNIPQGKPWVTRLVELACLSLAAKMKNTSFSLSDFQSREEGFMFGAQT  126

Query  682   IHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSH  518
             I+RME +IL  L WR+RSITPFSFLHFF +L  + +  + Q+L  RAS IIF +H
Sbjct  127   INRMELLILDTLNWRMRSITPFSFLHFFVTLVDINERPLIQALKSRASDIIFNAH  181



>ref|XP_010106726.1| Putative cyclin-D6-1 [Morus notabilis]
 gb|EXC11594.1| Putative cyclin-D6-1 [Morus notabilis]
Length=315

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 114/274 (42%), Positives = 151/274 (55%), Gaps = 38/274 (14%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDA-VPALFAGESDHMPSLLSF----NHQISFSIRREAFSLT  905
             MEF+L +PLT SF + H  D  +  LFA E+DHM S   F    N     S R EA SL 
Sbjct  1     MEFDLTDPLTLSFQEEHQSDTDIADLFASEADHMHSRNFFSRLKNSDSYVSFRSEAISLV  60

Query  904   YRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS  725
              + QF   FD  I+YLA+NY+DR+L                               +   
Sbjct  61    LQAQFSCDFDPFISYLAINYMDRYL-------------------------------VSKQ  89

Query  724   DIQRDE-GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIH  548
             +I RDE G +FD++++H+ME +IL  L WR+RSITPFSF  FF S + L D  + Q+L  
Sbjct  90    EIPRDEEGFIFDAKTVHKMELLILDALSWRMRSITPFSFFAFFMSFFELNDHPLTQALKD  149

Query  547   RASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILN  368
             RAS IIF+S  D+K  E+ PSVIAASALL  + +L PLQF SF  +I  C+YVK + ++ 
Sbjct  150   RASEIIFSSQSDMKFSEFKPSVIAASALLSASHELFPLQFPSFNASISDCQYVKRENLIK  209

Query  367   CLSVMRETVT-RGIESSIDAISDCSLTPRSVLHR  269
             C + M+E V    + SS       + TP SVL R
Sbjct  210   CFNQMQEMVAMMQVYSSNCETFSSTKTPMSVLER  243



>ref|XP_011079045.1| PREDICTED: putative cyclin-D6-1 [Sesamum indicum]
Length=309

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 108/272 (40%), Positives = 160/272 (59%), Gaps = 12/272 (4%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVP-ALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             +F+LENP ++S +D     + P  LF  E+ HMPS  ++   +S + R         +  
Sbjct  7     DFHLENPFSNSNDDG---TSFPLRLFHTETAHMPSN-TYIQTLSTAPRLRRRRWRIVSLI  62

Query  889   IY---KFDRSIAYLAMNYIDRFLSRQAV---LENKPWVVRILVISCLSLAAKMRCIDLCL  728
              Y    FD   +YLA+NY+DRFLS       L+ KPW++ ++ +SC+SLA KMR ++  +
Sbjct  63    QYCSLNFDPFSSYLAINYMDRFLSTSRYCIPLDGKPWILNLVAVSCVSLALKMRKMEFSI  122

Query  727   SDIQRDE-GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLI  551
             S  Q D+ G++    ++ RME +IL  L+WR+RSI PFSF+ FF S + LED   AQ L 
Sbjct  123   SHFQHDDVGMILHPHTVERMEMLILGALRWRMRSINPFSFMSFFLSFFHLEDTKSAQELK  182

Query  550   HRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEIL  371
              RA+ II  +  DIKL E+ PS+I+ASALL  A +L PLQ    +N+I  CEYV  D++ 
Sbjct  183   ERATHIILMAQNDIKLLEFKPSIISASALLSAAYELFPLQLPCSRNSISSCEYVDKDDLF  242

Query  370   NCLSVMRETVTRGIESSIDAISDCSLTPRSVL  275
             NC   M++ V   ++     +   S TP++VL
Sbjct  243   NCYYRMQQAVVATMDDYESMVEMGSCTPKNVL  274



>ref|XP_006594638.1| PREDICTED: putative cyclin-D6-1-like isoform X2 [Glycine max]
Length=243

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 136/243 (56%), Gaps = 36/243 (15%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS--LLSFNHQISFSIRREAFSLTYRT  896
             MEF+LE+PL S   +      +  LFA ES+H+PS   LS  H   F    EA SL  + 
Sbjct  1     MEFDLEDPLVSL--EEEQTFTISELFASESEHVPSPNCLSSTHFHVFC--GEAISLILQV  56

Query  895   QFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQ  716
             Q   K D+ +AYLA+NY+ RF+S Q + + KPW +R+LVISCLSLA+KM+   L + D+Q
Sbjct  57    QVSCKLDQFVAYLAINYLHRFMSCQEIPQGKPWFLRLLVISCLSLASKMKNTTLSILDMQ  116

Query  715   RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAST  536
             + EG  F +QSI RME +IL  LKWR+                             RAS 
Sbjct  117   K-EGCYFKAQSIQRMELLILGALKWRM-----------------------------RASE  146

Query  535   IIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSV  356
             IIF +   IK  EY PS IAA++L++ + +L P Q+ + + +I  CEY+  + +  C  +
Sbjct  147   IIFNAQNGIKFLEYKPSTIAATSLIFASHELFPQQYSTLRASITACEYLDEETLSKCFDL  206

Query  355   MRE  347
             M++
Sbjct  207   MQD  209



>gb|KHG16890.1| Putative cyclin-D6-1 -like protein [Gossypium arboreum]
Length=265

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/296 (36%), Positives = 151/296 (51%), Gaps = 54/296 (18%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPAL----FAGESDHMPSLLSFN----HQISFSIRREAF  914
             MEF+LENPLT+ F+D H    VP+     F  ESDHMP+           ++ SIRREA 
Sbjct  1     MEFDLENPLTN-FDDFHVSSTVPSFIPSFFLVESDHMPTETYIKTLKASDLATSIRREA-  58

Query  913   SLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL  734
              +   +QF  KF   ++YLA+NY+DRFLS Q + +   WV+R++ ISC+SLAAKM  ++ 
Sbjct  59    -ICSISQFSCKFSPFLSYLAVNYLDRFLSSQGLPQPNTWVLRLVAISCVSLAAKMNKLEF  117

Query  733   CLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSL  554
              L+  Q D G MF++Q+I RME                            L+DP +   L
Sbjct  118   ELTHFQGDGGFMFEAQTIERMEY---------------------------LKDPPLMDVL  150

Query  553   IHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEI  374
               RA  II  +  DIKL E+ PS+IAA+AL+  + +L P QF SF+ AI  C YV  + +
Sbjct  151   KARAVEIIMEAQNDIKLLEFKPSIIAATALVCASHELFPSQFPSFRKAISYCPYVNKENM  210

Query  373   LNCLSVMRETVTRGIESSIDAISDCSLTPRSVLHRESGMMPERDGGM-KRRRLNNF  209
             LNC                ++I D            S      +G M KRR+ N++
Sbjct  211   LNCY---------------NSIIDMGWRSNQAEDMVSQQFSSSEGDMFKRRKTNDY  251



>gb|KFK30921.1| hypothetical protein AALP_AA6G043400 [Arabis alpina]
Length=266

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 127/187 (68%), Gaps = 5/187 (3%)
 Frame = -2

Query  895  QFIYKFDR-SIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDI  719
            Q+  KFD  S+ YLA+NY+DRFLS + + ++KPW+++++ +SC+SL+AKMR  ++ + D+
Sbjct  29   QYSRKFDDPSLTYLAVNYLDRFLSSEDIPQSKPWILKLISLSCVSLSAKMRKPNISVHDL  88

Query  718  QRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIA---QSLIH  548
               EG MFD Q I RME +IL  LKWR+RSITPFSF  FF SL+ L++  +     SL  
Sbjct  89   PV-EGEMFDVQMIERMENVILGALKWRMRSITPFSFFDFFLSLFDLKEDHLVVLKHSLKS  147

Query  547  RASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILN  368
            +A+ + F   +DIK  E+ PSVIA + LL+V+ +L P+QF  F N I +C YV  DE++ 
Sbjct  148  QATDLTFNLQHDIKFLEFKPSVIAGATLLFVSSELCPIQFQCFSNGICQCTYVNKDELME  207

Query  367  CLSVMRE  347
            C   ++E
Sbjct  208  CYKAIQE  214



>gb|AFK48182.1| unknown [Lotus japonicus]
Length=217

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 117/183 (64%), Gaps = 3/183 (2%)
 Frame = -2

Query  811  ENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLR  632
            + KPW++++ VIS LSLA+KM    +  S +Q+  G  F +++I RME +IL  L WR+R
Sbjct  33   QKKPWLLKLAVISSLSLASKMMNTPISFSIMQK-AGCNFKAENIQRMELIILGALNWRMR  91

Query  631  SITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVA  452
            SITPF FLHFF SL  ++D S+ Q+L  RAS IIF +H DIK  EY PS IAA+AL+  +
Sbjct  92   SITPFPFLHFFISLAEIKDQSLKQALKERASEIIFNAHNDIKHLEYKPSTIAATALICAS  151

Query  451  EKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVTRGIESSIDAISDCSLTPRSVLH  272
             +L+P Q+   + +I  CE+V  + +  C  +M+E V   +E+ +   +  + TP SVL 
Sbjct  152  HELVPQQYSVLRASITACEHVDKETLSKCFDLMQEMVR--VEALMVDTTSSTETPVSVLD  209

Query  271  RES  263
            R +
Sbjct  210  RST  212



>ref|XP_009121963.1| PREDICTED: putative cyclin-D6-1 [Brassica rapa]
Length=298

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 168/269 (62%), Gaps = 22/269 (8%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLD-AVP--ALFAGESDHMPSLLSFNHQISFSIRREAFSLTYR  899
             MEF+LE+PL+ S + H++ D A+P  +LF  E  HMPS   F+     +++  A  L+ R
Sbjct  1     MEFHLEHPLSHSPSIHNNNDVALPPNSLFLVEPQHMPSPHYFH-----TLKSSASLLSNR  55

Query  898   T-------QFIYKFDR-SIAYLAMNYIDRFLSRQAVL-ENKPWVVRILVISCLSLAAKMR  746
                     Q+  K D  S+ YLA+NY+DRFLS + ++ ++KPW+++++ +SC+SL+AKMR
Sbjct  56    NHAVSSIIQYSRKLDDPSLTYLAVNYLDRFLSSEDMMPQSKPWILKLISLSCVSLSAKMR  115

Query  745   CIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLE--DP  572
               D+ + D+   EG MFD+Q I RME +IL  LKWR+RS+TPFSFL FF SL      D 
Sbjct  116   KPDISVCDLPV-EGEMFDAQMIERMENVILGALKWRMRSVTPFSFLSFFLSLLFELEEDH  174

Query  571   SI-AQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCE  395
             S+   SL  +A+ + F+  +DIK  E+ PSV+AA+ALL+ + ++ P QF  F N I +C 
Sbjct  175   SVLKHSLKAQATDLTFSLQHDIKFLEFKPSVVAAAALLFASSEICPQQFPCFSNRICQCT  234

Query  394   YVKSDEILNCLSVMRE-TVTRGIESSIDA  311
             YV  DE++ C   M+E  V    E S D 
Sbjct  235   YVNKDELMECYKAMQERNVVEDNEGSNDT  263



>gb|KCW89471.1| hypothetical protein EUGRSUZ_A01768 [Eucalyptus grandis]
Length=246

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 114/191 (60%), Gaps = 18/191 (9%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQF  890
             MEF+LENPL          + + +LF  E DHMP       Q    +R   F +  R   
Sbjct  1     MEFDLENPLPLCS------ETLASLFLVEPDHMP-----GEQYVRGLRDGGFDVAVRRDI  49

Query  889   IYKF-------DRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLC  731
             +          D   +YLA+NY+DRFLS Q++    PWV+R+L + C+SLAAKMR  D  
Sbjct  50    VSSISRLSSRLDPLSSYLAVNYLDRFLSCQSLPHLSPWVLRLLAVCCVSLAAKMRNTDFS  109

Query  730   LSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLI  551
             L+D Q D G + DS++I RME +IL  LKWR+RS+TPFSF+ FFTSL+ L+DP + Q+L 
Sbjct  110   LADFQGDGGFVHDSRTIQRMEVLILGALKWRMRSVTPFSFVAFFTSLFKLKDPPLRQALN  169

Query  550   HRASTIIFTSH  518
              RA+ IIF S 
Sbjct  170   ARATEIIFKSQ  180



>ref|NP_001059961.1| Os07g0556000 [Oryza sativa Japonica Group]
 sp|Q69S43.1|CCD61_ORYSJ RecName: Full=Cyclin-D6-1; AltName: Full=G1/S-specific cyclin-D6-1; 
Short=CycD6;1 [Oryza sativa Japonica Group]
 dbj|BAD30903.1| putative cyclin D1 [Oryza sativa Japonica Group]
 dbj|BAF21875.1| Os07g0556000 [Oryza sativa Japonica Group]
 dbj|BAH00726.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67394.1| hypothetical protein OsJ_24707 [Oryza sativa Japonica Group]
Length=320

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 149/280 (53%), Gaps = 15/280 (5%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFI  887
             EF+LENP TS  ++      + +L   E  H PS+ +             F    R    
Sbjct  19    EFDLENPFTSPADE-----PIASLLDAEGHHSPSVSAAASAARREAA--GFISKVRYDGE  71

Query  886   YKFDRSIAYLAMNYIDRFLS-RQAVLENKPWVVRILVISCLSLAAKM-RCIDLCLSDIQR  713
                   +AYLA+NY+DR+LS RQ   E  PW  R+L ISCL+LAAKM R   +  +DIQR
Sbjct  72    LDVHPRVAYLALNYVDRYLSKRQLACERNPWAPRLLAISCLTLAAKMQRAAAISAADIQR  131

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFF-TSLYPL-EDPSIAQSLIHRAS  539
              E  MFD   I RME M+L+ L+WR RS+TP +FL FF ++ +P    P++  ++  RA 
Sbjct  132   GEEFMFDEAKIQRMEQMVLNALEWRTRSVTPLAFLGFFLSACFPQPRHPALLDAIKARAV  191

Query  538   TIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLS  359
              ++     ++K+ E++PSV AA+ALL  A ++     L F+  +  C +V S+++  C  
Sbjct  192   DLLLRVQPEVKMAEFSPSVAAAAALLAAAGEVAGAHLLGFEAGVAACPFVNSEKLRECGE  251

Query  358   VMRETVTRGIESSIDAISDCSLTPRSVL--HRESGMMPER  245
             VM      G+  S  A +  + TP +VL  HR +    ER
Sbjct  252   VM--AAACGVGPSWAAAATSAETPVTVLGHHRSASSESER  289



>emb|CDY22116.1| BnaA09g01450D [Brassica napus]
Length=298

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 168/269 (62%), Gaps = 22/269 (8%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLD-AVP--ALFAGESDHMPSLLSFNHQISFSIRREAFSLTYR  899
             MEF+LE+PL+ S + H++ D A+P  +LF  E  HMPS   F+     +++  A  L+ R
Sbjct  1     MEFHLEHPLSHSPSIHNNNDVALPPNSLFLVEPQHMPSPHYFH-----TLKSSASLLSNR  55

Query  898   T-------QFIYKFDR-SIAYLAMNYIDRFLSRQAVL-ENKPWVVRILVISCLSLAAKMR  746
                     Q+  K D  S+ YLA+NY+DRFLS + ++ ++KPW+++++ +SC+SL+AKMR
Sbjct  56    NHAVSSIIQYSRKLDDPSLTYLAVNYLDRFLSSEDMMPQSKPWILKLISLSCVSLSAKMR  115

Query  745   CIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLE--DP  572
               D+ + D+   EG MFD+Q I RME +IL  LKWR+RS+TPFSFL FF SL      D 
Sbjct  116   KPDISVCDLPV-EGEMFDAQMIERMENVILGALKWRMRSVTPFSFLSFFLSLLFELEEDH  174

Query  571   SI-AQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCE  395
             S+   SL  +A+ + F+  +DIK  E+ PSV+AA+ALL+ + ++ P QF  F N I +C 
Sbjct  175   SVLKHSLKAQATDLTFSLQHDIKFLEFKPSVVAAAALLFASSEICPQQFPCFSNRICQCT  234

Query  394   YVKSDEILNCLSVMRE-TVTRGIESSIDA  311
             YV  DE++ C   M+E  V    E S D 
Sbjct  235   YVNKDELMECYKAMQERDVVEDNEGSNDT  263



>ref|XP_006426676.1| hypothetical protein CICLE_v10027195mg [Citrus clementina]
 gb|ESR39916.1| hypothetical protein CICLE_v10027195mg [Citrus clementina]
Length=164

 Score =   148 bits (373),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 106/159 (67%), Gaps = 6/159 (4%)
 Frame = -2

Query  1069  MEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS--LLSFNHQISF--SIRREAFSLTY  902
             MEF+LENP TS   + H  D +  LFA E DHMPS   + +     F  S+R+EA SL  
Sbjct  1     MEFDLENPFTSF--EEHQSDTLLDLFAIEYDHMPSHNFMQYLKITDFYVSLRQEAVSLVL  58

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
             + QF   F+  I+YLA+ Y+DRF+SRQ + + KPWV R+L +SC+S  AKM+     +S 
Sbjct  59    QIQFSCNFEPFISYLAVTYLDRFISRQEIPQRKPWVPRLLAVSCISRTAKMKNTHFPISK  118

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLH  605
              Q D+ L+FD+Q+IH+ME +IL  L WR+RSITPFSFL+
Sbjct  119   FQGDQELIFDAQTIHQMELLILDALNWRMRSITPFSFLY  157



>gb|KDP20866.1| hypothetical protein JCGZ_21337 [Jatropha curcas]
Length=199

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 122/198 (62%), Gaps = 16/198 (8%)
 Frame = -2

Query  751  MRCIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDP  572
            MR     LS++Q ++  +FD Q+I RME +IL  L WR+RS+TPFSF+HFF SL+ L+DP
Sbjct  1    MRNTHFSLSNLQGEDSFIFDMQTISRMEILILDALNWRMRSVTPFSFVHFFISLFHLKDP  60

Query  571  SIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEY  392
             + Q+L  RA+ IIF +H ++KL ++ PS+IAASALL  + +L PLQF S+K +I  CE 
Sbjct  61   PLTQALKDRATQIIFQAHNEMKLLKFKPSIIAASALLVASHELFPLQFPSYKCSISSCEC  120

Query  391  VKSDEILNCLSVMRETVT-RGIESSIDAISDCSLTPRSVLHRE--------------SGM  257
            V  +++  C + ++E V     ES +D +S  + TP SVL R               +  
Sbjct  121  VNREKLEKCFNAVQEMVEMEWSESILDTVSS-TRTPLSVLDRHCTKSSSASETTSISASA  179

Query  256  MPERDGGMKRRRLNNFCD  203
            +PE+    +R+R++ + +
Sbjct  180  LPEKRDTKRRKRIDYYSN  197



>emb|CAO00120.1| D6-type cyclin [Populus trichocarpa]
Length=156

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 97/146 (66%), Gaps = 1/146 (1%)
 Frame = -2

Query  706  GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIF  527
            G +FD+Q+I +ME +IL  L WR+RSITPFSF+ FF SL+  +DP + Q+L  RAS IIF
Sbjct  2    GFVFDTQTIQKMEVLILGALNWRMRSITPFSFISFFISLFKPKDPPLRQALKARASEIIF  61

Query  526  TSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE  347
             +  DI L E+ PS+IAASALLY + +L P+QFL F+ AI  C +V  + +L C + M+E
Sbjct  62   KAQNDINLLEFKPSLIAASALLYASHELFPMQFLCFRKAISNCSHVNKENLLQCYNAMQE  121

Query  346  TVTRGIESSIDAISDCSLTPRSVLHR  269
                G  S  D +S  S TP +VL +
Sbjct  122  IAMDGYRSQFDMVSS-SDTPVNVLDQ  146



>emb|CDY21951.1| BnaC09g00570D [Brassica napus]
Length=302

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 163/279 (58%), Gaps = 36/279 (13%)
 Frame = -2

Query  1069  MEFNLENPLTSS-----------FNDHHHLDAVP--ALFAGESDHMPSLLSFNHQISFSI  929
             MEF+LE+PL+ S           FND    D +P  +LF  E  HMPS   F+     ++
Sbjct  1     MEFHLEHPLSHSPSIHNNKNETNFND----DTLPPHSLFLVEPQHMPSPHYFH-----TL  51

Query  928   RREAFSLTYRTQFIYKF--------DRSIAYLAMNYIDRFLSRQAVL-ENKPWVVRILVI  776
             +  A  L+ R   I           D S+ YLA+NY+DRFLS + ++ ++KPW+++++ +
Sbjct  52    KSSASLLSNRNHAISSIIKYSRKLDDPSLTYLAVNYLDRFLSSEDMMPQSKPWILKLISL  111

Query  775   SCLSLAAKMRCIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFT  596
             SC+SL+AKMR  D+ + D+   EG MFD+Q I RME +IL  LKWR+RS+TPFSFL FF 
Sbjct  112   SCVSLSAKMRKPDISVCDLPV-EGEMFDAQMIERMENVILGALKWRMRSVTPFSFLSFFL  170

Query  595   SLYPLE--DPSI-AQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFL  425
             SL      D S+   SL  +A+ + F   +DIK  E+ PSV+AA+ALL+ + +L P QF 
Sbjct  171   SLLFELEEDHSVLKHSLKAQATDLTFNLQHDIKFLEFKPSVVAAAALLFASSELCPQQFP  230

Query  424   SFKNAIFRCEYVKSDEILNCLSVMRE-TVTRGIESSIDA  311
              F N I +C YV  DE++ C   M+E  V    E S D 
Sbjct  231   CFSNRICQCTYVNKDELMECYKAMQERDVVEDNEGSNDT  269



>gb|ADE76356.1| unknown [Picea sitchensis]
Length=347

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 163/291 (56%), Gaps = 23/291 (8%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPS---LLSFNHQ-ISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNY  845
             +++  L   E DHMP    L  F  + +  S+R++  S   +    Y F    AYLA+NY
Sbjct  57    ESISFLVEKECDHMPQDGYLQRFQSRTLDVSVRQDGLSWILKVHAYYNFGPLTAYLAINY  116

Query  844   IDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQ-RDEGLMFDSQSIHRM  671
             +DRFLS   + + K W++++L +SCLSLAAKM    +  L D+Q  D   +F++++I RM
Sbjct  117   LDRFLSSYQMPQGKAWMLQLLSVSCLSLAAKMEETHVPLLLDLQIEDAKYVFEARTIERM  176

Query  670   EGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYN  491
             E +IL+ LKWRLRSITPFSFLH+F       D S  ++LI R+  +I  +   I L  + 
Sbjct  177   ELLILTTLKWRLRSITPFSFLHYFVH-RAAGDQSPPRALITRSIELIVATIRVIHLVGHR  235

Query  490   PSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVTRGIESSIDA  311
             PS IAA+A++  AE+++PL  L +K A+ R    K + I +C +VM+E +   I +S   
Sbjct  236   PSSIAAAAVMCAAEEVVPLLALDYKRALCRASEHK-ETIYSCYTVMQEMLIDRIWTSKKR  294

Query  310   ISDCS---LTPRSVL-------HRESGMM-----PERDGGMKRRRLNNFCD  203
              S      L+P  VL       + ES +      P    G KRR++N+FCD
Sbjct  295   TSGTLSSFLSPVGVLDAACLSCNSESSIASFTSNPSAITGTKRRKVNSFCD  345



>gb|EEC82258.1| hypothetical protein OsI_26449 [Oryza sativa Indica Group]
Length=266

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 128/214 (60%), Gaps = 8/214 (4%)
 Frame = -2

Query  868  IAYLAMNYIDRFLS-RQAVLENKPWVVRILVISCLSLAAKM-RCIDLCLSDIQRDEGLMF  695
            +AYLA+NY+DR+LS RQ   E  PW  R+L ISCL+LAAKM R   +  +DIQR E  MF
Sbjct  30   VAYLALNYVDRYLSKRQLACERNPWAPRLLAISCLTLAAKMQRAAAISAADIQRGEEFMF  89

Query  694  DSQSIHRMEGMILSCLKWRLRSITPFSFLHFF-TSLYPL-EDPSIAQSLIHRASTIIFTS  521
            D   I RME M+L+ L+WR RS+TP +FL FF ++ +P    P++  ++  RA  ++   
Sbjct  90   DEAKIQRMEQMVLNALEWRTRSVTPLAFLGFFLSACFPQPRHPALLDAIKARAVDLLLRV  149

Query  520  HYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETV  341
              ++K+ E++PSV AA+ALL  A ++    FL F+  +  C +V S+++  C  VM    
Sbjct  150  QPEVKMAEFSPSVAAAAALLAAAGEVAGGHFLGFEAGVAACPFVNSEKLRECGEVMAAAC  209

Query  340  TRGIESSIDAISDCSLTPRSVL--HRESGMMPER  245
              G+  S  A +  + TP +VL  HR +    ER
Sbjct  210  --GVGPSWAAAASSAETPVTVLGHHRSASSESER  241



>ref|XP_004957987.1| PREDICTED: cyclin-D6-1-like [Setaria italica]
Length=310

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/296 (35%), Positives = 150/296 (51%), Gaps = 25/296 (8%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFI  887
             EF+LENP TS  ++      + +L   E  H           +       F    R    
Sbjct  17    EFDLENPFTSPADE-----PIASLLEAEGHHA--PSVSAAASAARRDAAGFISKVRFGGE  69

Query  886   YKFDRSIAYLAMNYIDRFLSR-QAVLENKPWVVRILVISCLSLAAKM-RCIDLCLSDIQR  713
                +  +AYLA+NY+DRFLS+ Q   E +PW  R+L ISCLSLAAKM R     ++DIQR
Sbjct  70    LAVNPRVAYLALNYVDRFLSKNQLPCEQQPWAPRLLAISCLSLAAKMQRVAAFSIADIQR  129

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSL--YPLEDPSIAQSLIHRAS  539
             DE  MFD+ ++ RME ++L  L+WR RS+TP +FL FF S    P   P    ++  RA 
Sbjct  130   DEEFMFDAVTVRRMERVLLDALEWRARSVTPLAFLGFFISACYPPPRHPLQVAAVKARAV  189

Query  538   TIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLS  359
              I+  +  ++K+ E++PSV AA+ALL  A ++       F+  +  C +V SD++  C  
Sbjct  190   DILLRAQPEVKMAEFSPSVAAAAALLAAAGEVTAANLPVFQAGVAACPFVNSDKLRECGE  249

Query  358   VMRETVTRGIESSIDAISDCSLTPRSVL--HRESGMMPERD--------GGMKRRR  221
             V+      G+     A S  + TP +VL  HR +    E D        GG  ++R
Sbjct  250   VL--AAACGVGPGRAAAS--ADTPVTVLGHHRSASSASESDWTVGSAANGGDAKKR  301



>dbj|BAK07784.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=309

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 140/244 (57%), Gaps = 15/244 (6%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFI  887
             EF+LENP TS  ++      + +L   E  H           + ++RR+A     + ++ 
Sbjct  16    EFDLENPFTSPADE-----PIASLLDAEGHHA----PSVSAAASAVRRDAARFISKVRYD  66

Query  886   YKFD--RSIAYLAMNYIDRFLSR-QAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD-I  719
              +      +AYLA NY+DRFLS+ Q   E KPW  R+L ISCLS+AAKM+ +D    D I
Sbjct  67    GELGLHPRVAYLAQNYVDRFLSKGQLPFERKPWAPRLLAISCLSIAAKMQRVDAISMDYI  126

Query  718   QRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTS--LYPLEDPSIAQSLIHR  545
             QRDE  MFD+ +I RME ++L  L+WR RS+TP +FL FF S    P   P++  ++  R
Sbjct  127   QRDEEFMFDAVTIRRMERVVLGALEWRARSVTPLAFLGFFLSACFPPPRHPALLDAVKER  186

Query  544   ASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNC  365
             A  ++  +  ++K+ E++PSV+AASALL  A ++      +F+  +  C +V S+++  C
Sbjct  187   AVDLLLRAQPEVKMAEFSPSVVAASALLAAAGEIAVAHLPAFQAGVAACSFVNSEKLREC  246

Query  364   LSVM  353
               VM
Sbjct  247   GEVM  250



>gb|EMS53686.1| Cyclin-D6-1 [Triticum urartu]
Length=313

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 142/244 (58%), Gaps = 15/244 (6%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFI  887
             EF+LEN  TS  ++      + +L   E+ H           + ++RR+A     + ++ 
Sbjct  16    EFDLENTFTSPADE-----PIASLLDAEAHHA----PSVSAAASAVRRDAARFISKVRYD  66

Query  886   YKF--DRSIAYLAMNYIDRFLSR-QAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD-I  719
              +      +AYLA+NY+DRFLS+ Q   E KPW  R+L ISCLS+AAKM+ +D    D I
Sbjct  67    GELAVHPRVAYLALNYVDRFLSKGQLPFERKPWAPRLLAISCLSIAAKMQRVDAISMDYI  126

Query  718   QRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTS--LYPLEDPSIAQSLIHR  545
             QRDE  MFD+ +I RME ++L  L+WR RS+TP +FL FF S    P   P++  ++  R
Sbjct  127   QRDEEFMFDAVTIRRMERVVLGALEWRARSVTPLAFLGFFLSACFPPPRHPALLDAVKER  186

Query  544   ASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNC  365
             A  ++  +  ++K+ E++PSV+AASALL  A ++      +F+ A+  C +V S+++  C
Sbjct  187   AVDLLLRAQPEVKMAEFSPSVVAASALLAAAGEITVAHLPAFQAAVAACPFVNSEKLREC  246

Query  364   LSVM  353
               VM
Sbjct  247   GEVM  250



>ref|NP_001149068.1| CYCD6 [Zea mays]
 gb|ACG34069.1| CYCD6 [Zea mays]
 tpg|DAA63084.1| TPA: CYCD6 [Zea mays]
Length=307

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 152/291 (52%), Gaps = 20/291 (7%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFI  887
             EF+LENP TS  ++      + +L   E  H           +      AF    R    
Sbjct  19    EFDLENPFTSPADE-----PIASLLDAEGHHA--PSISAAASATRRAAAAFISKVRFGGE  71

Query  886   YKFDRSIAYLAMNYIDRFLS-RQAVLENKPWVVRILVISCLSLAAKM-RCIDLCLSDIQR  713
                   +AYLA+NY+DRFLS RQ   E +PW  R+L ISCLSLAAKM R      +DIQR
Sbjct  72    LAVHPRVAYLALNYVDRFLSKRQLACEQQPWAPRLLAISCLSLAAKMQRVATFSTADIQR  131

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSL--YPLEDPSIAQSLIHRAS  539
             DE  MFD+ +I RME ++L  L+WR RS+TP +FL FF S    P + P    ++  RA 
Sbjct  132   DEDFMFDAVTIRRMERVVLGALEWRARSVTPLAFLGFFLSACYPPPQHPPQVAAVKARAV  191

Query  538   TIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLS  359
              ++  +  ++K+ E++PSV+AA+ALL  A ++      +F+ ++  C +V S+++  C  
Sbjct  192   DLLLHAQPEVKMAEFSPSVVAAAALLAAAGEVAAANLHAFQASLAACPFVNSEKLRECGE  251

Query  358   VMRETVTRGIESSIDAISDCSLTPRSVL--HRESGMMPERD---GGMKRRR  221
             V+      G+     A S  + TP +VL   R +    E D   GG  ++R
Sbjct  252   VL--AAAGGVGRGRAAPS--ADTPVTVLGHQRSASSASETDWINGGDAKKR  298



>ref|XP_006841234.1| hypothetical protein AMTR_s00135p00066200 [Amborella trichopoda]
 gb|ERN02909.1| hypothetical protein AMTR_s00135p00066200 [Amborella trichopoda]
Length=344

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/230 (36%), Positives = 135/230 (59%), Gaps = 9/230 (4%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPS---LLSFNHQI-SFSIRREAFSLTYRTQFIYKFDRSIAYLAMNY  845
             D +  L + E D +P    L+     +   S+RREA +  ++    Y F     YL++NY
Sbjct  54    DCMGLLVSKEGDFLPRDDYLIRLQSGVLDSSLRREAVNWIWKVHGHYSFQPLTTYLSVNY  113

Query  844   IDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQRDEG-LMFDSQSIHRM  671
             +DRFLS   + + K W++++L ++CLSLAAKM   D+ LS D+Q  E   +F+S++I RM
Sbjct  114   LDRFLSCYELPQGKAWMIQLLSVACLSLAAKMEETDVPLSLDLQVGEAKYVFESRTIQRM  173

Query  670   EGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYN  491
             E ++LS LKWR++S+TPFSF+ +F      +D    ++ + R+S II T+    +  E+ 
Sbjct  174   ELLVLSNLKWRMQSVTPFSFVDYFLHKINGDDSWAPRAYLCRSSDIILTTIKGTEFLEFR  233

Query  490   PSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETV  341
             PS IAA+  + V+E+    + L F NA+  C  V+  ++L C  +++E V
Sbjct  234   PSEIAAAVAISVSEE---SKSLDFNNALACCPNVEKGKVLRCYELIQEIV  280



>ref|XP_009381479.1| PREDICTED: cyclin-D3-1-like [Musa acuminata subsp. malaccensis]
Length=344

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 94/273 (34%), Positives = 149/273 (55%), Gaps = 17/273 (6%)
 Frame = -2

Query  1087  FLSDLLMEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSL  908
             F  DLL++F L++    S       + +P    GE     +L         SIRR+A   
Sbjct  46    FYGDLLVDFPLQSDEFLSLLVKREPEHLPREDYGERLRSGTL-------EPSIRRDAIDW  98

Query  907   TYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCL  728
              ++    Y F    AYL++NY DRFLS   + + K W+ R+L ++CLSLAAKM   D+  
Sbjct  99    MWKVHAYYNFGPLSAYLSVNYFDRFLSEYELPQGKTWMTRLLSVACLSLAAKMEKTDVPQ  158

Query  727   S-DIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLED-PSIAQS  557
             S D+Q  E   +F++++I RME M+L+ LKWR++++TPFSF+ FF   +  +D P+  QS
Sbjct  159   SPDLQDGEAKYVFEARAIMRMELMVLNTLKWRMQAVTPFSFIDFFLHKFNGDDVPN--QS  216

Query  556   LIHRASTIIFTSHYDIKLFEYNPSVIAAS-ALLYVAEKLIPLQFLSFKNAIFRCEYVKSD  380
              I R+S +I ++   I    + PSV AA+ ALL + E    +Q +  + A+  C +V  +
Sbjct  217   SIVRSSELILSTTRGIDFLAFRPSVTAAAIALLVLGE----IQNVDVQKALSCCSHVAKE  272

Query  379   EILNCLSVMRETVTRGIESSIDAISDCSLTPRS  281
              +L C  V+++ V    +S+ D     S  P+S
Sbjct  273   GVLECYEVIQDKVLMRKQSAKDVSLSASSVPQS  305



>gb|EMT22750.1| Cyclin-D6-1 [Aegilops tauschii]
Length=294

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 114/176 (65%), Gaps = 4/176 (2%)
 Frame = -2

Query  868  IAYLAMNYIDRFLSR-QAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD-IQRDEGLMF  695
            +AYLA+NY+DRFLS+ Q   E KPW  R+L ISCLS+AAKM+ +D    D IQRDE  MF
Sbjct  56   VAYLALNYVDRFLSKGQLPFERKPWAPRLLAISCLSIAAKMQRVDAISMDYIQRDEEFMF  115

Query  694  DSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTS--LYPLEDPSIAQSLIHRASTIIFTS  521
            D+ +I RME ++L  L+WR RS+TP +FL FF S    P    ++  ++  RA  ++  +
Sbjct  116  DAVTIQRMERVVLGALEWRARSVTPLAFLGFFLSACFPPPRHLALLDAVKERAVDLLLRA  175

Query  520  HYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM  353
              ++K+ E++PSV+AASALL  A ++      +F+ A+  C +V S+++  C  VM
Sbjct  176  QPEVKMAEFSPSVVAASALLAAAGEIAVAHLPAFQAAVAACPFVNSEKLRECGEVM  231



>ref|XP_008782336.1| PREDICTED: cyclin-D3-1-like [Phoenix dactylifera]
Length=352

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/249 (34%), Positives = 138/249 (55%), Gaps = 13/249 (5%)
 Frame = -2

Query  1087  FLSDLLMEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSL  908
             F  D L  F L++    +      L+ +P       D+   LL  N  +  SIRR+A   
Sbjct  51    FYGDCLRSFPLQSEECIALLVEKELEHIP-----REDYAKRLL--NGDLDISIRRDAIDW  103

Query  907   TYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCL  728
               +    YKF    AYL++NY+DRFLS   + E K W++++L ++CLSLAAK+   ++ L
Sbjct  104   IGKVHAHYKFGPLSAYLSVNYMDRFLSAYELPEGKAWMMQLLTVTCLSLAAKIEETEVPL  163

Query  727   S-DIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSL  554
             S D+Q  E   +F++++I RME ++L  LKWR++++TPFSF+ +F   +  +  S   SL
Sbjct  164   SLDLQVGEAKYVFEAKTIQRMELLVLGTLKWRMQAVTPFSFIDYFLQKFN-DGNSPTNSL  222

Query  553   IHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEI  374
             + R   +I +S        + PS IAA A+ + A  L  +Q +  +NA+ RC +V  + +
Sbjct  223   VSRTVELILSSVRGTGFLRFRPSEIAA-AVAFSA--LREIQIVGIENALTRCIHVDKERV  279

Query  373   LNCLSVMRE  347
             L C  V+++
Sbjct  280   LRCYEVIQQ  288



>ref|XP_009390267.1| PREDICTED: cyclin-D4-1-like [Musa acuminata subsp. malaccensis]
Length=356

 Score =   130 bits (328),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 88/278 (32%), Positives = 144/278 (52%), Gaps = 23/278 (8%)
 Frame = -2

Query  1093  SLFLSDLLMEFNLENPLTSSFNDHHHLDAVPALFAGESDHMP----SLLSFNHQISFSIR  926
             S F   +LM+F L++            D V  L   ES H P    +      Q+    R
Sbjct  51    SGFCGAILMDFTLQSE-----------DCVVELVERESQHRPQGDYAERLLRGQLDMVAR  99

Query  925   REAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMR  746
              +A     +    + F    AYL++NY+DRFLS   + + K W+ ++L ++CLSLAAK+ 
Sbjct  100   SDAIDWIQKVHAHHNFGPLTAYLSINYLDRFLSSYELPQGKAWIPQLLSVACLSLAAKVE  159

Query  745   CIDLCLS-DIQ-RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDP  572
               ++ LS ++Q  D   +F++++IHRME ++L  LKWR++++TPFSF+ +F  LY   D 
Sbjct  160   ETEVPLSLELQVGDANHVFEARTIHRMELLVLGTLKWRMQALTPFSFIGYF--LYKFSDG  217

Query  571   SIAQSLIHRAST-IIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCE  395
             ++  SL+  +S  +I  +  +I   EY PS IAA+  L V   L   Q L    A+ RC 
Sbjct  218   NLPDSLLTSSSVDLILGTVREIDFLEYRPSEIAAAVALSV---LKDTQILDLDQALARCI  274

Query  394   YVKSDEILNCLSVMRETVTRGIESSIDAISDCSLTPRS  281
             +V  + +  C  V++E  +    ++ +     S  P+S
Sbjct  275   HVNKERVFKCHRVIQEMTSMKNRTNRNTSPSISAVPKS  312



>ref|XP_008651459.1| PREDICTED: CYCD6 isoform X1 [Zea mays]
 tpg|DAA63085.1| TPA: hypothetical protein ZEAMMB73_209613 [Zea mays]
Length=304

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 148/291 (51%), Gaps = 23/291 (8%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFI  887
             EF+LENP TS  ++      + +L   E  H           +      AF    R    
Sbjct  19    EFDLENPFTSPADE-----PIASLLDAEGHHA--PSISAAASATRRAAAAFISKVRFGGE  71

Query  886   YKFDRSIAYLAMNYIDRFLS-RQAVLENKPWVVRILVISCLSLAAKM-RCIDLCLSDIQR  713
                   +AYLA+NY+DRFLS RQ   E +PW  R+L ISCLSLAAKM R      +DIQR
Sbjct  72    LAVHPRVAYLALNYVDRFLSKRQLACEQQPWAPRLLAISCLSLAAKMQRVATFSTADIQR  131

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSL--YPLEDPSIAQSLIHRAS  539
             DE  MFD+ +I RME ++L  L+WR RS+TP +FL FF S    P + P    ++  RA 
Sbjct  132   DEDFMFDAVTIRRMERVVLGALEWRARSVTPLAFLGFFLSACYPPPQHPPQVAAVKARAV  191

Query  538   TIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLS  359
              ++  +  ++K+ E++PSV+AA+ALL  A ++      +F+ ++  C + K  E    L+
Sbjct  192   DLLLHAQPEVKMAEFSPSVVAAAALLAAAGEVAAANLHAFQASLAACPFEKLRECGEVLA  251

Query  358   VMRETVTRGIESSIDAISDCSLTPRSVL--HRESGMMPERD---GGMKRRR  221
                  V RG        +  + TP +VL   R +    E D   GG  ++R
Sbjct  252   AA-GGVGRG------RAAPSADTPVTVLGHQRSASSASETDWINGGDAKKR  295



>gb|AEK20778.1| cyclin dependent kinase regulator [Musa acuminata AAA Group]
Length=344

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/228 (36%), Positives = 133/228 (58%), Gaps = 13/228 (6%)
 Frame = -2

Query  934  SIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAA  755
            SIRR+A    ++    Y F    AYL++NY+DRFLS   + + K W+ ++L ++CLSLAA
Sbjct  90   SIRRDAIDWIWKVHAHYNFGPLSAYLSVNYLDRFLSSYDLPQGKAWMTQLLSVACLSLAA  149

Query  754  KMRCIDLCLS-DIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPL  581
            KM   ++ LS D+Q  E   +F+ ++I RME +++S LKWR++++TPFSF+ FF  L+  
Sbjct  150  KMEETEVPLSLDLQVGEAKYIFEGRTIQRMELLVMSTLKWRMQAVTPFSFIDFF--LHKF  207

Query  580  EDPSIAQSL-IHRASTIIFTSHYDIKLFEYNPSVIAAS-ALLYVAEKLIPLQFLSFKNAI  407
                    L + R++ +I ++   I    + PSVI+A+ ALL + E     Q +  + A+
Sbjct  208  NGCGAPSKLSLSRSAELILSTIRGIDFLAFRPSVISAAIALLVLGET----QIVDVEEAL  263

Query  406  FRCEYVKSDEILNCLSVMRETVTRGIESSIDAISDCSLTPRS---VLH  272
              C +V  + +L C  V+++ V    +S+ D +S  S  P+S   VLH
Sbjct  264  SCCCHVAKEGVLGCYEVIQDKVLMRKQSAKDLVSSVSCVPQSPVGVLH  311



>ref|XP_006657822.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-D6-1-like [Oryza brachyantha]
Length=311

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 96/285 (34%), Positives = 143/285 (50%), Gaps = 25/285 (9%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFI  887
             EF+LENP TS  ++      + +L   E  H           +      AF    R    
Sbjct  16    EFDLENPFTSPADE-----PIASLLDAEGHHS--PSVSAASSAARREAAAFISEVRYDGE  68

Query  886   YKFDRSIAYLAMNYIDRFLSRQAVLEN--KPWVVRILVISCLSLAAKM-RCIDLCLSDIQ  716
                   +AYLA+NY+DRFLS++ +  +   PW  R+L ISCLSLAAKM R   + ++DIQ
Sbjct  69    LNVQPRVAYLALNYVDRFLSKRQLAGDGHNPWAPRLLAISCLSLAAKMQRAAAISVADIQ  128

Query  715   RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFF-TSLYPLEDPSIAQSLIHRAS  539
             R +  MF   +I RME M+L  L+WR RS+TP +FL FF +S +P   P      +  A 
Sbjct  129   RGD-PMFGEATIRRMERMVLDALEWRARSVTPLAFLGFFLSSCFP--QPRHQPPPLDSAR  185

Query  538   TIIFTS-HY-DIKLFEYNPSVIAASALL---YVAEKLIPLQFLSFKNAIFRCEYVKSDEI  374
               +F   H+ ++K+ E++PSV A +  L    VA   +P    +F+  +  C +V S+++
Sbjct  186   LSLFAPVHFAEVKMAEFSPSVAAGAGPLPPXQVAGAHLP----AFQAGVAACHFVNSEKL  241

Query  373   LNCLSVMRETVTRGIESSIDAISDCSLTPRSVL--HRESGMMPER  245
               C  VM      G   +  A +  + TP +VL  HR +    ER
Sbjct  242   RECGEVMAAACGVGPGWTAAAAAGSADTPVTVLGHHRSASSESER  286



>ref|XP_009410124.1| PREDICTED: cyclin-D3-1-like [Musa acuminata subsp. malaccensis]
Length=344

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/228 (36%), Positives = 132/228 (58%), Gaps = 13/228 (6%)
 Frame = -2

Query  934  SIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAA  755
            SIRR+A    ++    Y F    AYL++NY+DRFLS   + + K W+ ++L ++CLSLAA
Sbjct  90   SIRRDAIDWIWKVHAHYNFGPLSAYLSVNYLDRFLSSYDLPQGKAWMTQLLSVACLSLAA  149

Query  754  KMRCIDLCLS-DIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLY-P  584
            KM   ++ LS D+Q  E   +F+ ++I RME +++S LKWR++++TPFSF+ FF   +  
Sbjct  150  KMEETEVPLSLDLQVGEAKYIFEGRTIQRMELLVMSTLKWRMQAVTPFSFIDFFLHKFNG  209

Query  583  LEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAAS-ALLYVAEKLIPLQFLSFKNAI  407
               PS     + R++ +I ++   I    + PSVI+A+ ALL + E     Q +    A+
Sbjct  210  CGAPSKVS--LSRSAELILSTIRGIDFLAFRPSVISAAIALLVLGEA----QIVDVDEAL  263

Query  406  FRCEYVKSDEILNCLSVMRETVTRGIESSIDAISDCSLTPRS---VLH  272
              C +V  + +L C  V+++ V    +S+ D +S  S  P+S   VLH
Sbjct  264  SCCCHVAKEGVLGCYEVIQDKVLMRKQSAKDLVSSVSCVPQSPVGVLH  311



>ref|XP_008795181.1| PREDICTED: cyclin-D4-1-like [Phoenix dactylifera]
Length=352

 Score =   128 bits (322),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/237 (34%), Positives = 128/237 (54%), Gaps = 8/237 (3%)
 Frame = -2

Query  985  ESDHMPSLLSFNHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLEN  806
            E D+    LS +  +  S+RR+A     +    Y F    AYL++NY+DRFLS   + ++
Sbjct  79   EEDYAKRFLSGD--LDISVRRDAIDWIGKVHAHYNFGPLSAYLSVNYVDRFLSAYELPQS  136

Query  805  KPWVVRILVISCLSLAAKMRCIDLCLS-DIQRDEG-LMFDSQSIHRMEGMILSCLKWRLR  632
            K W+V++L ++CLSLAAKM   ++ LS D+Q  E    F++++I RME ++LS LKWR++
Sbjct  137  KAWMVQLLSVACLSLAAKMEENEVPLSLDLQVGEAQYAFEARTIQRMELLVLSTLKWRMQ  196

Query  631  SITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVA  452
            ++TPFSF+ +F   +  +  S   SL+ R+  +I  +        + PS IAA+  L   
Sbjct  197  AVTPFSFIDYFLQKFN-DGNSPTNSLVSRSVELILNAVRGTGFLGFRPSEIAAAVAL---  252

Query  451  EKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVTRGIESSIDAISDCSLTPRS  281
              L  +Q +  +N +  C +V    +L C   ++     G ESS  A    S  P S
Sbjct  253  SALREIQIVEIENNLTHCIHVDKVRVLRCYEEIQAKTLAGKESSRSAGPSASFIPHS  309



>ref|XP_010926356.1| PREDICTED: cyclin-D4-1-like isoform X1 [Elaeis guineensis]
Length=353

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 137/254 (54%), Gaps = 21/254 (8%)
 Frame = -2

Query  1093  SLFLSDLLMEFNLENPLTSSFNDHHHLDAVPALFAGESDHMP----SLLSFNHQISFSIR  926
             S F  D L  F    PL S        + +  L   E +HMP    +    N  +  S+R
Sbjct  49    SDFYGDFLKSF----PLQSE-------ECIALLVEKELEHMPRKDYAKRLQNGDLDISVR  97

Query  925   REAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMR  746
             R+A     +    YKF    AYL++NY+DRFLS   + E K W+ ++L ++CLSLAAK+ 
Sbjct  98    RDAIDWIGKVHVHYKFGPLSAYLSVNYMDRFLSAYKLPEGKAWMTQLLTVACLSLAAKIE  157

Query  745   CIDLCLS-DIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDP  572
               ++ LS D+Q  E   +F++++I RME ++LS LKWR++++TPFSF+ +F   +  +  
Sbjct  158   ETEVPLSLDLQVGEAKYVFEAKTIQRMELLVLSTLKWRMQAVTPFSFIDYFLQKFN-DGN  216

Query  571   SIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEY  392
             S   S++ R+  +I +S        + PS IAA A+ + A  L  +Q +  KN +  C +
Sbjct  217   SPTNSVVSRSVELILSSVRGTGFLGFRPSEIAA-AVAFSA--LGEIQTVGIKNTLSCCIH  273

Query  391   VKSDEILNCLSVMR  350
             V  + +L C  V++
Sbjct  274   VDKERVLRCNEVIQ  287



>ref|XP_003576488.1| PREDICTED: cyclin-D2-1-like isoform X1 [Brachypodium distachyon]
Length=323

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 135/242 (56%), Gaps = 11/242 (5%)
 Frame = -2

Query  997  LFAGESDHMPSLLSFNHQISFSI----RREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFL  830
            L  GE+D+ P     +   S S+    R ++ +   + Q  Y F    AYLA+NY+DRFL
Sbjct  58   LIGGEADYSPRSDYPDQLRSRSVDPAARADSVAWILKVQVSYGFLPLTAYLAVNYMDRFL  117

Query  829  SRQAVLENKPWVVRILVISCLSLAAKM-RCIDLCLSDIQRDEG-LMFDSQSIHRMEGMIL  656
            S   + +   W +++L ++CLSLAAKM   +   L D+Q +    +F+ Q+I RME +IL
Sbjct  118  SLHRLPQEDGWAMQLLAVTCLSLAAKMEETLVPSLLDLQAESTRYIFEPQTILRMELLIL  177

Query  655  SCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQS--LIHRASTIIFTSHYDIKLFEYNPSV  482
            + L WRLRS+TPF+F+ FF       DP    +  LI RA+ II  + +DIK  ++ PS 
Sbjct  178  TALNWRLRSVTPFTFIDFFACKV---DPRGKHTRYLIARATQIILAALHDIKFLDHCPST  234

Query  481  IAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVTRGIESSIDAISD  302
            +AA+A+L    +   L F++   A+  C  +  + + +C  +M+  ++    ++ +A++ 
Sbjct  235  MAAAAVLCATGETPTLPFVNPSLAVNWCIGLAEEGVSSCYKLMQPLLSGKRANTAEAVNL  294

Query  301  CS  296
            CS
Sbjct  295  CS  296



>ref|XP_002510103.1| cyclin d, putative [Ricinus communis]
 gb|EEF52290.1| cyclin d, putative [Ricinus communis]
Length=327

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 148/264 (56%), Gaps = 11/264 (4%)
 Frame = -2

Query  967  SLLSFNHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVR  788
            SL +F++ + F+ R EA +   + + I+ F    AYL++ Y DRFLSR+++   K W V+
Sbjct  61   SLSTFDNWVKFA-RLEAITWILKNRAIFGFGFQTAYLSITYFDRFLSRRSIDREKSWAVK  119

Query  787  ILVISCLSLAAKMRCIDL-CLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSF  611
            +L ++CLSLAAKM  I +  LS+ Q +E   F+S+ I RME ++L+ L+WR+ S TPF+F
Sbjct  120  LLSVACLSLAAKMEEIKVPPLSNFQIEE-YNFESKVIQRMELLVLNTLEWRMISSTPFAF  178

Query  610  LHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQ  431
            LH+F   +  E P  ++ L+ R   +IF    +I   E+ PSVIAA+A L   ++ +  +
Sbjct  179  LHYFIIKFSKEPPP-SRHLVSRTVGLIFAVVKEITSMEHRPSVIAAAAALMSLDRNLIRK  237

Query  430  FLSFK-NAIFRCEYVKSDEILNCLSVMR--ETVTRGIESSIDA-ISDCSLTPRSVLHRES  263
             L  K ++I    +++ +++  C S+M+  E    G  + +++ +      P SVL   S
Sbjct  238  ALECKIDSISPSGFLEIEDVFQCYSLMQKLEMEKHGTPTFVNSDVWPTQFRPMSVLENSS  297

Query  262  GMMPERDGGMKRRRLNNFCDDQEY  191
                      KR+RL     DQ Y
Sbjct  298  VTSA---ISSKRKRLAFSDSDQNY  318



>ref|XP_002462322.1| hypothetical protein SORBIDRAFT_02g023800 [Sorghum bicolor]
 gb|EER98843.1| hypothetical protein SORBIDRAFT_02g023800 [Sorghum bicolor]
Length=333

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 134/254 (53%), Gaps = 19/254 (7%)
 Frame = -2

Query  1039  SSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSI----RREAFSLTYRTQFIYKFDR  872
             S+  D     ++  L  GE+ + P     +   S SI    R E+ +   + Q  Y F  
Sbjct  42    SAVEDEESAASIAELIGGEAQYSPRPDYPDRLRSRSIDPAARAESVAWILKVQEYYGFLP  101

Query  871   SIAYLAMNYIDRFLS-RQAVLENKPWVVRILVISCLSLAAKMR------CIDLCLSDIQR  713
               AYLA+NY+DRFLS  +   E   W +++L ++CLSLAAKM        +DL +    R
Sbjct  102   LTAYLAVNYMDRFLSLHRLPQEEDGWAMQLLAVTCLSLAAKMEETLVPSLLDLQVEGTSR  161

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI--AQSLIHRAS  539
              +   FD  ++ RME ++L+ L WRLRS+TPF+F+ FF       DP     + LI RA+
Sbjct  162   YD---FDPGTVGRMELIVLTALNWRLRSVTPFTFIDFFACKV---DPGGRHTRCLIARAT  215

Query  538   TIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLS  359
              +I  + +DI+  ++ PS +AA+A+L    +   L+ +S   A+  C  +  + I +C  
Sbjct  216   QVILAAMHDIEFLDHCPSSMAAAAVLCATGETPSLESVSPGAAVSWCIGLAEEGISSCYR  275

Query  358   VMRETVTRGIESSI  317
             +MR+ VT  +++ +
Sbjct  276   LMRQLVTGNVQTRV  289



>ref|XP_006856973.1| hypothetical protein AMTR_s00190p00017930 [Amborella trichopoda]
 gb|ERN18440.1| hypothetical protein AMTR_s00190p00017930 [Amborella trichopoda]
Length=309

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 147/278 (53%), Gaps = 21/278 (8%)
 Frame = -2

Query  1045  LTSSFNDHHHLDAV---PALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFIYKFD  875
             + S+  D  H+ ++      F  + D++  L S N  ++ S R +A    Y+    Y F 
Sbjct  17    IQSTMPDEAHIASLISQETHFTPKEDYLFKLQSGN--VNVSARNDAVDWIYKVHGHYNFA  74

Query  874   RSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQRDE--G  704
                A L++NY+DRFLS   + + K W+V++L ++CLSLAAKM   D+ LS D+Q  E   
Sbjct  75    PLTACLSVNYLDRFLSEYELPQGKVWMVQLLSVACLSLAAKMEETDVPLSLDLQVSEETK  134

Query  703   LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFT  524
              +F++++I +ME ++L+ LKWR+ +ITPFSF+  F      E+P I +SLI R++ +I  
Sbjct  135   FVFEARTIQKMELLLLTTLKWRMNAITPFSFIDHFIFRTNPENP-IPKSLISRSTQLILN  193

Query  523   SHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCE-YVKSDEILNCLSVMRE  347
                 I+  E+ PS +A++  ++V+ ++ P   + F +A+  C   +  +++  C  ++ E
Sbjct  194   LTRGIEFLEFRPSELASAVAIFVSREIQPA--VDFHDAMDSCSPLINKEKVSKCYELIEE  251

Query  346   TVTRGIESSIDAISDCSLTPRSVLHRESGMMPERDGGM  233
                      I+   DC          ES   P+   G+
Sbjct  252   ---------IETTKDCCFFAGKSFSGESSASPKSPIGV  280



>ref|XP_006836691.1| hypothetical protein AMTR_s00088p00097010 [Amborella trichopoda]
 gb|ERM99544.1| hypothetical protein AMTR_s00088p00097010 [Amborella trichopoda]
Length=329

 Score =   125 bits (314),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 96/291 (33%), Positives = 147/291 (51%), Gaps = 31/291 (11%)
 Frame = -2

Query  1012  DAVPALFAGESDHMP----SLLSFNHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNY  845
             D+V      ESD +P    S    +  I  S R++A +   R    Y+F    AYLA+NY
Sbjct  37    DSVAGFLEYESDFIPPNDYSERFRDGSIDLSARKDAIAWILRVHTYYQFRPLTAYLAVNY  96

Query  844   IDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQRDEG-LMFDSQSIHRM  671
             +DRFLS  A+ + K W  ++L ++CLSLAAKM    +  L D+Q      +F+ +++ RM
Sbjct  97    VDRFLSSHALPQGKGWPFQLLSVACLSLAAKMEEPTVPTLLDLQVGGARFIFEGRTVRRM  156

Query  670   EGMILSCLKWRLRSITPFSFLH-----FFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIK  506
             E ++LS L WR+RS+TPF+F+H     FF S  P         L+ RA+ ++  + +  +
Sbjct  157   EVLVLSKLGWRMRSVTPFTFIHHFLQNFFNSTSPF--------LLSRATQLVLGTIHGTE  208

Query  505   LFEYNPSVIAASALLYVAEKLIPLQFLSFKNA---IFRCEYVKSDEILNCLSVMRETVTR  335
               ++ PS IAA+A L   + L   +F S K A   IF  + +  +  L+C  +MRE + R
Sbjct  209   FMDFRPSSIAAAAALCAGDDLP--EFPSLKKAKPGIFSIDGLCRESTLSCYQLMREILIR  266

Query  334   GIESSIDAISDCSLTPRS---VLHRESGMMPERDGGM----KRRRLNNFCD  203
               +          ++PRS   VL R    +           KRR+LN  CD
Sbjct  267   RPKPMKTPAPLFRVSPRSPIGVLDRHELPLSSSSYSSSTSNKRRKLNELCD  317



>ref|XP_007018513.1| D5-type cyclin, putative [Theobroma cacao]
 gb|EOY15738.1| D5-type cyclin, putative [Theobroma cacao]
Length=317

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 120/196 (61%), Gaps = 5/196 (3%)
 Frame = -2

Query  928  RREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKM  749
            R EA +   +T+ ++ F    AYL++ Y DRFLSR+++   K W +++L ++CLSLAAKM
Sbjct  67   RLEAITWILKTRAVFGFRFQTAYLSVIYFDRFLSRRSIDSEKSWAMQLLSMACLSLAAKM  126

Query  748  RCIDL-CLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDP  572
              I +  LS+ Q +E   F S+ I RME ++L+ L+WR+ SITPF+FLHFF +    E P
Sbjct  127  EEIKVPALSEFQSEE-CNFKSKVIQRMELLVLNTLEWRMSSITPFAFLHFFITKMCKESP  185

Query  571  SIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFK-NAIFRCE  395
               + L+ +   +I     +I L E+ PSV+AA+A L   ++ +  + L    N++  C 
Sbjct  186  --PRHLVSKTVQLILAIMREINLMEHRPSVVAAAATLRALDQRLTRKALECTMNSVSYCG  243

Query  394  YVKSDEILNCLSVMRE  347
            +++ +++  C S+M++
Sbjct  244  FLEIEDVFTCYSLMQK  259



>ref|XP_010238138.1| PREDICTED: cyclin-D2-1-like isoform X2 [Brachypodium distachyon]
Length=322

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 82/242 (34%), Positives = 136/242 (56%), Gaps = 12/242 (5%)
 Frame = -2

Query  997  LFAGESDHMPSLLSFNHQISFSI----RREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFL  830
            L  GE+D+ P     +   S S+    R ++ +   + Q  Y F    AYLA+NY+DRFL
Sbjct  58   LIGGEADYSPRSDYPDQLRSRSVDPAARADSVAWILKVQVSYGFLPLTAYLAVNYMDRFL  117

Query  829  SRQAVLENKPWVVRILVISCLSLAAKMR-CIDLCLSDIQRDEG-LMFDSQSIHRMEGMIL  656
            S   + E+  W +++L ++CLSLAAKM   +   L D+Q +    +F+ Q+I RME +IL
Sbjct  118  SLHRLPEDG-WAMQLLAVTCLSLAAKMEETLVPSLLDLQAESTRYIFEPQTILRMELLIL  176

Query  655  SCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQS--LIHRASTIIFTSHYDIKLFEYNPSV  482
            + L WRLRS+TPF+F+ FF       DP    +  LI RA+ II  + +DIK  ++ PS 
Sbjct  177  TALNWRLRSVTPFTFIDFFACKV---DPRGKHTRYLIARATQIILAALHDIKFLDHCPST  233

Query  481  IAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVTRGIESSIDAISD  302
            +AA+A+L    +   L F++   A+  C  +  + + +C  +M+  ++    ++ +A++ 
Sbjct  234  MAAAAVLCATGETPTLPFVNPSLAVNWCIGLAEEGVSSCYKLMQPLLSGKRANTAEAVNL  293

Query  301  CS  296
            CS
Sbjct  294  CS  295



>ref|NP_001234758.1| CycD3;3 protein [Solanum lycopersicum]
 emb|CAB60838.1| CycD3;3 [Solanum lycopersicum]
Length=336

 Score =   125 bits (313),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 80/253 (32%), Positives = 142/253 (56%), Gaps = 12/253 (5%)
 Frame = -2

Query  1081  SDLLMEFNLENPLTSSFNDHHHL---DAVPALFAGESDHMPSLLSFNHQISF-SIRREAF  914
             +++L E ++E   T SF+ H  L   + + +LF+ E+++  S        SF S RRE+ 
Sbjct  28    NNILTEVSIE---TESFSSHDLLWEEEELTSLFSKETEYEISYNVLEKNQSFISSRRESV  84

Query  913   SLTYRTQFIYKFDRSIAYLAMNYIDRFL--SRQAVLENKPWVVRILVISCLSLAAKMRCI  740
                 +T   Y F     +LA+NY DRFL  S    L +KPW+ +++ ++CLSLAAK+   
Sbjct  85    EWILKTTAYYSFSAQTGFLAVNYFDRFLLFSFNQSLNHKPWMNQLVAVTCLSLAAKVEET  144

Query  739   DL-CLSDIQRDE-GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI  566
             D+  L D+Q +E G +F+S++I RME +ILS LKW++  +TPFSFL F T    L+   +
Sbjct  145   DVPLLLDLQVEESGFLFESKTIQRMEMLILSTLKWKMNPVTPFSFLDFITRRLGLKH-CL  203

Query  565   AQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVK  386
             +   + R   ++  +  D +   Y PS +A++ +L+V ++L P     +++ +     + 
Sbjct  204   SLEFLRRCEKVLLYTITDDRFIGYLPSAMASATMLHVLDRLKPCIGEKYQDQLLGILGIV  263

Query  385   SDEILNCLSVMRE  347
              +++  C  +++E
Sbjct  264   KEKVEGCYRLIQE  276



>emb|CDP00205.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 91/261 (35%), Positives = 141/261 (54%), Gaps = 13/261 (5%)
 Frame = -2

Query  1099  ASSLFLSDLLMEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS---LLSFNHQ-ISFS  932
             +S++F  D L E + E  + S        +++  L   E  ++P    L SF  Q +  S
Sbjct  18    SSTIFSGDDLPECSSE--IESQHPPEDLEESIIGLIEHEKQYVPGIDYLESFQSQSLDAS  75

Query  931   IRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAK  752
              R ++ +   + Q  Y F    AYL++NY DR L  + + + K W +++L ++CLSLAAK
Sbjct  76    ARADSIAWILKVQRYYGFQPLTAYLSVNYFDRVLYSRRLPQTKGWPLQLLSVACLSLAAK  135

Query  751   M-RCIDLCLSDIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLE  578
             M   +   L D+Q +    +F+ ++I RME ++L+ L WRLRSITPFSFL FF       
Sbjct  136   MEEPLVPPLLDLQVEGAKYIFEPRTIGRMEFLVLNTLDWRLRSITPFSFLSFFAHKV---  192

Query  577   DP--SIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIF  404
             DP  + A  LI RA+ II +   D    EY PS IAA A+L  A  L    FLS + A  
Sbjct  193   DPTGTYAGFLISRANDIILSHIQDASFLEYRPSCIAAVAILSAARDLPIFSFLSPEYAES  252

Query  403   RCEYVKSDEILNCLSVMRETV  341
              C+ +  ++I++C  V+++ +
Sbjct  253   WCDGLHREKIISCYGVVQQII  273



>ref|XP_010272455.1| PREDICTED: cyclin-D5-1-like [Nelumbo nucifera]
Length=341

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 89/256 (35%), Positives = 146/256 (57%), Gaps = 15/256 (6%)
 Frame = -2

Query  934  SIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAA  755
            S R +A     +T+  + F    AYL++ Y+DRFLSR+ +   K W +R+L ++CLSLAA
Sbjct  78   SARLDAILWILKTRAYFGFRFQTAYLSVTYLDRFLSRRTIESGKTWAIRLLSVACLSLAA  137

Query  754  KM-RCIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLE  578
            KM  C    LS+ + DE   F+++ I RME +ILS L+WR+ SITPF++LH+F + +  E
Sbjct  138  KMEECRVPALSEFRVDE-YNFETKVIQRMELLILSTLEWRMGSITPFAYLHYFVTKFCDE  196

Query  577  DPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFK-NAIFR  401
             P   + ++ RA  ++ T   ++ + ++ PS IAA+A+L   ++ +  + + FK  +I  
Sbjct  197  YP--PKCIVSRAMELVLTIIKEMNVMDHRPSAIAAAAVLAALDRRLTSKTVEFKMGSISS  254

Query  400  CEYVKSDEILNCLSVMRETVTRGIE-----SSIDAISDCSLTPRSVLHRESGMMPERDGG  236
            C  +K++ +L+C ++M+E+    +E      S D  S C   P   +  +S  +     G
Sbjct  255  CGSLKNEHVLSCYNLMQESQIGKLEIPRLLISPDPSSICK--PSEDVQEDSSFISA--AG  310

Query  235  MKRRRLNNFCDDQEYC  188
             KRRRL  F D  E C
Sbjct  311  TKRRRL-MFNDGDENC  325



>ref|XP_009401229.1| PREDICTED: cyclin-D4-1-like [Musa acuminata subsp. malaccensis]
Length=346

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/250 (35%), Positives = 136/250 (54%), Gaps = 15/250 (6%)
 Frame = -2

Query  997  LFAGESDHMP----SLLSFNHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFL  830
            L   ES HMP    +    +  +  SIRR A     +    Y      AYL++NY+DRFL
Sbjct  69   LVERESAHMPREDYAERLRSGSLDLSIRRNAIDWILKVHAHYNLGPLSAYLSVNYLDRFL  128

Query  829  SRQAVLENKPWVVRILVISCLSLAAKMRCID--LCLSDIQRDEG-LMFDSQSIHRMEGMI  659
            S   + E K W+ ++L ++CLSLAAKM   D  LCL D+Q  E   +F++++I RME ++
Sbjct  129  STYELPEGKAWMTQLLSVACLSLAAKMEETDVPLCL-DLQVGEAKYVFEARTIRRMELLV  187

Query  658  LSCLKWRLRSITPFSFLHFFTSLYPLEDPSI-AQSLIHRASTIIFTSHYDIKLFEYNPSV  482
            LS LKWR++++TPFSF+ FF  L      S+  ++ I R+  +I ++     L E+ PS 
Sbjct  188  LSTLKWRMQAVTPFSFIDFF--LNKFSGGSVPTKAAIDRSMELILSTIRGSDLLEFRPSE  245

Query  481  IAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE-TVTRGIESSIDAIS  305
             AA+  + V E+    Q +  + A+  C  V  D++L C  V+ +  + R  E   D+IS
Sbjct  246  TAAAITVLVLEQ---TQTMDVEKAVSGCIQVSKDQVLRCYQVIIDMELRRNRELKNDSIS  302

Query  304  DCSLTPRSVL  275
              + +P  VL
Sbjct  303  LKNDSPIGVL  312



>ref|XP_009403082.1| PREDICTED: cyclin-D4-1-like [Musa acuminata subsp. malaccensis]
Length=333

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/273 (32%), Positives = 146/273 (53%), Gaps = 23/273 (8%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSLT  905
             +F ++ PL S        D +  L   E  H+P       L S +  +SF  RR+A    
Sbjct  45    DFYVDFPLQSD-------DCLSLLVEREKKHLPREDYGERLRSGDLDLSF--RRDAIDWM  95

Query  904   YRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCL-  728
             ++    Y F    AY+++NY+DRFLS   + + K W+ ++L ++CLSLAAKM   D+ L 
Sbjct  96    WQVHAHYNFGPLTAYVSVNYLDRFLSAYELPQGKAWMTQLLAVACLSLAAKMEETDVPLF  155

Query  727   SDIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSL-  554
              D+Q  E   +F++++I RME ++LS L+W+++++TPFS++ FF  L+   D +    L 
Sbjct  156   MDLQVGEAKYVFEAKTIQRMELLVLSTLRWKMQAVTPFSYIDFF--LHKFSDGNSPTKLS  213

Query  553   IHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEI  374
             + R++ +I ++  D     + PSVIAA+  L V   L   Q +  +  +  C +V  D++
Sbjct  214   VSRSAELISSTVKDTDFLAFRPSVIAAAIALLV---LRETQMVDVEKKLSCCTHVMKDDV  270

Query  373   LNCLSVMRETVTRGIESSIDAISDCSLTPRSVL  275
             L C  V++  V    +S  D  S  S  P+S L
Sbjct  271   LGCHEVLQNKVLIRQQSIEDVSSSVSSVPQSPL  303



>gb|KDP41628.1| hypothetical protein JCGZ_16035 [Jatropha curcas]
Length=325

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/283 (32%), Positives = 147/283 (52%), Gaps = 29/283 (10%)
 Frame = -2

Query  985  ESDHMPSLLSFNHQISFSIRR---------------EAFSLTYRTQFIYKFDRSIAYLAM  851
            E D++  L  F  +I+F ++R               EA +   +T+  + F    AYL+M
Sbjct  44   EEDYLEML--FEREINFRLKRDQSMDIDNWVKCARLEAITWILKTRAFFGFRLQTAYLSM  101

Query  850  NYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQRDEGLMFDSQSIHR  674
             Y DRFLSR+++   K W V++L ++CLSLAAKM  I +  LS+ Q  E   F+S+ I R
Sbjct  102  TYFDRFLSRRSIDSEKSWAVKLLSVACLSLAAKMEEIKVPSLSEFQ-IEDYNFESRVIQR  160

Query  673  MEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEY  494
            ME ++L+ ++WR+ SITPF FLH+F   +  E P   + ++ R    I     +I L ++
Sbjct  161  MELLVLNTMEWRMISITPFVFLHYFIIKFSEESP--PRHIVSRTVGFILDLMREINLMDH  218

Query  493  NPSVIAASALLYVAEKLIPLQFLSFK-NAIFRCEYVKSDEILNCLSVMRETVTRGIE-SS  320
             PSVIA +A L   ++ +  Q +  K N+I    +++ D++  C S++++     ++  +
Sbjct  219  RPSVIAVAATLMALDQSLTRQAMECKMNSISHSGFLEIDDVFQCYSIIQKLEMENLKIPN  278

Query  319  IDAISDCSLTPRSVLHRESGMMPERDGGMKRRRLNNFCDDQEY  191
            +   S   L P  VL   S      D   KR+R   F  +Q Y
Sbjct  279  LSKSSAGELRPIDVLESSSVTC---DINTKRKR---FAFNQNY  315



>ref|XP_009127780.1| PREDICTED: cyclin-D1-1-like [Brassica rapa]
Length=337

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/240 (36%), Positives = 131/240 (55%), Gaps = 16/240 (7%)
 Frame = -2

Query  1054  ENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFIYKFD  875
             E  + S   D  H   VP L     D++    S    +  S R ++ S   + Q  YKF 
Sbjct  43    EESIASCLEDEGHF--VPGL-----DYLSRFHS--QSLDASAREDSVSWILKVQAYYKFQ  93

Query  874   RSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLC-LSDIQRDEGL-  701
                AYLA+NY+DRFL  + + E   W +++L ++CLSLAAKM  + +  L D Q  EG+ 
Sbjct  94    PLTAYLAVNYMDRFLYARRLPETSGWPMQLLAVACLSLAAKMEEVLVPHLFDFQV-EGVK  152

Query  700   -MFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFT  524
              +F++++I RME ++LS L WRLRS+TPFSFL FF      +  S+   L H A+ II +
Sbjct  153   YIFEAKTIQRMELLVLSVLDWRLRSVTPFSFLSFFAYKIDPQGTSLGLFLTH-ATKIILS  211

Query  523   SHYDIKLFEYNPSVIAASALLYVAEKLIPLQ--FLSFKNAIFRCEYVKSDEILNCLSVMR  350
             +  +    EY PS IAA+A+L VA +L  L       ++    C+ +  ++I+ C  +M+
Sbjct  212   NTKEASFLEYRPSSIAAAAILCVANELPSLSSALNPHESPETWCDGLSKEKIVKCYRLMK  271



>ref|XP_003519458.1| PREDICTED: cyclin-D1-1-like [Glycine max]
 gb|KHN28667.1| Cyclin-D1-1 [Glycine soja]
Length=339

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 128/241 (53%), Gaps = 7/241 (3%)
 Frame = -2

Query  1045  LTSSFNDHHHLDAVPALFAGESDHMPSLLSFNH----QISFSIRREAFSLTYRTQFIYKF  878
             L S        +++      E + +P     N      +  S R E+ +   + Q  Y F
Sbjct  37    LDSPPPSEAEAESIAGFIEDERNFVPGFEYLNRFQSRSLDASAREESVAWILKVQAYYAF  96

Query  877   DRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKM-RCIDLCLSDIQRDEG-  704
                 AYL++NY+DRFL+ + + +   W +++L ++CLSLAAKM   +   L D+Q +   
Sbjct  97    QPLTAYLSVNYLDRFLNSRQLPQTNGWPLQLLSVACLSLAAKMEEPLVPSLLDLQVEGAK  156

Query  703   LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFT  524
              +F+ ++I RME ++L  L WRLRS+TPFSFL FF         +    LI RA+ II +
Sbjct  157   YVFEPKTIRRMELLVLGVLDWRLRSVTPFSFLDFFACKLD-SSGTFTGFLISRATQIILS  215

Query  523   SHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRET  344
             +  +     Y PS IAA+++L+ A ++    F+  ++A   CE ++ ++++ C  +M+E 
Sbjct  216   NIQEASFLAYWPSCIAAASILHAANEIPNWSFVRPEHAESWCEGLRKEKVIGCYQLMQEL  275

Query  343   V  341
             V
Sbjct  276   V  276



>ref|NP_001275138.1| D-type cyclin family 3 subgroup 3 [Solanum tuberosum]
 gb|ABY25837.1| D-type cyclin family 3 subgroup 3 [Solanum tuberosum]
Length=332

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/252 (32%), Positives = 141/252 (56%), Gaps = 12/252 (5%)
 Frame = -2

Query  1078  DLLMEFNLENPLTSSFNDHHHL---DAVPALFAGESDHMPSLLSFNHQISF-SIRREAFS  911
             D+L E ++E   T SF+ H  L   + + +LF+ E+++  S        SF S RRE+  
Sbjct  25    DILTEVSVE---TESFSAHDLLWEEEELTSLFSKETEYKISCNVLEKDQSFISARRESVE  81

Query  910   LTYRTQFIYKFDRSIAYLAMNYIDRFL--SRQAVLENKPWVVRILVISCLSLAAKMRCID  737
                +T   Y F    A+LA+NY DRFL  S    L++KPW++++  ++C SLAAK+   D
Sbjct  82    WILKTTAYYSFSAQTAFLAVNYFDRFLLFSFNQSLKHKPWMIQLAAVTCPSLAAKVEETD  141

Query  736   L-CLSDIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIA  563
             +  L D+Q +E   +F+S++I RME ++LS LKW++  +TPFSFL F T    L+   ++
Sbjct  142   VPLLLDLQVEESRFVFESKTIQRMEMLVLSTLKWKMNPVTPFSFLDFITRRLGLK-YCLS  200

Query  562   QSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKS  383
                + R   ++  +  D +   Y PS +A++ +L+V ++L P     +++ +     +  
Sbjct  201   LEFLRRCEKVLLYTITDGRFIGYLPSAMASATMLHVLDRLKPCIGEKYQDQLLGILGIVK  260

Query  382   DEILNCLSVMRE  347
             D++  C  +++E
Sbjct  261   DKVEECYRLIQE  272



>ref|XP_009391337.1| PREDICTED: cyclin-D3-1-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=347

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 88/283 (31%), Positives = 151/283 (53%), Gaps = 24/283 (8%)
 Frame = -2

Query  1096  SSLFLSDLLMEFNLENPLTSSFNDHHHLDAVPALFAGESDHMP----SLLSFNHQISFSI  929
             SS F  D L++F    P+ S        + V  L   E++HMP    ++   +  +  +I
Sbjct  42    SSDFYGDFLVDF----PVQSD-------ECVGLLVGRETEHMPREDYAVRLRSGALDLAI  90

Query  928   RREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKM  749
             RR+A    ++    Y F    AYLA+NY+DRFLS   +   K W+ ++L ++CLSLAAKM
Sbjct  91    RRDATDWIWKVHAQYSFGPLSAYLAVNYMDRFLSAYELPRGKAWMSQLLSVACLSLAAKM  150

Query  748   RCIDLCLS-DIQ-RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLED  575
                ++ LS D+Q  D   +F++++I RME ++LS LKWR++++TPFSF+ FF   +   +
Sbjct  151   EETEVPLSLDLQVGDAKYIFEARTIQRMEQLVLSTLKWRMQAVTPFSFIDFFLHKFNGGN  210

Query  574   PSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCE  395
              + ++ L+ R+  +I  +   I+   + PS +AA+  L V   L   Q +  + A+  C 
Sbjct  211   -APSKLLVSRSVELILGTIRGIEFLAFRPSELAAAVSLSV---LRETQNVEAEKALSCCV  266

Query  394   YVKSDEILNCLSVMRETVT---RGIESSIDAISDCSLTPRSVL  275
             +V  + +  C  +++E +    R +E +    S    +P  VL
Sbjct  267   HVVKEGVFRCYEMIQELMAVRGRSLEIASPLASYVPQSPNGVL  309



>ref|XP_009801107.1| PREDICTED: cyclin-D2-1-like [Nicotiana sylvestris]
Length=359

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 80/224 (36%), Positives = 133/224 (59%), Gaps = 11/224 (5%)
 Frame = -2

Query  997  LFAGESDHMPSLLSF----NHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFL  830
            +   ES+HMP++  F    N  +    R E      +    + F    AYLA+NY+DRFL
Sbjct  74   MIEKESEHMPAVDYFDRLRNGDLDIGARDEILDWIAKVHSHFSFGPMCAYLAVNYLDRFL  133

Query  829  SRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQ-RDEGLMFDSQSIHRMEGMIL  656
            S   + + K W++++L ++CLSLAAKM   D+ LS D+Q  D   +F++++I RME ++L
Sbjct  134  SAYDLPKGKAWMMQLLGVACLSLAAKMEETDVPLSLDLQVEDAKFVFEARTIQRMELLVL  193

Query  655  SCLKWRLRSITPFSFLHFFTSLYPLEDPSIA-QSLIHRASTIIFTSHYDIKLFEYNPSVI  479
            S LKWR+++ITPFSF  +F  L  + D  IA +SLI+++  +I ++   I   EY PS I
Sbjct  194  STLKWRMQAITPFSFTDYF--LKKITDDQIASRSLINKSVQLILSTLKGIHFLEYKPSEI  251

Query  478  AASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE  347
            AA+  + VA K   +      +A+   ++V+ D+++ C+ +++E
Sbjct  252  AAAVAISVAVKTETIDSEKAISALV--QHVQKDKVMKCVELIQE  293



>ref|XP_003562933.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-D6-1 [Brachypodium distachyon]
Length=285

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 104/189 (55%), Gaps = 11/189 (6%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFIY  884
             F+LENP TS  ++      + +L   E  H           S   +   F    R     
Sbjct  15    FDLENPFTSPADE-----PIASLLDAEGPHS--PSVSAAASSARRQAAGFISKVRYDGEL  67

Query  883   KFDRSIAYLAMNYIDRFLS-RQAVLENKPWVVRILVISCLSLAAKMRCID-LCLSDIQRD  710
                  +AYLA+NY+DR+LS RQ   E+KPW  R+L +SCLS+AAKM+ +D + ++DIQRD
Sbjct  68    AVHPRVAYLALNYVDRYLSKRQLPCEHKPWAPRLLAVSCLSIAAKMQRVDAISIADIQRD  127

Query  709   EGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTS--LYPLEDPSIAQSLIHRAST  536
             E  MFD+ SI RME ++L  L+WR RS+TP +FL FF S    P   P +  ++  RA  
Sbjct  128   EEFMFDAVSIRRMERLVLGALEWRARSVTPLAFLGFFLSECFPPPRHPPLLAAVKARAVD  187

Query  535   IIFTSHYDI  509
             ++  +  D+
Sbjct  188   LLLRAQPDL  196



>ref|XP_004141404.1| PREDICTED: cyclin-D5-1-like [Cucumis sativus]
 gb|KGN55270.1| hypothetical protein Csa_4G642510 [Cucumis sativus]
Length=317

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 86/301 (29%), Positives = 154/301 (51%), Gaps = 26/301 (9%)
 Frame = -2

Query  1030  NDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRRE---------------AFSLTYRT  896
             ++H  +D      A E D++ +LL    + SF  R++               A +   +T
Sbjct  14    DEHTFIDIANPSPAEEDDYVDTLLV--KETSFGFRKDKSLMFGNWMKCARLDAIAWILKT  71

Query  895   QFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDI  719
             + ++ F    AYL+M Y DRFLSR+A+   K W +R+L ++CLSLA+KM  + +  LS+ 
Sbjct  72    RNVFGFGCQTAYLSMIYFDRFLSRRAITNEKLWAIRLLAVACLSLASKMEELKVPALSEF  131

Query  718   QRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAS  539
               D+   F+S+ I RME ++L+ L+W++ S TPFSF+ +F S   +E P    + + +  
Sbjct  132   PVDD-FNFESKVIQRMELLVLNTLEWKMGSTTPFSFIPYFISKLSIESP--PSNKVSQIV  188

Query  538   TIIFTSHYDIKLFEYNPSVI-AASALLYVAEKLIPLQFLSFK-NAIFRCEYVKSDEILNC  365
              +I+    +     + PSV+ AA+A+L   +  +  + L  K  +I +C Y++ +E+++C
Sbjct  189   ELIWVMIRETSTQNHRPSVVAAATAILATMDDRLTRKALQLKMKSISQCRYLEVEEVISC  248

Query  364   LSVMRETVTRGIESSIDAISDCSLTPRSVLHRESGMMPERDGGM--KRRRLNNFCDDQEY  191
              ++M+E          D +    L+P  +   +          +  KR+RL NF +  E 
Sbjct  249   YNLMQELRLEKCREEADCLKSPDLSPTQMKSMDCSENSSVTSSLASKRKRL-NFSNLDEK  307

Query  190   C  188
             C
Sbjct  308   C  308



>ref|XP_009394048.1| PREDICTED: cyclin-D3-1-like [Musa acuminata subsp. malaccensis]
Length=353

 Score =   122 bits (306),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 135/258 (52%), Gaps = 19/258 (7%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAM  851
             D V  +   ES H+P       LL    Q+  +IR +A     +    ++F    AYL++
Sbjct  65    DCVALMVERESQHLPQGDYVKRLL--RGQLDLAIRSDAIDWIQKVHAHHRFGPLSAYLSV  122

Query  850   NYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQRDEG-LMFDSQSIH  677
             NY+DRFLS     + K W+ ++L ++CLSLAAK    ++  S D+Q  E   +F+++++ 
Sbjct  123   NYLDRFLSSYEHSQGKAWMTQLLSVACLSLAAKADETEVLSSLDLQIGEARYVFEARTVQ  182

Query  676   RMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQ-SLIHRASTIIFTSHYDIKLF  500
             RME ++LS LKWR++ +TPFSF+ +F  LY   D  +   SL+ R+  +I  +  +I   
Sbjct  183   RMELLVLSTLKWRMQVVTPFSFIDYF--LYKFSDGIVPDSSLVSRSVGLILGTVREIDFL  240

Query  499   EYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETV---TRGI  329
             E+ PS IAA+  L   +K    Q L    A+  C +V  + +L C  V++E      R  
Sbjct  241   EFRPSEIAAAVALTALKK---TQVLEVGKAVTCCNHVDMERVLRCNEVIQEMTLMKNRRY  297

Query  328   ESSIDAISDCSLTPRSVL  275
             +    ++S    +P  VL
Sbjct  298   KKGGSSVSTAPKSPIGVL  315



>ref|XP_009381630.1| PREDICTED: cyclin-D2-1-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=314

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 86/289 (30%), Positives = 147/289 (51%), Gaps = 37/289 (13%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPSLLSFNHQISFS-------IRREAFSLTYRTQFIYKFDRSIAYLA  854
             +++  L A E+D+ P    F++   F         R+EA +   +    Y F    AYLA
Sbjct  43    ESIAGLIAAETDYSPG---FDYPDRFRSKSLDSVARQEAVAWILKVHVYYGFRPLTAYLA  99

Query  853   MNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQRDEG-LMFDSQSI  680
             +NY+DRFLS   + +N+ W +++L ++CLSLAAK+    L  L D+Q +    +F+ ++I
Sbjct  100   VNYLDRFLSSHRLPQNE-WALQLLSVACLSLAAKLEETLLPSLLDLQVEGAKFIFEPRTI  158

Query  679   HRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPS--IAQSLIHRASTIIFTSHYDIK  506
              RME ++L+ L WRLRS+TPF+F++FF       DP+   A+SL+ R + I   +  DIK
Sbjct  159   LRMELLVLNALNWRLRSVTPFTFINFFVHKI---DPAGKYARSLVSRVTEITLATTKDIK  215

Query  505   LFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVTRGIE  326
                + PS +AA++++   +++  L F++   A   C  +  + I +C   +++ +     
Sbjct  216   FLSHRPSSLAAASIICATDEVKDLTFVNPGIAASWCTGLIEEGIADCYQSLKQVI-----  270

Query  325   SSIDAISDCSLTPRSVLHRESGMMPERDGGM---------KRRRLNNFC  206
                  +      P  +L +     P   G           KRR+LNN C
Sbjct  271   -----VDITRREPPMILPQLRVATPMNMGPSVSSSSSPPNKRRKLNNNC  314



>emb|CAA71244.1| cyclin-D like protein [Oxybasis rubra]
Length=372

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/256 (33%), Positives = 142/256 (55%), Gaps = 13/256 (5%)
 Frame = -2

Query  1093  SLFLSDLLMEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSF----NHQISFSIR  926
             +L L  ++ E N E  ++  F  +H  + + +LF  E  H   L       N  +    R
Sbjct  52    TLILLIIIKEHNFEALISGFFVANH--ECLASLFDNERQHFLGLDYLKRFRNGDLDLGAR  109

Query  925   REAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMR  746
                    ++ Q  Y F     YL++NY+DRFLS    L  K W++++L ++CLSLAAK+ 
Sbjct  110   NLVIDWIHKVQSHYNFGPLCVYLSVNYLDRFLSAYE-LPGKAWMMQLLGVACLSLAAKVD  168

Query  745   CIDLCLS-DIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLE-D  575
               D+ L  D+Q  E   +F++++I RME ++LS LKWR++S+TPFSF+ +F  LY L  D
Sbjct  169   ETDVPLILDLQVSESKFVFEAKTIQRMELLVLSTLKWRMQSVTPFSFIDYF--LYKLSGD  226

Query  574   PSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCE  395
                ++SLI +A  +I ++   I L E+ PS IAA+  + V ++   ++F   K   F  +
Sbjct  227   KMPSKSLIFQAIQLILSTIKGIDLMEFRPSEIAAAVAISVTQQTQIVEFTD-KAFSFLTD  285

Query  394   YVKSDEILNCLSVMRE  347
             +V+ + ++ C+ +M +
Sbjct  286   HVEKERLMKCVEIMHD  301



>ref|XP_002283315.1| PREDICTED: cyclin-D5-1 [Vitis vinifera]
 ref|XP_010664519.1| PREDICTED: cyclin-D5-1 [Vitis vinifera]
 emb|CBI19408.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 138/248 (56%), Gaps = 8/248 (3%)
 Frame = -2

Query  928  RREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKM  749
            R +A +   RT+ ++ F    AYL + Y+DRFLSR+A+  +K W +R+L ++CLSLAAKM
Sbjct  67   RLDAVAWILRTRAVFGFRFQTAYLCVAYLDRFLSRRAIDSDKTWAIRLLSVACLSLAAKM  126

Query  748  -RCIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDP  572
              C    LS+   +E   F+S+ I RME ++L+ L+WR+ SITPF+F+H+F + +  + P
Sbjct  127  EECRAPALSEFAVEE-YNFESKVIQRMELLVLNTLEWRMGSITPFAFIHYFITKFCNQSP  185

Query  571  SIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFK-NAIFRCE  395
                +++ R   +      +I L ++ PSVIAA+A+L   ++ +    L  K NAI  C 
Sbjct  186  --PPNVVSRTVQLTMAIMREINLMDHRPSVIAAAAVLVALDQRLTRNELESKMNAISSCG  243

Query  394  YVKSDEILNCLSVMRETVTRGIESSIDAISDCSLTPRSVLHRESGMMPERDGGMKRRRLN  215
             ++ +++ +C SV++         S++  S   L P   +H  S +        KR+RL 
Sbjct  244  SLQPEDVFSCYSVVQGLDKEKCALSLNP-STTQLRPAVDVHENSSVTSA--ASTKRKRLT  300

Query  214  NFCDDQEY  191
             +  D  Y
Sbjct  301  FYDCDPNY  308



>ref|XP_010675548.1| PREDICTED: cyclin-D4-1 [Beta vulgaris subsp. vulgaris]
Length=356

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 121/197 (61%), Gaps = 6/197 (3%)
 Frame = -2

Query  928  RREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKM  749
            R +A    ++ Q  Y       YL++NY+DRFLS   +   K W++++L +SC+S+AAKM
Sbjct  97   RNQAIDWIHKVQSHYNLGPLCVYLSVNYLDRFLSAYELPNGKAWMMQLLAVSCVSIAAKM  156

Query  748  RCIDLCLS-DIQ-RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLE-  578
               D+ LS D+Q  D   +F++++I RME +++S LKWR++S+TPFSF+ +F  LY L  
Sbjct  157  EETDVPLSIDLQVGDSKFVFEAKTIQRMELLVMSTLKWRMQSVTPFSFIDYF--LYKLSG  214

Query  577  DPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRC  398
            D    +SLI +A  +I ++   I L E+ PS IAA+  ++V ++   ++ L+ K   F  
Sbjct  215  DQMPPRSLISQAIQLIISTIKGIDLMEFRPSEIAAAVAIFVTQETQIVE-LTDKAFSFLS  273

Query  397  EYVKSDEILNCLSVMRE  347
            ++V+ + ++ C+  + +
Sbjct  274  DHVEKERMMQCVEFLHD  290



>ref|XP_009417607.1| PREDICTED: cyclin-D4-1-like [Musa acuminata subsp. malaccensis]
Length=350

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 130/228 (57%), Gaps = 9/228 (4%)
 Frame = -2

Query  943  ISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLS  764
            +  +IRR+A     +    Y F    AYLA+NY+DRFLS   + + K W+ ++L ++CLS
Sbjct  89   LDLAIRRDAIDWILKVHAHYSFGPLSAYLAVNYLDRFLSGYELPQGKAWMTQLLSVACLS  148

Query  763  LAAKMRCIDLCLS-DIQ-RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSL  590
            LAAKM   ++ LS D+Q  D   +F++++I RME ++LS LKWR++++TPFS++ FF   
Sbjct  149  LAAKMEETEVPLSLDLQVGDAKYVFEAKTIQRMELLVLSTLKWRMQAVTPFSYVDFFLHK  208

Query  589  YPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNA  410
            +    P  ++ L++R+  +I +      L  + PS +AA+  L     L   Q +  + A
Sbjct  209  FNGGSPP-SKILVYRSVELILSMARGTDLLVFRPSEVAAAIAL---SALRETQVVEVEKA  264

Query  409  IFRCEYVKSDEILNCLSVMRETV---TRGIESSIDAISDCSLTPRSVL  275
            +  C +V  + +L C  V+++ +   +R  + +I ++S    +P  VL
Sbjct  265  LSCCIHVVQEGVLRCFEVIQDLMAVRSRPRKIAISSVSSLPQSPIGVL  312



>ref|XP_006390912.1| hypothetical protein EUTSA_v10018896mg [Eutrema salsugineum]
 gb|ESQ28198.1| hypothetical protein EUTSA_v10018896mg [Eutrema salsugineum]
Length=317

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 86/242 (36%), Positives = 134/242 (55%), Gaps = 20/242 (8%)
 Frame = -2

Query  1054  ENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFIYKFD  875
             ++ + S   D  H   VP L     D++    S    +  S+R E+ S   + Q  Y F 
Sbjct  27    DDSIASCIEDERHF--VPGL-----DYLSRFQS--QSLDASVREESVSWILKVQAYYNFQ  77

Query  874   RSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQRDEGL-  701
                AYLA+NY+DRFL  + + E   W +++L ++CLSLAAKM  I +  L D Q  EG+ 
Sbjct  78    PLTAYLAVNYMDRFLYARRLPETSGWPMQLLAVACLSLAAKMEEILVPSLFDFQV-EGVK  136

Query  700   -MFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDP--SIAQSLIHRASTII  530
              +F++++I RME ++LS L WRLRS+TPFSFL FF   Y + DP  +     +  A+ II
Sbjct  137   YIFEAKTIKRMELLVLSVLDWRLRSVTPFSFLSFFA--YKI-DPLGTFLGLFLSHATEII  193

Query  529   FTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSF--KNAIFRCEYVKSDEILNCLSV  356
              ++  +    EY PS IAA+A+L VA +L  L   +   ++    C+ +  ++I+ C  +
Sbjct  194   LSNIKEASFLEYRPSSIAAAAILCVANELPSLSSAANPPESPETWCDGLSKEKIVRCYRL  253

Query  355   MR  350
             M+
Sbjct  254   MK  255



>ref|XP_010939736.1| PREDICTED: cyclin-D3-1-like [Elaeis guineensis]
Length=349

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 131/229 (57%), Gaps = 11/229 (5%)
 Frame = -2

Query  943  ISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLS  764
            +  SIRRE+    ++    Y F    AYL++NY+DRFLS   + + K W+ ++L ++CLS
Sbjct  88   LDLSIRRESIDWIWKVHAHYSFGPLSAYLSVNYLDRFLSTYELPQGKAWMTQLLSVACLS  147

Query  763  LAAKMRCIDL-CLSDIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSL  590
            LAAKM   ++  L D+Q  +   +F++++I RME ++LS LKW+++++TPFSF+ +F  L
Sbjct  148  LAAKMEETEVPLLLDLQVGQSKYVFEARTIQRMELLVLSTLKWKMQAVTPFSFIDYF--L  205

Query  589  YPLEDP-SIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKN  413
            +   D  S ++ LI R++ +I  +        + PS IAA+  L V   L   Q +  + 
Sbjct  206  HKFNDGNSSSKLLISRSTELILNTVRGTAFLAFRPSEIAAAVALSV---LGETQTVDVEK  262

Query  412  AIFRCEYVKSDEILNCLSVMRETV---TRGIESSIDAISDCSLTPRSVL  275
             +  C ++  + +L C  V++E V    R ++++   +S    +P +VL
Sbjct  263  GVSCCIHISKERVLRCYEVIQENVLMRNRLLKNASPTVSSVPWSPIAVL  311



>ref|XP_006338089.1| PREDICTED: cyclin-D2-1-like [Solanum tuberosum]
Length=356

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 90/305 (30%), Positives = 156/305 (51%), Gaps = 41/305 (13%)
 Frame = -2

Query  1033  FNDHHHLDAVPA--------LFAGESDHMPSLLSF----NHQISFSIRREAFSLTYRTQF  890
             FN       VP         +   E +HMP++       N  +    R E      +   
Sbjct  54    FNGEEFYTGVPLQSDECLVLMIGKECEHMPAVDYLERLRNGDLDIGARDEILDWIAKVHS  113

Query  889   IYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQ-  716
              + F    AYLA+NY+DRFLS   + + K W++++L ++CLS+AAKM   D+ LS D+Q 
Sbjct  114   QFNFGPMCAYLAVNYLDRFLSAYDLPKEKAWMMQLLGVACLSIAAKMEETDVPLSLDLQG  173

Query  715   RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAST  536
              D   +F++++I RME ++L+ LKWR+++ITPFS++ +F  +  + +  I  S I+++  
Sbjct  174   GDAKFVFEAKTIQRMELLVLTTLKWRMQAITPFSYIDYF--IKKINNDQI--SSINKSVE  229

Query  535   IIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSV  356
             +I ++   I   E+ PSVIAA+  +  A K   +      +A+   ++V+ D+++ C+ +
Sbjct  230   LILSTLKGIHFLEFKPSVIAAAVAISFAVKTETVDSDKALSALV--QHVQKDKLMKCIEL  287

Query  355   MRE------TVTRGIESSIDAISDCSLTPRSVL------HRESGMMPE------RDGGMK  230
             ++E       V   I SSI ++     +P  VL      +R  G   E       +  +K
Sbjct  288   IQELSLASDLVKVPIASSITSVPQ---SPIGVLDAACLSYRTDGSGVESRSNSSHNSPVK  344

Query  229   RRRLN  215
             RR+LN
Sbjct  345   RRKLN  349



>ref|XP_004956724.1| PREDICTED: cyclin-D2-1-like isoform X3 [Setaria italica]
Length=331

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/248 (33%), Positives = 131/248 (53%), Gaps = 18/248 (7%)
 Frame = -2

Query  1039  SSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSI----RREAFSLTYRTQFIYKFDR  872
             S+  +     ++  L  GE+D+ P     +   S SI    R E+ +   + Q  Y F  
Sbjct  44    SAGEEAESAASIAELIGGEADYSPRPDYPDRLRSRSIDPAARAESVAWILKVQEYYGFLP  103

Query  871   SIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMR------CIDLCLSDIQRD  710
               AYLA+NY+DRFLS   + +   W + +L ++CLSLAAKM        +DL +  I R 
Sbjct  104   LTAYLAVNYMDRFLSLHRLPQEDGWAMELLAVTCLSLAAKMEETLVPSLLDLQVEGISR-  162

Query  709   EGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI--AQSLIHRAST  536
                +F+  +I RME ++L+ L WRLRS+TPF+F+ FF       DP     + LI RA+ 
Sbjct  163   --YVFEPGTIGRMELLVLTALNWRLRSVTPFTFIDFFACKV---DPGGRHTRCLIARATQ  217

Query  535   IIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSV  356
             +I  + +DI+  ++ PS +AA+A+L    +   L+ +S   A+  C  +  + I +C  +
Sbjct  218   VILAAMHDIEFLDHCPSAMAAAAVLCATGETPSLESVSPGAAVGWCIGLAEETIGSCYRL  277

Query  355   MRETVTRG  332
             M++ V  G
Sbjct  278   MQQLVIGG  285



>ref|XP_007157500.1| hypothetical protein PHAVU_002G074800g [Phaseolus vulgaris]
 gb|ESW29494.1| hypothetical protein PHAVU_002G074800g [Phaseolus vulgaris]
Length=444

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 75/230 (33%), Positives = 122/230 (53%), Gaps = 7/230 (3%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPSLLSFNH----QISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNY  845
             D++      E   +P     N      +  S R E+ +   + Q  Y F    AYL++NY
Sbjct  154   DSIAGFIEDERHFVPGFEYLNRFQSRSLDASAREESVAWILKVQACYAFQPLTAYLSVNY  213

Query  844   IDRFLSRQAVLENKPWVVRILVISCLSLAAKM-RCIDLCLSDIQRDEG-LMFDSQSIHRM  671
             +DRFL+ + + +   W  ++L ++CLSLAAKM   +   L D+Q +    +F+ ++I RM
Sbjct  214   MDRFLNSRTLPQTNGWPFQLLSVACLSLAAKMEEPLVPSLLDLQAEGAKYLFEPRTIRRM  273

Query  670   EGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYN  491
             E ++LS L WRLRS+TPFSFL FF         +    LI RA+ II ++  +     Y 
Sbjct  274   ELLVLSVLDWRLRSVTPFSFLDFFACKLD-STGTFTGFLISRATQIILSNIQEASFLAYW  332

Query  490   PSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETV  341
             PS IA +A+L+ A ++     +  ++A   CE +  ++I+ C  +M+E V
Sbjct  333   PSCIAVAAILHAANEIPNWSLVRPEDAESWCEGLIKEKIIGCYQLMQELV  382



>ref|XP_008802301.1| PREDICTED: cyclin-D4-1-like [Phoenix dactylifera]
Length=348

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 120/222 (54%), Gaps = 12/222 (5%)
 Frame = -2

Query  985  ESDHMP----SLLSFNHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQA  818
            ES+H+P    +    +  +  SIRREA     +    Y F    AYL+ NY+DRFLS   
Sbjct  69   ESEHLPRGDYAERLRSGALDLSIRREAVDWILKVHANYSFGPLSAYLSANYLDRFLSTYE  128

Query  817  VLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQRDEG-LMFDSQSIHRMEGMILSCLK  644
            + + K W  ++L ++CLSLA KM   ++  L D+Q  E   +F++++I RME ++LS LK
Sbjct  129  LPQGKAWTTQLLSVACLSLATKMEETEVPLLLDLQVGESKYVFEARTIQRMELLVLSTLK  188

Query  643  WRLRSITPFSFLHFFTSLYPLEDPSIAQSL-IHRASTIIFTSHYDIKLFEYNPSVIAASA  467
            WR++++TPFSF+ +F  LY   D +    L I R+  +I ++        + PS IAA+ 
Sbjct  189  WRMQAVTPFSFIDYF--LYKFNDGNSPTKLSISRSMELILSTMRGTDFLAFRPSEIAAAV  246

Query  466  LLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETV  341
             L V   L   Q +     +  C ++  + +L C  V++E +
Sbjct  247  ALSV---LGETQTVDVDKGVSSCIHIAKERVLRCYEVIQEII  285



>ref|XP_008452642.1| PREDICTED: cyclin-D5-2-like [Cucumis melo]
Length=317

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 88/301 (29%), Positives = 152/301 (50%), Gaps = 26/301 (9%)
 Frame = -2

Query  1030  NDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRRE---------------AFSLTYRT  896
             ++H  +D      A E D++  LL    + SF  R++               A +   +T
Sbjct  14    DEHTFIDIGNPSPAEEDDYVDILLV--KETSFGFRKDKSLVLGNWMKCARLDAIAWILKT  71

Query  895   QFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDI  719
             + ++ F    AYL+M Y DRFLSR+A+   K W +R+L ++CLSLAAKM  + +  LS+ 
Sbjct  72    RNVFGFGCQTAYLSMIYFDRFLSRRAITNEKLWAIRLLAVACLSLAAKMEELKVPALSEF  131

Query  718   QRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRAS  539
               D+   F+S+ I RME ++L+ L+W++ S TPFSF+ +F S   +E P    + + +  
Sbjct  132   PVDD-FNFESKVIQRMELLVLNTLEWKMGSTTPFSFIPYFISKLSIESP--PSNKVSQIV  188

Query  538   TIIFTSHYDIKLFEYNPSVIA-ASALLYVAEKLIPLQFLSFK-NAIFRCEYVKSDEILNC  365
              +I+    +     + PSV+A A+A+L   +  +  + L  K  +I +C Y++ +E+++C
Sbjct  189   ELIWVMIRETNTQNHRPSVVAVATAILATMDDRLTRKALELKMKSISQCRYLELEEVISC  248

Query  364   LSVMRETVTRGIESSIDAISDCSLTPRSV--LHRESGMMPERDGGMKRRRLNNFCDDQEY  191
              ++M+E          D +    L+P  +  L              KR+RL NF +  E 
Sbjct  249   YNLMQELRLEKCREEADCLKSPDLSPTQMKPLDCSENSSVTSSIASKRKRL-NFSNLDEK  307

Query  190   C  188
             C
Sbjct  308   C  308



>emb|CDY67142.1| BnaAnng23660D [Brassica napus]
Length=339

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 87/242 (36%), Positives = 131/242 (54%), Gaps = 18/242 (7%)
 Frame = -2

Query  1054  ENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFS--LTYRTQFIYK  881
             E  + S   D  H   VP L     D++    S    +  S R ++ S  L    Q  YK
Sbjct  43    EESIASCLEDEGHF--VPGL-----DYLSRFHS--QSLDASAREDSVSWILKASVQAYYK  93

Query  880   FDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLC-LSDIQRDEG  704
             F    AYLA+NY+DRFL  + + E   W +++L ++CLSLAAKM  + +  L D Q  EG
Sbjct  94    FQPLTAYLAVNYMDRFLYARRLPETSGWPMQLLAVACLSLAAKMEEVLVPHLFDFQV-EG  152

Query  703   L--MFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTII  530
             +  +F++++I RME ++LS L WRLRS+TPFSFL FF      +  S+   L H A+ II
Sbjct  153   VKYIFEAKTIQRMELLVLSVLDWRLRSVTPFSFLSFFAYKIDPQGTSLGLFLTH-ATKII  211

Query  529   FTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQ--FLSFKNAIFRCEYVKSDEILNCLSV  356
              ++  +    EY PS IAA+A+L VA +L  L       ++    C+ +  ++I+ C  +
Sbjct  212   LSNTKEASFLEYRPSSIAAAAILCVANELPSLSSALNPHESPETWCDGLSKEKIVKCYRL  271

Query  355   MR  350
             M+
Sbjct  272   MK  273



>ref|XP_010272942.1| PREDICTED: cyclin-D3-1-like [Nelumbo nucifera]
Length=359

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 129/228 (57%), Gaps = 10/228 (4%)
 Frame = -2

Query  943  ISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLS  764
            +   +RREA     +    Y F    AYL++NY+DRFLS   +   K W++++L ++CLS
Sbjct  95   LDLGVRREAIDWIQKAHAYYNFGPLSAYLSINYLDRFLSAYELPRGKAWMMQLLAVACLS  154

Query  763  LAAKMRCIDLCLS-DIQRDE-GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSL  590
            LAAKM   ++ LS D+Q  E   +F++++I RME ++LS LKWR++++TPFS++ +F  L
Sbjct  155  LAAKMEETEVPLSLDLQVGETKFVFEARTIQRMELLVLSTLKWRMQAVTPFSYIEYF--L  212

Query  589  YPLEDPSIAQSL-IHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKN  413
            + + D      L I R+  +I ++   I    Y PS IAA+  + V  +    + +  + 
Sbjct  213  FKINDDQPPSRLCISRSIQLILSTMKGIDFLNYRPSEIAAAVAMSVCRE---AKTVDIEK  269

Query  412  AIFRCEYVKSDEILNCLSVMRET--VTRGIESSIDAISDCSLTPRSVL  275
            AI    +V+ + ++ CL ++R+   ++  ++    +IS    +P  VL
Sbjct  270  AISCFAHVEKERVVKCLELIRDMSLISGFVKVGSGSISSVPHSPIGVL  317



>ref|XP_004237975.1| PREDICTED: cyclin-D2-1-like [Solanum lycopersicum]
Length=355

 Score =   119 bits (298),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 87/281 (31%), Positives = 145/281 (52%), Gaps = 32/281 (11%)
 Frame = -2

Query  985  ESDHMPSLLSF----NHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQA  818
            E +HMP++       N  +    R E      +    + F    AYLA+NY+DRFLS   
Sbjct  82   ECEHMPAVDYLERLRNGDLDIGARDEILDWIAKVHSQFNFGPMCAYLAVNYLDRFLSAYD  141

Query  817  VLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQ-RDEGLMFDSQSIHRMEGMILSCLK  644
            + + K W++++L ++CLS+AAKM   D+ LS D+Q  D   +F++++I RME ++L+ LK
Sbjct  142  LPKEKAWMMQLLGVACLSIAAKMEETDVPLSLDLQGGDAKFVFEAKTIQRMELLVLTTLK  201

Query  643  WRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASAL  464
            WR+++ITPFS++ +F       D     S I+++  +I ++   I   E+ PSVIAA+  
Sbjct  202  WRMQAITPFSYIDYFIKKINNSD---QISSINKSVELILSTLKGINFLEFKPSVIAAAVA  258

Query  463  LYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNC------LSVMRETVTRGIESSIDAISD  302
            +  A K   L      +A+   ++V+ D+++ C      LS+  + V   I SSI ++  
Sbjct  259  ISFAVKTETLDSEKALSALV--QHVQKDKVMKCVELIQALSLASDFVKVPIASSIPSVPQ  316

Query  301  CSLTPRSVLHR------------ESGMMPERDGGMKRRRLN  215
               +P  VL              ES      +  +KRR+LN
Sbjct  317  ---SPIGVLDAACLSYTSDGSGVESRSNSSHNSPVKRRKLN  354



>ref|XP_010531357.1| PREDICTED: cyclin-D2-1-like [Tarenaya hassleriana]
Length=348

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/233 (32%), Positives = 125/233 (54%), Gaps = 10/233 (4%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPSLLSFNH----QISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNY  845
             D +  +   E+D +P                +R EA    ++    Y F      L+MNY
Sbjct  62    DRIREMLERETDFLPGNDYLKRLRAGDFELCVRNEALDWIWKACDHYHFGPQCVCLSMNY  121

Query  844   IDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQ-RDEGLMFDSQSIHRM  671
             +DRFLS   + ++K W V++L +SCLSLAAKM   D+  S D+Q  D   +F+++++ RM
Sbjct  122   LDRFLSSYELPKDKAWAVQLLAVSCLSLAAKMDETDMPQSIDLQVGDPKFLFEAKTLQRM  181

Query  670   EGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYN  491
             E ++L+ L WRL+ +TPFSF+ +F S    + PS  ++ I R+S +I  +   I+  +Y 
Sbjct  182   ELLVLNTLNWRLKVLTPFSFIDYFLS-KTTDHPS--ENSISRSSELILNTARGIEFLDYR  238

Query  490   PSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVTRG  332
             PS IAA+  + ++     ++ +  + AI    +VK + +  CL ++ E   RG
Sbjct  239   PSEIAAATAVAISIS-GEMEVIENEKAICSLSHVKQERVAKCLRMVTEKNRRG  290



>ref|XP_004143552.1| PREDICTED: cyclin-D2-1-like [Cucumis sativus]
 ref|XP_004170914.1| PREDICTED: cyclin-D2-1-like [Cucumis sativus]
 gb|KGN48716.1| hypothetical protein Csa_6G499110 [Cucumis sativus]
Length=366

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 136/247 (55%), Gaps = 15/247 (6%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSLTY  902
             F  EN L SS  +    + V  +   E +H+P+      +LS +  + F  RREA    +
Sbjct  43    FGSENFLGSSVLESE--ERVKRMVEKEIEHLPTHDYLKRMLSGDLDLKF--RREAVDWIW  98

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS-  725
             +    Y F      L+MNY+DRFLS   +  +K W V++L ++C+SLAAKM   ++ L  
Sbjct  99    KAHAHYSFGPLSLCLSMNYLDRFLSVYHLPMDKSWTVQLLSVACMSLAAKMEETEVPLPI  158

Query  724   DIQRDE-GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIH  548
             D+Q +E   +F++++I RME ++LS LKW++++ITPFSF+ +F S   +E  +I      
Sbjct  159   DLQVEEPKFVFEAKTIQRMELLVLSRLKWKMQAITPFSFIDYFLSKISVEQQNIPNLYFS  218

Query  547   RASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILN  368
             ++S +I ++   I   E+ PS IA +  + ++ +    Q      AI    Y++ + ++ 
Sbjct  219   KSSQLILSTIKGIDFLEFKPSEIALAVAISISRE---FQTPDMNKAILSFPYMEKERVMK  275

Query  367   CLSVMRE  347
             C+ ++R+
Sbjct  276   CIDLIRD  282



>ref|XP_008440562.1| PREDICTED: cyclin-D4-1-like isoform X1 [Cucumis melo]
Length=368

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/247 (31%), Positives = 136/247 (55%), Gaps = 15/247 (6%)
 Frame = -2

Query  1063  FNLENPLTSSFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSLTY  902
             F  EN L SS  +    + V  +   E +H+P+      +LS +  + F  RREA    +
Sbjct  42    FGSENFLGSSVLESE--ERVKRMVEKEIEHLPTHDYLKRMLSGDLDLKF--RREAVDWIW  97

Query  901   RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS-  725
             +    Y F      L+MNY+DRFLS   +  +K W V++L ++C+SLAAKM   ++ L  
Sbjct  98    KAHAHYSFGPLSLCLSMNYLDRFLSVYHLPMDKSWTVQLLSVACMSLAAKMEETEVPLPI  157

Query  724   DIQRDE-GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIH  548
             D+Q +E   +F++++I RME ++LS LKW++++ITPFSF+ +F S   +E  +I      
Sbjct  158   DLQVEEPKFVFEAKTIQRMELLVLSRLKWKMQAITPFSFIDYFLSKISVEQQNIPSFYFS  217

Query  547   RASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILN  368
             ++S +I ++   I   E+ PS IA +  + ++ +    Q      AI    Y++ + ++ 
Sbjct  218   KSSQLILSTIKGIDFLEFKPSEIALAVAISISRE---FQTPDMNKAILSFPYMEKERVMK  274

Query  367   CLSVMRE  347
             C+ ++R+
Sbjct  275   CIELIRD  281



>ref|XP_002268394.1| PREDICTED: cyclin-D1-1 isoform X2 [Vitis vinifera]
 emb|CBI32091.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 87/259 (34%), Positives = 141/259 (54%), Gaps = 8/259 (3%)
 Frame = -2

Query  952  NHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVIS  773
            +H +  S R E+ +   + Q  + F    AYL++NY+DRFL  + + +   W +++L ++
Sbjct  64   SHSLDASAREESVAWILKVQAYHGFQPLTAYLSVNYLDRFLYSRRLPQTNGWPLQLLSVA  123

Query  772  CLSLAAKM-RCIDLCLSDIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFF  599
            CLSLAAKM   +   L D+Q +    +F+S++I RME ++L  L WRLRSITPFSF+ FF
Sbjct  124  CLSLAAKMEEPLVPSLLDLQVEGAKFIFESKTIRRMELLVLGVLDWRLRSITPFSFIGFF  183

Query  598  TSLYPLE-DPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLS  422
               Y L+   S+   LI RA+ II ++  +    EY PS IAA+A+L  A ++  L  + 
Sbjct  184  A--YKLDSSGSVIGFLISRATQIILSNIQEASFLEYWPSCIAAAAILCAANEIPKLSLVD  241

Query  421  FKNAIFRCEYVKSDEILNCLSVMRE-TVTRGIESSIDAISDCSLTPRSVLHRESGMMPER  245
             + A   C+ +  ++I++C  +M+E TV          +    +T R+ +          
Sbjct  242  PERAESWCDGLSKEKIISCYQLMQEITVDNNRRKPPKLLPQLRVTIRARVRSSGSSSSSS  301

Query  244  DGGMKRRRLNN--FCDDQE  194
                KRR+LNN  + DD +
Sbjct  302  SSSYKRRKLNNCLWVDDDK  320



>ref|XP_010272026.1| PREDICTED: cyclin-D1-1-like isoform X3 [Nelumbo nucifera]
Length=324

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 120/202 (59%), Gaps = 6/202 (3%)
 Frame = -2

Query  934  SIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAA  755
            S R+E+     + Q  Y F    AYL++NY+DRFLS   + + K W +++L  +CLSLAA
Sbjct  70   SARQESVEWILKVQAFYHFQPLTAYLSVNYLDRFLSSSRLPQAKGWPLQLLSAACLSLAA  129

Query  754  KM-RCIDLCLSDIQRDE-GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPL  581
            KM   +   L D+Q +    +F+ ++I RME ++LS L WRLRSITPF+F+++F   Y +
Sbjct  130  KMEEPLVPSLLDLQVEATKFIFEPRTIQRMELLVLSALDWRLRSITPFNFVNYFA--YKV  187

Query  580  E-DPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQF-LSFKNAI  407
            +   ++   L+ RA+ II     +I   +Y PS +AA A+L  A++   L   ++  NA+
Sbjct  188  DSSGTLIGFLVSRATEIILAIIREINFLKYRPSSVAAGAILCAAKENPNLSLVVNPGNAV  247

Query  406  FRCEYVKSDEILNCLSVMRETV  341
              C+ +  D I++C  +M++ V
Sbjct  248  SWCDGLCKDRIVSCYRLMQQLV  269



>ref|XP_004956725.1| PREDICTED: cyclin-D2-1-like isoform X4 [Setaria italica]
Length=330

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 132/248 (53%), Gaps = 19/248 (8%)
 Frame = -2

Query  1039  SSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSI----RREAFSLTYRTQFIYKFDR  872
             S+  +     ++  L  GE+D+ P     +   S SI    R E+ +   + Q  Y F  
Sbjct  44    SAGEEAESAASIAELIGGEADYSPRPDYPDRLRSRSIDPAARAESVAWILKVQEYYGFLP  103

Query  871   SIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMR------CIDLCLSDIQRD  710
               AYLA+NY+DRFLS   + E+  W + +L ++CLSLAAKM        +DL +  I R 
Sbjct  104   LTAYLAVNYMDRFLSLHRLPEDG-WAMELLAVTCLSLAAKMEETLVPSLLDLQVEGISR-  161

Query  709   EGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI--AQSLIHRAST  536
                +F+  +I RME ++L+ L WRLRS+TPF+F+ FF       DP     + LI RA+ 
Sbjct  162   --YVFEPGTIGRMELLVLTALNWRLRSVTPFTFIDFFACKV---DPGGRHTRCLIARATQ  216

Query  535   IIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSV  356
             +I  + +DI+  ++ PS +AA+A+L    +   L+ +S   A+  C  +  + I +C  +
Sbjct  217   VILAAMHDIEFLDHCPSAMAAAAVLCATGETPSLESVSPGAAVGWCIGLAEETIGSCYRL  276

Query  355   MRETVTRG  332
             M++ V  G
Sbjct  277   MQQLVIGG  284



>ref|XP_009598219.1| PREDICTED: cyclin-D3-1-like [Nicotiana tomentosiformis]
Length=340

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 116/201 (58%), Gaps = 3/201 (1%)
 Frame = -2

Query  934  SIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAA  755
            S+RREA     +    Y F    A+LA+NY+DRFLS      +KPW+ +++ ++CLSLAA
Sbjct  83   SVRREAVEWILKVIGYYSFSAQTAFLAVNYLDRFLSSFVFQTHKPWIYQLVAVACLSLAA  142

Query  754  KMRCIDL-CLSDIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPL  581
            K+   ++  L D+Q +E   +F+S+++ RME ++LS L+W++  +TPFSFL + T    L
Sbjct  143  KVEETEVPLLLDLQVEESRYVFESKTVQRMELLVLSTLEWKMNPVTPFSFLDYITRRLGL  202

Query  580  EDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFR  401
             +  +    + R   ++  +  D +   Y PS +A++ +L+V ++L P     +++ +  
Sbjct  203  NN-CLCWEFLRRCERVLLYTITDCRFIGYLPSAMASATMLHVIDRLQPCIGEKYQDQLLD  261

Query  400  CEYVKSDEILNCLSVMRETVT  338
               +  D++ +C  +M+E  +
Sbjct  262  ILGIVKDKVEDCYKLMQEVAS  282



>ref|XP_004238706.1| PREDICTED: cyclin-D1-1 [Solanum lycopersicum]
Length=337

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 128/229 (56%), Gaps = 9/229 (4%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPS---LLSFNHQ-ISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNY  845
             +++  L   E + +P    +  F  Q +S + R E+ +   + Q  Y F    AYLA+NY
Sbjct  47    ESIAGLIEDEQNFVPGFDYIEKFQSQSLSAAARDESVAWILKVQRHYAFQPLTAYLAVNY  106

Query  844   IDRFLSRQAVLENKPWVVRILVISCLSLAAKM-RCIDLCLSDIQRDEG-LMFDSQSIHRM  671
              DRFL  +++ +   W +++L ++CLSLAAKM   +   L D+Q +    +F+ ++I RM
Sbjct  107   FDRFLYLRSLPQTNGWPLQLLSVACLSLAAKMEEPLVPSLLDLQVEGAKYIFEPKTIQRM  166

Query  670   EGMILSCLKWRLRSITPFSFLHFFTSLYPLED-PSIAQSLIHRASTIIFTSHYDIKLFEY  494
             E ++L  L WRLRSITPFSFL FF +   L+   +    LI RAS II ++  +    EY
Sbjct  167   EFLVLRILDWRLRSITPFSFLSFFAA--KLDSLGTFTAFLISRASQIILSNIQEASFLEY  224

Query  493   NPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE  347
              PS IAA+ +L  A  L     ++ ++A   C  ++ D+I+ C  ++++
Sbjct  225   WPSCIAAATILCAANDLPNFSLVNAEHAESWCHGLRKDKIVGCYELVQK  273



>ref|XP_009409296.1| PREDICTED: cyclin-D4-1-like [Musa acuminata subsp. malaccensis]
Length=348

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/249 (32%), Positives = 137/249 (55%), Gaps = 13/249 (5%)
 Frame = -2

Query  1000 ALFAGESDHMPSLLSFNHQISF-----SIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDR  836
            +L   ES+HMP    +  ++ +     SIR +      +    Y F    AYLA+NY+DR
Sbjct  67   SLVERESEHMPRE-DYAERLRYGALDSSIRTDTIDRILKVHAHYNFGPLSAYLAVNYLDR  125

Query  835  FLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQRDEG-LMFDSQSIHRMEGM  662
            FLS   + + K W+ ++L ++CLSLAAKM   ++ LS D Q  E   +F++++I RME +
Sbjct  126  FLSNYELPKGKAWMTQLLSVACLSLAAKMEETEVPLSLDFQVGEANYVFEAKTIQRMELL  185

Query  661  ILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSV  482
            +LS LKWR++++TPFSF+ FF   +   + +  ++++ R+  +I ++        + PS 
Sbjct  186  VLSTLKWRMQALTPFSFIDFFLHKFSGGN-APTKTVVSRSMELILSTVRGADFLAFRPSE  244

Query  481  IAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE-TVTRGIESSIDAIS  305
            IAA+  L V+ +  P+     + A+  C  V  +++L C  V+++  + R      D IS
Sbjct  245  IAAAITLLVSGERQPVD---VEKAVSCCLQVAKEKVLRCCEVIKDMELMRSRPLRNDNIS  301

Query  304  DCSLTPRSV  278
              S+ P S+
Sbjct  302  FSSVPPSSI  310



>ref|XP_010653055.1| PREDICTED: cyclin-D1-1 isoform X1 [Vitis vinifera]
Length=325

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 142/260 (55%), Gaps = 9/260 (3%)
 Frame = -2

Query  952  NHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFL-SRQAVLENKPWVVRILVI  776
            +H +  S R E+ +   + Q  + F    AYL++NY+DRFL SR+   +   W +++L +
Sbjct  64   SHSLDASAREESVAWILKVQAYHGFQPLTAYLSVNYLDRFLYSRRLPQQTNGWPLQLLSV  123

Query  775  SCLSLAAKMR-CIDLCLSDIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHF  602
            +CLSLAAKM   +   L D+Q +    +F+S++I RME ++L  L WRLRSITPFSF+ F
Sbjct  124  ACLSLAAKMEEPLVPSLLDLQVEGAKFIFESKTIRRMELLVLGVLDWRLRSITPFSFIGF  183

Query  601  FTSLYPLE-DPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFL  425
            F   Y L+   S+   LI RA+ II ++  +    EY PS IAA+A+L  A ++  L  +
Sbjct  184  FA--YKLDSSGSVIGFLISRATQIILSNIQEASFLEYWPSCIAAAAILCAANEIPKLSLV  241

Query  424  SFKNAIFRCEYVKSDEILNCLSVMRE-TVTRGIESSIDAISDCSLTPRSVLHRESGMMPE  248
              + A   C+ +  ++I++C  +M+E TV          +    +T R+ +         
Sbjct  242  DPERAESWCDGLSKEKIISCYQLMQEITVDNNRRKPPKLLPQLRVTIRARVRSSGSSSSS  301

Query  247  RDGGMKRRRLNN--FCDDQE  194
                 KRR+LNN  + DD +
Sbjct  302  SSSSYKRRKLNNCLWVDDDK  321



>ref|XP_009627754.1| PREDICTED: cyclin-D1-1 [Nicotiana tomentosiformis]
Length=336

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 126/230 (55%), Gaps = 11/230 (5%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPSLLSFNHQISFSI----RREAFSLTYRTQFIYKFDRSIAYLAMNY  845
             +++  L   E   +P    F    S S+    R ++ +   + Q  Y F    AYLA+NY
Sbjct  48    ESIAGLIEDERYFVPGFDYFERFQSQSLIAVAREDSVAWILKVQRHYGFQPLTAYLAVNY  107

Query  844   IDRFLSRQAVLENKPWVVRILVISCLSLAAKM-RCIDLCLSDIQRDEG-LMFDSQSIHRM  671
              DRFL  +++ +   W +++L ++CLSLAAKM   +   L DIQ +    MF+ ++I RM
Sbjct  108   FDRFLYSRSLPQTDGWPLQLLSVACLSLAAKMEEPLVPSLLDIQVEGAKYMFEPKTIQRM  167

Query  670   EGMILSCLKWRLRSITPFSFLHFFTSLYPLEDP--SIAQSLIHRASTIIFTSHYDIKLFE  497
             E ++L  L WRLRSITPF FL FF   Y L DP  +    LI +A+ II ++  +    E
Sbjct  168   EFLVLRVLDWRLRSITPFCFLSFFA--YKL-DPVGTFTGFLISKATEIILSNIQEASFLE  224

Query  496   YNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE  347
             Y PS IAA+ +L  A  L     ++ ++A   C+ ++ D+I+ C  ++++
Sbjct  225   YWPSCIAAATILCAANDLPNFSLVNAEHAESWCDGLRKDKIVGCYELVQK  274



>gb|KFK41441.1| hypothetical protein AALP_AA2G130900 [Arabis alpina]
Length=329

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/241 (35%), Positives = 132/241 (55%), Gaps = 18/241 (7%)
 Frame = -2

Query  1054  ENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFIYKFD  875
             ++ + S  +D  H   VP L     D++    S    +  S R E+ +   + Q  Y F 
Sbjct  30    DDSIASLIDDERHF--VPGL-----DYLSRFQS--RSLDASAREESVAWILKVQAYYSFQ  80

Query  874   RSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQRDEGL-  701
                AYLA+NY+DRFL  + + E   W +++L ++CLSLAAKM  I + CL D Q  EG+ 
Sbjct  81    PLTAYLAVNYMDRFLYARRLPETSGWPMQLLAVACLSLAAKMEEILVPCLFDFQV-EGVK  139

Query  700   -MFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFT-SLYPLEDPSIAQSLIHRASTIIF  527
              +F++++I RME ++LS L WRLRS+TPF FL FF   + PL   +     +  A+ II 
Sbjct  140   YIFEAKTIKRMELLVLSVLDWRLRSVTPFCFLSFFAYKIDPLG--TFLDFFLSNATEIIL  197

Query  526   TSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLS--FKNAIFRCEYVKSDEILNCLSVM  353
             ++  +    EY PS IAA+A+L VA +L  L   +   ++    C  +  ++I+ C  +M
Sbjct  198   SNIKEASFLEYWPSSIAAAAILCVANELPSLSSAANPHESPETWCNGLSKEKIVKCYRLM  257

Query  352   R  350
             +
Sbjct  258   K  258



>gb|KFK41442.1| hypothetical protein AALP_AA2G130900 [Arabis alpina]
Length=328

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/241 (35%), Positives = 132/241 (55%), Gaps = 18/241 (7%)
 Frame = -2

Query  1054  ENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFIYKFD  875
             ++ + S  +D  H   VP L     D++    S    +  S R E+ +   + Q  Y F 
Sbjct  30    DDSIASLIDDERHF--VPGL-----DYLSRFQS--RSLDASAREESVAWILKVQAYYSFQ  80

Query  874   RSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQRDEGL-  701
                AYLA+NY+DRFL  + + E   W +++L ++CLSLAAKM  I + CL D Q  EG+ 
Sbjct  81    PLTAYLAVNYMDRFLYARRLPETSGWPMQLLAVACLSLAAKMEEILVPCLFDFQV-EGVK  139

Query  700   -MFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFT-SLYPLEDPSIAQSLIHRASTIIF  527
              +F++++I RME ++LS L WRLRS+TPF FL FF   + PL   +     +  A+ II 
Sbjct  140   YIFEAKTIKRMELLVLSVLDWRLRSVTPFCFLSFFAYKIDPLG--TFLDFFLSNATEIIL  197

Query  526   TSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLS--FKNAIFRCEYVKSDEILNCLSVM  353
             ++  +    EY PS IAA+A+L VA +L  L   +   ++    C  +  ++I+ C  +M
Sbjct  198   SNIKEASFLEYWPSSIAAAAILCVANELPSLSSAANPHESPETWCNGLSKEKIVKCYRLM  257

Query  352   R  350
             +
Sbjct  258   K  258



>ref|XP_009380230.1| PREDICTED: cyclin-D4-1-like [Musa acuminata subsp. malaccensis]
Length=354

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/252 (31%), Positives = 131/252 (52%), Gaps = 15/252 (6%)
 Frame = -2

Query  1012  DAVPALFAGESDHMP----SLLSFNHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNY  845
             D + +L   E  H+P    +      Q+  ++R +A     R    Y F    AYL+ NY
Sbjct  67    DCIASLVEKELQHLPQGNYAERLLRGQLDLAVRNDAIDWIQRVHEHYNFGPLTAYLSANY  126

Query  844   IDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQRDEG-LMFDSQSIHRM  671
             +DRF S   + + K W+ ++L ++CLSLAAK+   +   S D+Q  E   +F++++I RM
Sbjct  127   LDRFFSSYELPQGKAWMTQLLSVACLSLAAKVEETEAPFSIDLQVGEAKYVFEARTIQRM  186

Query  670   EGMILSCLKWRLRSITPFSFL-HFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEY  494
             E ++LS LKWR++++TPFSF+ +F    +    P    SLI R+  ++  +   +   E+
Sbjct  187   ELLVLSTLKWRMQAVTPFSFIVYFLCKFHDANSPD--GSLISRSIALVLATVRGVDFLEF  244

Query  493   NPSVIAASALLYVAEKLIPLQFLSFKNAIF-RCEYVKSDEILNCLSVMRETVTRGIESSI  317
              PS IAA+  L     L  +QFL    A+   C +V  + +L C  V++E     +++  
Sbjct  245   RPSEIAAAVALSA---LKEIQFLEIDKALACCCIHVNKERVLRCHEVIQEMAL--MKNGT  299

Query  316   DAISDCSLTPRS  281
              A +  S  P+S
Sbjct  300   YASTSVSAVPKS  311



>emb|CDY59943.1| BnaAnng16340D [Brassica napus]
Length=361

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 129/241 (54%), Gaps = 16/241 (7%)
 Frame = -2

Query  1054  ENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFS--LTYRTQFIYK  881
             E  + S   D  H   VP L     D++    S    +  S R ++ S  L    Q  YK
Sbjct  65    EESIASCIEDERHF--VPGL-----DYLSRFHS--QSLDASAREDSVSWILKASVQAYYK  115

Query  880   FDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSDIQRDEGL  701
             F    AYLA+NY+DRFL  + + E   W +++L ++CLSLAAKM  + + L    + EG+
Sbjct  116   FQPLTAYLAVNYMDRFLYARRLPETSGWPMQLLAVACLSLAAKMEEVLVPLLFDFQVEGV  175

Query  700   --MFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIF  527
               +F++++I RME ++LS L WRLRS+TPFSFL FF      +  S+   L H A+ II 
Sbjct  176   KYIFEAKTIQRMELLVLSVLDWRLRSVTPFSFLSFFAYKIDPQGTSLGFFLTH-ATKIIL  234

Query  526   TSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFR--CEYVKSDEILNCLSVM  353
             ++  +    +Y PS IAA+A+L VA +L  L      N      C+ +  ++I+ C  +M
Sbjct  235   SNIKEASFLDYRPSSIAAAAILCVANELPSLSSAVNPNESPETWCDGLSKEKIVRCYRLM  294

Query  352   R  350
             +
Sbjct  295   K  295



>gb|EYU36377.1| hypothetical protein MIMGU_mgv1a022525mg [Erythranthe guttata]
Length=328

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 87/296 (29%), Positives = 144/296 (49%), Gaps = 11/296 (4%)
 Frame = -2

Query  1090  LFLSDLLMEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFS  911
             L   ++    + E+   S F D +  D +  L   ES     LL    Q S+ +R     
Sbjct  15    LLCKEIATSLDDEDEAASIFEDFYEDDYIKLLLDRESTTNGGLLQMQQQNSWILRARLDG  74

Query  910   LTY--RTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCID  737
             + Y    + +  F    AY ++ ++DRFLSR+++   K W +R+L I+CLSLAAKM    
Sbjct  75    IHYILTKREVLGFRYQTAYTSVTFLDRFLSRRSIDVEKSWAIRLLSIACLSLAAKMEETT  134

Query  736   L-CLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQ  560
             L  LSD+  D+   F+S  I RME ++L+ L+W + SITPFSF+ FF   +     +  +
Sbjct  135   LPALSDLCADD-YKFESSVIQRMELLVLNTLEWEMGSITPFSFVQFFAEKF----RNRTK  189

Query  559   SLIHRASTIIFTSHYDIKLFE-YNPSVIAASALLYVAEKLIPLQFLSFKNA-IFRCEYVK  386
               + R + I   +  D+ +   + PSVIAA+A L   +     + L  K A +     +K
Sbjct  190   IGLSRTAHITLATIRDVNIMTCHKPSVIAAAATLVALDHGYTREALHHKIAPLISTHAIK  249

Query  385   SDEILNCLSVMRETVTRGIESSIDAISDCSLTPRSVLHRESGMMPERDGGMKRRRL  218
              +E++ C  +++E     +  S + +    L+P  +   +        GG KR+RL
Sbjct  250   IEEVIACYYIIKEMEVERLNLS-ERVKSPELSPTELQRADDAYGSYSGGGAKRKRL  304



>ref|XP_006355943.1| PREDICTED: cyclin-D1-1-like [Solanum tuberosum]
Length=336

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 129/229 (56%), Gaps = 9/229 (4%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPS---LLSFNHQ-ISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNY  845
             +++  L   E + +P    +  F  Q +S + R E+ +   + Q  Y F    AYLA+NY
Sbjct  47    ESIAGLIEDERNFVPGYDYIEKFQSQSLSAAARDESVAWILKVQRHYGFQPLTAYLAVNY  106

Query  844   IDRFLSRQAVLENKPWVVRILVISCLSLAAKM-RCIDLCLSDIQRDEG-LMFDSQSIHRM  671
              DRFL  +++ +   W +++L ++CLSLAAKM   +   L D+Q +    +F+ ++I RM
Sbjct  107   FDRFLYSRSLPQTNGWPLQLLSVACLSLAAKMEEPLVPSLLDLQVEGAKYIFEPKTIQRM  166

Query  670   EGMILSCLKWRLRSITPFSFLHFFTSLYPLED-PSIAQSLIHRASTIIFTSHYDIKLFEY  494
             E ++L  L WRLRSITPF+FL FF +   L+   +    LI RAS II ++  +    EY
Sbjct  167   EFLVLRILDWRLRSITPFNFLSFFAA--KLDSLGTFTAVLISRASQIILSNIQEASFHEY  224

Query  493   NPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE  347
              PS IAA+ +L  A+ L     ++ ++A   C  ++ D+I+ C  ++++
Sbjct  225   WPSCIAAATILCAAKDLPNFSLVNAEHAESWCHGLRKDKIVGCYELVQK  273



>ref|XP_009800525.1| PREDICTED: cyclin-D3-3-like [Nicotiana sylvestris]
Length=342

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/223 (30%), Positives = 125/223 (56%), Gaps = 3/223 (1%)
 Frame = -2

Query  1000 ALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQ  821
            +LF+ E++++ + +        S RREA     +    Y F    A+LA+NY+DRFLS  
Sbjct  63   SLFSKETENVINNVVEKTPSLASARREAVEWILKVIGYYSFSAQTAFLAVNYLDRFLSSF  122

Query  820  AVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQ-RDEGLMFDSQSIHRMEGMILSCL  647
                +KPW+ +++ ++CLSLAAK+   ++  L D+Q  D   +F+S+++ RME ++LS L
Sbjct  123  EFQSHKPWINQLVAVACLSLAAKVEETEVPLLFDLQVEDPRYVFESKTVQRMELLVLSTL  182

Query  646  KWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASA  467
            +W++  +TPFSFL + T    L +  +    + R   ++  +  D +   Y PS +A++ 
Sbjct  183  EWKMNPVTPFSFLDYITRRLGLNN-CLCWEFVRRCERVLLYTITDCRFIGYLPSAMASAT  241

Query  466  LLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVT  338
            +L+V ++L P     +++ +     +  D++ +C  +M+E  T
Sbjct  242  MLHVIDRLQPCIGEKYQDQLLDILGIVKDKVEDCYRLMQEVAT  284



>gb|KHN08249.1| Cyclin-D3-1 [Glycine soja]
Length=352

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/219 (32%), Positives = 123/219 (56%), Gaps = 9/219 (4%)
 Frame = -2

Query  985  ESDHMPSLLSFNH----QISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQA  818
            E  H P L   N      + F  R EA     + +  + F     YL++NY+DRFL    
Sbjct  70   ECQHWPGLRCLNKLQTGDLDFGARMEAVDWILKVRSHFGFGPLCGYLSINYLDRFLCAYE  129

Query  817  VLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQRDEG-LMFDSQSIHRMEGMILSCLK  644
            + + + W +++L ++CLSLAAK+   ++ +S D+Q  E   +F++++I RME ++LS LK
Sbjct  130  LPKGRVWTMQLLAVACLSLAAKLDETEVPISLDLQVGESKFLFEAKTIQRMELLVLSTLK  189

Query  643  WRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASAL  464
            WR+++ITPF+FL +F      +D S  +S I R+  +I ++   I   E+ PS IAA+  
Sbjct  190  WRMQAITPFTFLDYFLCKIN-DDQSPLRSSIMRSIQLISSTARGIDFLEFKPSEIAAAVA  248

Query  463  LYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE  347
            +YV  +   +   + K   F  ++V+ + +L C+ +++E
Sbjct  249  MYVMGETQTVD--AGKATSFLIQHVEKERLLKCVKMIQE  285



>ref|XP_006849324.1| hypothetical protein AMTR_s00164p00026810 [Amborella trichopoda]
 gb|ERN10905.1| hypothetical protein AMTR_s00164p00026810 [Amborella trichopoda]
Length=316

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 135/253 (53%), Gaps = 20/253 (8%)
 Frame = -2

Query  928  RREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKM  749
            RR+      + +  Y F    A+L++NY+DR L+R   +  K W + +  ++CLSLAAKM
Sbjct  70   RRDVIRWIAKVRMFYNFGYHTAFLSLNYLDRVLARCPAIREKDWAIHLSAVACLSLAAKM  129

Query  748  ------RCIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFF-TSL  590
                  R +DL + + +     MF+ + + RME ++L  L WRL  +TPFSFL FF T L
Sbjct  130  EELVVPRLLDLQVENPK----FMFEPKLVQRMELLVLDTLAWRLNVVTPFSFLKFFMTRL  185

Query  589  YPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNA  410
               ++P   +SL+ R+  +I T+   +   +  PS IAA+++L  +      Q L+ ++ 
Sbjct  186  CHSQNP---KSLMSRSIDLILTTSEVMNFSDNRPSAIAAASILISSG-----QELTKEST  237

Query  409  IFRCEYVKSDEILNCLSVMRETVTRGIESSIDAISDCSLTPRSVLHRESGMMPERDGGMK  230
             F   +++ D +L+C ++MR+  T   +    AIS  +L P  +   E+  +       K
Sbjct  238  EFTMGFIEHDCVLSCYNLMRKLETDKCKIPRIAISP-NLLPSPIGVIEAAQLSTSSPNSK  296

Query  229  RRRLNNFCDDQEY  191
            RR+L ++ DD E+
Sbjct  297  RRKLLDYGDDYEF  309



>ref|XP_002463007.1| hypothetical protein SORBIDRAFT_02g036130 [Sorghum bicolor]
 gb|EER99528.1| hypothetical protein SORBIDRAFT_02g036130 [Sorghum bicolor]
Length=314

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 95/300 (32%), Positives = 144/300 (48%), Gaps = 26/300 (9%)
 Frame = -2

Query  1078  DLLMEFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYR  899
             D   EF+LENP TS  ++      + +L   E+ H           +      AF    R
Sbjct  17    DYEFEFDLENPFTSPADE-----PIASLLDAEAHHA--PSVSAAASAARRDAVAFISKVR  69

Query  898   TQFIYKFDRSIAYLAMNYIDRFLS-RQAVLENKPWVVRILVISCLSLAAKMRCIDLCLSD  722
                       +AYLA+NY+DRFLS RQ   E +PW   + +      A   R     +  
Sbjct  70    FSGELAVHPRVAYLALNYVDRFLSKRQLACEQQPWPRLLALSCLSLAAKMQRVATFSIDH  129

Query  721   IQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSL--YPLEDPSIAQSLIH  548
             IQRDE  MFD+ ++ RME  +L  L+WR RS+TPF+FL FF S+   P + P    ++  
Sbjct  130   IQRDEDFMFDAATVRRMERWVLGALEWRARSVTPFAFLSFFLSVCYPPPQHPPQVAAIKA  189

Query  547   RASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILN  368
             RA  ++  +  ++K+ E++PSV+AASALL  A ++      +F+  +  C +V S+++  
Sbjct  190   RAVDLLLRAQPEVKMAEFSPSVVAASALLAAAREVAAANLPAFQAGVAACPFVNSEKLRE  249

Query  367   CLSVMRETVTRGIESSIDAISDCSLTPRSVL--HRESGMMPERD----------GGMKRR  224
             C  V+      G+     A S  + TP +VL  HR +    E D          GG K+R
Sbjct  250   CGEVL--AAACGVGPGRAAAS--ADTPVTVLGHHRSASSASESDWTIGSATNGGGGAKKR  305



>ref|XP_003544823.1| PREDICTED: cyclin-D4-1-like isoform X1 [Glycine max]
 gb|KHN35458.1| Cyclin-D4-1 [Glycine soja]
Length=355

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 138/248 (56%), Gaps = 17/248 (7%)
 Frame = -2

Query  985  ESDHMPSLLSFNH----QISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQA  818
            E DH+P+    N      + F  R+EA     + Q  + F    AYL++NY+DRFLS   
Sbjct  73   EWDHLPNGDYVNRLRSGDLDFGARKEAIDWIEKVQQHFGFGPLCAYLSINYLDRFLSAYE  132

Query  817  VLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQRDEG-LMFDSQSIHRMEGMILSCLK  644
            + +++ W +++L + CLSLAAKM   D+  S D+Q  E   +F++++I RME ++LS L+
Sbjct  133  LPKHRAWTMQLLAVGCLSLAAKMEETDVPFSLDLQVGESKYIFEAKTIQRMELLVLSTLR  192

Query  643  WRLRSITPFSFLHFFTSLYPL-EDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAAS-  470
            WR+++ITPFSF+  F  LY + +D S   + I ++  +I ++   I   E+ PS IAA+ 
Sbjct  193  WRMQAITPFSFIDHF--LYKINDDQSPIGASILQSIQLILSTVRGIDFLEFRPSEIAAAV  250

Query  469  ALLYVAEKLIPLQFLSFKNAI-FRCEYVKSDEILNCLSVMRETVTRGIESSIDAISDCSL  293
            A+  V E     Q +  + AI    + V+ + +L C+ +++E  +    S+  A +  S+
Sbjct  251  AISVVGEG----QTVHTEKAISVLIQLVEKERVLKCVKMIQELASNSGGSAKGASASVSV  306

Query  292  --TPRSVL  275
               P S L
Sbjct  307  PSVPESPL  314



>ref|XP_010512099.1| PREDICTED: cyclin-D1-1-like isoform X1 [Camelina sativa]
Length=397

 Score =   117 bits (294),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 117/201 (58%), Gaps = 9/201 (4%)
 Frame = -2

Query  934  SIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAA  755
            S R ++ +   + Q  YKF    AYLA+NY+DRFL  + + E   W +++L ++CLSLAA
Sbjct  138  SAREDSVAWILKVQAYYKFQPLTAYLAVNYMDRFLYARRLPETSGWPMQLLAVACLSLAA  197

Query  754  KMRCIDL-CLSDIQ-RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPL  581
            KM  + + CL D Q      +F++++I RME ++LS L WRLRS+TPF FL FF   Y +
Sbjct  198  KMEEVLVPCLFDFQVAGVKYIFEAKTIKRMELLVLSVLDWRLRSVTPFDFLSFFA--YKI  255

Query  580  EDPSIA--QSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFL--SFKN  413
             DPS       I  A+ II ++  +    EY PS IAA+A+L VA +L  L  +    ++
Sbjct  256  -DPSGTFLGFFISHATEIILSNIKEASFLEYWPSSIAAAAILCVANELPSLSSVVNPHES  314

Query  412  AIFRCEYVKSDEILNCLSVMR  350
                C+ +  ++I+ C  +M+
Sbjct  315  PETWCDGLSKEKIVRCYRLMK  335



>ref|XP_011074359.1| PREDICTED: cyclin-D5-3-like [Sesamum indicum]
Length=326

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 120/214 (56%), Gaps = 21/214 (10%)
 Frame = -2

Query  928  RREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKM  749
            R +      RT+ +  F    AYL++ Y+DRFLSR++V   K W +R+L ++CLSLAAKM
Sbjct  74   RLDGIHYILRTREVLGFGVQTAYLSVTYLDRFLSRRSVDAEKSWALRLLSMACLSLAAKM  133

Query  748  R------CIDLCLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLY  587
                     + CL D        F+S  I RME ++L+ L+W++ SITPF+++ FF + +
Sbjct  134  EESVVPALSEFCLGDYN------FESSVIQRMELLVLNTLEWKMGSITPFAYVQFFANKF  187

Query  586  PLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAI  407
               D S  ++ + R   +I  S   +K+  + PSVIAA+A L+V ++ + +  L  K + 
Sbjct  188  F--DNSSPRNGVSRTMDLILGSMKYVKIMSHRPSVIAAAAALFVLDQELTIDALKLKISD  245

Query  406  FRCEYVKSDEILNCLSVMRE------TVTRGIES  323
                Y   D I++C ++++E       +++GI+S
Sbjct  246  LTGSY-DIDNIISCYNLVQEMDIERLKLSKGIKS  278



>ref|XP_010551453.1| PREDICTED: cyclin-D1-1 [Tarenaya hassleriana]
Length=332

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 96/298 (32%), Positives = 149/298 (50%), Gaps = 28/298 (9%)
 Frame = -2

Query  1066  EFNLENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFI  887
             +F+ +  + +   D  H   VP L     D++    S    +  S R EA S   + +  
Sbjct  37    DFSSDESIAAFIEDERHF--VPGL-----DYLSRFQS--QSLDASAREEAVSWILKVKAF  87

Query  886   YKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCI----DLCLSDI  719
             Y F    AYLA+NY+DRFL  + + +   W +++L ++CLSLAAK+  +     LCL   
Sbjct  88    YNFQPLTAYLAVNYMDRFLYARRLPQTNGWPMQLLAVACLSLAAKLEELLVPSLLCL---  144

Query  718   QRDEGL--MFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFT-SLYPLEDPSIAQSLIH  548
              + EG   +F  ++I RME ++LS L WRLRS+TPFSFL FF   + P    +    L+ 
Sbjct  145   -QVEGTKYVFQPKTIQRMELLVLSILDWRLRSVTPFSFLTFFACKISP--SGTFLGLLVS  201

Query  547   RASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFK-NAIFRCEYVKSDEIL  371
             RA+ II ++  +    EY PS IAA+A+L VA++L  L   + + N    C  +  ++++
Sbjct  202   RATDIILSNMQETCFVEYWPSSIAAAAILCVADELPILSSSNRQGNPEAWCHGLSQEKVV  261

Query  370   NCLSVMRETVTRGI-ESSIDAISDCSLTPRSVLHR---ESGMMPERD-GGMKRRRLNN  212
              C  +M+     G        I    +T R+   R    S +    D    KRR+LNN
Sbjct  262   KCYRLMQAVALDGSRRKGPRVIPQLRVTVRTSTVRPSDPSSLFSSPDLSPYKRRKLNN  319



>ref|XP_010254697.1| PREDICTED: cyclin-D1-1 [Nelumbo nucifera]
Length=324

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/233 (32%), Positives = 130/233 (56%), Gaps = 10/233 (4%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPSL---LSFNHQI-SFSIRREAFSLTYRTQFIYKFDRSIAYLAMNY  845
             +++      E D++P L     F  ++   S R+E+     +    Y F    AYL++NY
Sbjct  40    ESIAGFVEDEGDYVPELDYLARFQSRLLDASARQESVEWILKVHAFYHFHPVTAYLSVNY  99

Query  844   IDRFLSRQAVLENKPWVVRILVISCLSLAAKM-RCIDLCLSDIQRDEG-LMFDSQSIHRM  671
             +DRFL+   + + K W +++L ++CLSLAAKM   +   L D+Q +    +F+ ++I RM
Sbjct  100   LDRFLASDRLPQAKGWPLQLLSVACLSLAAKMEEPLVPSLLDLQVEGAKFIFEPRTIQRM  159

Query  670   EGMILSCLKWRLRSITPFSFLHFFTSLYPLEDP-SIAQSLIHRASTIIFTSHYDIKLFEY  494
             E ++L+ L WRLRSITPF+F+++F   Y ++   S+   L+ RA+ II     +I    Y
Sbjct  160   ELLVLTALDWRLRSITPFNFINYFA--YKVDSTGSLTAFLVSRATQIILAIIREISFLNY  217

Query  493   NPSVIAASALLYVAEKLIPLQFLSFKN-AIFRCEYVKSDEILNCLSVMRETVT  338
              PS +AA+ +L  A+++  L  L     A+  C+ +  + I++C  +M++ V 
Sbjct  218   WPSSVAAAGILCAAKEIPNLSLLVNPGIAVSWCDGLSKERIVSCYRLMQQLVV  270



>ref|XP_009410280.1| PREDICTED: cyclin-D2-1-like [Musa acuminata subsp. malaccensis]
Length=315

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 88/288 (31%), Positives = 146/288 (51%), Gaps = 32/288 (11%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPSLL---SFNHQI-SFSIRREAFSLTYRTQFIYKFDRSIAYLAMNY  845
             +++     GE+D  P L     F  ++   + R+EA +   +    Y F    A LA+NY
Sbjct  43    ESIAGFIEGEADSSPQLDYPDRFQAKLLDPAARQEAVTWILKVHEYYCFRPLTACLAVNY  102

Query  844   IDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQRDEG-LMFDSQSIHRM  671
             +DRFLSR  + +N+ W +++L ++CLSLAAKM    L  L D+Q +   ++F+ +++ RM
Sbjct  103   LDRFLSRHCLPQNE-WTLQLLSVACLSLAAKMEETLLPSLLDLQVEGAKIIFEPRTVLRM  161

Query  670   EGMILSCLKWRLRSITPFSFLHFFTSLYPLEDP--SIAQSLIHRASTIIFTSHYDIKLFE  497
             E ++L+ L WRLRS+TPF+F+ FF       DP    A++L+  A+ I   +  D++   
Sbjct  162   ELVVLNALNWRLRSVTPFTFIDFFVHKI---DPVGKYARTLVSLATEITLATTKDVRFLS  218

Query  496   YNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETV---TRGIE  326
             + PS +AA+A++   +++  L F+    A   C  +    I  C   M++ +   TR   
Sbjct  219   HCPSSLAAAAIICATDEIKDLAFVDPGIAASWCIGLTEAGIAGCYRSMKQVIVNRTRKAS  278

Query  325   SSIDAISDCSLTPRSVLHRESGMMPERDGGMKRRRLNNFC----DDQE  194
             +S+D                S          KRR+LNN C    +DQE
Sbjct  279   TSVDL-------------EPSVSSSYSSPPSKRRKLNNNCLWVDNDQE  313



>ref|XP_002981056.1| hypothetical protein SELMODRAFT_420671 [Selaginella moellendorffii]
 gb|EFJ17757.1| hypothetical protein SELMODRAFT_420671 [Selaginella moellendorffii]
Length=338

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 131/241 (54%), Gaps = 19/241 (8%)
 Frame = -2

Query  1021  HHLDAVP--ALFAGESDHMPSLLSF----NHQISFSIRREAFSLTYRTQFIYKFDRSIAY  860
             H  DAVP  ++   ES H+P    F    +  +  S R  A     + + +Y F      
Sbjct  40    HFDDAVPLSSIVQRESGHLPDAGYFAVLRSEDVISSARSNAVYWMMKVRNVYSFSPLTIA  99

Query  859   LAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQRDEGL--MFDS  689
             LA+NY DR+LS+Q +   K W++ +L ++CLSLAAKM   D+  L D+Q  EGL  +F+S
Sbjct  100   LAVNYFDRYLSKQLLRTWKAWMIELLTVACLSLAAKMEEPDVPMLQDLQI-EGLDHIFES  158

Query  688   QSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQ----SLIHRASTIIFTS  521
             ++I RME  ++  L WR+ S+TPFS++        L++  +++    SL++R S ++  +
Sbjct  159   KTIQRMEIAVMKLLGWRMGSVTPFSYIEGL-----LQNLDVSRNMKLSLLNRTSEVLVKT  213

Query  520   HYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETV  341
               ++    + PSV++ +A+    E+L+PL+  + K ++ +      D++  C  +M E V
Sbjct  214   LPEMDFLAFPPSVVSLAAMSCALEELLPLRAEALKGSLAKILPTPQDQLRRCYRLMEELV  273

Query  340   T  338
              
Sbjct  274   V  274



>ref|XP_010512100.1| PREDICTED: cyclin-D1-1-like isoform X2 [Camelina sativa]
Length=395

 Score =   117 bits (294),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 117/201 (58%), Gaps = 9/201 (4%)
 Frame = -2

Query  934  SIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAA  755
            S R ++ +   + Q  YKF    AYLA+NY+DRFL  + + E   W +++L ++CLSLAA
Sbjct  138  SAREDSVAWILKVQAYYKFQPLTAYLAVNYMDRFLYARRLPETSGWPMQLLAVACLSLAA  197

Query  754  KMRCIDL-CLSDIQ-RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPL  581
            KM  + + CL D Q      +F++++I RME ++LS L WRLRS+TPF FL FF   Y +
Sbjct  198  KMEEVLVPCLFDFQVAGVKYIFEAKTIKRMELLVLSVLDWRLRSVTPFDFLSFFA--YKI  255

Query  580  EDPSIA--QSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFL--SFKN  413
             DPS       I  A+ II ++  +    EY PS IAA+A+L VA +L  L  +    ++
Sbjct  256  -DPSGTFLGFFISHATEIILSNIKEASFLEYWPSSIAAAAILCVANELPSLSSVVNPHES  314

Query  412  AIFRCEYVKSDEILNCLSVMR  350
                C+ +  ++I+ C  +M+
Sbjct  315  PETWCDGLSKEKIVRCYRLMK  335



>ref|XP_009631276.1| PREDICTED: cyclin-D2-1-like [Nicotiana tomentosiformis]
Length=359

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 130/220 (59%), Gaps = 11/220 (5%)
 Frame = -2

Query  985  ESDHMPSLLSF----NHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQA  818
            E +HM +   F    N  +    R E      +    + F    AYLA+NY+DRFLS   
Sbjct  78   ECEHMAAADYFDRLRNGDLDIGARDEILDWIAKIHSHFSFGPMCAYLAVNYLDRFLSAYD  137

Query  817  VLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQ-RDEGLMFDSQSIHRMEGMILSCLK  644
            + + K W++++L ++CLSLAAKM   D+ LS D+Q  D   +F++++I RME ++LS LK
Sbjct  138  LPKGKAWMMQLLGVACLSLAAKMEETDVPLSLDLQVEDAKFVFEARTIQRMELLVLSTLK  197

Query  643  WRLRSITPFSFLHFFTSLYPLEDPSIA-QSLIHRASTIIFTSHYDIKLFEYNPSVIAASA  467
            WR+++ITPFSF+ +F  L  + D  IA +SLI+++  ++ ++   I   EY PS IAA+ 
Sbjct  198  WRMQAITPFSFIDYF--LKKINDDKIATRSLINKSVLLLLSTLKGIHFLEYKPSEIAAAV  255

Query  466  LLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE  347
             + VA K   +      +A+   ++V+ D+++ C+ +++E
Sbjct  256  AISVAVKTETIDSEKATSALV--QHVQKDKVMKCVELIQE  293



>ref|XP_003518252.1| PREDICTED: cyclin-D4-1 [Glycine max]
 gb|KHN26123.1| Cyclin-D4-1 [Glycine soja]
Length=357

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 79/254 (31%), Positives = 140/254 (55%), Gaps = 19/254 (7%)
 Frame = -2

Query  985  ESDHMPSLLSFNH----QISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQA  818
            E DH+P+    N      + F  R+EA     + Q  + F    AYL++NY+DRFLS   
Sbjct  73   EWDHLPNGDYRNKLRSGDLDFEARKEAIDWIQKVQEHFGFGPVCAYLSINYLDRFLSAYE  132

Query  817  VLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQRDEG-LMFDSQSIHRMEGMILSCLK  644
            + +++ W +++L + CLSLAAKM   D  +S D+Q  E   +F++++I RME ++LS L+
Sbjct  133  LPKHRTWTMQLLAVGCLSLAAKMEETDAPMSLDLQVGESKYIFEAKTIQRMELLVLSTLR  192

Query  643  WRLRSITPFSFLHFFTSLYPL-EDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASA  467
            WR+++ITPFSF+  F  LY + +D S   + I ++  +I ++   I   E+ PS IAA+ 
Sbjct  193  WRMQAITPFSFIDHF--LYKINDDQSPIGASILQSIQLILSTVRGIDFLEFRPSEIAAAV  250

Query  466  LLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVT-------RGIESSIDAI  308
             + V  +   +Q  + K      + V+ + +L C+ +++E  +       +G  +S+ ++
Sbjct  251  AISVVGEGQTVQ--TEKAISVLIQLVEKERVLKCVKLIQELASNSGGGSAKGDSASV-SV  307

Query  307  SDCSLTPRSVLHRE  266
                 +P  VL+ E
Sbjct  308  PSVPQSPIGVLNTE  321



>ref|XP_009380893.1| PREDICTED: cyclin-D4-1-like [Musa acuminata subsp. malaccensis]
Length=342

 Score =   116 bits (290),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 127/225 (56%), Gaps = 12/225 (5%)
 Frame = -2

Query  1000 ALFAGESDHMP----SLLSFNHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRF  833
            +L   E++HMP    +    +  +  SIRR+A     +    YKF    AYL++NY DRF
Sbjct  67   SLVRRETEHMPRDDYAERLRSGALDLSIRRDAIGWILKVHAHYKFGPLSAYLSVNYFDRF  126

Query  832  LSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQ-RDEGLMFDSQSIHRMEGMI  659
             S   + + K W+ ++L ++CLSLAAKM   ++ LS D+Q R+    F++++I RME ++
Sbjct  127  FSNYELPKGKAWMTQLLSVACLSLAAKMEETEVPLSMDLQERETKYDFEAKTIQRMELLV  186

Query  658  LSCLKWRLRSITPFSFLHFFTSLYPLED-PSIAQSLIHRASTIIFTSHYDIKLFEYNPSV  482
            LS LKWR++++TPFS++ FF   +   + P+  +  I R+  +I ++    +   + PS 
Sbjct  187  LSTLKWRMQAVTPFSYVEFFLHRFSGGNAPTKVE--IFRSVELILSTITGTEFLAFRPSE  244

Query  481  IAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE  347
            IAA+  L V   L   Q +  + A+  C  V  +++L C  V+++
Sbjct  245  IAAAITLKV---LGETQDVCIEKAVSCCIQVAKEKVLRCYEVIKD  286



>ref|XP_009401443.1| PREDICTED: cyclin-D4-1-like [Musa acuminata subsp. malaccensis]
Length=345

 Score =   116 bits (290),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 118/203 (58%), Gaps = 6/203 (3%)
 Frame = -2

Query  943  ISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLS  764
            +  S+R +A    ++    Y F    AYL++NY+DRFLS     + K W+ ++LV++CL+
Sbjct  87   LDLSLRGDAIDWMWKVHAHYNFGPLSAYLSVNYLDRFLSAYEFPQGKTWMTQLLVVACLT  146

Query  763  LAAKMRCIDLCLS-DIQRDE-GLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSL  590
            LAAKM   ++ LS D+Q  E   +F+ ++I RME ++L+ LKWR++++TPFS++ FF   
Sbjct  147  LAAKMEETEVLLSLDLQVGETKYVFEDRTIQRMELLVLNTLKWRMQAVTPFSYIDFFLHK  206

Query  589  YPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNA  410
            +   + +  + L+ R++ +I  +   I    + PSVIAA+  L V   L   Q +  + +
Sbjct  207  FSGGN-APTKLLVSRSTELILGTVKGIDCLAFRPSVIAAAIALLV---LRDTQVVDAEKS  262

Query  409  IFRCEYVKSDEILNCLSVMRETV  341
            +  C +V  + +  C  V+++ V
Sbjct  263  LSFCTHVPKERVSACFEVIQDKV  285



>ref|XP_004289346.1| PREDICTED: cyclin-D5-1-like [Fragaria vesca subsp. vesca]
Length=333

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 136/247 (55%), Gaps = 9/247 (4%)
 Frame = -2

Query  928  RREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKM  749
            R ++    +  +  + F    AYL++ Y DRFLS++++ + K W  R+L ++CLSLAAKM
Sbjct  80   RLDSIDWIFNARAEFGFRLQTAYLSITYYDRFLSKRSIDDGKLWAFRLLSVACLSLAAKM  139

Query  748  RCIDL-CLSDIQRDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDP  572
              I +  LS  Q  +   F+S++I RME ++LS L+W+L SITPF++L  F + +  E  
Sbjct  140  EEIKVPSLSQFQVQD-YDFESRTIQRMELLVLSTLEWKLGSITPFAYLPNFINKFCCESE  198

Query  571  SIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFK-NAIFRCE  395
            S  + L+  A ++I     +I+L +  PS+IA +A+L + +  +    L  K ++I    
Sbjct  199  SRPKGLLSGAISLIVAMTKEIELTDTRPSIIAGAAILALVDGQLTRNLLDLKMSSISFWH  258

Query  394  YVKSDEILNCLSVMRETVTRGIESSIDAISDCSLTPRSVLHRESGMMP--ERDGGMKRRR  221
                D I +C ++++E V R  ++     S  SL+  +VL  ++  +   E  GG KRR 
Sbjct  259  SEDYDHIYSCYNLVQEIVERKDKTP----SKFSLSSPNVLPTQASTIDVLENSGGTKRRL  314

Query  220  LNNFCDD  200
              +  DD
Sbjct  315  TFSDSDD  321



>ref|XP_008811014.1| PREDICTED: cyclin-D4-1-like isoform X1 [Phoenix dactylifera]
Length=348

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 127/229 (55%), Gaps = 11/229 (5%)
 Frame = -2

Query  943  ISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLS  764
            +  SIRRE+    ++    Y F    AYL++NY+DRFLS   + + K W++++L ++CLS
Sbjct  87   LDLSIRRESIDWIWKVHAHYNFGPLSAYLSVNYLDRFLSTYELPQGKTWMMQLLSVACLS  146

Query  763  LAAKMRCIDL-CLSDIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSL  590
            LAAKM   ++  L D+Q  +   +F++++I RME ++LS LKWR++++TPFSF+ +F  L
Sbjct  147  LAAKMEETEVPLLLDLQVGKSKYVFEARTIQRMELLVLSTLKWRMQAVTPFSFIDYF--L  204

Query  589  YPLEDPSIAQSL-IHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKN  413
            +   D +    L I R+  +I  +        + PS IAA+  L     L   Q +  + 
Sbjct  205  HKFNDGNSPTKLSISRSMELILDTVGGTDFLAFRPSEIAAAVAL---SALGETQTVDVEK  261

Query  412  AIFRCEYVKSDEILNCLSVMRETV---TRGIESSIDAISDCSLTPRSVL  275
             +  C  +  + +L C  V++E +    R ++++   +S    +P +VL
Sbjct  262  GVSCCNLIAKERVLRCYEVIQENILMRNRPLKNATLMVSSVPRSPIAVL  310



>ref|XP_006302511.1| hypothetical protein CARUB_v10020608mg [Capsella rubella]
 gb|EOA35409.1| hypothetical protein CARUB_v10020608mg [Capsella rubella]
Length=338

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/224 (34%), Positives = 123/224 (55%), Gaps = 17/224 (8%)
 Frame = -2

Query  994  FAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAV  815
            F    D++   LS    +  S R ++ +   + Q  YKF    AYLA+NY+DRFL  + +
Sbjct  57   FVPGHDYLSRFLS--RSLDASAREDSVAWILKVQAYYKFQPLTAYLAVNYMDRFLYARRL  114

Query  814  LENKPWVVRILVISCLSLAAKMRCI------DLCLSDIQRDEGLMFDSQSIHRMEGMILS  653
             E   W +++L ++CLSLAAKM  I      D  ++ ++     +F++++I RME ++LS
Sbjct  115  PETSGWPMQLLAVACLSLAAKMEEILVPSLFDFQVAGVK----YLFEAKTIKRMELLVLS  170

Query  652  CLKWRLRSITPFSFLHFFT-SLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIA  476
             L WRLRS+TPF FL FF   + PL   +     I  A+ II ++  +    EY PS IA
Sbjct  171  VLDWRLRSVTPFDFLSFFAYKIDPLG--TFLGFFISHATEIILSNIKEASFLEYWPSSIA  228

Query  475  ASALLYVAEKLIPLQFL--SFKNAIFRCEYVKSDEILNCLSVMR  350
            A+A+L VA +L  L  +    K+    C+ +  ++I+ C  +M+
Sbjct  229  AAAILCVANELPSLSSVVNPHKSPETWCDGLSKEKIVRCYRLMK  272



>ref|NP_001149823.1| cyclin delta-2 [Zea mays]
 gb|ACG36910.1| cyclin delta-2 [Zea mays]
Length=322

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 125/239 (52%), Gaps = 17/239 (7%)
 Frame = -2

Query  997  LFAGESDHMPSLLSFNHQISFSI----RREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFL  830
            L  GE+ + P     +   S SI    R E+ +   + Q  Y F    AYLA+NY+DRFL
Sbjct  48   LIGGEAQYSPRPDYPDRLRSRSIDPAARAESVAWILKVQEYYGFLPLTAYLAVNYMDRFL  107

Query  829  SRQAVLENKPWVVRILVISCLSLAAKMR------CIDLCLSDIQRDEGLMFDSQSIHRME  668
            S   + +   W +++L ++CLSLAAKM        +DL +    R +   F+  ++ RME
Sbjct  108  SLHRLPQEDGWAMQLLAVTCLSLAAKMEETLVPSLLDLQVEGTSRYD--CFEPGTVGRME  165

Query  667  GMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI--AQSLIHRASTIIFTSHYDIKLFEY  494
             ++L  L WRLRS+TPF+F+ FF       DP     + LI RA+ +I  + +D++  ++
Sbjct  166  LLVLMALNWRLRSVTPFTFVDFFACKV---DPGGRHTRCLIARATQVILAAMHDVEFLDH  222

Query  493  NPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVTRGIESSI  317
             PS +AA+A+L    +   L+ +S   A+  C  +  + I +C  +M+  V   + + +
Sbjct  223  CPSSMAAAAVLCAIGETPSLESVSPGAAVSWCIGLAEEGISSCYRLMQRLVIGNVRTRV  281



>ref|XP_006302510.1| hypothetical protein CARUB_v10020608mg [Capsella rubella]
 gb|EOA35408.1| hypothetical protein CARUB_v10020608mg [Capsella rubella]
Length=331

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/220 (36%), Positives = 122/220 (55%), Gaps = 9/220 (4%)
 Frame = -2

Query  994  FAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAV  815
            F    D++   LS    +  S R ++ +   + Q  YKF    AYLA+NY+DRFL  + +
Sbjct  57   FVPGHDYLSRFLS--RSLDASAREDSVAWILKVQAYYKFQPLTAYLAVNYMDRFLYARRL  114

Query  814  LENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQ-RDEGLMFDSQSIHRMEGMILSCLKW  641
             E   W +++L ++CLSLAAKM  I +  L D Q      +F++++I RME ++LS L W
Sbjct  115  PETSGWPMQLLAVACLSLAAKMEEILVPSLFDFQVAGVKYLFEAKTIKRMELLVLSVLDW  174

Query  640  RLRSITPFSFLHFFT-SLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASAL  464
            RLRS+TPF FL FF   + PL   +     I  A+ II ++  +    EY PS IAA+A+
Sbjct  175  RLRSVTPFDFLSFFAYKIDPLG--TFLGFFISHATEIILSNIKEASFLEYWPSSIAAAAI  232

Query  463  LYVAEKLIPLQFL--SFKNAIFRCEYVKSDEILNCLSVMR  350
            L VA +L  L  +    K+    C+ +  ++I+ C  +M+
Sbjct  233  LCVANELPSLSSVVNPHKSPETWCDGLSKEKIVRCYRLMK  272



>ref|XP_010530194.1| PREDICTED: cyclin-D4-1-like [Tarenaya hassleriana]
Length=335

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/228 (33%), Positives = 129/228 (57%), Gaps = 8/228 (4%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPSLLSFNH----QISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNY  845
             + + +L + ES+H+P     N      +    R EA     +    + F    +YL++NY
Sbjct  62    EGLSSLISKESEHLPKDDYMNRLRNGDLDLVARAEAIDWICKVHAHFGFGPLCSYLSINY  121

Query  844   IDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQRDEG-LMFDSQSIHRM  671
             +DRFLS   + + K W++++L ++CLSLAAKM   ++ +S D+Q  E   +F++++I RM
Sbjct  122   MDRFLSSYELPKGKAWMMQLLAVACLSLAAKMEETEVPVSLDLQVGESKFVFEARTIQRM  181

Query  670   EGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYN  491
             E ++LS LKWR++++TPFSFL  F S   + D S+ +  I R+  +I ++   I L E+ 
Sbjct  182   ELLVLSTLKWRMQAVTPFSFLDHFHSKINI-DQSLQRLAILRSIQLISSTLKGIDLLEFK  240

Query  490   PSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE  347
             PS IAA+ ++  AE+ I   F S         YV  + +L C  ++++
Sbjct  241   PSEIAATVVISSAEE-IHNAFDSEMALSALSPYVSKERVLKCKELIQD  287



>ref|XP_003555300.1| PREDICTED: cyclin-D4-1-like isoform X1 [Glycine max]
Length=324

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 84/256 (33%), Positives = 129/256 (50%), Gaps = 33/256 (13%)
 Frame = -2

Query  1030  NDHHHLD---------AVPALFAGESDHMPSLLSF----NHQISFSIRREAFSLTYRTQF  890
             +DHHH           A+  L   E+ HMP         +  +  + R +A +   +   
Sbjct  26    SDHHHPPSPFPDSDEAAIAGLLDAETHHMPEKDYLRRCRDRSVDVTARLDAVNWILKVHA  85

Query  889   IYKFDRSIAYLAMNYIDRFLSRQAV-LENKPWVVRILVISCLSLAAKMRCIDLC-LSDIQ  716
              Y+F    A+L++NY+DRFLSR ++  E+  W  ++L ++CLSLAAKM    +  L D+Q
Sbjct  86    FYEFSPVTAFLSVNYLDRFLSRCSLPQESGGWAFQLLSVACLSLAAKMEESHVPFLLDLQ  145

Query  715   R-DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLH-FFTSLYPLEDPSIAQSLIHRA  542
                   +F+ +++ RME  ++S LKWRLRS+TPF +LH FFT L     PS +   I  A
Sbjct  146   LFQPKFVFEPKTVQRMELWVMSNLKWRLRSVTPFDYLHYFFTKL-----PSSSSQSITTA  200

Query  541   STIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNA-IFRCEYVKSDEILNC  365
             S +I ++   I    + PS +AA+A+   A   +PL F    N+ + RC          C
Sbjct  201   SNLILSTTRVINFLGFAPSTVAAAAVQCSANGQLPLSFHDRLNSEMVRC----------C  250

Query  364   LSVMRETVTRGIESSI  317
               +M E V     +SI
Sbjct  251   HQLMEEYVVDTCPASI  266



>gb|KDO81113.1| hypothetical protein CISIN_1g045125mg, partial [Citrus sinensis]
Length=342

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 129/229 (56%), Gaps = 11/229 (5%)
 Frame = -2

Query  943  ISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLS  764
            +  + R+EA     +    + F    +YL +NY+DRFLS   + + K W++++L ++CLS
Sbjct  96   LDLAARQEAVDWIAKVHSHFGFGPLCSYLTINYLDRFLSAYELPKGKVWMMQLLAVACLS  155

Query  763  LAAKMRCID--LCLSDIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTS  593
            LAAKM   +  LCL D+Q  +   +F++++I RME ++LS LKWR+++ITPFSFL +FT 
Sbjct  156  LAAKMEETEVPLCL-DLQVGQSKFLFEAKTIQRMELLVLSTLKWRMQAITPFSFLDYFTR  214

Query  592  LYPLEDPSIAQS----LIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFL  425
                +D    Q+    L  R+  II +S   I   E+ PS IAA+  + V  +   +  +
Sbjct  215  KITDDDDDHHQTPLRALFCRSIQIITSSIKGIDFLEFKPSEIAAAVAISVTGETKTV--V  272

Query  424  SFKNAI-FRCEYVKSDEILNCLSVMRETVTRGIESSIDAISDCSLTPRS  281
              + AI    ++VK + +L C+ +M +++  G   S  + S  +  P+S
Sbjct  273  DTEKAISLLTQHVKKERVLKCIKMMNDSLISGSVKSATSASLATSFPQS  321



>ref|XP_004143797.1| PREDICTED: cyclin-D1-1-like [Cucumis sativus]
 ref|XP_004170800.1| PREDICTED: cyclin-D1-1-like [Cucumis sativus]
 gb|KGN51205.1| hypothetical protein Csa_5G488810 [Cucumis sativus]
Length=335

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/258 (34%), Positives = 141/258 (55%), Gaps = 18/258 (7%)
 Frame = -2

Query  1096  SSLFLSDLLMEF--NLENPLTSSFNDHHHLDAVPALFAGESDHMPS---LLSFNHQ-ISF  935
             SS  LS  L+E+  +LE+P +S        D++ +    E   +P    L  F  Q +  
Sbjct  21    SSGILSGDLLEYSSDLESPASSE-------DSIASFIEDERHFVPGIDYLSRFQSQSLDS  73

Query  934   SIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAA  755
             S R ++ +   + Q  Y F    AYL++NY+DRFL  + + E   W +++L ++CLSLAA
Sbjct  74    SARADSVAWILKVQAYYGFQPLTAYLSVNYLDRFLYSRRLPETNGWPLQLLSVACLSLAA  133

Query  754   KM-RCIDLCLSDIQ-RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPL  581
             KM   I     D+Q      +F+ ++I RME ++L+ L WRLRS+TPFSF+ FF   Y +
Sbjct  134   KMEEPIVPSFVDLQIEGAKYIFEPRTIRRMELLVLTTLNWRLRSVTPFSFIGFFA--YKV  191

Query  580   EDPSIAQSLIH-RASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIF  404
             +      S ++ R++ II ++  D    EY PS IAA+ALL  A ++  L  L+ ++A  
Sbjct  192   DPTGTFSSFLNSRSTEIILSNTRDATFLEYWPSCIAAAALLCAANEIPNLTLLNPEHAQS  251

Query  403   RCEYVKSDEILNCLSVMR  350
              C  +  D+I+ C  +M+
Sbjct  252   WCNGLSKDKIVGCYRLMQ  269



>ref|XP_003607665.1| Cyclin d2 [Medicago truncatula]
 gb|AES89862.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=342

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/260 (30%), Positives = 139/260 (53%), Gaps = 23/260 (9%)
 Frame = -2

Query  943  ISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLS  764
            + F  R EA     + Q  + F     YL++NY+DRFLS     E + W +++L ++CLS
Sbjct  87   LDFGARNEAIDWIQKVQSHFGFGPLCVYLSINYMDRFLSAYQFPERRDWSMQLLAVACLS  146

Query  763  LAAKMRCIDLC-LSDIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSL  590
            LAAK+   D+  + ++Q  E   +F++++I ++E ++L+ LKWR+++ITPFSF+ +F S 
Sbjct  147  LAAKVDETDVPRILELQIGESKFVFEAKTIQKIELLVLTTLKWRMQAITPFSFIEYFLSK  206

Query  589  YPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNA  410
               +  S+  S+I + + +I ++       E+ PS IAA+   YV E+   +   S K+ 
Sbjct  207  INDDKSSLNNSIILQCTQLISSTIKSPDFLEFKPSEIAAAVATYVVEEFQAID--SSKSI  264

Query  409  IFRCEYVKSDEILNCLSVMRET-VTRGIESSIDAISDCSLTPRSVLHRESGMM-------  254
                +Y++ + +L C+  ++E  +    +S+  ++S       SVL    GM        
Sbjct  265  STLIQYIEKERLLKCVEKVQEMCIFTAKDSNASSVS-------SVLQSPMGMFDTLRFRY  317

Query  253  --PERDGGM--KRRRLNNFC  206
               + + G+  KRR+LN  C
Sbjct  318  KCDDNNAGVDAKRRKLNKRC  337



>gb|AAL47480.1| cyclin D3 [Helianthus tuberosus]
Length=357

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/225 (31%), Positives = 117/225 (52%), Gaps = 8/225 (4%)
 Frame = -2

Query  1000 ALFAGESDHM---PSLLSFNHQIS--FSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDR  836
            +LF  E +     P  LSF       F+ R+EA     + +  Y F    A LA+NY+DR
Sbjct  64   SLFTKEQEQQKQTPCTLSFGKTSPSVFAARKEAVDWILKVKSCYGFTPLTAILAINYLDR  123

Query  835  FLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQ-RDEGLMFDSQSIHRMEGM  662
            FLS     E+KPW+++++ +SCLSLAAK+    +  L D+Q  D   +F++++I +ME +
Sbjct  124  FLSSLHFQEDKPWMIQLVAVSCLSLAAKVEETQVPLLLDLQVEDTKYLFEAKNIQKMELL  183

Query  661  ILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSV  482
            ++S LKWR+  +TP SFL        L D  +      +   +I     D +   Y PSV
Sbjct  184  VMSTLKWRMNPVTPISFLDHIVRRLGLTD-HVHWDFFKKCEAMILCLVSDSRFVCYKPSV  242

Query  481  IAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRE  347
            +A + +L+V +++ P   + +K+ +        D+I  C  ++ E
Sbjct  243  LATATMLHVVDEIDPPNCIDYKSQLLDLLKTTKDDINECYELIVE  287



>ref|NP_201345.1| cyclin-D4-1 [Arabidopsis thaliana]
 sp|Q8LGA1.2|CCD41_ARATH RecName: Full=Cyclin-D4-1; AltName: Full=G1/S-specific cyclin-D4-1; 
Short=CycD4;1 [Arabidopsis thaliana]
 dbj|BAB11564.1| D-type cyclin [Arabidopsis thaliana]
 gb|AED98049.1| cyclin-D4-1 [Arabidopsis thaliana]
Length=308

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 83/268 (31%), Positives = 137/268 (51%), Gaps = 30/268 (11%)
 Frame = -2

Query  1036  SFNDHHHLDAVPALFAGESDHMPS------LLSFNHQISFSIRREAFSLTYRTQFIYKFD  875
              F+     + +  +   E  H+PS      L S +  ++   RR+A +  ++   +++F 
Sbjct  37    GFSQSESEEIIMEMVEKEKQHLPSDDYIKRLRSGDLDLNVG-RRDALNWIWKACEVHQFG  95

Query  874   RSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMR------CIDLCLSDIQR  713
                  LAMNY+DRFLS   +   K W++++L ++CLSLAAK+        IDL + D Q 
Sbjct  96    PLCFCLAMNYLDRFLSVHDLPSGKGWILQLLAVACLSLAAKIEETEVPMLIDLQVGDPQ-  154

Query  712   DEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTI  533
                 +F+++S+ RME ++L+ LKWRLR+ITP S++ +F       D   + +LI R+  +
Sbjct  155   ---FVFEAKSVQRMELLVLNKLKWRLRAITPCSYIRYFLRKMSKCDQEPSNTLISRSLQV  211

Query  532   IFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVM  353
             I ++   I   E+ PS +AA+  L V+ +   LQ + F N+ F         + + L   
Sbjct  212   IASTTKGIDFLEFRPSEVAAAVALSVSGE---LQRVHFDNSSF-------SPLFSLLQKE  261

Query  352   R-ETVTRGIESSIDAISDCSLTPRSVLH  272
             R + +   IES  D    CS TP  VL 
Sbjct  262   RVKKIGEMIES--DGSDLCSQTPNGVLE  287



>gb|ACU21437.1| unknown [Glycine max]
Length=352

 Score =   114 bits (285),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 124/220 (56%), Gaps = 11/220 (5%)
 Frame = -2

Query  985  ESDHMPSLLSFNH----QISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQA  818
            E  H   L   N      + F  R EA    ++ +  + F     YL++NY+DRFL    
Sbjct  70   ECQHWSGLRYLNKFQTGDLDFGARMEAIDWIHKVRSHFGFGPLCGYLSINYLDRFLFAYE  129

Query  817  VLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQRDEG-LMFDSQSIHRMEGMILSCLK  644
            + + + W +++LV++CLSLAAK+   ++ LS D+Q  E   +F++++I RME ++LS LK
Sbjct  130  LPKGRVWTMQLLVVACLSLAAKLDETEVPLSLDLQVGESKFLFEAKTIQRMELLVLSTLK  189

Query  643  WRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAASAL  464
            WR+++ITPF+FL +F      +D S  +S I R+  +I ++   I   E+ PS IAA+  
Sbjct  190  WRMQAITPFTFLDYFLCKIN-DDQSPLRSSIMRSIQLISSTARGIDFLEFKPSEIAAAVA  248

Query  463  LYVAEKLIPLQFLSFKNAI-FRCEYVKSDEILNCLSVMRE  347
            +YV   +   Q +    AI    ++V+ + +L C+ +++E
Sbjct  249  MYV---MGETQTVDTGKAISVLIQHVEKERLLKCVQMIQE  285



>ref|XP_010419132.1| PREDICTED: cyclin-D1-1 [Camelina sativa]
Length=309

 Score =   113 bits (283),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 78/231 (34%), Positives = 127/231 (55%), Gaps = 11/231 (5%)
 Frame = -2

Query  1015  LDAVPALFAGESDHMPS---LLSFNHQ-ISFSIRREAFSLTYRTQFIYKFDRSIAYLAMN  848
             +D++     GE   +P    L  F  + +  S R ++ +   + Q  YKF    AYLA+N
Sbjct  21    VDSIACFIEGERHFVPGHDYLSRFQSRSLDASAREDSVAWILKVQAYYKFQPLTAYLAVN  80

Query  847   YIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQ-RDEGLMFDSQSIHR  674
             Y+DRFL  + + E   W +++L ++CLSLAAKM  + +  L D Q      +F++++I R
Sbjct  81    YMDRFLYARRLPETSGWPMQLLAVACLSLAAKMEEVLVPSLFDFQVAGVKYIFEAKTIKR  140

Query  673   MEGMILSCLKWRLRSITPFSFLHFFT-SLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFE  497
             ME ++LS L WRLRS+TPF FL FF   + PL   +     +  A+ II ++  +    E
Sbjct  141   MELLVLSVLDWRLRSVTPFDFLSFFAYKIDPLG--TFLGFFVSHATQIILSNIKEASFLE  198

Query  496   YNPSVIAASALLYVAEKLIPLQFL--SFKNAIFRCEYVKSDEILNCLSVMR  350
             Y PS IAA+A+L VA +L  L  +    ++    C+ +  ++I+ C  +M+
Sbjct  199   YWPSSIAAAAILCVANELPSLSSVVNPHESPETWCDGLSKEKIVRCYRLMK  249



>ref|XP_006596367.1| PREDICTED: cyclin-D4-1-like isoform X2 [Glycine max]
Length=354

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 137/248 (55%), Gaps = 18/248 (7%)
 Frame = -2

Query  985  ESDHMPSLLSFNH----QISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQA  818
            E DH+P+    N      + F  R+EA     + Q  + F    AYL++NY+DRFLS   
Sbjct  73   EWDHLPNGDYVNRLRSGDLDFGARKEAIDWIEKVQQHFGFGPLCAYLSINYLDRFLSAYE  132

Query  817  VLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQRDEG-LMFDSQSIHRMEGMILSCLK  644
             L ++ W +++L + CLSLAAKM   D+  S D+Q  E   +F++++I RME ++LS L+
Sbjct  133  -LPHRAWTMQLLAVGCLSLAAKMEETDVPFSLDLQVGESKYIFEAKTIQRMELLVLSTLR  191

Query  643  WRLRSITPFSFLHFFTSLYPL-EDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSVIAAS-  470
            WR+++ITPFSF+  F  LY + +D S   + I ++  +I ++   I   E+ PS IAA+ 
Sbjct  192  WRMQAITPFSFIDHF--LYKINDDQSPIGASILQSIQLILSTVRGIDFLEFRPSEIAAAV  249

Query  469  ALLYVAEKLIPLQFLSFKNAI-FRCEYVKSDEILNCLSVMRETVTRGIESSIDAISDCSL  293
            A+  V E     Q +  + AI    + V+ + +L C+ +++E  +    S+  A +  S+
Sbjct  250  AISVVGEG----QTVHTEKAISVLIQLVEKERVLKCVKMIQELASNSGGSAKGASASVSV  305

Query  292  --TPRSVL  275
               P S L
Sbjct  306  PSVPESPL  313



>emb|CAB61221.1| cyclin D1 [Antirrhinum majus]
Length=330

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 115/207 (56%), Gaps = 12/207 (6%)
 Frame = -2

Query  928  RREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKM  749
            R E+ +   + Q  Y F    AYLA++Y DRFL+   + +   W +++L ++CLSLAAKM
Sbjct  74   RTESTAWILKVQRYYGFQPLTAYLAVSYFDRFLNAHHLPKLNGWPMQLLSVACLSLAAKM  133

Query  748  -RCIDLCLSDIQ-RDEGLMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLED  575
               +   L D+Q      +F+ ++I RME ++L  L WRLRSI+PF +L FF       D
Sbjct  134  EESLVPSLLDLQVEGANFIFEPRNIQRMELLVLRVLDWRLRSISPFCYLSFFALKI---D  190

Query  574  PSIAQS--LIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFR  401
            P+   +  L  RA  II ++  +  L EY PS IAA+ +L  A  L    F++ ++A   
Sbjct  191  PTGTYTGFLTSRAKEIILSTVQETSLIEYRPSCIAAATMLSSANDLPKFSFITAQHAEAW  250

Query  400  CEYVKSDEILNCLSVMRETVTRGIESS  320
            C+ +  D I +C+ ++     +G+ES+
Sbjct  251  CDGLHKDNIASCIKLI-----QGVESN  272



>ref|XP_001756858.1| predicted protein [Physcomitrella patens]
 gb|EDQ78455.1| predicted protein [Physcomitrella patens]
 dbj|BAK64053.1| cyclin D;2 [Physcomitrella patens]
Length=362

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 126/230 (55%), Gaps = 8/230 (3%)
 Frame = -2

Query  1012  DAVPALFAGESDHMP----SLLSFNHQISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNY  845
             DAV  L   E+ +MP    S    + ++S   R +A     + Q  Y +      LA+NY
Sbjct  53    DAVSTLLLKEAQYMPEPDYSERYHSRELSNGARLDAVRWIQKVQAFYNYSPLTVALAVNY  112

Query  844   IDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQ-RDEGLMFDSQSIHRM  671
             +DRFLSR  + E K W++++L +SC+SLAAKM   ++  L D+Q   +  +F++ +I RM
Sbjct  113   MDRFLSRHHLPEGKDWMLQLLSVSCISLAAKMEESEVPILLDLQVEQQEHIFEAHTIQRM  172

Query  670   EGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYN  491
             E ++LS L+WR+  +TPFS++ +F     + +  + ++L+ R S II  +  D    +Y 
Sbjct  173   ELLVLSTLEWRMSVVTPFSYIDYFFHKLGISE-LLLRALLSRVSEIIMKAIEDTTFLQYL  231

Query  490   PSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETV  341
             PSV+AA++L++  E++  L        IF    V  D I +C   M+  V
Sbjct  232   PSVVAAASLIFSLEEVTALHTDDLIR-IFSDLSVDVDAIKDCYHDMQVAV  280



>ref|XP_009106467.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-D1-1 [Brassica rapa]
Length=444

 Score =   115 bits (287),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 130/233 (56%), Gaps = 17/233 (7%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPSL--LSFNHQISF--SIRREAFSLTYRTQFIYKFDRSIAYLAMNY  845
             D++ +    E   +P L  LS  H  S   S R E+ +   + Q  Y F    AYLA+NY
Sbjct  155   DSIASCIEDERHFVPGLDYLSRFHSQSLDASAREESVTWILKVQAYYSFQPLTAYLAVNY  214

Query  844   IDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQRDEGL--MFDSQSIHR  674
             +DRFL  + + E   W +++L ++CLSLAAKM  + +  L D Q  EG+  +F++++I R
Sbjct  215   MDRFLYARRLPETSGWPMQLLAVACLSLAAKMEEVLVPSLFDFQV-EGVKYIFEAKTIQR  273

Query  673   MEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLI---HRASTIIFTSHYDIKL  503
             ME ++L  L WRLRS+TPFSFL FF   Y + DP +  SL      A+ II ++  +   
Sbjct  274   MELLVLDVLDWRLRSVTPFSFLSFFA--YKI-DP-LGTSLGFFRSHATEIILSNIKEASF  329

Query  502   FEYNPSVIAASALLYVAEKLIPLQFLS--FKNAIFRCEYVKSDEILNCLSVMR  350
              EY PS IAA+A+L VA +L  L   +    +    C+ +  ++I+ C  +M+
Sbjct  330   LEYKPSSIAAAAILCVANELPSLSSAANPHDSPETWCDXLSKEKIVRCYKLMK  382



>ref|XP_010928562.1| PREDICTED: cyclin-D2-1-like isoform X1 [Elaeis guineensis]
Length=317

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 149/291 (51%), Gaps = 39/291 (13%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPSLLSFNHQISFS-------IRREAFSLTYRTQFIYKFDRSIAYLA  854
             +++     GESD+ P    F++Q  F         R+E+ +   +    Y+F    AYLA
Sbjct  43    ESIAGFIEGESDYSPR---FDYQDRFRSRSLDPFARQESIAWILKVHEYYRFHPLTAYLA  99

Query  853   MNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKM-RCIDLCLSDIQRDEG--LMFDSQS  683
             +NY+DRFLS   + ++  W +++L ++CLSLAAKM   +   L D+Q  EG   +F+ ++
Sbjct  100   VNYMDRFLSSHQLPQSNGWALQLLSVACLSLAAKMEETLVPALLDLQV-EGPRFIFEPRT  158

Query  682   IHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDP--SIAQSLIHRASTIIFTSHYDI  509
             I RME ++L+ L WRLRS+TPF+F+ FF   Y + DP  + A+ L+ RA+ II    +DI
Sbjct  159   ICRMELLVLTALNWRLRSVTPFTFIDFFA--YKV-DPMGTHARYLVSRATHIILAMIHDI  215

Query  508   KLFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVTRGI  329
                 + PS IAASA++Y A +   L F+S   A+  C  +  + I NC  +M +      
Sbjct  216   DFLNHCPSSIAASAIIYAAGETQDLAFVSPGVAVSWCIGLTEEAIANCYQLMLQV-----  270

Query  328   ESSIDAISDCSLTPRSVLHRESGMMPERDGGM----------KRRRLNNFC  206
                  AI      P  +L +     P                KRR+LNN C
Sbjct  271   -----AIDHKQRKPPMILSQLRVTTPHSVDSGVSSSPSSPPNKRRKLNNNC  316



>tpg|DAA61294.1| TPA: cyclin delta-2 [Zea mays]
Length=325

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 125/239 (52%), Gaps = 17/239 (7%)
 Frame = -2

Query  997  LFAGESDHMPSLLSFNHQISFSI----RREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFL  830
            L  GE+ + P     +   S SI    R E+ +   + Q  Y F    AYLA+NY+DRFL
Sbjct  49   LIGGEAQYSPRPDYPDRLRSRSIDPAARAESVAWILKVQEYYGFLPLTAYLAVNYMDRFL  108

Query  829  SRQAVLENKPWVVRILVISCLSLAAKMR------CIDLCLSDIQRDEGLMFDSQSIHRME  668
            S   + +   W +++L ++CLSLAAKM        +DL +    R +   F+  ++ +ME
Sbjct  109  SLHRLPQEDGWAMQLLAVTCLSLAAKMEETLVPSLLDLQVEGTSRYD--CFEPGTVGQME  166

Query  667  GMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSI--AQSLIHRASTIIFTSHYDIKLFEY  494
             ++L  L WRLRS+TPF+F+ FF       DP     + LI RA+ +I  + +D++  ++
Sbjct  167  LLVLMALNWRLRSVTPFTFVDFFACKV---DPGGRHTRCLIARATQVILAAMHDVEFLDH  223

Query  493  NPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVTRGIESSI  317
             PS +AA+A+L    +   L+ +S   A+  C  +  + I +C  +M+  V   + + +
Sbjct  224  CPSSMAAAAVLCAIGETPSLESVSPGAAVSWCIGLAEEGISSCYRLMQRLVIGNVRTRV  282



>ref|XP_011097500.1| PREDICTED: cyclin-D4-1-like [Sesamum indicum]
Length=363

 Score =   114 bits (284),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 123/228 (54%), Gaps = 22/228 (10%)
 Frame = -2

Query  985  ESDHMPSLLSFNH----QISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQA  818
            E +H+P+          ++  S+R+EA    ++    + F     YLAMNY+DRFLS   
Sbjct  77   EREHLPADDYLKRLRSGELDMSLRKEALDWMFKACAHHNFGELCLYLAMNYMDRFLSVYN  136

Query  817  VLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQRDE-GLMFDSQSIHRMEGMILSCLK  644
            +   K W V+++ ++CLSLAAK+  +D+  + D+Q  E   +F+ ++I RME ++L+ LK
Sbjct  137  LPGGKTWAVQLVAVACLSLAAKIDEVDVPSTVDLQAGEPKFLFEGKTIQRMEMLVLNYLK  196

Query  643  WRLRSITPFSFLHFF------TSLYPLEDPSIAQSLIHRASTIIFTSHYDIKLFEYNPSV  482
            W ++S TPF+F+ +F        L P         LI R+  II ++   I   E+ PS 
Sbjct  197  WNMKSYTPFNFIEYFLRKTNHVRLPP-------GPLIARSIQIILSTIKGIDFLEFRPSE  249

Query  481  IAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVT  338
            IAA+  +YV+ +   +Q +    A+     V+   ++ CL ++++ ++
Sbjct  250  IAAAVAVYVSGE---IQAMDIDKALSSSMEVEKGRVMKCLELIQDLIS  294



>ref|XP_006647938.1| PREDICTED: cyclin-D3-1-like [Oryza brachyantha]
Length=352

 Score =   113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 130/238 (55%), Gaps = 17/238 (7%)
 Frame = -2

Query  1012  DAVPALFAGESDHMPSLLSFNHQIS--------FSIRREAFSLTYRTQFIYKFDRSIAYL  857
             + + AL   E +HMP +  +  ++          ++RR+A    ++    Y F    A L
Sbjct  64    ECIAALVEREEEHMP-MEGYPERLQPRPESVDLAAVRRDALDWIWKVIEHYNFAPLTAVL  122

Query  856   AMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDLCLS-DIQRDEG-LMFDSQS  683
             ++NY+DR+LS   + E + W+ ++L ++CLSLAAKM    + L  D+Q  E   +F++++
Sbjct  123   SVNYLDRYLSENGLPEREAWMTQLLAVACLSLAAKMEETFVPLPLDLQVAEAQFVFEART  182

Query  682   IHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLED-PSIAQSLIHRASTIIFTSHYDIK  506
             I RME ++L  LKWR+R++T  SF+ +F + +     PS+    + R++ +I ++   ++
Sbjct  183   IERMELLVLRTLKWRMRAVTACSFIDYFLNKFSDHGAPSLPA--LSRSTDLILSTAKGVE  240

Query  505   LFEYNPSVIAASALLYVAEKLIPLQFLSFKNAIFRCEYVKSDEILNCLSVMRETVTRG  332
                + PS IAAS  L     L   +    + +I  C+Y+  +E+L C  +++E +T G
Sbjct  241   FVAFRPSEIAASVALTA---LGECRSSVLERSITSCKYISKEEVLRCYEMIQEKITLG  295



>ref|XP_006433861.1| hypothetical protein CICLE_v10001581mg [Citrus clementina]
 gb|ESR47101.1| hypothetical protein CICLE_v10001581mg [Citrus clementina]
Length=366

 Score =   114 bits (284),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 129/229 (56%), Gaps = 11/229 (5%)
 Frame = -2

Query  943  ISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLS  764
            +  + R+EA     +    + F    +YL +NY+DRFLS   + + K W++++L ++CLS
Sbjct  96   LDLAARQEAVDWIAKVHSHFGFGPLCSYLTINYLDRFLSAYELPKGKVWMMQLLAVACLS  155

Query  763  LAAKMR--CIDLCLSDIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTS  593
            LAAKM    + LCL D+Q  +   +F++++I RME ++LS LKWR+++ITPFSFL +FT 
Sbjct  156  LAAKMEETEVPLCL-DLQVGQSKFLFEAKTIQRMELLVLSTLKWRMQAITPFSFLDYFTR  214

Query  592  LYPLEDPSIAQS----LIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFL  425
                +D    Q+    L  R+  II ++   I   E+ PS IAA+  + V  +   +  +
Sbjct  215  KITDDDDDHHQTPLRALFCRSIQIITSTIKGIDFLEFKPSEIAAAVAISVTGETKTV--V  272

Query  424  SFKNAI-FRCEYVKSDEILNCLSVMRETVTRGIESSIDAISDCSLTPRS  281
              + AI    ++VK + +L C+ +M +++  G   S  + S  +  P+S
Sbjct  273  DTEKAISLLTQHVKKERVLKCIKMMNDSLISGSVKSATSASLATSFPQS  321



>ref|XP_011025651.1| PREDICTED: cyclin-D1-1-like [Populus euphratica]
Length=327

 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 89/265 (34%), Positives = 143/265 (54%), Gaps = 20/265 (8%)
 Frame = -2

Query  1084  LSDLLME------FNLENPLTSSFNDHHHL---DAVPALFAGESDHMPSLLSFN----HQ  944
             LSDLL        F+ E+P  SS  + H L    ++      E + +P    F+      
Sbjct  7     LSDLLCGEDSSDIFSGESPECSSDLESHDLVEESSIAGFIEDERNFVPGYDYFSRFQSQS  66

Query  943   ISFSIRREAFSLTYRTQFIYKFDRSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLS  764
             +  S R ++ +   + Q  Y F    AYL++NY+DRFL  + + +   W +++L ++CLS
Sbjct  67    LDASAREQSVAWILKVQACYGFQPLTAYLSVNYLDRFLYSRRLPQTDGWPLQLLSVACLS  126

Query  763   LAAKM-RCIDLCLSDIQRDEG-LMFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSL  590
             LAAKM   +   L D+Q +    +F+ ++I RME ++L  L WRLRSITPFSF  FF   
Sbjct  127   LAAKMEEPLVPSLLDLQVEGAKYIFEPRTIRRMELLVLGVLDWRLRSITPFSFTGFFACK  186

Query  589   YPLEDPSIAQS--LIHRASTIIFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLSFK  416
                 DP+ A +  LI RA+ II ++  +    EY PS IAA+A+L  A  +  L  ++ +
Sbjct  187   L---DPAGAYTGFLISRATEIILSNIKEASFLEYRPSSIAAAAILCAANDIPNLSLVNPE  243

Query  415   NAIFRCEYVKSDEILNCLSVMRETV  341
             +A   C+ +  D+I++C  +M++ V
Sbjct  244   HAESWCDGLSKDKIISCYRLMQDLV  268



>emb|CDY11608.1| BnaC06g31310D [Brassica napus]
Length=317

 Score =   113 bits (282),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 84/243 (35%), Positives = 131/243 (54%), Gaps = 22/243 (9%)
 Frame = -2

Query  1054  ENPLTSSFNDHHHLDAVPALFAGESDHMPSLLSFNHQISFSIRREAFSLTYRTQFIYKFD  875
             ++ + S   D  H   VP L     D++    S    +  S R E+ +   + +  Y F 
Sbjct  27    DDSIASCIEDERHF--VPGL-----DYLSRFHS--QSLDASAREESVTWILQARAFYSFQ  77

Query  874   RSIAYLAMNYIDRFLSRQAVLENKPWVVRILVISCLSLAAKMRCIDL-CLSDIQRDEGL-  701
                AYLA+NY+DRFL  + + E   W +++L ++CLSLAAKM  + +  L D Q  EG+ 
Sbjct  78    PLTAYLAVNYMDRFLYARRLPETSGWPMQLLAVACLSLAAKMEEVVVPSLFDFQV-EGVK  136

Query  700   -MFDSQSIHRMEGMILSCLKWRLRSITPFSFLHFFTSLYPLEDPSIAQSLI---HRASTI  533
              +F++++I RME ++L  L WRLRS+TPFSFL FF   Y + DP +  SL      A+ I
Sbjct  137   YIFEAKTIQRMELLVLDVLDWRLRSVTPFSFLSFFA--YKI-DP-LGTSLGFFRSHATEI  192

Query  532   IFTSHYDIKLFEYNPSVIAASALLYVAEKLIPLQFLS--FKNAIFRCEYVKSDEILNCLS  359
             I ++  +    EY PS IAA+A+L VA +L  L   +    +    C  +  ++I+ C  
Sbjct  193   ILSNIKEASFLEYRPSSIAAAAILCVANELPSLSSAANLHDSPETWCNGLSKEKIVRCYK  252

Query  358   VMR  350
             +M+
Sbjct  253   LMK  255



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3061147228170