BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23609_g1_i1 len=517 path=[8153:0-516]

Length=517
                                                                      Score     E

ref|XP_009624780.1|  PREDICTED: monoacylglycerol lipase ABHD6           220   8e-68   
ref|XP_009776049.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      219   3e-67   
ref|XP_004248797.1|  PREDICTED: monoacylglycerol lipase ABHD6           216   3e-66   
ref|XP_006359795.1|  PREDICTED: monoacylglycerol lipase abhd6-A-like    216   4e-66   
ref|XP_011087890.1|  PREDICTED: monoacylglycerol lipase ABHD6           211   3e-64   
emb|CDO97441.1|  unnamed protein product                                210   1e-63   
gb|EPS68601.1|  hypothetical protein M569_06166                         208   6e-63   
ref|XP_003593204.1|  Hydrolase                                          205   9e-63   
gb|EYU18474.1|  hypothetical protein MIMGU_mgv1a010034mg                207   2e-62   
ref|XP_010068231.1|  PREDICTED: monoacylglycerol lipase ABHD6           205   6e-62   
gb|AES63455.2|  alpha/beta-hydrolase superfamily protein                205   8e-62   
ref|XP_003547085.1|  PREDICTED: monoacylglycerol lipase ABHD6           205   8e-62   
ref|XP_010269303.1|  PREDICTED: monoacylglycerol lipase abhd6-A         204   2e-61   
ref|XP_007042944.1|  Alpha/beta-Hydrolases superfamily protein          204   3e-61   
ref|XP_002525864.1|  abhydrolase domain containing, putative            202   1e-60   Ricinus communis
ref|XP_002272747.1|  PREDICTED: monoacylglycerol lipase ABHD6           200   5e-60   Vitis vinifera
ref|XP_002298701.1|  hydrolase family protein                           199   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_004485585.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      199   5e-59   
gb|KDO49110.1|  hypothetical protein CISIN_1g042555mg                   197   8e-59   
ref|XP_006423859.1|  hypothetical protein CICLE_v10030086mg             197   8e-59   
ref|XP_010690508.1|  PREDICTED: uncharacterized protein LOC104904032    197   8e-59   
ref|XP_006493892.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      197   1e-58   
ref|XP_007148408.1|  hypothetical protein PHAVU_006G206100g             195   6e-58   
ref|XP_002285791.1|  PREDICTED: monoacylglycerol lipase ABHD6           193   2e-57   Vitis vinifera
ref|XP_007200397.1|  hypothetical protein PRUPE_ppa008541mg             194   2e-57   
ref|XP_011045672.1|  PREDICTED: monoacylglycerol lipase abhd6-A         193   4e-57   
ref|XP_003532960.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      193   5e-57   
emb|CBI19164.3|  unnamed protein product                                193   6e-57   
ref|XP_003635235.1|  PREDICTED: uncharacterized protein LOC100853399    191   7e-57   
ref|XP_007018761.1|  Alpha/beta-Hydrolases superfamily protein is...    192   2e-56   
ref|XP_007018762.1|  Alpha/beta-Hydrolases superfamily protein is...    192   2e-56   
ref|XP_002263605.2|  PREDICTED: uncharacterized protein LOC100242910    191   2e-56   Vitis vinifera
emb|CAC05469.1|  putative hydrolase                                     190   3e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KDP40902.1|  hypothetical protein JCGZ_24901                         190   4e-56   
ref|NP_196505.2|  alpha/beta-Hydrolases superfamily protein             190   5e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CBI38426.3|  unnamed protein product                                189   6e-56   
emb|CBI14844.3|  unnamed protein product                                189   7e-56   
ref|XP_002262933.3|  PREDICTED: uncharacterized protein LOC100264766    189   8e-56   Vitis vinifera
ref|XP_011016513.1|  PREDICTED: monoacylglycerol lipase ABHD6           189   1e-55   
ref|XP_006288272.1|  hypothetical protein CARUB_v10001518mg             188   3e-55   
ref|XP_009344576.1|  PREDICTED: monoacylglycerol lipase ABHD6           188   4e-55   
ref|XP_002871371.1|  predicted protein                                  187   5e-55   
emb|CDY44797.1|  BnaC02g00900D                                          187   8e-55   
ref|XP_002301056.1|  hydrolase family protein                           187   1e-54   Populus trichocarpa [western balsam poplar]
ref|XP_006399421.1|  hypothetical protein EUTSA_v10015451mg             186   1e-54   
ref|XP_009131110.1|  PREDICTED: monoacylglycerol lipase abhd6-B-like    186   2e-54   
emb|CDX78359.1|  BnaA03g02710D                                          186   2e-54   
ref|XP_010491571.1|  PREDICTED: uncharacterized protein LOC104769127    186   2e-54   
gb|KFK25251.1|  hypothetical protein AALP_AA8G087700                    186   2e-54   
emb|CDX69905.1|  BnaA10g22540D                                          185   3e-54   
emb|CDX81126.1|  BnaC03g03800D                                          185   4e-54   
ref|XP_010422984.1|  PREDICTED: uncharacterized protein LOC104708175    184   6e-54   
ref|XP_007047918.1|  Alpha/beta-Hydrolases superfamily protein is...    180   2e-53   
ref|XP_009122516.1|  PREDICTED: uncharacterized protein LOC103847208    183   2e-53   
ref|XP_010546343.1|  PREDICTED: monoacylglycerol lipase ABHD6           183   2e-53   
ref|XP_007047917.1|  Alpha/beta-Hydrolases superfamily protein is...    181   5e-53   
ref|XP_003524260.1|  PREDICTED: epoxide hydrolase 3                     182   7e-53   
emb|CDY21582.1|  BnaC09g47100D                                          181   9e-53   
ref|XP_008373280.1|  PREDICTED: epoxide hydrolase 3                     182   1e-52   
emb|CDY40723.1|  BnaAnng05860D                                          181   1e-52   
ref|XP_008237384.1|  PREDICTED: monoacylglycerol lipase ABHD6           184   1e-52   
ref|XP_007047913.1|  Alpha/beta-Hydrolases superfamily protein is...    181   2e-52   
ref|XP_007047916.1|  Alpha/beta-Hydrolases superfamily protein is...    181   2e-52   
ref|XP_010027905.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      181   2e-52   
ref|XP_004504092.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      180   3e-52   
ref|XP_010452932.1|  PREDICTED: uncharacterized protein LOC104734933    180   3e-52   
gb|KDP41386.1|  hypothetical protein JCGZ_15793                         179   8e-52   
ref|XP_009603502.1|  PREDICTED: epoxide hydrolase 4                     179   9e-52   
ref|XP_011100065.1|  PREDICTED: uncharacterized protein LOC105178306    179   1e-51   
ref|XP_010027904.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      179   1e-51   
ref|XP_009789417.1|  PREDICTED: uncharacterized protein LOC104237044    178   2e-51   
ref|XP_004292444.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      179   2e-51   
ref|XP_002307077.1|  hypothetical protein POPTR_0005s07540g             178   3e-51   Populus trichocarpa [western balsam poplar]
gb|KHG17564.1|  Monoacylglycerol lipase ABHD6                           178   3e-51   
ref|XP_009125759.1|  PREDICTED: monoacylglycerol lipase abhd6-B-like    177   3e-51   
ref|XP_010027903.1|  PREDICTED: abhydrolase domain-containing pro...    177   5e-51   
gb|KCW54542.1|  hypothetical protein EUGRSUZ_I00502                     175   9e-51   
ref|XP_010025435.1|  PREDICTED: uncharacterized protein LOC104415777    176   1e-50   
ref|XP_010531367.1|  PREDICTED: monoacylglycerol lipase ABHD6           176   2e-50   
gb|KDO58791.1|  hypothetical protein CISIN_1g021268mg                   175   3e-50   
ref|XP_006426372.1|  hypothetical protein CICLE_v10026111mg             175   3e-50   
ref|XP_011031037.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    175   4e-50   
ref|XP_011031038.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    174   5e-50   
ref|XP_006382897.1|  hypothetical protein POPTR_0005s07540g             174   6e-50   
ref|XP_007159667.1|  hypothetical protein PHAVU_002G257100g             174   7e-50   
ref|XP_006585267.1|  PREDICTED: epoxide hydrolase 3-like                173   1e-49   
ref|XP_008343338.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      172   1e-49   
gb|KHG06812.1|  Lipase 3                                                173   1e-49   
ref|XP_006466238.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      172   4e-49   
ref|XP_007141181.1|  hypothetical protein PHAVU_008G173800g             172   6e-49   
ref|XP_008383931.1|  PREDICTED: monoacylglycerol lipase ABHD6           172   7e-49   
ref|XP_009334649.1|  PREDICTED: epoxide hydrolase 3-like                171   8e-49   
ref|XP_007222763.1|  hypothetical protein PRUPE_ppa008754mg             171   9e-49   
ref|XP_010060010.1|  PREDICTED: uncharacterized protein LOC104447954    172   1e-48   
ref|XP_006595211.1|  PREDICTED: uncharacterized protein LOC100808998    179   1e-48   
ref|XP_006433979.1|  hypothetical protein CICLE_v10001896mg             171   1e-48   
ref|XP_002532883.1|  abhydrolase domain containing, putative            171   1e-48   Ricinus communis
ref|XP_004146882.1|  PREDICTED: 2-hydroxy-6-oxo-2,4-heptadienoate...    171   1e-48   
ref|XP_008453821.1|  PREDICTED: uncharacterized protein LOC103494432    171   2e-48   
ref|XP_004237916.1|  PREDICTED: monoacylglycerol lipase abhd6-A i...    170   2e-48   
ref|XP_008373281.1|  PREDICTED: uncharacterized protein LOC103436612    169   2e-48   
ref|XP_009334325.1|  PREDICTED: uncharacterized protein LOC103927158    170   2e-48   
ref|XP_008373261.1|  PREDICTED: epoxide hydrolase 3-like                170   2e-48   
ref|XP_006353227.1|  PREDICTED: epoxide hydrolase 3-like                170   3e-48   
ref|XP_004237915.1|  PREDICTED: monoacylglycerol lipase abhd6-A i...    170   3e-48   
ref|XP_003601937.1|  Monoacylglycerol lipase ABHD6                      170   3e-48   
ref|XP_002310555.1|  hydrolase family protein                           170   3e-48   Populus trichocarpa [western balsam poplar]
ref|XP_008219440.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...    169   4e-48   
ref|XP_008219441.1|  PREDICTED: valacyclovir hydrolase isoform X2       169   4e-48   
ref|XP_009372756.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      169   5e-48   
ref|XP_010555370.1|  PREDICTED: monoacylglycerol lipase abhd6-A-like    169   5e-48   
ref|XP_006364861.1|  PREDICTED: epoxide hydrolase 3-like isoform X2     169   5e-48   
ref|XP_006364860.1|  PREDICTED: epoxide hydrolase 3-like isoform X1     169   8e-48   
ref|XP_006472597.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    167   8e-48   
ref|XP_010089876.1|  Monoacylglycerol lipase ABHD6                      169   9e-48   
ref|XP_009785723.1|  PREDICTED: uncharacterized protein LOC104233...    167   1e-47   
ref|XP_002513927.1|  abhydrolase domain containing, putative            169   1e-47   Ricinus communis
ref|XP_008444836.1|  PREDICTED: LOW QUALITY PROTEIN: monoacylglyc...    168   1e-47   
gb|KEH28075.1|  alpha/beta-hydrolase superfamily protein                168   1e-47   
ref|XP_009785722.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    167   2e-47   
gb|AGU28423.1|  alpha/beta-hydrolase superfamily protein                167   3e-47   
ref|XP_009785721.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    167   3e-47   
ref|XP_011023080.1|  PREDICTED: uncharacterized protein LOC105124669    168   3e-47   
ref|XP_009370707.1|  PREDICTED: epoxide hydrolase 3-like                167   4e-47   
emb|CDP01063.1|  unnamed protein product                                166   5e-47   
ref|XP_006472596.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    166   6e-47   
ref|XP_006472595.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    166   8e-47   
ref|XP_007205593.1|  hypothetical protein PRUPE_ppa008883mg             166   9e-47   
ref|XP_008234133.1|  PREDICTED: epoxide hydrolase 3                     166   1e-46   
ref|XP_010087617.1|  hypothetical protein L484_022144                   168   1e-46   
emb|CDP01476.1|  unnamed protein product                                165   2e-46   
ref|XP_009334351.1|  PREDICTED: uncharacterized protein LOC103927180    165   2e-46   
ref|XP_009588327.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    165   2e-46   
ref|XP_006404949.1|  hypothetical protein EUTSA_v10000245mg             165   3e-46   
ref|XP_011074186.1|  PREDICTED: monoacylglycerol lipase abhd6-B         165   3e-46   
ref|XP_009588310.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    165   3e-46   
ref|XP_009588318.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    164   3e-46   
ref|XP_006411798.1|  hypothetical protein EUTSA_v10025707mg             164   4e-46   
gb|KDP29699.1|  hypothetical protein JCGZ_18634                         164   4e-46   
ref|XP_009138545.1|  PREDICTED: monoacylglycerol lipase ABHD6           164   5e-46   
ref|XP_003615123.1|  Leucine-rich repeat-containing protein             171   1e-45   
ref|XP_004152639.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      162   2e-45   
ref|XP_010431977.1|  PREDICTED: uncharacterized protein LOC104716284    159   2e-45   
gb|KHN29048.1|  Monoacylglycerol lipase ABHD6                           162   3e-45   
gb|KFK30573.1|  hypothetical protein AALP_AA7G279400                    162   4e-45   
ref|XP_010431979.1|  PREDICTED: uncharacterized protein LOC104716...    159   4e-45   
ref|XP_010534077.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      161   4e-45   
ref|XP_010680530.1|  PREDICTED: uncharacterized protein LOC104895664    161   5e-45   
ref|XP_002866899.1|  hydrolase, alpha/beta fold family protein          162   5e-45   
ref|NP_568075.1|  hydrolase, alpha/beta fold family protein             161   7e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61205.1|  putative hydrolase                                      161   7e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490376.1|  PREDICTED: 2-hydroxy-6-oxononadienedioate/2-...    160   8e-45   
ref|XP_010027907.1|  PREDICTED: uncharacterized protein LOC104418304    160   1e-44   
gb|EPS57377.1|  hypothetical protein M569_17440                         160   1e-44   
ref|XP_010431978.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    159   1e-44   
ref|XP_004300648.1|  PREDICTED: monoacylglycerol lipase abhd6-A-like    160   1e-44   
ref|XP_006284174.1|  hypothetical protein CARUB_v10005320mg             160   1e-44   
ref|XP_010041675.1|  PREDICTED: uncharacterized protein LOC104430621    160   2e-44   
emb|CAN66985.1|  hypothetical protein VITISV_009675                     157   2e-44   Vitis vinifera
gb|KCW54547.1|  hypothetical protein EUGRSUZ_I00506                     158   2e-44   
ref|XP_010087616.1|  Uncharacterized protein L484_022143                159   3e-44   
ref|XP_003552813.1|  PREDICTED: monoacylglycerol lipase ABHD6           159   5e-44   
gb|KEH20809.1|  alpha/beta fold hydrolase                               158   5e-44   
ref|XP_010027906.1|  PREDICTED: uncharacterized protein LOC104418301    159   6e-44   
ref|XP_004143463.1|  PREDICTED: 2-hydroxy-6-oxononadienedioate/2-...    158   8e-44   
ref|XP_008440587.1|  PREDICTED: epoxide hydrolase 4-like                158   9e-44   
ref|XP_010535465.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    157   3e-43   
ref|XP_010535457.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    157   4e-43   
ref|XP_010030445.1|  PREDICTED: uncharacterized protein LOC104420275    153   2e-42   
ref|XP_010030446.1|  PREDICTED: uncharacterized protein LOC104420276    154   2e-42   
gb|KHN33529.1|  Monoacylglycerol lipase ABHD6                           152   6e-42   
gb|KCW54543.1|  hypothetical protein EUGRSUZ_I00503                     153   8e-42   
gb|ABR18124.1|  unknown                                                 150   8e-41   Picea sitchensis
emb|CDX88427.1|  BnaC06g38710D                                          145   1e-38   
ref|XP_009106526.1|  PREDICTED: uncharacterized protein LOC103832304    144   2e-38   
emb|CDX87465.1|  BnaA07g34080D                                          144   2e-38   
ref|XP_008781874.1|  PREDICTED: uncharacterized protein LOC103701...    143   5e-38   
ref|XP_008781871.1|  PREDICTED: uncharacterized protein LOC103701...    143   1e-37   
ref|XP_008781873.1|  PREDICTED: uncharacterized protein LOC103701...    143   1e-37   
gb|KFK42211.1|  hypothetical protein AALP_AA2G225700                    141   3e-37   
gb|EPS60389.1|  hypothetical protein M569_14412                         140   6e-37   
ref|XP_009380208.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    138   3e-36   
ref|XP_006390007.1|  hypothetical protein EUTSA_v10018907mg             138   5e-36   
ref|XP_010916850.1|  PREDICTED: uncharacterized protein LOC105041603    137   7e-36   
ref|XP_009380207.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    138   8e-36   
ref|XP_004288186.1|  PREDICTED: lipase 3-like                           136   3e-35   
ref|XP_007047915.1|  Alpha/beta-Hydrolases superfamily protein is...    133   1e-34   
ref|XP_007047914.1|  Alpha/beta-Hydrolases superfamily protein is...    133   2e-34   
ref|XP_010926315.1|  PREDICTED: monoacylglycerol lipase abhd6-B-l...    133   2e-34   
ref|XP_010926314.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    133   3e-34   
ref|XP_010926311.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    133   3e-34   
ref|XP_010926310.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    133   3e-34   
ref|XP_010926309.1|  PREDICTED: monoacylglycerol lipase abhd6-B-l...    133   4e-34   
ref|XP_006302572.1|  hypothetical protein CARUB_v10020680mg             133   4e-34   
ref|XP_010926308.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    133   5e-34   
ref|XP_010926307.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    133   6e-34   
ref|XP_007042937.1|  Alpha/beta-Hydrolases superfamily protein, p...    132   8e-34   
gb|AAG52103.1|AC012680_14  hypothetical protein; 59058-58351            130   9e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565173.1|  alpha/beta-Hydrolases superfamily protein             131   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008782159.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    130   2e-33   
ref|XP_008782158.1|  PREDICTED: monoacylglycerol lipase abhd6-B-l...    131   3e-33   
ref|XP_010472031.1|  PREDICTED: uncharacterized protein LOC104751718    130   6e-33   
ref|XP_010428943.1|  PREDICTED: uncharacterized protein LOC104713502    130   6e-33   
ref|XP_010416797.1|  PREDICTED: uncharacterized protein LOC104702608    129   6e-33   
ref|XP_002889179.1|  hydrolase, alpha/beta fold family protein          129   8e-33   
ref|XP_009413546.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      126   1e-31   
ref|XP_011019330.1|  PREDICTED: uncharacterized protein LOC105122109    123   1e-30   
ref|XP_006827312.1|  hypothetical protein AMTR_s00010p00266510          120   2e-30   
ref|XP_009795564.1|  PREDICTED: epoxide hydrolase 4-like                122   5e-30   
gb|KDO73662.1|  hypothetical protein CISIN_1g0219211mg                  119   7e-30   
ref|XP_006342917.1|  PREDICTED: uncharacterized protein LOC102595617    122   8e-30   
ref|XP_009600030.1|  PREDICTED: epoxide hydrolase 4                     122   8e-30   
ref|XP_007223174.1|  hypothetical protein PRUPE_ppa009136mg             121   9e-30   
ref|XP_006474513.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      121   1e-29   
ref|XP_008393578.1|  PREDICTED: monoacylglycerol lipase ABHD6           120   2e-29   
ref|XP_004235544.1|  PREDICTED: uncharacterized protein LOC101251165    120   2e-29   
ref|XP_006452975.1|  hypothetical protein CICLE_v10009014mg             120   3e-29   
ref|XP_004303453.1|  PREDICTED: dihydrolipoyllysine-residue acety...    119   4e-29   
ref|XP_009362895.1|  PREDICTED: uncharacterized protein LOC103952919    119   5e-29   
ref|XP_007012452.1|  Alpha/beta-Hydrolases superfamily protein, p...    118   5e-29   
ref|XP_002308516.1|  hydrolase family protein                           119   6e-29   Populus trichocarpa [western balsam poplar]
emb|CDP13481.1|  unnamed protein product                                119   6e-29   
ref|XP_008220584.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      118   1e-28   
ref|XP_007012451.1|  Alpha/beta-Hydrolases superfamily protein, p...    117   2e-28   
ref|XP_007012449.1|  Alpha/beta-Hydrolases superfamily protein is...    117   2e-28   
ref|XP_007012450.1|  Alpha/beta-Hydrolases superfamily protein, p...    117   2e-28   
ref|XP_007136895.1|  hypothetical protein PHAVU_009G083100g             117   2e-28   
gb|ADE75703.1|  unknown                                                 117   3e-28   
ref|XP_004501423.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      116   6e-28   
gb|EMT26431.1|  hypothetical protein F775_16327                         115   7e-28   
gb|KEH35884.1|  alpha/beta fold hydrolase                               114   9e-28   
ref|XP_010098384.1|  4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandro...    115   2e-27   
gb|EAZ40704.1|  hypothetical protein OsJ_25173                          114   2e-27   Oryza sativa Japonica Group [Japonica rice]
gb|ACU19094.1|  unknown                                                 112   2e-27   Glycine max [soybeans]
ref|NP_001060317.1|  Os07g0622700                                       115   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003603229.1|  Epoxide hydrolase                                  114   3e-27   
gb|EPS58835.1|  hypothetical protein M569_15976                         111   4e-27   
ref|XP_003522308.1|  PREDICTED: monoacylglycerol lipase ABHD6           113   7e-27   
gb|KHG11170.1|  Uncharacterized protein F383_14589                      113   9e-27   
ref|XP_003527758.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      112   2e-26   
ref|XP_002521324.1|  abhydrolase domain containing, putative            110   4e-26   Ricinus communis
ref|XP_002281808.1|  PREDICTED: monoacylglycerol lipase ABHD6           111   4e-26   Vitis vinifera
ref|XP_004958357.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    110   8e-26   
ref|XP_004305753.1|  PREDICTED: lipase 1-like                           110   1e-25   
ref|XP_008360463.1|  PREDICTED: uncharacterized protein LOC103424...    110   1e-25   
gb|KDP34016.1|  hypothetical protein JCGZ_07587                         110   1e-25   
ref|XP_008360462.1|  PREDICTED: uncharacterized protein LOC103424...    110   1e-25   
ref|XP_004303692.1|  PREDICTED: 2-hydroxy-6-oxononadienedioate/2-...    110   2e-25   
gb|EYU21324.1|  hypothetical protein MIMGU_mgv1a009646mg                110   2e-25   
ref|XP_002521325.1|  abhydrolase domain containing, putative            109   2e-25   Ricinus communis
emb|CDO97850.1|  unnamed protein product                                109   3e-25   
ref|XP_011072585.1|  PREDICTED: epoxide hydrolase 3-like                109   4e-25   
ref|XP_004986933.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      109   4e-25   
ref|XP_003557794.2|  PREDICTED: monoacylglycerol lipase ABHD6-like      108   4e-25   
ref|XP_003562687.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      108   7e-25   
ref|XP_003526070.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      107   9e-25   
ref|XP_010273840.1|  PREDICTED: monoacylglycerol lipase abhd6-B-like    107   9e-25   
ref|XP_009375466.1|  PREDICTED: epoxide hydrolase 4                     107   1e-24   
gb|KCW54545.1|  hypothetical protein EUGRSUZ_I00505                     107   1e-24   
gb|EYU32330.1|  hypothetical protein MIMGU_mgv1a010482mg                106   2e-24   
ref|XP_007217295.1|  hypothetical protein PRUPE_ppa018297mg             106   3e-24   
ref|XP_008656486.1|  PREDICTED: monoacylglycerol lipase ABHD6           106   3e-24   
ref|XP_002467763.1|  hypothetical protein SORBIDRAFT_01g033640          106   3e-24   Sorghum bicolor [broomcorn]
tpg|DAA45634.1|  TPA: hypothetical protein ZEAMMB73_671876              107   3e-24   
ref|XP_010086804.1|  hypothetical protein L484_009575                   106   3e-24   
gb|EYU32331.1|  hypothetical protein MIMGU_mgv1a010482mg                105   4e-24   
gb|EYU20281.1|  hypothetical protein MIMGU_mgv1a010770mg                105   4e-24   
gb|EYU32329.1|  hypothetical protein MIMGU_mgv1a010482mg                105   5e-24   
ref|XP_007136896.1|  hypothetical protein PHAVU_009G083200g             105   5e-24   
ref|XP_008445545.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      105   5e-24   
ref|XP_004144216.1|  PREDICTED: epoxide hydrolase 4-like                105   6e-24   
dbj|BAK06224.1|  predicted protein                                      105   7e-24   
ref|XP_006465918.1|  PREDICTED: uncharacterized protein LOC102625...    104   1e-23   
ref|XP_010654429.1|  PREDICTED: epoxide hydrolase 3                     104   1e-23   
ref|XP_002298091.2|  hydrolase family protein                           104   2e-23   Populus trichocarpa [western balsam poplar]
gb|KDO65027.1|  hypothetical protein CISIN_1g022521mg                   103   2e-23   
ref|XP_010493254.1|  PREDICTED: monoacylglycerol lipase ABHD6-like      104   2e-23   
ref|XP_010324990.1|  PREDICTED: uncharacterized protein LOC101262...    103   2e-23   
gb|KFK30870.1|  hypothetical protein AALP_AA6G036500                    104   2e-23   
ref|XP_006426658.1|  hypothetical protein CICLE_v10026135mg             103   2e-23   
ref|XP_006465917.1|  PREDICTED: uncharacterized protein LOC102625...    104   2e-23   
gb|KFK29929.1|  hypothetical protein AALP_AA7G196600                    103   2e-23   
gb|KDP46260.1|  hypothetical protein JCGZ_10100                         103   2e-23   
ref|XP_004245033.1|  PREDICTED: epoxide hydrolase 4-like isoform X1     103   3e-23   
emb|CDX68954.1|  BnaC01g04990D                                          103   5e-23   
ref|XP_009120705.1|  PREDICTED: uncharacterized protein LOC103845...    102   5e-23   
ref|XP_010049289.1|  PREDICTED: monoacylglycerol lipase abhd6-A-like    103   5e-23   
ref|XP_009120703.1|  PREDICTED: monoacylglycerol lipase ABHD6-lik...    102   5e-23   
ref|XP_009784036.1|  PREDICTED: epoxide hydrolase 4-like                102   6e-23   
ref|XP_009120704.1|  PREDICTED: uncharacterized protein LOC103845...    102   6e-23   
ref|XP_010261870.1|  PREDICTED: uncharacterized protein LOC104600553    102   7e-23   
emb|CDY53078.1|  BnaC03g76680D                                        99.4    8e-23   
gb|KCW81813.1|  hypothetical protein EUGRSUZ_C03169                     101   1e-22   
ref|XP_011035722.1|  PREDICTED: uncharacterized protein LOC105133422    101   2e-22   
ref|XP_009375465.1|  PREDICTED: uncharacterized protein LOC103964273    101   2e-22   
ref|XP_002963747.1|  hypothetical protein SELMODRAFT_79445              101   2e-22   
gb|EYU20280.1|  hypothetical protein MIMGU_mgv1a010852mg                101   2e-22   
ref|XP_006412383.1|  hypothetical protein EUTSA_v10025802mg             101   2e-22   
ref|XP_010049288.1|  PREDICTED: uncharacterized protein LOC104437938    101   2e-22   
ref|XP_002974830.1|  hypothetical protein SELMODRAFT_101768             101   2e-22   
ref|XP_006284121.1|  hypothetical protein CARUB_v10005254mg             100   4e-22   
ref|XP_011082211.1|  PREDICTED: uncharacterized protein LOC105165032    100   4e-22   
emb|CDY24780.1|  BnaA08g15300D                                          100   4e-22   
ref|XP_010447271.1|  PREDICTED: abhydrolase domain-containing pro...    100   4e-22   
ref|XP_009138168.1|  PREDICTED: uncharacterized protein LOC103862223    100   4e-22   
ref|XP_002869220.1|  hypothetical protein ARALYDRAFT_491367             100   5e-22   
ref|XP_008228193.1|  PREDICTED: monoacylglycerol lipase abhd6-B-like    100   5e-22   
ref|XP_008228189.1|  PREDICTED: monoacylglycerol lipase abhd6-B-like    100   6e-22   
ref|XP_009601363.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    99.8    6e-22   
gb|ABR17888.1|  unknown                                               98.2    7e-22   
ref|XP_006353844.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    99.8    7e-22   
ref|XP_010467648.1|  PREDICTED: epoxide hydrolase 4 isoform X2        99.8    7e-22   
ref|XP_009404328.1|  PREDICTED: uncharacterized protein LOC103987678  99.8    8e-22   
ref|XP_010489541.1|  PREDICTED: epoxide hydrolase 4-like isoform X1   99.8    8e-22   
ref|XP_010467647.1|  PREDICTED: epoxide hydrolase 4 isoform X1        99.8    8e-22   
ref|XP_002887441.1|  predicted protein                                99.8    8e-22   
ref|XP_006849675.1|  hypothetical protein AMTR_s00024p00233790        98.2    1e-21   
ref|XP_007024630.1|  Alpha/beta-Hydrolases superfamily protein, p...  99.4    1e-21   
emb|CDX69235.1|  BnaC01g02180D                                        99.0    1e-21   
gb|ABK25250.1|  unknown                                               99.0    1e-21   
ref|NP_001167744.1|  uncharacterized protein LOC100381432             99.0    1e-21   
tpg|DAA63665.1|  TPA: hydrolase                                       99.0    2e-21   
ref|XP_010432599.1|  PREDICTED: abhydrolase domain-containing pro...  98.6    2e-21   
ref|XP_009386316.1|  PREDICTED: uncharacterized protein LOC103973...  98.2    2e-21   
ref|XP_008391393.1|  PREDICTED: uncharacterized protein LOC103453613  98.6    2e-21   
ref|XP_010459336.1|  PREDICTED: uncharacterized protein LOC104740439  98.6    2e-21   
gb|KHG03543.1|  Monoacylglycerol lipase ABHD6                         98.6    2e-21   
ref|XP_010498094.1|  PREDICTED: uncharacterized protein LOC104775...  98.6    2e-21   
ref|XP_006288274.1|  hypothetical protein CARUB_v10001520mg           98.6    2e-21   
ref|XP_009386315.1|  PREDICTED: uncharacterized protein LOC103973...  98.6    2e-21   
ref|XP_010437790.1|  PREDICTED: abhydrolase domain-containing pro...  98.2    3e-21   
ref|XP_002874037.1|  predicted protein                                98.2    3e-21   
ref|XP_009124478.1|  PREDICTED: uncharacterized protein LOC103849450  98.2    3e-21   
ref|XP_010685311.1|  PREDICTED: uncharacterized protein LOC104899751  98.2    3e-21   
gb|KCW54549.1|  hypothetical protein EUGRSUZ_I00509                   97.1    3e-21   
gb|AAG51842.1|AC010926_5  unknown protein; 69438-68116                97.8    4e-21   
ref|NP_177406.2|  alpha/beta-Hydrolases superfamily protein           97.8    4e-21   
ref|XP_010936912.1|  PREDICTED: uncharacterized protein LOC105056...  97.4    6e-21   
emb|CAC34488.1|  putative protein                                     95.9    6e-21   
ref|XP_006416704.1|  hypothetical protein EUTSA_v10008164mg           97.1    7e-21   
ref|XP_006305310.1|  hypothetical protein CARUB_v10009687mg           97.1    8e-21   
ref|XP_008782478.1|  PREDICTED: uncharacterized protein LOC103701996  97.1    8e-21   
ref|XP_008228358.1|  PREDICTED: monoacylglycerol lipase abhd6-B-like  96.3    1e-20   
gb|EYU30999.1|  hypothetical protein MIMGU_mgv1a024947mg              95.9    1e-20   
ref|XP_010419167.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    96.7    1e-20   
emb|CDY72515.1|  BnaCnng78060D                                        96.3    1e-20   
ref|XP_006300918.1|  hypothetical protein CARUB_v10021290mg           96.3    1e-20   
ref|XP_006409162.1|  hypothetical protein EUTSA_v10023049mg           96.3    1e-20   
ref|XP_002890225.1|  hypothetical protein ARALYDRAFT_471948           96.3    1e-20   
emb|CDX96768.1|  BnaA08g23110D                                        96.3    1e-20   
ref|NP_680183.2|  hydrolase, alpha/beta fold family protein           95.9    2e-20   
ref|XP_006299489.1|  hypothetical protein CARUB_v10015657mg           95.9    2e-20   
ref|XP_010936911.1|  PREDICTED: uncharacterized protein LOC105056...  97.4    2e-20   
gb|KHN26751.1|  Monoacylglycerol lipase ABHD6                         95.1    2e-20   
gb|AAO73899.1|  hydrolase, alpha/beta fold family                     95.5    2e-20   
ref|XP_009143626.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    95.5    2e-20   
ref|XP_010537613.1|  PREDICTED: uncharacterized protein LOC104812248  95.5    2e-20   
emb|CDX68259.1|  BnaA07g22990D                                        95.5    2e-20   
ref|XP_009110408.1|  PREDICTED: uncharacterized protein LOC103835955  95.5    2e-20   
ref|XP_009104849.1|  PREDICTED: uncharacterized protein LOC103830784  95.5    3e-20   
ref|XP_002886166.1|  hydrolase, alpha/beta fold family protein        94.7    4e-20   
gb|ABK25920.1|  unknown                                               94.4    5e-20   
ref|XP_002975198.1|  hypothetical protein SELMODRAFT_102385           94.4    5e-20   
ref|XP_011048363.1|  PREDICTED: uncharacterized protein LOC105142...  94.0    6e-20   
ref|XP_009109326.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    94.0    6e-20   
gb|ABK24747.1|  unknown                                               94.4    7e-20   
gb|ABR17273.1|  unknown                                               94.0    7e-20   
ref|XP_006365111.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    94.0    7e-20   
ref|NP_565437.1|  esterase/lipase domain-containing protein           94.0    8e-20   
ref|XP_002977602.1|  hypothetical protein SELMODRAFT_106963           94.0    8e-20   
ref|XP_011048355.1|  PREDICTED: epoxide hydrolase 4-like isoform X1   94.0    8e-20   
emb|CDY64608.1|  BnaA01g34530D                                        94.0    8e-20   
ref|XP_010428149.1|  PREDICTED: uncharacterized protein LOC104712867  93.6    1e-19   
ref|XP_009406831.1|  PREDICTED: uncharacterized protein LOC103989641  94.0    1e-19   
ref|XP_010471289.1|  PREDICTED: monoacylglycerol lipase abhd6-B-like  93.6    1e-19   
ref|XP_006379244.1|  hypothetical protein POPTR_0009s11970g           92.8    1e-19   
ref|NP_564022.1|  alpha/beta-hydrolase domain-containing protein      93.2    1e-19   
gb|AAM64771.1|  unknown                                               93.2    1e-19   
ref|XP_004230956.1|  PREDICTED: monoacylglycerol lipase abhd6-A       93.2    1e-19   
ref|XP_006379246.1|  hypothetical protein POPTR_0009s11970g           92.8    1e-19   
gb|AAF97314.1|AC007843_17  Unknown protein                            93.2    2e-19   
emb|CDY64616.1|  BnaC08g48310D                                        96.3    2e-19   
emb|CDY36478.1|  BnaC03g48370D                                        92.8    2e-19   
emb|CDY29230.1|  BnaA06g25270D                                        92.8    2e-19   
ref|XP_009150734.1|  PREDICTED: epoxide hydrolase 4                   92.8    2e-19   
ref|XP_002313792.2|  hypothetical protein POPTR_0009s11970g           92.8    2e-19   
ref|NP_195044.2|  hydrolase, alpha/beta fold family protein           92.4    2e-19   
gb|ACJ83957.1|  unknown                                               91.7    3e-19   
ref|XP_006365115.1|  PREDICTED: uncharacterized protein LOC102589861  92.4    3e-19   
ref|XP_009126514.1|  PREDICTED: abhydrolase domain-containing pro...  92.4    3e-19   
ref|XP_004292035.1|  PREDICTED: uncharacterized protein LOC101301169  90.9    3e-19   
gb|ACG29228.1|  hydrolase                                             92.4    3e-19   
ref|XP_003612007.1|  Epoxide hydrolase                                92.0    4e-19   
ref|XP_010456621.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    91.7    4e-19   
ref|XP_002509492.1|  abhydrolase domain containing, putative          90.5    5e-19   
ref|XP_010936914.1|  PREDICTED: uncharacterized protein LOC105056...  91.3    5e-19   
ref|XP_010526035.1|  PREDICTED: monoacylglycerol lipase ABHD6         91.3    6e-19   
ref|XP_008377296.1|  PREDICTED: uncharacterized protein LOC103440399  91.3    6e-19   
ref|XP_003612012.1|  Epoxide hydrolase                                91.3    7e-19   
ref|XP_002463200.1|  hypothetical protein SORBIDRAFT_02g039680        90.9    7e-19   
ref|XP_001775520.1|  predicted protein                                91.3    7e-19   
ref|XP_010936913.1|  PREDICTED: uncharacterized protein LOC105056...  91.3    7e-19   
ref|XP_010476892.1|  PREDICTED: uncharacterized protein LOC104756073  91.3    8e-19   
gb|KFK26352.1|  hypothetical protein AALP_AA8G237400                  90.9    8e-19   
ref|XP_008379571.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    91.3    8e-19   
ref|XP_006390642.1|  hypothetical protein EUTSA_v10018986mg           90.5    1e-18   
gb|KFK30282.1|  hypothetical protein AALP_AA7G241000                  90.9    1e-18   
ref|XP_002989107.1|  hypothetical protein SELMODRAFT_129270           90.5    1e-18   
gb|KHN11098.1|  Epoxide hydrolase 3                                   90.5    1e-18   
ref|XP_003547986.1|  PREDICTED: epoxide hydrolase 3-like              90.5    1e-18   
ref|XP_009347549.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  90.9    1e-18   
ref|XP_006647769.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    90.5    1e-18   
ref|XP_010088927.1|  hypothetical protein L484_018554                 90.1    1e-18   
ref|XP_004509266.1|  PREDICTED: epoxide hydrolase 4-like              90.1    2e-18   
ref|NP_001050266.2|  Os03g0388800                                     90.1    2e-18   
gb|ABF96342.1|  hydrolase, alpha/beta fold family protein, putati...  90.1    2e-18   
ref|XP_008382204.1|  PREDICTED: uncharacterized protein LOC103445011  90.1    2e-18   
ref|XP_006341695.1|  PREDICTED: 1-acylglycerol-3-phosphate O-acyl...  88.6    2e-18   
ref|XP_001784455.1|  predicted protein                                89.7    2e-18   
gb|AFK46154.1|  unknown                                               88.2    3e-18   
ref|XP_002983826.1|  hypothetical protein SELMODRAFT_118740           89.4    3e-18   
emb|CDX72392.1|  BnaC07g44140D                                        89.4    3e-18   
ref|XP_009395686.1|  PREDICTED: uncharacterized protein LOC103980888  89.4    3e-18   
ref|XP_006878596.1|  hypothetical protein AMTR_s00011p00254080        89.4    4e-18   
emb|CBI17511.3|  unnamed protein product                              89.0    4e-18   
ref|XP_010033734.1|  PREDICTED: uncharacterized protein LOC104422983  89.0    5e-18   
ref|XP_002974805.1|  hypothetical protein SELMODRAFT_101938           89.0    5e-18   
ref|XP_006599379.1|  PREDICTED: epoxide hydrolase 4-like isoform X3   88.6    5e-18   
ref|NP_001047873.2|  Os02g0706900                                     88.2    6e-18   
ref|XP_002986614.1|  hypothetical protein SELMODRAFT_446664           92.0    6e-18   
ref|XP_002963721.1|  hypothetical protein SELMODRAFT_80187            88.6    6e-18   
ref|XP_003547985.1|  PREDICTED: epoxide hydrolase 4-like isoform X1   88.6    7e-18   
ref|XP_002965286.1|  hypothetical protein SELMODRAFT_439148           92.0    7e-18   
gb|ABK27126.1|  unknown                                               88.2    7e-18   
gb|ACJ84440.1|  unknown                                               88.2    8e-18   
ref|XP_004287894.1|  PREDICTED: epoxide hydrolase 4-like              88.2    9e-18   
gb|EAY87227.1|  hypothetical protein OsI_08629                        88.2    1e-17   
gb|AAL87168.1|AF480496_22  putative hydrolase                         87.8    1e-17   
ref|XP_009762310.1|  PREDICTED: uncharacterized protein LOC104214353  87.8    1e-17   
ref|XP_008461034.1|  PREDICTED: uncharacterized protein LOC103499739  87.4    1e-17   
ref|NP_001146375.1|  uncharacterized protein LOC100279953             87.4    1e-17   
ref|XP_008802457.1|  PREDICTED: uncharacterized protein LOC103716296  87.4    2e-17   
ref|XP_006400700.1|  hypothetical protein EUTSA_v10014154mg           87.4    2e-17   
ref|XP_010548329.1|  PREDICTED: uncharacterized protein LOC104819...  86.7    2e-17   
ref|XP_003520313.1|  PREDICTED: epoxide hydrolase 4-like              87.0    2e-17   
ref|XP_008338404.1|  PREDICTED: monoacylglycerol lipase ABHD6         87.4    2e-17   
ref|XP_010679732.1|  PREDICTED: epoxide hydrolase 4                   87.0    2e-17   
ref|XP_003612006.1|  2-hydroxy-6-oxononadienedioate/2-hydroxy-6-o...  87.0    2e-17   
ref|XP_009371602.1|  PREDICTED: epoxide hydrolase 4-like              86.3    2e-17   
ref|XP_006411983.1|  hypothetical protein EUTSA_v10025766mg           86.7    2e-17   
dbj|BAJ98525.1|  predicted protein                                    86.7    3e-17   
ref|XP_010548328.1|  PREDICTED: epoxide hydrolase 4 isoform X1        86.3    3e-17   
ref|XP_011099621.1|  PREDICTED: monoacylglycerol lipase ABHD6         86.7    3e-17   
emb|CDX69236.1|  BnaC01g02170D                                        86.7    3e-17   
ref|XP_004953623.1|  PREDICTED: uncharacterized protein LOC101758156  86.7    3e-17   
emb|CAN72982.1|  hypothetical protein VITISV_009033                   85.5    4e-17   
ref|XP_009358230.1|  PREDICTED: epoxide hydrolase 4-like              85.9    5e-17   
ref|XP_011048375.1|  PREDICTED: epoxide hydrolase 3-like              85.9    5e-17   
ref|XP_007042182.1|  Alpha/beta-Hydrolases superfamily protein, p...  85.1    6e-17   
ref|XP_008452086.1|  PREDICTED: uncharacterized protein LOC103493...  85.5    6e-17   
ref|XP_007042181.1|  Alpha/beta-Hydrolases superfamily protein, p...  85.5    6e-17   
ref|XP_009587043.1|  PREDICTED: uncharacterized protein LOC104084...  85.1    8e-17   
ref|XP_007156048.1|  hypothetical protein PHAVU_003G254000g           85.5    8e-17   
ref|XP_007042178.1|  Alpha/beta-Hydrolases superfamily protein, p...  85.5    8e-17   
ref|XP_008452085.1|  PREDICTED: monoacylglycerol lipase ABHD6 iso...  85.1    8e-17   
ref|XP_009587042.1|  PREDICTED: uncharacterized protein LOC104084...  85.1    9e-17   
ref|XP_002266831.1|  PREDICTED: epoxide hydrolase 3                   85.1    9e-17   
ref|XP_009414818.1|  PREDICTED: uncharacterized protein LOC103995...  84.7    9e-17   
ref|XP_004148865.1|  PREDICTED: epoxide hydrolase 3-like              84.7    1e-16   
ref|NP_001049153.1|  Os03g0178500                                     84.7    1e-16   
ref|XP_007200797.1|  hypothetical protein PRUPE_ppa024898mg           84.7    1e-16   
ref|XP_006423282.1|  hypothetical protein CICLE_v10028935mg           84.3    1e-16   
ref|XP_006423281.1|  hypothetical protein CICLE_v10028935mg           84.7    1e-16   
ref|XP_009414817.1|  PREDICTED: uncharacterized protein LOC103995...  84.3    2e-16   
dbj|BAK00702.1|  predicted protein                                    84.3    2e-16   
ref|XP_006425667.1|  hypothetical protein CICLE_v10026099mg           84.3    2e-16   
gb|KDO79561.1|  hypothetical protein CISIN_1g020916mg                 84.3    2e-16   
gb|KDO47523.1|  hypothetical protein CISIN_1g0222532mg                83.2    2e-16   
ref|XP_008236906.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    84.3    2e-16   
ref|XP_009788105.1|  PREDICTED: uncharacterized protein LOC104235966  84.0    2e-16   
ref|XP_007199433.1|  hypothetical protein PRUPE_ppa026591mg           84.0    2e-16   
gb|AAO13466.1|  Hypothetical protein                                  84.7    2e-16   
gb|KEH20434.1|  alpha/beta fold hydrolase                             83.6    2e-16   
ref|XP_007046925.1|  Alpha/beta-Hydrolases superfamily protein is...  84.0    2e-16   
gb|KDO47519.1|  hypothetical protein CISIN_1g0210702mg                83.2    3e-16   
ref|XP_002305432.2|  hypothetical protein POPTR_0004s16300g           83.6    3e-16   
ref|XP_008338088.1|  PREDICTED: monoacylglycerol lipase abhd6-A       84.0    3e-16   
ref|XP_003629418.1|  Epoxide hydrolase                                84.0    3e-16   
ref|XP_009340765.1|  PREDICTED: LOW QUALITY PROTEIN: monoacylglyc...  84.3    3e-16   
ref|XP_004164828.1|  PREDICTED: epoxide hydrolase 3-like              83.6    3e-16   
ref|XP_010437328.1|  PREDICTED: epoxide hydrolase 4-like              83.6    4e-16   
ref|XP_002305433.1|  hypothetical protein POPTR_0004s16310g           83.2    4e-16   
ref|XP_006423279.1|  hypothetical protein CICLE_v10029133mg           82.8    5e-16   
ref|XP_003631665.1|  PREDICTED: epoxide hydrolase 4-like              82.8    5e-16   
emb|CDY64609.1|  BnaA01g34540D                                        82.8    6e-16   
ref|XP_006469148.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    82.8    6e-16   
ref|XP_006379242.1|  hypothetical protein POPTR_0009s11950g           82.8    6e-16   
ref|XP_009143412.1|  PREDICTED: monoacylglycerol lipase ABHD6-like    82.4    8e-16   
ref|XP_010088930.1|  hypothetical protein L484_018557                 82.4    8e-16   
gb|KHG01052.1|  Epoxide hydrolase 3                                   82.4    8e-16   



>ref|XP_009624780.1| PREDICTED: monoacylglycerol lipase ABHD6 [Nicotiana tomentosiformis]
Length=300

 Score =   220 bits (560),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +CLSFTASRD +YRYFF+FSGLRSVTTD +DGT MHCW+PKV +P KPNL L+HGFGANA
Sbjct  3    KCLSFTASRDRFYRYFFSFSGLRSVTTDLEDGTTMHCWIPKVHEPTKPNLFLVHGFGANA  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQY D+LRHF P FNVY+PDL+FFG S TT PERTE FQARCVK+LME HGV + SLVG
Sbjct  63   MWQYSDLLRHFTPHFNVYLPDLVFFGASATTRPERTESFQARCVKKLMEVHGVHKTSLVG  122

Query  503  ISYGG  517
            ISYGG
Sbjct  123  ISYGG  127



>ref|XP_009776049.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Nicotiana sylvestris]
Length=300

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C+SFTASRD +YRYFF+FSGLRSVTTD +DGT MHCW+PKV +P KPNL L+HGFGANA
Sbjct  3    KCISFTASRDRFYRYFFSFSGLRSVTTDLEDGTTMHCWIPKVHEPTKPNLFLVHGFGANA  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQY D+LRHF P FNVY+PDL+FFG S TT PERTE FQARCVK+LME HGV   SLVG
Sbjct  63   MWQYSDLLRHFTPHFNVYLPDLVFFGASATTRPERTESFQARCVKKLMEVHGVHRTSLVG  122

Query  503  ISYGG  517
            ISYGG
Sbjct  123  ISYGG  127



>ref|XP_004248797.1| PREDICTED: monoacylglycerol lipase ABHD6 [Solanum lycopersicum]
Length=299

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++CLSFTASRD +YRYFF+FSGLRSVTTD +DGT MHCW+PKV +P KPNL L+HGFGAN
Sbjct  2    AKCLSFTASRDRFYRYFFSFSGLRSVTTDLEDGTTMHCWIPKVDEPTKPNLFLVHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQY D+LRHF P FNVY+PDLLFFG S T  PERTE FQA CVK+LME HGV   SLV
Sbjct  62   AMWQYSDLLRHFTPHFNVYLPDLLFFGASSTKRPERTESFQATCVKKLMEVHGVVRTSLV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_006359795.1| PREDICTED: monoacylglycerol lipase abhd6-A-like [Solanum tuberosum]
Length=299

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++CLSFTASRD +YRYFF+FSGLRSVTTD +DGT MHCW+PKV +P KPNL L+HGFGAN
Sbjct  2    AKCLSFTASRDRFYRYFFSFSGLRSVTTDLEDGTTMHCWIPKVDEPTKPNLFLVHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQY D+LRHF P FNVY+PDLLFFG S T  PERTE FQA CVK+LME HGV   SLV
Sbjct  62   AMWQYSDLLRHFTPHFNVYLPDLLFFGASSTKRPERTETFQATCVKKLMEVHGVVRTSLV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_011087890.1| PREDICTED: monoacylglycerol lipase ABHD6 [Sesamum indicum]
Length=322

 Score =   211 bits (538),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++CLSFT S D+ YR FF++SGLRSV TDF DGT MHCWVPK QK  KPNLLL+HGFGAN
Sbjct  2    AKCLSFTGSADFLYRSFFSYSGLRSVKTDFPDGTTMHCWVPKSQKLSKPNLLLVHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQYGD+L H +PRFN+YVPDLLFFG S T  PERTE FQA+CV RLMEAHGV +MSLV
Sbjct  62   AMWQYGDLLHHLMPRFNIYVPDLLFFGDSKTERPERTEAFQAQCVMRLMEAHGVHKMSLV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>emb|CDO97441.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   210 bits (535),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C+SFTAS DW+YR FFA++GL+SVTTDF DGT MHCWVPK  KP KPNLLLLHGFGANAM
Sbjct  4    CISFTASTDWFYRSFFAYTGLKSVTTDFGDGTFMHCWVPKTVKPSKPNLLLLHGFGANAM  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQY + LRH VP+FN+YVPDLLFFG S T  PERTE FQA+CV +LME HGV++M+LVGI
Sbjct  64   WQYREHLRHLVPKFNIYVPDLLFFGESSTKSPERTEAFQAQCVMKLMEVHGVQKMNLVGI  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>gb|EPS68601.1| hypothetical protein M569_06166 [Genlisea aurea]
Length=315

 Score =   208 bits (529),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC SFT S D+ YR FF++SGLRSV TD  DGT MHCWVPK +KP KPNL+L+HGFGAN
Sbjct  2    ARCFSFTGSADFLYRSFFSYSGLRSVRTDLPDGTSMHCWVPKSRKPAKPNLVLVHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQYGD L H +PRFNVYVPDLLFFG S T  PER+EEFQA CV R+MEAHGV +MSLV
Sbjct  62   AMWQYGDSLHHLIPRFNVYVPDLLFFGDSSTPRPERSEEFQAVCVMRMMEAHGVRKMSLV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_003593204.1| Hydrolase [Medicago truncatula]
Length=249

 Score =   205 bits (522),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +2

Query  131  SKASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGF  310
            SK S+C+SF ASRDW YR+ F  +GLRSV TD  DGT MHCWVPK+  P KP+L+L+HGF
Sbjct  3    SKFSKCVSFAASRDWLYRHSFTVAGLRSVVTDLGDGTTMHCWVPKLHNPCKPSLVLVHGF  62

Query  311  GANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEM  490
            GANAMWQYG+ L HF+ +FN+YVPDLLFFGGS+T+ PERTE FQA C+K+LMEAHGV  +
Sbjct  63   GANAMWQYGEHLHHFIRQFNLYVPDLLFFGGSFTSRPERTESFQALCLKKLMEAHGVNRL  122

Query  491  SLVGISYGG  517
            SLVGISYGG
Sbjct  123  SLVGISYGG  131



>gb|EYU18474.1| hypothetical protein MIMGU_mgv1a010034mg [Erythranthe guttata]
Length=324

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-TKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            RCLS T S D+ YR FF++SGLRSV TD +DG T MHCWVPK  K  KPNLLL+HGFGAN
Sbjct  12   RCLSLTGSADFLYRSFFSYSGLRSVKTDLNDGGTTMHCWVPKSHKESKPNLLLVHGFGAN  71

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQYG++LRH +PRFN+YVPDLLFFG S TT PER+E FQA+CV RLMEAHGVE+MSLV
Sbjct  72   AMWQYGELLRHLMPRFNIYVPDLLFFGESSTTRPERSEAFQAQCVMRLMEAHGVEKMSLV  131

Query  500  GISYGG  517
            GISYGG
Sbjct  132  GISYGG  137



>ref|XP_010068231.1| PREDICTED: monoacylglycerol lipase ABHD6 [Eucalyptus grandis]
 gb|KCW63173.1| hypothetical protein EUGRSUZ_G00780 [Eucalyptus grandis]
Length=297

 Score =   205 bits (521),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            S+C SFTASRDW+YRY+FA SGLRSV+T   DGT M CWVPK++KP KPNL+L+HGFGAN
Sbjct  2    SKCFSFTASRDWFYRYWFAKSGLRSVSTSLGDGTVMQCWVPKIRKPSKPNLVLVHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQY + L HF PRFNVYVPDL+FFG SYT+ P+RTE FQARC+ RLM+  GV  M +V
Sbjct  62   AMWQYAEALHHFTPRFNVYVPDLIFFGRSYTSRPDRTESFQARCLMRLMDLQGVNRMCMV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>gb|AES63455.2| alpha/beta-hydrolase superfamily protein [Medicago truncatula]
Length=329

 Score =   205 bits (522),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +2

Query  131  SKASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGF  310
            SK S+C+SF ASRDW YR+ F  +GLRSV TD  DGT MHCWVPK+  P KP+L+L+HGF
Sbjct  3    SKFSKCVSFAASRDWLYRHSFTVAGLRSVVTDLGDGTTMHCWVPKLHNPCKPSLVLVHGF  62

Query  311  GANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEM  490
            GANAMWQYG+ L HF+ +FN+YVPDLLFFGGS+T+ PERTE FQA C+K+LMEAHGV  +
Sbjct  63   GANAMWQYGEHLHHFIRQFNLYVPDLLFFGGSFTSRPERTESFQALCLKKLMEAHGVNRL  122

Query  491  SLVGISYGG  517
            SLVGISYGG
Sbjct  123  SLVGISYGG  131



>ref|XP_003547085.1| PREDICTED: monoacylglycerol lipase ABHD6 [Glycine max]
Length=322

 Score =   205 bits (522),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFG  313
            K S+C+SFTASRDW YR+ FA +GLRSV TD  +GT MHCWVPK+ KP KP+L+L+HGFG
Sbjct  4    KLSKCISFTASRDWLYRHLFASAGLRSVATDLGEGTTMHCWVPKMHKPCKPSLVLVHGFG  63

Query  314  ANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMS  493
            ANAMWQYG+ +RHF+  FNVYVPDL+FFG S+T+ PER+E FQA CV ++MEAHGV +MS
Sbjct  64   ANAMWQYGEHIRHFMGHFNVYVPDLVFFGESFTSRPERSESFQAECVVKMMEAHGVHKMS  123

Query  494  LVGISYGG  517
            LVGISYGG
Sbjct  124  LVGISYGG  131



>ref|XP_010269303.1| PREDICTED: monoacylglycerol lipase abhd6-A [Nelumbo nucifera]
Length=320

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGA  316
            A++C SFTASRDW YRY FA +GLRS TTD  DGT +HCWVPK  K  KP LLLLHGFGA
Sbjct  2    ANKCFSFTASRDWCYRYAFASTGLRSATTDLGDGTVVHCWVPKTHKQNKPTLLLLHGFGA  61

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            NAMWQ+GDILR FV RFN+YVPDLLFFG S+TT PER+E FQA+C+ R+M AHGV++M L
Sbjct  62   NAMWQWGDILRSFVSRFNIYVPDLLFFGDSFTTRPERSESFQAQCMMRMMAAHGVQKMIL  121

Query  497  VGISYGG  517
            +G+SYGG
Sbjct  122  IGLSYGG  128



>ref|XP_007042944.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX98775.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=333

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = +2

Query  122  INRSKASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLL  301
            +++ K S+C SFTASRDW+YR+ FA +GLRSV TD  +GT MHCWVPK+Q   +PNLLL+
Sbjct  1    MHQFKMSKCFSFTASRDWFYRHSFANAGLRSVRTDIGEGTVMHCWVPKIQNKSRPNLLLV  60

Query  302  HGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGV  481
            HGFGANAMWQYG+ LRHF  RFNVYVPDL+FFG SYTT  +RTE FQA+CV R+M+ HGV
Sbjct  61   HGFGANAMWQYGEHLRHFTSRFNVYVPDLVFFGESYTTRTDRTESFQAQCVMRMMDEHGV  120

Query  482  EEMSLVGISYGG  517
              MSLVGISYGG
Sbjct  121  PRMSLVGISYGG  132



>ref|XP_002525864.1| abhydrolase domain containing, putative [Ricinus communis]
 gb|EEF36558.1| abhydrolase domain containing, putative [Ricinus communis]
Length=321

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC SFTASRDW+YR  FA +GL+++T+D  DGT M CW+P++QK  KPNL+L+HGFGAN
Sbjct  2    ARCFSFTASRDWFYRLSFANAGLQAITSDIGDGTIMRCWIPRIQKQSKPNLVLVHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQYG+ LRHF  RFNVYVPDLLFFG SYT+ PER E FQA+C+ RLME+HGV  M+LV
Sbjct  62   AMWQYGEHLRHFTSRFNVYVPDLLFFGESYTSRPERHESFQAKCLMRLMESHGVRRMNLV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_002272747.1| PREDICTED: monoacylglycerol lipase ABHD6 [Vitis vinifera]
 emb|CBI32984.3| unnamed protein product [Vitis vinifera]
Length=311

 Score =   200 bits (509),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SF ASRDW+YRY F  +GLRSV TD  +GT MHCWVPK  +  KPNL+L+HGFGAN
Sbjct  2    AKCFSFAASRDWWYRYSFTSAGLRSVLTDLGEGTVMHCWVPKCHRQTKPNLVLVHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQYG +LRHF+ RFN+YVPDLLFFG S+TT PERTE FQA CV ++ME HGV +M+LV
Sbjct  62   AMWQYGYLLRHFIQRFNIYVPDLLFFGRSFTTRPERTEAFQAECVMKMMETHGVRKMNLV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GVSYGG  127



>ref|XP_002298701.1| hydrolase family protein [Populus trichocarpa]
 gb|EEE83506.1| hydrolase family protein [Populus trichocarpa]
Length=318

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            S+C SFTASRDW+YRY FA +GLR+ + +  DGT MHCWVP++ K  KP+LLLLHGFGAN
Sbjct  2    SKCFSFTASRDWFYRYSFAKAGLRAHSANLGDGTIMHCWVPRIIKSSKPSLLLLHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQYG  L  F  RFNVYVPDLLFFG SYT+ PERTE FQA+CV RLMEAHGV  M+LV
Sbjct  62   AMWQYGQHLHIFTSRFNVYVPDLLFFGESYTSRPERTESFQAQCVMRLMEAHGVHRMNLV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_004485585.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Cicer arietinum]
Length=374

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = +2

Query  131  SKASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGF  310
            SK SRC SF ASRDW YR+ F  +GLRSV TD  +GT MHCWVPK+  P  P L+L+HGF
Sbjct  3    SKFSRCFSFAASRDWLYRHSFTVAGLRSVVTDLGEGTTMHCWVPKLHNPNNPTLVLVHGF  62

Query  311  GANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEM  490
            GANAMWQYG+ LRHF+  FNVYVPDLLFFGGS+T+  ERTE FQA C+ +LME HGV  M
Sbjct  63   GANAMWQYGEHLRHFIAHFNVYVPDLLFFGGSFTSRKERTESFQAMCLMKLMEIHGVHRM  122

Query  491  SLVGISYGG  517
            +LVGISYGG
Sbjct  123  NLVGISYGG  131



>gb|KDO49110.1| hypothetical protein CISIN_1g042555mg [Citrus sinensis]
Length=322

 Score =   197 bits (502),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC SFTAS DW++RY F+ +GLRS +TD  DGT M CWVPK  K  KPNLLLLHGFGAN
Sbjct  2    TRCFSFTASGDWFFRYSFSNAGLRSTSTDLGDGTVMQCWVPKFPKILKPNLLLLHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQYG+ LRHF PRFNVYVPDL+FFG SYTT  +RTE FQARCV RLME   V+ MSLV
Sbjct  62   AMWQYGEFLRHFTPRFNVYVPDLVFFGESYTTRADRTESFQARCVMRLMEVFCVKRMSLV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_006423859.1| hypothetical protein CICLE_v10030086mg [Citrus clementina]
 gb|ESR37099.1| hypothetical protein CICLE_v10030086mg [Citrus clementina]
Length=322

 Score =   197 bits (502),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC SFTAS DW++RY F+ +GLRS +TD  DGT M CWVPK  K  KPNLLLLHGFGAN
Sbjct  2    TRCFSFTASGDWFFRYSFSNAGLRSTSTDLGDGTVMQCWVPKFPKILKPNLLLLHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQYG+ LRHF PRFNVYVPDL+FFG SYTT  +RTE FQARCV RLME   V+ MSLV
Sbjct  62   AMWQYGEFLRHFTPRFNVYVPDLVFFGESYTTRADRTESFQARCVMRLMEVFCVKRMSLV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_010690508.1| PREDICTED: uncharacterized protein LOC104904032 [Beta vulgaris 
subsp. vulgaris]
Length=319

 Score =   197 bits (501),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            R LSFTASRDW+YR  F+ +GLRSV++D  DGT MHCWVPKV    KPNLLL+HGFGANA
Sbjct  8    RSLSFTASRDWWYRLSFSQAGLRSVSSDIGDGTTMHCWVPKVHTQSKPNLLLVHGFGANA  67

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQY D+L HF+P++NVYVPDLLFFG SYT+  ERTE FQARC+ +L+  HGV++++LVG
Sbjct  68   MWQYADVLHHFMPKYNVYVPDLLFFGRSYTSQKERTETFQARCLMKLLHIHGVQKVNLVG  127

Query  503  ISYGG  517
            ISYGG
Sbjct  128  ISYGG  132



>ref|XP_006493892.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Citrus sinensis]
Length=322

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC SFTAS DW++RY F+ +GLRS +TD  DGT M CWVPK  K  KPNLLLLHGFGAN
Sbjct  2    TRCFSFTASGDWFFRYSFSNAGLRSTSTDLGDGTVMQCWVPKFPKILKPNLLLLHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQYG+ LRHF PRFNVYVPDL+FFG SYTT  +RTE FQARCV RLME   V+ MSLV
Sbjct  62   AMWQYGEFLRHFTPRFNVYVPDLVFFGESYTTRADRTESFQARCVMRLMEVFCVKRMSLV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_007148408.1| hypothetical protein PHAVU_006G206100g [Phaseolus vulgaris]
 gb|ESW20402.1| hypothetical protein PHAVU_006G206100g [Phaseolus vulgaris]
Length=323

 Score =   195 bits (496),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFG  313
            K S+C SFTASRDW YR+ FA +GLRSV TD  +GT MHCWVPK+QKP KP+L+L+HGFG
Sbjct  4    KLSKCFSFTASRDWVYRHLFASAGLRSVVTDLGEGTSMHCWVPKLQKPCKPSLVLVHGFG  63

Query  314  ANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMS  493
            ANAMWQYG+ +R F   FNVYVPDL+FFG S+T+  +R+E FQA+C+ +++EAHGV+ MS
Sbjct  64   ANAMWQYGEHVRLFTGHFNVYVPDLVFFGESFTSRSDRSESFQAQCLVKMLEAHGVQRMS  123

Query  494  LVGISYGG  517
            LVGISYGG
Sbjct  124  LVGISYGG  131



>ref|XP_002285791.1| PREDICTED: monoacylglycerol lipase ABHD6 [Vitis vinifera]
Length=298

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C SFTA+RDW YR  F  SGLRS  TD  DGT +HCWVPK +K  KPNLLL+HGFGANA+
Sbjct  3    CFSFTATRDWCYRSIFTKSGLRSTITDLGDGTVIHCWVPKTRKESKPNLLLIHGFGANAL  62

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+GD++ + VP FNVYVPDLLFFG SYTT PERTE FQA+CV R+MEA  V++MSL+G+
Sbjct  63   WQWGDLIPYLVPYFNVYVPDLLFFGDSYTTRPERTESFQAQCVMRVMEAKSVKKMSLIGL  122

Query  506  SYGG  517
            SYGG
Sbjct  123  SYGG  126



>ref|XP_007200397.1| hypothetical protein PRUPE_ppa008541mg [Prunus persica]
 gb|EMJ01596.1| hypothetical protein PRUPE_ppa008541mg [Prunus persica]
Length=327

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFG  313
            K  + +S TAS DW+YR+ FA +GLRSV T+  DGT M+CWVPK  KP KP LLLLHGFG
Sbjct  5    KLPKFISLTASIDWFYRHSFANAGLRSVLTNLGDGTIMNCWVPKSHKPYKPTLLLLHGFG  64

Query  314  ANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMS  493
            ANAMWQYG+ LRHF P FNVYVPDLLFFG SYT+  ER+E FQA+CV RLMEAHGV +MS
Sbjct  65   ANAMWQYGEHLRHFTPHFNVYVPDLLFFGHSYTSCLERSESFQAQCVIRLMEAHGVGKMS  124

Query  494  LVGISYGG  517
            +VGISYGG
Sbjct  125  MVGISYGG  132



>ref|XP_011045672.1| PREDICTED: monoacylglycerol lipase abhd6-A [Populus euphratica]
Length=318

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            S+C SFTASRDW+YRY FA +GLR+ + +  DGT MHCWVP++ K  KP+LLLLHGFGAN
Sbjct  2    SKCFSFTASRDWFYRYSFAKAGLRAQSANLGDGTIMHCWVPRIIKSSKPSLLLLHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQY   L  F  RFNVYVPDLLFFG SYT+  ERTE FQA+CV RLMEAHGV  M+LV
Sbjct  62   AMWQYVQHLHIFTSRFNVYVPDLLFFGESYTSRHERTESFQAQCVMRLMEAHGVHRMNLV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_003532960.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Glycine max]
Length=322

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFG  313
            K S+C+SFTASRDW YR+ FA +GLRSV TD  +GT +HCWVPK+ KP KP+L+L+HGFG
Sbjct  4    KLSKCISFTASRDWLYRHLFAAAGLRSVATDLGEGTIVHCWVPKMHKPCKPSLVLIHGFG  63

Query  314  ANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMS  493
            ANAMWQYG+ +R F+  FNVYVPDL+FFG S+T   ER+E FQA C+ ++MEAHGV +MS
Sbjct  64   ANAMWQYGEHIRLFMGHFNVYVPDLVFFGESFTLRAERSEYFQAECMVKMMEAHGVHKMS  123

Query  494  LVGISYGG  517
            LVGISYGG
Sbjct  124  LVGISYGG  131



>emb|CBI19164.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   193 bits (490),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C SFTA+RDW YR  F  SGLRS  TD  DGT +HCWVPK +K  KPNLLL+HGFGANA+
Sbjct  47   CFSFTATRDWCYRSIFTKSGLRSTITDLGDGTVIHCWVPKTRKESKPNLLLIHGFGANAL  106

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+GD++ + VP FNVYVPDLLFFG SYTT PERTE FQA+CV R+MEA  V++MSL+G+
Sbjct  107  WQWGDLIPYLVPYFNVYVPDLLFFGDSYTTRPERTESFQAQCVMRVMEAKSVKKMSLIGL  166

Query  506  SYGG  517
            SYGG
Sbjct  167  SYGG  170



>ref|XP_003635235.1| PREDICTED: uncharacterized protein LOC100853399 [Vitis vinifera]
Length=262

 Score =   191 bits (484),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTA+RDW +R  F+ +GLRS T+D  DGT MHCW+PK +K  KPNLLL+HG GAN
Sbjct  2    AKCCSFTATRDWCFRLSFSNAGLRSTTSDLGDGTVMHCWIPKSRKENKPNLLLIHGMGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D +R  + RFNVYVPDL+FFG SYTT PER+E FQA+CV R+ME HGV  M++V
Sbjct  62   AMWQWADFIRPLIARFNVYVPDLVFFGDSYTTRPERSESFQAQCVMRMMEGHGVSRMNVV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_007018761.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY15986.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=335

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +2

Query  128  RSKASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHG  307
            + K +RC S T +++W YR+ F  SGLRS  TD  DGT MHCWVPK++K  KPNLLL+HG
Sbjct  7    KKKMTRCFSLTEAKNWCYRFSFNKSGLRSTITDLQDGTIMHCWVPKIRKDSKPNLLLIHG  66

Query  308  FGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEE  487
             GANAMWQ+GDILR  +P FN+++PDLLFFG SYTT PER+E FQA+CV R+ME + V +
Sbjct  67   LGANAMWQWGDILRQMIPYFNIFIPDLLFFGESYTTRPERSESFQAQCVMRVMEKNSVRK  126

Query  488  MSLVGISYGG  517
            +SLVG+SYGG
Sbjct  127  LSLVGLSYGG  136



>ref|XP_007018762.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY15987.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=336

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +2

Query  128  RSKASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHG  307
            + K +RC S T +++W YR+ F  SGLRS  TD  DGT MHCWVPK++K  KPNLLL+HG
Sbjct  7    KKKMTRCFSLTEAKNWCYRFSFNKSGLRSTITDLQDGTIMHCWVPKIRKDSKPNLLLIHG  66

Query  308  FGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEE  487
             GANAMWQ+GDILR  +P FN+++PDLLFFG SYTT PER+E FQA+CV R+ME + V +
Sbjct  67   LGANAMWQWGDILRQMIPYFNIFIPDLLFFGESYTTRPERSESFQAQCVMRVMEKNSVRK  126

Query  488  MSLVGISYGG  517
            +SLVG+SYGG
Sbjct  127  LSLVGLSYGG  136



>ref|XP_002263605.2| PREDICTED: uncharacterized protein LOC100242910 [Vitis vinifera]
Length=321

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTA+RDW +R  F+ +GLRS T+D  DGT MHCW+PK +K  KPNLLL+HG GAN
Sbjct  2    AKCCSFTATRDWCFRLSFSNAGLRSTTSDLGDGTVMHCWIPKSRKENKPNLLLIHGMGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D +R  + RFNVYVPDL+FFG SYTT PER+E FQA+CV R+ME HGV  M++V
Sbjct  62   AMWQWADFIRPLIARFNVYVPDLVFFGDSYTTRPERSESFQAQCVIRMMEGHGVSRMNVV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>emb|CAC05469.1| putative hydrolase [Arabidopsis thaliana]
Length=303

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 101/133 (76%), Gaps = 5/133 (4%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-----TKMHCWVPKVQKPGKPNLLL  298
            K  RC SFTASRDW +R  FA +GLRSVTTD   G     T MHCW+PK     KPNLLL
Sbjct  6    KLLRCFSFTASRDWLFRQSFANAGLRSVTTDLSHGNSIASTAMHCWIPKSPNRSKPNLLL  65

Query  299  LHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            LHGFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+ P RTE FQARC+ RLMEAHG
Sbjct  66   LHGFGANAMWQYGEHLRAFTGRFNVYVPDLLFFGLSSTSEPNRTESFQARCLMRLMEAHG  125

Query  479  VEEMSLVGISYGG  517
            V+ M++VGISYGG
Sbjct  126  VQRMNIVGISYGG  138



>gb|KDP40902.1| hypothetical protein JCGZ_24901 [Jatropha curcas]
Length=319

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC SFT+SRDW+YRY F  +GLRS +TD  DGT MHCWVP+  K  KPNL+L+HGFGAN
Sbjct  2    ARCFSFTSSRDWFYRYSFCNAGLRSTSTDLCDGTHMHCWVPRTPKLSKPNLVLVHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQYGD LRHF  RFNVYVPDLLFFG SYT  PER E FQA+C+ +L+   GV ++ LV
Sbjct  62   AMWQYGDQLRHFTARFNVYVPDLLFFGESYTLRPERHESFQAKCLMKLLVKLGVHKIRLV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GVSYGG  127



>ref|NP_196505.2| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAY78820.1| hydrolase [Arabidopsis thaliana]
 gb|AED91392.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=311

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 101/133 (76%), Gaps = 5/133 (4%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-----TKMHCWVPKVQKPGKPNLLL  298
            K  RC SFTASRDW +R  FA +GLRSVTTD   G     T MHCW+PK     KPNLLL
Sbjct  6    KLLRCFSFTASRDWLFRQSFANAGLRSVTTDLSHGNSIASTAMHCWIPKSPNRSKPNLLL  65

Query  299  LHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            LHGFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+ P RTE FQARC+ RLMEAHG
Sbjct  66   LHGFGANAMWQYGEHLRAFTGRFNVYVPDLLFFGLSSTSEPNRTESFQARCLMRLMEAHG  125

Query  479  VEEMSLVGISYGG  517
            V+ M++VGISYGG
Sbjct  126  VQRMNIVGISYGG  138



>emb|CBI38426.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   189 bits (479),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C SFTA+RDW +R  F+ +GLRS T+D  DGT MHCW+PK +K  KPNLLL+HG GANAM
Sbjct  21   CCSFTATRDWCFRLSFSNAGLRSTTSDLGDGTVMHCWIPKSRKENKPNLLLIHGMGANAM  80

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ D +R  + RFNVYVPDL+FFG SYTT PER+E FQA+CV R+ME HGV  M++VGI
Sbjct  81   WQWADFIRPLIARFNVYVPDLVFFGDSYTTRPERSESFQAQCVMRMMEGHGVSRMNVVGI  140

Query  506  SYGG  517
            SYGG
Sbjct  141  SYGG  144



>emb|CBI14844.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   189 bits (480),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTA+RDW +R  F+ +GLRS T+D  DGT MHCW+PK +K  KPNL+L+HG GAN
Sbjct  2    AKCFSFTATRDWCFRLSFSNAGLRSTTSDLGDGTVMHCWIPKARKENKPNLVLIHGMGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D +R  + RFNVYVPDL+FFG SYTT PER+E FQA+CV R++E HGV  M++V
Sbjct  62   AMWQWADFIRPLIARFNVYVPDLVFFGDSYTTRPERSESFQAQCVMRMIEGHGVSRMNVV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_002262933.3| PREDICTED: uncharacterized protein LOC100264766 [Vitis vinifera]
Length=321

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTA+RDW +R  F+ +GLRS T+D  DGT MHCW+PK +K  KPNL+L+HG GAN
Sbjct  2    AKCFSFTATRDWCFRLSFSNAGLRSTTSDLGDGTVMHCWIPKARKENKPNLVLIHGMGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D +R  + RFNVYVPDL+FFG SYTT PER+E FQA+CV R++E HGV  M++V
Sbjct  62   AMWQWADFIRPLIARFNVYVPDLVFFGDSYTTRPERSESFQAQCVMRMIEGHGVSRMNVV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_011016513.1| PREDICTED: monoacylglycerol lipase ABHD6 [Populus euphratica]
Length=315

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            SRC SFT +++W +R  F  SGLRS  TD  DGT MHCWVPK +K  KP+LLL+HG GAN
Sbjct  2    SRCFSFTRTKNWCFRSTFTRSGLRSEITDLKDGTVMHCWVPKTRKDSKPDLLLIHGLGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            A+WQ+GD+++HF P FNVYVPDL+FFG SYTT PERTE FQA+C+ R+MEAH V++ SLV
Sbjct  62   ALWQWGDVIQHFAPYFNVYVPDLVFFGDSYTTRPERTESFQAQCLMRVMEAHSVQKFSLV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_006288272.1| hypothetical protein CARUB_v10001518mg [Capsella rubella]
 gb|EOA21170.1| hypothetical protein CARUB_v10001518mg [Capsella rubella]
Length=311

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 100/133 (75%), Gaps = 5/133 (4%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-----TKMHCWVPKVQKPGKPNLLL  298
            K  RC SFTASRDW +R  FA +GLRSVTTD   G     T MHCW+PK     KPNLLL
Sbjct  6    KLLRCFSFTASRDWLFRQSFANAGLRSVTTDLSHGNSIASTAMHCWIPKYPNRSKPNLLL  65

Query  299  LHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            LHGFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+ P R+E FQARC+ RLMEAHG
Sbjct  66   LHGFGANAMWQYGEHLRAFTGRFNVYVPDLLFFGLSSTSEPNRSETFQARCLMRLMEAHG  125

Query  479  VEEMSLVGISYGG  517
            V+ M +VGISYGG
Sbjct  126  VQRMDIVGISYGG  138



>ref|XP_009344576.1| PREDICTED: monoacylglycerol lipase ABHD6 [Pyrus x bretschneideri]
Length=323

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFG  313
            K  + +SFTAS DW+YR++FA +GLRSV T+  DGT +HCWVPK  K  KP LLLLHGFG
Sbjct  5    KLPKRISFTASVDWFYRHYFANAGLRSVLTNLGDGTTIHCWVPKSPKSYKPTLLLLHGFG  64

Query  314  ANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMS  493
            ANAMWQYG+ LRHF  RFNVYVPDLLFFG SYT+  ERTE FQA+ + RLM++HGV +MS
Sbjct  65   ANAMWQYGEHLRHFTTRFNVYVPDLLFFGHSYTSRLERTESFQAQSIIRLMKSHGVGQMS  124

Query  494  LVGISYGG  517
            +VGISYGG
Sbjct  125  MVGISYGG  132



>ref|XP_002871371.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47630.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=311

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 101/133 (76%), Gaps = 5/133 (4%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-----TKMHCWVPKVQKPGKPNLLL  298
            K  RC SFTASRDW +R  FA +GLRSVTTD   G     T MHCW+PK     KPNLLL
Sbjct  6    KLLRCFSFTASRDWLFRQSFANAGLRSVTTDLSHGNSIASTAMHCWIPKSPNRSKPNLLL  65

Query  299  LHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            +HGFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+ P R+E FQARC+ RLMEAHG
Sbjct  66   VHGFGANAMWQYGEHLRAFTGRFNVYVPDLLFFGLSSTSEPNRSESFQARCLMRLMEAHG  125

Query  479  VEEMSLVGISYGG  517
            V+ M++VGISYGG
Sbjct  126  VQRMNIVGISYGG  138



>emb|CDY44797.1| BnaC02g00900D [Brassica napus]
Length=311

 Score =   187 bits (474),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 101/133 (76%), Gaps = 5/133 (4%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-----TKMHCWVPKVQKPGKPNLLL  298
            K  RC SFTASRDW ++  F+ +GLRSVTTD   G     T MHCW+PK     KPNLLL
Sbjct  6    KLLRCFSFTASRDWLFKQSFSNAGLRSVTTDLSHGNPLASTSMHCWIPKSPNRSKPNLLL  65

Query  299  LHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            LHGFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+ P R+E FQARC+ RLMEAHG
Sbjct  66   LHGFGANAMWQYGEHLRAFTGRFNVYVPDLLFFGLSSTSEPNRSESFQARCLMRLMEAHG  125

Query  479  VEEMSLVGISYGG  517
            VE M++VGISYGG
Sbjct  126  VERMNVVGISYGG  138



>ref|XP_002301056.1| hydrolase family protein [Populus trichocarpa]
 gb|EEE80329.1| hydrolase family protein [Populus trichocarpa]
Length=318

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            SRC SFT +++W +R  F  SGLRS  TD  DGT MHCWVPK +K  +P+LLL+HG GAN
Sbjct  2    SRCFSFTGTKNWCFRSTFTRSGLRSEITDLKDGTVMHCWVPKTRKDSRPDLLLIHGLGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            A+WQ+GD+++ FVP FNVYVPDL+FFG SYTT PERTE FQA+C+ R+MEAH V++ SLV
Sbjct  62   ALWQWGDVIQDFVPYFNVYVPDLVFFGDSYTTRPERTESFQAQCLMRVMEAHSVQKFSLV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_006399421.1| hypothetical protein EUTSA_v10015451mg [Eutrema salsugineum]
 gb|ESQ40874.1| hypothetical protein EUTSA_v10015451mg [Eutrema salsugineum]
Length=316

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 101/133 (76%), Gaps = 5/133 (4%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-----TKMHCWVPKVQKPGKPNLLL  298
            K  RC SFTASRDW +R  FA +GLRSVTTD   G     T MHCW+PK     KPNLLL
Sbjct  6    KLLRCFSFTASRDWLFRQSFANAGLRSVTTDLSHGNSIASTAMHCWIPKSPNRSKPNLLL  65

Query  299  LHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            +HGFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+ P R+E FQARC+ +LMEAHG
Sbjct  66   VHGFGANAMWQYGEHLRAFTGRFNVYVPDLLFFGLSSTSEPNRSESFQARCLMKLMEAHG  125

Query  479  VEEMSLVGISYGG  517
            V+ M++VGISYGG
Sbjct  126  VQRMNIVGISYGG  138



>ref|XP_009131110.1| PREDICTED: monoacylglycerol lipase abhd6-B-like [Brassica rapa]
Length=311

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 100/136 (74%), Gaps = 5/136 (4%)
 Frame = +2

Query  125  NRSKASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-----TKMHCWVPKVQKPGKPN  289
            +  K  RC SFTASRDW++R  FA +GLRSV TD   G     T MHCW+PK     KPN
Sbjct  3    DHMKLLRCFSFTASRDWFFRQSFANAGLRSVVTDLSHGNSIASTTMHCWIPKSPNRTKPN  62

Query  290  LLLLHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLME  469
            LLLLHGFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+   RTE FQARC+ RLME
Sbjct  63   LLLLHGFGANAMWQYGEHLRAFTGRFNVYVPDLLFFGLSSTSEQNRTESFQARCLMRLME  122

Query  470  AHGVEEMSLVGISYGG  517
            AHGV  MS+VGISYGG
Sbjct  123  AHGVHRMSIVGISYGG  138



>emb|CDX78359.1| BnaA03g02710D [Brassica napus]
Length=312

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 100/136 (74%), Gaps = 5/136 (4%)
 Frame = +2

Query  125  NRSKASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-----TKMHCWVPKVQKPGKPN  289
            +  K  RC SFTASRDW++R  FA +GLRSV TD   G     T MHCW+PK     KPN
Sbjct  3    DHMKLLRCFSFTASRDWFFRQSFANAGLRSVVTDLSHGNSIASTTMHCWIPKSPNRTKPN  62

Query  290  LLLLHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLME  469
            LLLLHGFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+   RTE FQARC+ RLME
Sbjct  63   LLLLHGFGANAMWQYGEHLRAFTGRFNVYVPDLLFFGLSSTSEQNRTESFQARCLMRLME  122

Query  470  AHGVEEMSLVGISYGG  517
            AHGV  MS+VGISYGG
Sbjct  123  AHGVHRMSIVGISYGG  138



>ref|XP_010491571.1| PREDICTED: uncharacterized protein LOC104769127 [Camelina sativa]
Length=311

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 100/133 (75%), Gaps = 5/133 (4%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-----TKMHCWVPKVQKPGKPNLLL  298
            K  RC SFTASRDW +R  FA +GLRSVTTD   G     T MHCW+PK     KPNLLL
Sbjct  6    KLLRCFSFTASRDWLFRQSFANAGLRSVTTDLSHGNSITSTAMHCWIPKSPNRSKPNLLL  65

Query  299  LHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            +HGFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+ P RTE FQA C+ RLMEAHG
Sbjct  66   VHGFGANAMWQYGEHLRAFTGRFNVYVPDLLFFGLSSTSEPNRTESFQALCLMRLMEAHG  125

Query  479  VEEMSLVGISYGG  517
            V+ M++VGISYGG
Sbjct  126  VQRMNIVGISYGG  138



>gb|KFK25251.1| hypothetical protein AALP_AA8G087700 [Arabis alpina]
Length=311

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 101/133 (76%), Gaps = 5/133 (4%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-----TKMHCWVPKVQKPGKPNLLL  298
            K  RC SFTASRDW +R  FA +GLRSVTTD   G     T MHCW+PK     KPNLLL
Sbjct  6    KLLRCFSFTASRDWLFRQSFANAGLRSVTTDLTHGNSISSTAMHCWIPKFPNRSKPNLLL  65

Query  299  LHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            LHGFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+  +R+E FQARC+ RLMEAHG
Sbjct  66   LHGFGANAMWQYGEHLRSFTGRFNVYVPDLLFFGLSSTSESDRSESFQARCLMRLMEAHG  125

Query  479  VEEMSLVGISYGG  517
            V +M++VGISYGG
Sbjct  126  VRKMNIVGISYGG  138



>emb|CDX69905.1| BnaA10g22540D [Brassica napus]
Length=312

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 98/131 (75%), Gaps = 6/131 (5%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG------TKMHCWVPKVQKPGKPNLLLLH  304
            RC SFTASRDW +R  FA +GLRSVTTD   G      T MHCW+PK     KPNLLL+H
Sbjct  9    RCFSFTASRDWLFRQSFANAGLRSVTTDLSHGDSIASTTSMHCWIPKSPNRSKPNLLLVH  68

Query  305  GFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVE  484
            GFGANAMWQYG  LR F  R+NVYVPDLLFFG S T+ P RTE FQARC+ RLMEAHGV 
Sbjct  69   GFGANAMWQYGQHLRSFTGRYNVYVPDLLFFGLSSTSEPNRTESFQARCLMRLMEAHGVH  128

Query  485  EMSLVGISYGG  517
             M++VGISYGG
Sbjct  129  TMNIVGISYGG  139



>emb|CDX81126.1| BnaC03g03800D [Brassica napus]
Length=312

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 98/133 (74%), Gaps = 5/133 (4%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTK-----MHCWVPKVQKPGKPNLLL  298
            K  RC SFTASRDW++R  FA +GLRSV TD   G       MHCW+PK     KPNLLL
Sbjct  6    KLLRCFSFTASRDWFFRQSFANAGLRSVVTDLSHGNSIASATMHCWIPKSPNRSKPNLLL  65

Query  299  LHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            LHGFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+   RTE FQARC+ RLMEAHG
Sbjct  66   LHGFGANAMWQYGEHLRAFTGRFNVYVPDLLFFGLSSTSEQNRTESFQARCLMRLMEAHG  125

Query  479  VEEMSLVGISYGG  517
            V  MS+VGISYGG
Sbjct  126  VHRMSIVGISYGG  138



>ref|XP_010422984.1| PREDICTED: uncharacterized protein LOC104708175 [Camelina sativa]
Length=311

 Score =   184 bits (468),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 100/133 (75%), Gaps = 5/133 (4%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-----TKMHCWVPKVQKPGKPNLLL  298
            K  RC SFTASRDW +R  FA +GLRSVTTD   G     T MHCW+PK     KPNLLL
Sbjct  6    KLLRCFSFTASRDWLFRQSFANAGLRSVTTDLSHGNSIASTAMHCWIPKYPNRSKPNLLL  65

Query  299  LHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            +HGFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+ P R+E FQA C+ RLMEAHG
Sbjct  66   VHGFGANAMWQYGEHLRAFTGRFNVYVPDLLFFGLSSTSEPNRSESFQALCLMRLMEAHG  125

Query  479  VEEMSLVGISYGG  517
            V+ M++VGISYGG
Sbjct  126  VQRMNIVGISYGG  138



>ref|XP_007047918.1| Alpha/beta-Hydrolases superfamily protein isoform 6 [Theobroma 
cacao]
 gb|EOX92075.1| Alpha/beta-Hydrolases superfamily protein isoform 6 [Theobroma 
cacao]
Length=209

 Score =   180 bits (457),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTA+RDW YRY F+ +GLRS TTD  DGT MH W PK     KP L+L+HG GAN
Sbjct  2    AKCFSFTATRDWCYRYSFSNAGLRSSTTDLGDGTVMHVWAPKAHIQSKPTLVLIHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D +   + RFNVYVPDLLFFG SYTT PER+E+FQA+CV R+M+A+GV  MS+V
Sbjct  62   AMWQWNDFVSPLMSRFNVYVPDLLFFGESYTTRPERSEQFQAQCVMRVMDAYGVTVMSVV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_009122516.1| PREDICTED: uncharacterized protein LOC103847208 [Brassica rapa]
Length=312

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 98/131 (75%), Gaps = 6/131 (5%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFD------DGTKMHCWVPKVQKPGKPNLLLLH  304
            RC SFTASRDW +R  FA +GLRSVTT+          T MHCW+PK     KPNLLL+H
Sbjct  9    RCFSFTASRDWLFRQSFANAGLRSVTTNLSHTNSIASTTSMHCWIPKSPNRSKPNLLLVH  68

Query  305  GFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVE  484
            GFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+ P RTE FQARC+ RLMEAHGV 
Sbjct  69   GFGANAMWQYGEHLRSFTGRFNVYVPDLLFFGLSSTSEPNRTESFQARCLMRLMEAHGVH  128

Query  485  EMSLVGISYGG  517
             M++VGISYGG
Sbjct  129  TMNIVGISYGG  139



>ref|XP_010546343.1| PREDICTED: monoacylglycerol lipase ABHD6 [Tarenaya hassleriana]
Length=310

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 99/129 (77%), Gaps = 4/129 (3%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG----TKMHCWVPKVQKPGKPNLLLLHGF  310
            R  SFTA RDW++R  FA   LRSVTTD   G    T +HCW+PK   P KPNLLL+HGF
Sbjct  9    RYFSFTAYRDWFFRQSFAPPALRSVTTDLSHGGSSSTVIHCWIPKSPIPSKPNLLLIHGF  68

Query  311  GANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEM  490
            GANAMWQYG+ LR F  RFNVYVPDLLFFG S T+ P+R+E FQARC+ RLMEAHGV+ M
Sbjct  69   GANAMWQYGEHLRSFTARFNVYVPDLLFFGSSSTSEPDRSESFQARCLIRLMEAHGVQRM  128

Query  491  SLVGISYGG  517
            S+VGISYGG
Sbjct  129  SVVGISYGG  137



>ref|XP_007047917.1| Alpha/beta-Hydrolases superfamily protein isoform 5 [Theobroma 
cacao]
 gb|EOX92074.1| Alpha/beta-Hydrolases superfamily protein isoform 5 [Theobroma 
cacao]
Length=275

 Score =   181 bits (459),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTA+RDW YRY F+ +GLRS TTD  DGT MH W PK     KP L+L+HG GAN
Sbjct  2    AKCFSFTATRDWCYRYSFSNAGLRSSTTDLGDGTVMHVWAPKAHIQSKPTLVLIHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D +   + RFNVYVPDLLFFG SYTT PER+E+FQA+CV R+M+A+GV  MS+V
Sbjct  62   AMWQWNDFVSPLMSRFNVYVPDLLFFGESYTTRPERSEQFQAQCVMRVMDAYGVTVMSVV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_003524260.1| PREDICTED: epoxide hydrolase 3 [Glycine max]
Length=315

 Score =   182 bits (461),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGA  316
            A+ C+SFTA+RD  +R+ F+ +GL+SVTTD  DGT MHCW PK  K  KPNLLL+HGFGA
Sbjct  2    AAGCISFTATRDRCFRFSFSNAGLKSVTTDLGDGTIMHCWAPKAHKDSKPNLLLIHGFGA  61

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            NAMWQ+ D L     RFNVYVPDLLFFG S+TT P+R+E FQA+CV  L++AHG++  S+
Sbjct  62   NAMWQWNDFLSPLTRRFNVYVPDLLFFGDSHTTRPDRSEAFQAQCVAALLQAHGLQRTSV  121

Query  497  VGISYGG  517
            VGISYGG
Sbjct  122  VGISYGG  128



>emb|CDY21582.1| BnaC09g47100D [Brassica napus]
Length=312

 Score =   181 bits (460),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 98/131 (75%), Gaps = 6/131 (5%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFD------DGTKMHCWVPKVQKPGKPNLLLLH  304
            RC SFTASRDW +R  FA +GLRSVTTD          T MHCW+PK     KPNLLL+H
Sbjct  9    RCFSFTASRDWLFRQSFANAGLRSVTTDLSHTNSIASTTYMHCWIPKSPNRSKPNLLLVH  68

Query  305  GFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVE  484
            GFGANAMWQYG+ LR F  R+NVYVPDLLFFG S T+ P RTE FQA+C+ RLMEAHGV 
Sbjct  69   GFGANAMWQYGEHLRSFTGRYNVYVPDLLFFGLSSTSEPNRTESFQAQCLSRLMEAHGVH  128

Query  485  EMSLVGISYGG  517
             M++VGISYGG
Sbjct  129  TMNVVGISYGG  139



>ref|XP_008373280.1| PREDICTED: epoxide hydrolase 3 [Malus domestica]
Length=328

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFG  313
            K  + +SFTAS DW+YR++FA +GLRSV T+  DGT +HCWVPK  K  KP LLLLHGFG
Sbjct  5    KLPKRISFTASVDWFYRHYFANAGLRSVLTNLGDGTTIHCWVPKSPKSYKPTLLLLHGFG  64

Query  314  ANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMS  493
            ANAMWQYG+ LRHF  RFNVYVPDLLFFG S ++  ERTE FQA  + RLM++HGV +MS
Sbjct  65   ANAMWQYGEHLRHFTTRFNVYVPDLLFFGHSCSSRLERTESFQAESIIRLMKSHGVGKMS  124

Query  494  LVGISYGG  517
            +VGISYGG
Sbjct  125  VVGISYGG  132



>emb|CDY40723.1| BnaAnng05860D [Brassica napus]
Length=311

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFD-----DGTKMHCWVPKVQKPGKPNLLL  298
            K  RC SFTASRDW ++  F  +GLRSVTTD         T MHCW+PK     KPNLLL
Sbjct  6    KLLRCFSFTASRDWLFKQSFFNAGLRSVTTDLSHDNPLSSTSMHCWIPKSPNRSKPNLLL  65

Query  299  LHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            LHGFGANAMWQYG+ LR F+ +FNVYVPDLLFFG S TT P R+E FQA+C+ RLMEAHG
Sbjct  66   LHGFGANAMWQYGEHLRAFMGQFNVYVPDLLFFGLSSTTEPNRSESFQAQCLMRLMEAHG  125

Query  479  VEEMSLVGISYGG  517
            VE  S+VGISYGG
Sbjct  126  VERTSIVGISYGG  138



>ref|XP_008237384.1| PREDICTED: monoacylglycerol lipase ABHD6 [Prunus mume]
Length=443

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  173  WYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQYGDILRH  352
            W+YR+ FA +GLRSV T+  +GT M+CWVPK  KP KP LLLLHGFGANAMWQYG+ LRH
Sbjct  17   WFYRHSFANAGLRSVLTNLGNGTIMNCWVPKSHKPYKPTLLLLHGFGANAMWQYGEHLRH  76

Query  353  FVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYGG  517
            F P FNVYVPDLLFFG SYT+  ER+E FQA+CV RLMEAHGV +MS+VGISYGG
Sbjct  77   FTPHFNVYVPDLLFFGHSYTSCVERSESFQAQCVIRLMEAHGVGKMSMVGISYGG  131



>ref|XP_007047913.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX92070.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=315

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTA+RDW YRY F+ +GLRS TTD  DGT MH W PK     KP L+L+HG GAN
Sbjct  2    AKCFSFTATRDWCYRYSFSNAGLRSSTTDLGDGTVMHVWAPKAHIQSKPTLVLIHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D +   + RFNVYVPDLLFFG SYTT PER+E+FQA+CV R+M+A+GV  MS+V
Sbjct  62   AMWQWNDFVSPLMSRFNVYVPDLLFFGESYTTRPERSEQFQAQCVMRVMDAYGVTVMSVV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_007047916.1| Alpha/beta-Hydrolases superfamily protein isoform 4 [Theobroma 
cacao]
 gb|EOX92073.1| Alpha/beta-Hydrolases superfamily protein isoform 4 [Theobroma 
cacao]
Length=316

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTA+RDW YRY F+ +GLRS TTD  DGT MH W PK     KP L+L+HG GAN
Sbjct  2    AKCFSFTATRDWCYRYSFSNAGLRSSTTDLGDGTVMHVWAPKAHIQSKPTLVLIHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D +   + RFNVYVPDLLFFG SYTT PER+E+FQA+CV R+M+A+GV  MS+V
Sbjct  62   AMWQWNDFVSPLMSRFNVYVPDLLFFGESYTTRPERSEQFQAQCVMRVMDAYGVTVMSVV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_010027905.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Eucalyptus grandis]
Length=315

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTA+ D ++R+ F+++GL+  TTD  DGT +HCWVPK  KP KPNLLLLHG GAN
Sbjct  2    AKCFSFTATCDRWFRFSFSWAGLKPTTTDLGDGTVVHCWVPKTYKPNKPNLLLLHGLGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D +  F+ RFNVYVPDLLFFG SYTT PERTE+FQA+C+  ++EA GV ++++V
Sbjct  62   AMWQWNDFISSFLARFNVYVPDLLFFGESYTTRPERTEQFQAQCIAGVLEAQGVRKLNVV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_004504092.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Cicer arietinum]
Length=315

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C SFTASRD  YR  F+ +GL+S TTD  DGT MHCW+PK  K  KP+LLLLHG GANAM
Sbjct  4    CFSFTASRDRCYRLSFSNAGLKSTTTDIGDGTIMHCWLPKTHKNSKPSLLLLHGMGANAM  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ D +     RFNVYVPDLLFFG S+TT P+R+E FQA+CV  LMEAHGV  M+LVGI
Sbjct  64   WQWNDFVSPLTRRFNVYVPDLLFFGESHTTRPDRSESFQAQCVAALMEAHGVHSMNLVGI  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>ref|XP_010452932.1| PREDICTED: uncharacterized protein LOC104734933 [Camelina sativa]
Length=311

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-----TKMHCWVPKVQKPGKPNLLL  298
            K  RC SFTASRDW +R  FA +GLRSVTTD   G     T MHCW+PK     KPNLLL
Sbjct  6    KLLRCFSFTASRDWLFRQSFANAGLRSVTTDLSHGNSIASTAMHCWIPKYPNRSKPNLLL  65

Query  299  LHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            +HGFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+ P R+E FQA  + RLMEAHG
Sbjct  66   VHGFGANAMWQYGEHLRAFTGRFNVYVPDLLFFGLSSTSEPNRSESFQALYLMRLMEAHG  125

Query  479  VEEMSLVGISYGG  517
            V+ M++VGISYGG
Sbjct  126  VQRMNIVGISYGG  138



>gb|KDP41386.1| hypothetical protein JCGZ_15793 [Jatropha curcas]
Length=330

 Score =   179 bits (455),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC S T +++  +R  F  SGLRS  TD  DGT MHCW+P      KPNLLL+HG GAN
Sbjct  2    TRCFSITEAKNRCHRSTFTKSGLRSTITDLKDGTVMHCWIPNSPTDSKPNLLLIHGLGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            A+WQ+GD++RHF P FNVYVPDL+FFG S+TT PERTE FQA+CV R+MEA+ V ++SL+
Sbjct  62   ALWQWGDVIRHFTPHFNVYVPDLVFFGESFTTRPERTESFQAQCVMRVMEANSVRKLSLI  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_009603502.1| PREDICTED: epoxide hydrolase 4 [Nicotiana tomentosiformis]
Length=315

 Score =   179 bits (454),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTASR+W ++Y F+ SGL+S TTD  DGT MHCW+PK  K  KP LLL+HG GAN
Sbjct  2    AKCCSFTASRNWCFKYSFSNSGLKSSTTDLTDGTIMHCWIPKSHKERKPTLLLIHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ + +     RFN+YVPDLLFFG SYTT PER+E FQA+CV R+ME +GV++M++V
Sbjct  62   AMWQWNEFISPLSSRFNLYVPDLLFFGESYTTRPERSELFQAQCVMRIMEVYGVKKMTVV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_011100065.1| PREDICTED: uncharacterized protein LOC105178306 [Sesamum indicum]
Length=313

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTASRDW Y+  F+ +GL+S TTD  DGT +HCW PK  KP KP LLL+HG GAN
Sbjct  2    AKCFSFTASRDWCYKCSFSTAGLKSTTTDLGDGTVIHCWGPKTHKPSKPTLLLIHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D +     +FNVYVPDLLFFG SYTT PER+E FQA CV R MEA GV  M +V
Sbjct  62   AMWQWNDFVSPLSSKFNVYVPDLLFFGESYTTRPERSENFQAECVMRAMEAMGVRRMRVV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_010027904.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Eucalyptus grandis]
 gb|KCW54540.1| hypothetical protein EUGRSUZ_I00501 [Eucalyptus grandis]
Length=315

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTA RD ++R  F  +GL+S TTD  DGT MHCWVP+ ++P KPNLLLLHG GAN
Sbjct  2    AKCFSFTAIRDRWFRLSFFLAGLKSTTTDLGDGTVMHCWVPRTREPSKPNLLLLHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ + +  F+ RFNVYVPDLLFFG S+TT PERTE+FQA+CV  ++EA GV ++++V
Sbjct  62   AMWQWNEFISSFLARFNVYVPDLLFFGDSHTTRPERTEQFQAQCVAGVLEAQGVRKLNVV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_009789417.1| PREDICTED: uncharacterized protein LOC104237044 [Nicotiana sylvestris]
Length=315

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTASR+W ++Y F+ SGL+S TTD  DGT MHCW+PK  K  KP L+L+HG GAN
Sbjct  2    AKCCSFTASRNWCFKYSFSNSGLKSSTTDLTDGTIMHCWIPKTHKEKKPTLVLIHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ + +     RFN+YVPDLLFFG SYTT PER+E FQA+CV R+ME +GV++M++V
Sbjct  62   AMWQWNEFISPLSSRFNLYVPDLLFFGESYTTRPERSEFFQAQCVMRIMEVYGVKKMTVV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_004292444.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Fragaria vesca 
subsp. vesca]
Length=328

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 96/125 (77%), Gaps = 2/125 (2%)
 Frame = +2

Query  149  LSFTASRDWYYRYFFAFSGLRSVTTDFDDG--TKMHCWVPKVQKPGKPNLLLLHGFGANA  322
             SFTAS DW+ R+FF  +GLRSV TD  DG  T MHCWVPK+ K  KPNL+L+HGFGANA
Sbjct  11   FSFTASIDWFCRHFFGNAGLRSVITDIGDGDATNMHCWVPKIHKAFKPNLILIHGFGANA  70

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQYG+ +RHF  RFNVYVPDL+FFG SYT   ER E FQA CV +LM AH V + S+VG
Sbjct  71   MWQYGEHIRHFTARFNVYVPDLVFFGDSYTCSQERNESFQAACVVKLMHAHRVGKASIVG  130

Query  503  ISYGG  517
            ISYGG
Sbjct  131  ISYGG  135



>ref|XP_002307077.1| hypothetical protein POPTR_0005s07540g [Populus trichocarpa]
 gb|EEE94073.1| hypothetical protein POPTR_0005s07540g [Populus trichocarpa]
Length=317

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SF A++D  YRY F  +GL+S TTD  DGT MHCW+PK  KP KP LLL+HGFGAN
Sbjct  2    AKCFSFAATQDSCYRYSFTRAGLKSSTTDLGDGTIMHCWIPKRHKPSKPTLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+  ++  F+PRFNVYVPDLLFFG SYTT  ER+E FQA+CV  LMEA  V +M + 
Sbjct  62   AMWQFNGLIPQFMPRFNVYVPDLLFFGESYTTRAERSESFQAQCVMSLMEAQKVTKMDVF  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>gb|KHG17564.1| Monoacylglycerol lipase ABHD6 [Gossypium arboreum]
Length=333

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC S TA+R+  Y+  F  +GLRS  TD  DGT MHCWVP+     KPNLLL+HG GAN
Sbjct  2    TRCFSLTAARNRCYKSSFIKAGLRSTITDLQDGTVMHCWVPRTHNDSKPNLLLIHGLGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
             MWQ+GD +R  +P FN++VPDL+FFG SYTT PER+E FQA+CV RLMEA+ V+++SLV
Sbjct  62   TMWQWGDTIRKMIPFFNIFVPDLVFFGDSYTTRPERSESFQAQCVMRLMEANSVKKLSLV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_009125759.1| PREDICTED: monoacylglycerol lipase abhd6-B-like [Brassica rapa]
Length=311

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 97/133 (73%), Gaps = 5/133 (4%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFD-----DGTKMHCWVPKVQKPGKPNLLL  298
            K  RC SFTASRDW ++  F  +GL SVTTD         T MHCW+PK     KPNLLL
Sbjct  6    KLLRCFSFTASRDWLFKQSFLNAGLCSVTTDLSHDNPLSSTSMHCWIPKSPNRSKPNLLL  65

Query  299  LHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            LHGFGANAMWQYG+ LR F  RFNVYVPDLLFFG S T+ P R+E FQA+C+ RLMEAHG
Sbjct  66   LHGFGANAMWQYGEHLRAFTGRFNVYVPDLLFFGLSSTSEPNRSESFQAQCLMRLMEAHG  125

Query  479  VEEMSLVGISYGG  517
            V+  S+VGISYGG
Sbjct  126  VQRTSIVGISYGG  138



>ref|XP_010027903.1| PREDICTED: abhydrolase domain-containing protein 8-like [Eucalyptus 
grandis]
 gb|KCW54541.1| hypothetical protein EUGRSUZ_I00502 [Eucalyptus grandis]
Length=315

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SF  +R+  +R+ F+ +GL+S TTD  DGT MHCWVPK  KP KPNLLL+HG GAN
Sbjct  2    AKCFSFAETRNRCFRFSFSQAGLKSATTDLGDGTVMHCWVPKTYKPSKPNLLLVHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ + +  FV RFNVYVPDLLFFG SYTT PERTE+FQA+CV  +++A GV + ++V
Sbjct  62   AMWQWNEFISPFVARFNVYVPDLLFFGDSYTTRPERTEQFQAQCVAGVLKAQGVRKTNVV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>gb|KCW54542.1| hypothetical protein EUGRSUZ_I00502 [Eucalyptus grandis]
Length=280

 Score =   175 bits (444),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SF  +R+  +R+ F+ +GL+S TTD  DGT MHCWVPK  KP KPNLLL+HG GAN
Sbjct  2    AKCFSFAETRNRCFRFSFSQAGLKSATTDLGDGTVMHCWVPKTYKPSKPNLLLVHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ + +  FV RFNVYVPDLLFFG SYTT PERTE+FQA+CV  +++A GV + ++V
Sbjct  62   AMWQWNEFISPFVARFNVYVPDLLFFGDSYTTRPERTEQFQAQCVAGVLKAQGVRKTNVV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_010025435.1| PREDICTED: uncharacterized protein LOC104415777 [Eucalyptus grandis]
 ref|XP_010025436.1| PREDICTED: uncharacterized protein LOC104415777 [Eucalyptus grandis]
 ref|XP_010025437.1| PREDICTED: uncharacterized protein LOC104415777 [Eucalyptus grandis]
 gb|KCW62095.1| hypothetical protein EUGRSUZ_H04767 [Eucalyptus grandis]
Length=315

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC SFTA+RD   R+ F+ SGL+S  TD   GT MHCWVP+  KP +P+L+LLHG GAN
Sbjct  2    ARCCSFTATRDQCLRFSFSRSGLKSTVTDLGGGTVMHCWVPRRPKPARPDLVLLHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D +     RFNVYVPDLLFFG SYTT PER+EEFQA+CV  LMEA GV+ M++V
Sbjct  62   AMWQWNDFVSPLAARFNVYVPDLLFFGDSYTTRPERSEEFQAQCVVALMEAIGVKRMNVV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GMSYGG  127



>ref|XP_010531367.1| PREDICTED: monoacylglycerol lipase ABHD6 [Tarenaya hassleriana]
Length=312

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = +2

Query  131  SKASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGF  310
            S  + C SFTA R+ YYR+ F+  GLRS T D  DGT +HCWVP+     KP LLLLHG 
Sbjct  7    SDMTGCFSFTACRNRYYRFSFSSLGLRSSTVDLGDGTIIHCWVPRTHLDDKPTLLLLHGL  66

Query  311  GANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEM  490
            GANAMWQ+G  +  F+PRFNVYVPDLLFFG S TT PER+E FQARCV  +M+AHGV  M
Sbjct  67   GANAMWQWGWCIDRFIPRFNVYVPDLLFFGDSLTTRPERSESFQARCVMAMMDAHGVRTM  126

Query  491  SLVGISYGG  517
            ++ GISYGG
Sbjct  127  TVAGISYGG  135



>gb|KDO58791.1| hypothetical protein CISIN_1g021268mg [Citrus sinensis]
Length=315

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTA+R+  YRY FA SGL+S T D  +GT MHCWVPK  K  KPNL L+HG GAN
Sbjct  2    AKCFSFTAARNSCYRYSFAHSGLKSSTVDLGEGTVMHCWVPKTHKQNKPNLCLIHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D +   + +FNVYVPDLLFFG SYT+ P+R+E FQARCV  L++AHGV +  +V
Sbjct  62   AMWQWADFISPLISKFNVYVPDLLFFGDSYTSRPDRSESFQARCVMGLLDAHGVAKTHVV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GMSYGG  127



>ref|XP_006426372.1| hypothetical protein CICLE_v10026111mg [Citrus clementina]
 gb|ESR39612.1| hypothetical protein CICLE_v10026111mg [Citrus clementina]
Length=316

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTA+R+  YRY FA SGL+S T D  +GT MHCWVPK  K  KPNL L+HG GAN
Sbjct  2    AKCFSFTAARNSCYRYSFAHSGLKSSTVDLGEGTVMHCWVPKTHKQNKPNLCLIHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D +   + +FNVYVPDLLFFG SYT+ P+R+E FQARCV  L++AHGV +  +V
Sbjct  62   AMWQWADFISPLISKFNVYVPDLLFFGDSYTSRPDRSESFQARCVMGLLDAHGVAKTHVV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GMSYGG  127



>ref|XP_011031037.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X1 [Populus 
euphratica]
Length=317

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SF A++D  YRY F  +GL+S TTD  DGT MHCW+PK   P +P LLL+HGFGAN
Sbjct  2    AKCFSFAATQDSCYRYSFTRAGLKSSTTDLGDGTIMHCWIPKRHNPSRPTLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+  ++  F+PRFNVYVPDLLFFG SYTT  ER+E FQA+CV  LMEA  V +M + 
Sbjct  62   AMWQFNGLIPQFMPRFNVYVPDLLFFGESYTTRAERSESFQAQCVMSLMEAQKVTKMDVF  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_011031038.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X2 [Populus 
euphratica]
Length=316

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC SF A++D YYRY F  +GL+S TT+  DGT MHCW+PK   P  P LLL+HGFGAN
Sbjct  2    TRCFSFVAAQDSYYRYCFKRAGLKSSTTNLGDGTIMHCWIPKKHNPSMPTLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+  ++ HF+  FNVYVPDLLFFG SYTT  ER+E FQA+CV RL+EA  V +M + 
Sbjct  62   AMWQFNGLIPHFMSTFNVYVPDLLFFGESYTTRAERSESFQAQCVMRLIEAQNVAKMDVF  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_006382897.1| hypothetical protein POPTR_0005s07540g [Populus trichocarpa]
 gb|ERP60694.1| hypothetical protein POPTR_0005s07540g [Populus trichocarpa]
Length=316

 Score =   174 bits (442),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC SF A++D YYRY F  +GL+S TT+  DGT MHCW+PK+  P  P LLL+HGFGAN
Sbjct  2    TRCFSFVAAQDSYYRYCFKRAGLKSSTTNLGDGTIMHCWIPKMHNPSIPTLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+  ++ HF+  FNVYVPDLLFFG SYTT  ER+E FQA+CV  LMEA  V +M + 
Sbjct  62   AMWQFNGLIPHFMSTFNVYVPDLLFFGESYTTRAERSESFQAQCVMSLMEAQNVAKMDVF  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_007159667.1| hypothetical protein PHAVU_002G257100g [Phaseolus vulgaris]
 gb|ESW31661.1| hypothetical protein PHAVU_002G257100g [Phaseolus vulgaris]
Length=315

 Score =   174 bits (441),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C+SFTA+RD Y+R+ F+ +GL+S TTD   GT MHCW PK  K  KPNL+LLHGFGANAM
Sbjct  4    CISFTATRDRYFRFSFSNAGLKSTTTDLGHGTIMHCWAPKAHKYSKPNLVLLHGFGANAM  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ D L     RFNVYVPDLLFFG S+T  P+R+E FQA+CV  L++AHGV   S+VGI
Sbjct  64   WQWNDFLPPLKRRFNVYVPDLLFFGDSHTARPDRSEAFQAQCVAALLQAHGVRRSSVVGI  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>ref|XP_006585267.1| PREDICTED: epoxide hydrolase 3-like [Glycine max]
Length=312

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            + C+SFTA+RD  +R+ F+ +GL+S TTD  DGT MH W PK  K  KPNLLLLHGFGAN
Sbjct  2    AACISFTATRDRCFRFTFSNAGLKSATTDLGDGTIMHWWAPKAPKDSKPNLLLLHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D+L     RFNVYVPDL+FFG S+TT PER+E FQA+CV  L+ AHG+   S+V
Sbjct  62   AMWQWNDVLSPLTRRFNVYVPDLVFFGDSHTTRPERSEAFQAQCVAALLLAHGLHTTSVV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_008343338.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Malus domestica]
Length=267

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 94/125 (75%), Gaps = 1/125 (1%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-TKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            C S T S++  +R+ FA +GLRS  TD  DG T MHCWVP+   P KPNLLL+HGFG NA
Sbjct  3    CFSITQSKNSCHRFTFARAGLRSAITDLKDGATTMHCWVPQSPNPSKPNLLLIHGFGVNA  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ D+LRH  P +NVYVPDL+FFG SYTT P+R+E FQA CV + MEAH V  +SLVG
Sbjct  63   MWQFVDLLRHVTPHYNVYVPDLVFFGDSYTTRPDRSEWFQAECVMQAMEAHSVRRLSLVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>gb|KHG06812.1| Lipase 3 [Gossypium arboreum]
Length=308

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C SFTA+RD  +R  F+ +GLRS TTD  DGT MH W+PK+    KP L+L+HGFGANA
Sbjct  3    KCFSFTATRDSCFRCSFSSAGLRSSTTDLGDGTVMHVWIPKLHVQSKPTLVLIHGFGANA  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEE-MSLV  499
            MWQ+ D +   + RFNVYVPDLLFFG SYTT PER+E+FQA CV R+MEAHGV   M++V
Sbjct  63   MWQWNDFISPLISRFNVYVPDLLFFGESYTTRPERSEQFQAECVVRVMEAHGVVSGMNVV  122

Query  500  GISYGG  517
            GISYGG
Sbjct  123  GISYGG  128



>ref|XP_006466238.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Citrus sinensis]
Length=315

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTA+R+  YRY FA SGL+S T D  +GT MHCWVPK  K  KPNL L+HG GAN
Sbjct  2    AKCFSFTATRNSCYRYSFAHSGLKSSTVDLGEGTVMHCWVPKTHKQNKPNLCLIHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D +   + +FNVYVPDLLFFG SYT+  +R+E FQARCV  L++AHGV +  +V
Sbjct  62   AMWQWADFISPLISKFNVYVPDLLFFGDSYTSRSDRSESFQARCVMGLLDAHGVAKTHVV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_007141181.1| hypothetical protein PHAVU_008G173800g [Phaseolus vulgaris]
 gb|ESW13175.1| hypothetical protein PHAVU_008G173800g [Phaseolus vulgaris]
Length=310

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = +2

Query  152  SFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQ  331
            SFT +R+  YR  F   GLRS  TD  DGT MHCW PK +   KPNLLL+HGFG NA+WQ
Sbjct  7    SFTETRNRCYRSAFTGLGLRSTITDLKDGTVMHCWAPKARTQTKPNLLLIHGFGVNALWQ  66

Query  332  YGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISY  511
            +G+ +RH  P FNVYVPDL+FFGGSYTT PER E FQA CV R+MEA+GV  +SLVG+SY
Sbjct  67   WGNFVRHVAPLFNVYVPDLVFFGGSYTTRPERGERFQAECVMRVMEANGVRRVSLVGLSY  126

Query  512  GG  517
            GG
Sbjct  127  GG  128



>ref|XP_008383931.1| PREDICTED: monoacylglycerol lipase ABHD6 [Malus domestica]
Length=317

 Score =   172 bits (435),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-TKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            C S T S++  +R  FA +GLRS  TD  DG T MHCWVP+   P KPNLLL+HG G NA
Sbjct  3    CFSLTQSKNSCHRSTFARAGLRSAITDLKDGATTMHCWVPQSPNPSKPNLLLIHGLGLNA  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ D+LRH  P +NVYVPDL+FFG SYTT P+R+E FQA CV + MEAH V  +SLVG
Sbjct  63   MWQFVDLLRHVTPHYNVYVPDLVFFGDSYTTRPDRSESFQAECVMQAMEAHSVRRLSLVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_009334649.1| PREDICTED: epoxide hydrolase 3-like [Pyrus x bretschneideri]
Length=315

 Score =   171 bits (434),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C S  ASRD  +RY F  SGL+S TTD  DGT MHCW PK   P KP LLL+HG GANAM
Sbjct  4    CFSIIASRDRCFRYSFFSSGLKSTTTDLGDGTVMHCWAPKNHSPSKPTLLLIHGIGANAM  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ D +   V RFN+Y+PDL+FFG SY++ PER+E FQARCV  LM+AHGV++M + GI
Sbjct  64   WQWHDFVSPLVSRFNLYIPDLVFFGDSYSSRPERSEIFQARCVMALMDAHGVKKMMVTGI  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>ref|XP_007222763.1| hypothetical protein PRUPE_ppa008754mg [Prunus persica]
 gb|EMJ23962.1| hypothetical protein PRUPE_ppa008754mg [Prunus persica]
Length=320

 Score =   171 bits (434),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-TKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            C SFT S++  +R  FA +GLRS  TD  DG T MHCWVP+   P K NLLL+HG G NA
Sbjct  3    CFSFTESKNSCHRSTFARAGLRSAITDIKDGGTTMHCWVPQSPNPSKRNLLLIHGLGVNA  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ D+LRH  P FNVYVPDLLFFG S TT P+R+E FQA CV R+MEAH V  +SLVG
Sbjct  63   MWQFVDLLRHVTPHFNVYVPDLLFFGESSTTRPDRSESFQAECVMRVMEAHSVRRLSLVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_010060010.1| PREDICTED: uncharacterized protein LOC104447954 [Eucalyptus grandis]
 gb|KCW66529.1| hypothetical protein EUGRSUZ_F00329 [Eucalyptus grandis]
Length=350

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            RC S T  R   YR  FA  GLRS  TD  DGT +HCWVPK + P KP+LLL+HG GANA
Sbjct  4    RCFSLTEFRSRCYRSAFARWGLRSALTDLRDGTVVHCWVPKARSPAKPDLLLIHGLGANA  63

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            +WQ+ D+L H  P FN++VPDLLFFG S+T+ P+R++ FQARC+ R+MEAH V  +SLVG
Sbjct  64   LWQWADVLPHLAPHFNLFVPDLLFFGDSFTSRPDRSDSFQARCLMRVMEAHSVRRLSLVG  123

Query  503  ISYGG  517
            +SYGG
Sbjct  124  LSYGG  128



>ref|XP_006595211.1| PREDICTED: uncharacterized protein LOC100808998 [Glycine max]
Length=1046

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +2

Query  152  SFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQ  331
            SFT +R+  YR  FA SGLRS  TD  DGT MHCW PK +   KP+LLL+HG GANA+WQ
Sbjct  7    SFTETRNRCYRSMFAGSGLRSTVTDLKDGTVMHCWEPKARAESKPSLLLIHGLGANALWQ  66

Query  332  YGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISY  511
            +GD++RH  P +NVYVPDL+FFGGSYT  PER E FQA CV R+MEA GV  +SLVG+SY
Sbjct  67   WGDLIRHVAPHYNVYVPDLVFFGGSYTARPERGERFQAECVARVMEAKGVRRVSLVGLSY  126

Query  512  GG  517
            GG
Sbjct  127  GG  128



>ref|XP_006433979.1| hypothetical protein CICLE_v10001896mg [Citrus clementina]
 gb|ESR47219.1| hypothetical protein CICLE_v10001896mg [Citrus clementina]
 gb|KDO80973.1| hypothetical protein CISIN_1g021229mg [Citrus sinensis]
Length=315

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            SRC SFT +++W  +  F   G RS  TD  DG+ MHCWVPK +   KP+L+L+HG GAN
Sbjct  2    SRCFSFTEAKNWCLKSCFKRLGFRSSVTDLQDGSVMHCWVPKTRNDSKPDLVLIHGLGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            A+WQ+ +I+ H +  FNVYVPDLLFFG S+TT PER+E FQA CV R+MEAH V+++SLV
Sbjct  62   ALWQWTNIIPHMIHYFNVYVPDLLFFGDSFTTRPERSESFQAECVMRVMEAHSVKKLSLV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_002532883.1| abhydrolase domain containing, putative [Ricinus communis]
 gb|EEF29512.1| abhydrolase domain containing, putative [Ricinus communis]
Length=314

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTASRD  YRY F   GL+S TTD  DGT +HCW+PK     KP LLL+HGFGAN
Sbjct  2    AKCFSFTASRDSCYRYSFTRGGLKSCTTDLGDGTIIHCWIPKSHIQTKPTLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D++  F  +FN+Y+PDLLFFG SYTT P+RTE FQARC+  +ME   V++M ++
Sbjct  62   AMWQFNDVIPPFKSKFNIYIPDLLFFGDSYTTRPDRTESFQARCLMAVMERLNVKKMDVM  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_004146882.1| PREDICTED: 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase-like [Cucumis 
sativus]
 ref|XP_004166437.1| PREDICTED: 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase-like [Cucumis 
sativus]
 gb|KGN53199.1| hypothetical protein Csa_4G026270 [Cucumis sativus]
Length=314

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            + C SF+++ D  +RY F+ +GL+S+TTD  DGT +HCW PK ++  KPNLLLLHGFGAN
Sbjct  2    AACFSFSSTMDSCFRYSFSRAGLKSITTDLGDGTIIHCWAPKFRRETKPNLLLLHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ + +   +  FNVYVPDL+FFG SYTT PER+E FQARC+ RLM++ GV+++++V
Sbjct  62   AMWQWNEFIAPLIRFFNVYVPDLIFFGNSYTTRPERSESFQARCMMRLMDSFGVQKVNVV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_008453821.1| PREDICTED: uncharacterized protein LOC103494432 [Cucumis melo]
Length=314

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            + C SF+++ D  +RY F+ +GL+S+TTD  DGT +HCW PK ++  KPNLLLLHGFGAN
Sbjct  2    AACFSFSSTMDSCFRYSFSRAGLKSITTDLGDGTIIHCWAPKFRRETKPNLLLLHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ + +   +  FNVYVPDL+FFG SYTT PER+E FQARC+ RLM++ GV+++++V
Sbjct  62   AMWQWNEFIAPLIRFFNVYVPDLIFFGNSYTTRPERSESFQARCMMRLMDSFGVQKVNVV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_004237916.1| PREDICTED: monoacylglycerol lipase abhd6-A isoform X2 [Solanum 
lycopersicum]
Length=310

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C SFTA+++   +  F+  GLRS  TD  DGT MHCWVPK +KP +P+L+L+HGFGAN+
Sbjct  3    KCFSFTAAKNRCLKSTFSSRGLRSTFTDLKDGTIMHCWVPKSKKPTRPDLVLIHGFGANS  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ + +R     FNVYVPDLLFFG SYTT PERTE FQA+CVKR+ME + V +MS+VG
Sbjct  63   MWQWSETVRILSRHFNVYVPDLLFFGDSYTTRPERTESFQAQCVKRVMEENSVTKMSVVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_008373281.1| PREDICTED: uncharacterized protein LOC103436612 [Malus domestica]
Length=264

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C S  ASRD   RY F+ SGL+S TTD  DGT MHCW PK   P KP LLL+HG GANAM
Sbjct  4    CFSIIASRDRCLRYSFSSSGLKSTTTDLGDGTVMHCWAPKNHSPSKPTLLLIHGIGANAM  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ D +     RFN+Y+PDL+FFG SY++ PER+E FQARCV  LM+AHGV++M + GI
Sbjct  64   WQWHDFVSPLASRFNLYIPDLVFFGDSYSSRPERSEIFQARCVMALMDAHGVKKMMVTGI  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>ref|XP_009334325.1| PREDICTED: uncharacterized protein LOC103927158 [Pyrus x bretschneideri]
Length=317

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-TKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            C S T +++  +R  FA +GLRS  TD  DG T MHCWVP+   P KPNLLL+HG G NA
Sbjct  3    CFSLTQAKNSCHRSTFARAGLRSAITDIKDGATTMHCWVPQSPNPSKPNLLLIHGLGLNA  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ D+LRH  P +NVYVPDL+FFG SYTT P+R++ FQA CV + MEAH V  +SLVG
Sbjct  63   MWQFADLLRHVTPHYNVYVPDLVFFGDSYTTQPDRSDSFQAECVMQAMEAHSVRRLSLVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_008373261.1| PREDICTED: epoxide hydrolase 3-like [Malus domestica]
Length=315

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C S  ASRD   RY F+ SGL+S TTD  DGT MHCW PK   P KP LLL+HG GANAM
Sbjct  4    CFSIIASRDRCLRYSFSSSGLKSTTTDLGDGTVMHCWAPKNHSPSKPTLLLIHGIGANAM  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ D +     RFN+Y+PDL+FFG SY++ PER+E FQARCV  LM+AHGV++M + GI
Sbjct  64   WQWHDFVSPLASRFNLYIPDLVFFGDSYSSRPERSEIFQARCVMALMDAHGVKKMMVTGI  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>ref|XP_006353227.1| PREDICTED: epoxide hydrolase 3-like [Solanum tuberosum]
Length=317

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            S C SFTASR+W+ +Y F+ SGL+S TTD  +GT +HCW+PK  K  K +L+L+HG GAN
Sbjct  4    SNCFSFTASRNWFLKYSFSNSGLKSSTTDLGNGTTIHCWIPKTHKEKKSSLVLIHGIGAN  63

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ + ++    RFN+YVPDLLFFG SYT+  ERTE FQA CV R ME +GV++M +V
Sbjct  64   AMWQWSEFIKPLSSRFNLYVPDLLFFGESYTSRSERTESFQAECVMRTMEGYGVKKMDVV  123

Query  500  GISYGG  517
            G+SYGG
Sbjct  124  GLSYGG  129



>ref|XP_004237915.1| PREDICTED: monoacylglycerol lipase abhd6-A isoform X1 [Solanum 
lycopersicum]
Length=316

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C SFTA+++   +  F+  GLRS  TD  DGT MHCWVPK +KP +P+L+L+HGFGAN+
Sbjct  3    KCFSFTAAKNRCLKSTFSSRGLRSTFTDLKDGTIMHCWVPKSKKPTRPDLVLIHGFGANS  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ + +R     FNVYVPDLLFFG SYTT PERTE FQA+CVKR+ME + V +MS+VG
Sbjct  63   MWQWSETVRILSRHFNVYVPDLLFFGDSYTTRPERTESFQAQCVKRVMEENSVTKMSVVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_003601937.1| Monoacylglycerol lipase ABHD6 [Medicago truncatula]
 gb|AES72188.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=317

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGA  316
            +SR  SFT   +W++RY F+ SGL+S TTD  DGT MHCWVPK  +  KP+L+L+HG GA
Sbjct  3    SSRWFSFTTLCNWWFRYSFSKSGLKSTTTDLGDGTVMHCWVPKTAQKHKPSLILIHGIGA  62

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            NAMWQ+   +      FNVYVPDLLFFG SYTT PER+E+FQA+CV R++E HGV  M +
Sbjct  63   NAMWQWNSFIPELTHHFNVYVPDLLFFGDSYTTRPERSEQFQAKCVMRVLEGHGVRGMMV  122

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  123  VGLSYGG  129



>ref|XP_002310555.1| hydrolase family protein [Populus trichocarpa]
 gb|EEE91005.1| hydrolase family protein [Populus trichocarpa]
Length=317

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SF A++D  YRY F  SGL+S TTD  +GT MHCW+PK   P KP LLL+HGFGAN
Sbjct  2    AKCFSFAATQDSCYRYSFTRSGLKSSTTDLGEGTIMHCWIPKKHDPSKPTLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+  ++  F+ +FN+YVPDLLFFG SYT   ER+E FQA+CV  +MEAH V +M ++
Sbjct  62   AMWQFHGLIPKFISKFNIYVPDLLFFGESYTARAERSEAFQAQCVIGVMEAHKVTKMDVL  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_008219440.1| PREDICTED: monoacylglycerol lipase ABHD6 isoform X1 [Prunus mume]
Length=320

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-TKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            C S T S++  +R  FA +GLRS  TD  DG T MHCWVP+   P K NLLL+HG G NA
Sbjct  3    CFSLTESKNSCHRSTFARAGLRSAITDIKDGGTTMHCWVPQSPNPSKRNLLLIHGLGVNA  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ D+LRH  P FNVYVPDLLFFG S+TT P+R+E FQA CV R+MEAH V  +SL+G
Sbjct  63   MWQFVDLLRHVTPHFNVYVPDLLFFGESFTTRPDRSESFQAECVMRVMEAHSVRRLSLLG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_008219441.1| PREDICTED: valacyclovir hydrolase isoform X2 [Prunus mume]
Length=289

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-TKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            C S T S++  +R  FA +GLRS  TD  DG T MHCWVP+   P K NLLL+HG G NA
Sbjct  3    CFSLTESKNSCHRSTFARAGLRSAITDIKDGGTTMHCWVPQSPNPSKRNLLLIHGLGVNA  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ D+LRH  P FNVYVPDLLFFG S+TT P+R+E FQA CV R+MEAH V  +SL+G
Sbjct  63   MWQFVDLLRHVTPHFNVYVPDLLFFGESFTTRPDRSESFQAECVMRVMEAHSVRRLSLLG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_009372756.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Pyrus x bretschneideri]
Length=317

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 93/125 (74%), Gaps = 1/125 (1%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-TKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            C S T S++  +R+ FA +GLRS  TD  DG T +HCWVP+   P KPNLLL+HGFG NA
Sbjct  3    CFSITQSKNSCHRFTFARAGLRSAITDLKDGATTIHCWVPQSPNPSKPNLLLIHGFGVNA  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ D+LRH  P +NVYVPDL+FFG SYT  P+R+E FQA CV + MEAH V  +SLVG
Sbjct  63   MWQFVDLLRHVTPHYNVYVPDLVFFGDSYTXRPDRSEWFQAECVMQAMEAHSVRRLSLVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_010555370.1| PREDICTED: monoacylglycerol lipase abhd6-A-like [Tarenaya hassleriana]
Length=311

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C S+TA R+  +RY F+ +GLRS T D  DGT +HCWVP+     KP L+LLHG GANAM
Sbjct  4    CFSYTACRNKCFRYSFSSAGLRSSTADLGDGTIVHCWVPRTHLDHKPTLVLLHGIGANAM  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+   +  F+PRFNVYVPDLLFFG S+TT PER+E FQARCV  +M+AHGV  M++ GI
Sbjct  64   WQWDWFIDRFIPRFNVYVPDLLFFGDSHTTRPERSESFQARCVMAVMDAHGVRTMAVAGI  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>ref|XP_006364861.1| PREDICTED: epoxide hydrolase 3-like isoform X2 [Solanum tuberosum]
Length=310

 Score =   169 bits (428),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C SFTA+++   +  F+  GLRS  TD  DGT MHCWVPK +KP +P+L+L+HGFGAN+
Sbjct  3    KCFSFTATQNRCLKSTFSSRGLRSTFTDLKDGTIMHCWVPKSKKPTRPDLVLIHGFGANS  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ + +R     FNVYVPDLLFFG SYTT PERT  FQA+CVKR+MEA+ V +MS+VG
Sbjct  63   MWQWSETVRILSRHFNVYVPDLLFFGDSYTTRPERTVSFQAQCVKRVMEANSVTKMSVVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_006364860.1| PREDICTED: epoxide hydrolase 3-like isoform X1 [Solanum tuberosum]
Length=316

 Score =   169 bits (427),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C SFTA+++   +  F+  GLRS  TD  DGT MHCWVPK +KP +P+L+L+HGFGAN+
Sbjct  3    KCFSFTATQNRCLKSTFSSRGLRSTFTDLKDGTIMHCWVPKSKKPTRPDLVLIHGFGANS  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ + +R     FNVYVPDLLFFG SYTT PERT  FQA+CVKR+MEA+ V +MS+VG
Sbjct  63   MWQWSETVRILSRHFNVYVPDLLFFGDSYTTRPERTVSFQAQCVKRVMEANSVTKMSVVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_006472597.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X3 [Citrus 
sinensis]
 ref|XP_006472598.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X4 [Citrus 
sinensis]
Length=258

 Score =   167 bits (423),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            SRC SFT +++W  +  F   G RS  TD  DG+ MHCWVPK +   KP+L+L+HG GAN
Sbjct  2    SRCFSFTEAKNWCLKSCFKRLGFRSSVTDLQDGSVMHCWVPKTRNDSKPDLVLIHGLGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            A+WQ+ +I+ H +  FNVYVPDLLFFG S+TT PER+E FQA CV R+MEA  V+++SLV
Sbjct  62   ALWQWTNIIPHMIHYFNVYVPDLLFFGDSFTTRPERSESFQAECVMRVMEALSVKKLSLV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_010089876.1| Monoacylglycerol lipase ABHD6 [Morus notabilis]
 gb|EXB38517.1| Monoacylglycerol lipase ABHD6 [Morus notabilis]
Length=326

 Score =   169 bits (428),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            S+  SFT +++  YR  F  SGLRS  TD  DGT MHCW PK  K  KPNLLL+HG GAN
Sbjct  2    SKRFSFTKTKNKCYRSAFNKSGLRSTVTDLKDGTVMHCWAPKEPKESKPNLLLIHGLGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+GD++RH  P FN+Y+PDL+FFG SYT+ PER E FQA+CV R++EA  V  +SLV
Sbjct  62   AMWQWGDMVRHLAPLFNLYIPDLVFFGESYTSRPERAEWFQAQCVMRVIEALSVRRLSLV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_009785723.1| PREDICTED: uncharacterized protein LOC104233952 isoform X3 [Nicotiana 
sylvestris]
Length=272

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C S TA+++   +  F+  GLRS  TD  DGT MHCWVPK +K  +P+L+L+HGFGAN+
Sbjct  3    KCFSLTATKNRCLKSSFSSRGLRSTVTDLKDGTIMHCWVPKTRKSTRPDLVLIHGFGANS  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ + +R     FNVYVPDL+FFG SYTTLP+R+E FQA CVKR+MEA+ V +MS+VG
Sbjct  63   MWQWSETVRILSRHFNVYVPDLVFFGDSYTTLPDRSESFQAECVKRVMEANSVVKMSVVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_002513927.1| abhydrolase domain containing, putative [Ricinus communis]
 gb|EEF48510.1| abhydrolase domain containing, putative [Ricinus communis]
Length=322

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            SRC SFT +++  Y   F   GL+S TTD  DGT +HCWVPK     KPNLLL+HG GAN
Sbjct  2    SRCFSFTEAKNRCYISTFTKVGLQSTTTDLKDGTVIHCWVPKSPTQSKPNLLLIHGLGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ D++R F P FNVY+PDL+FFG SYTT  +RTE FQA CV R+MEA+ V ++SLV
Sbjct  62   AMWQWNDVIRRFTPYFNVYIPDLVFFGDSYTTRLDRTESFQAECVMRVMEANLVGKLSLV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_008444836.1| PREDICTED: LOW QUALITY PROTEIN: monoacylglycerol lipase ABHD6 
[Cucumis melo]
Length=303

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 98/128 (77%), Gaps = 2/128 (2%)
 Frame = +2

Query  140  SRCL--SFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFG  313
            ++CL  S T +++W++RY F  SGLRS  TD  DGT +HCWVPK     KPNLLL+HG G
Sbjct  2    TKCLFFSITETKNWFHRYSFTKSGLRSTITDLKDGTTVHCWVPKNPIRTKPNLLLIHGIG  61

Query  314  ANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMS  493
            ANA+WQ+GD +   +P FN+Y+PDL+FFG S+TT P+RTE FQA+C+ R+MEAH V + S
Sbjct  62   ANALWQWGDFIPALIPYFNLYIPDLIFFGDSFTTQPDRTEWFQAQCLIRVMEAHTVGKFS  121

Query  494  LVGISYGG  517
            LVG+SYGG
Sbjct  122  LVGLSYGG  129



>gb|KEH28075.1| alpha/beta-hydrolase superfamily protein [Medicago truncatula]
Length=303

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C S T +R+W YR  F  +GLRS  TD  DGT MHCW+PK +   KPNLLL+HG GAN
Sbjct  2    TQCFSLTETRNWCYRSTFTGAGLRSTITDLKDGTIMHCWIPKTRTESKPNLLLIHGLGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            A+WQ+G  +R     FNVYVPDL+FFGGSYT+ PERTE FQA CV ++ME   V  +S+V
Sbjct  62   ALWQWGHFIRSLTQLFNVYVPDLVFFGGSYTSRPERTEGFQAECVMKVMEMKCVRSVSVV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_009785722.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X2 [Nicotiana 
sylvestris]
Length=309

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C S TA+++   +  F+  GLRS  TD  DGT MHCWVPK +K  +P+L+L+HGFGAN+
Sbjct  3    KCFSLTATKNRCLKSSFSSRGLRSTVTDLKDGTIMHCWVPKTRKSTRPDLVLIHGFGANS  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ + +R     FNVYVPDL+FFG SYTTLP+R+E FQA CVKR+MEA+ V +MS+VG
Sbjct  63   MWQWSETVRILSRHFNVYVPDLVFFGDSYTTLPDRSESFQAECVKRVMEANSVVKMSVVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>gb|AGU28423.1| alpha/beta-hydrolase superfamily protein [Sinapis alba]
Length=320

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGA  316
            A+ C S+ +SR+  Y+Y F+ +GLRS T+D  +GT +HCWVP+  K  KP LLLLHG GA
Sbjct  2    AASCFSYVSSRNKCYQYSFSRAGLRSSTSDLGEGTVVHCWVPQTHKDDKPTLLLLHGIGA  61

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            NAMWQ+   +  F+PRFNVYVPDL+FFG S+TT P+RTE FQA CV ++M+ HGV  M++
Sbjct  62   NAMWQWDRFIDRFIPRFNVYVPDLIFFGDSHTTRPDRTESFQASCVMKVMDVHGVGTMTV  121

Query  497  VGISYGG  517
             G+SYGG
Sbjct  122  AGLSYGG  128



>ref|XP_009785721.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X1 [Nicotiana 
sylvestris]
Length=315

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C S TA+++   +  F+  GLRS  TD  DGT MHCWVPK +K  +P+L+L+HGFGAN+
Sbjct  3    KCFSLTATKNRCLKSSFSSRGLRSTVTDLKDGTIMHCWVPKTRKSTRPDLVLIHGFGANS  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ + +R     FNVYVPDL+FFG SYTTLP+R+E FQA CVKR+MEA+ V +MS+VG
Sbjct  63   MWQWSETVRILSRHFNVYVPDLVFFGDSYTTLPDRSESFQAECVKRVMEANSVVKMSVVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_011023080.1| PREDICTED: uncharacterized protein LOC105124669 [Populus euphratica]
Length=349

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC SF A++D  YRY F  SGL+S TTD  +GT MHCW+PK   P K  LLL+HGFGAN
Sbjct  2    ARCFSFAATQDSCYRYSFTRSGLKSSTTDLGEGTIMHCWIPKKHDPSKATLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+  ++  F+ +FN+YVPDLLFFG SYT   ER+E FQA+CV  +MEAH V +M ++
Sbjct  62   AMWQFHGLIPKFISKFNIYVPDLLFFGESYTARAERSEAFQAQCVIGVMEAHKVTKMDVL  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_009370707.1| PREDICTED: epoxide hydrolase 3-like [Pyrus x bretschneideri]
Length=315

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 91/124 (73%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C S  ASRD  +RY F  SGL+S TTD  DGT MHCW PK   P KP LLL+HG GANAM
Sbjct  4    CFSIIASRDRCFRYSFFSSGLKSTTTDLGDGTVMHCWAPKNHSPSKPTLLLIHGIGANAM  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+   +   V RFN+Y+PDL+FFG SY++ PER+E FQARCV  +M+AHGV++M + GI
Sbjct  64   WQWHGFVSPLVSRFNLYIPDLVFFGDSYSSRPERSEIFQARCVMAVMDAHGVKKMMVTGI  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>emb|CDP01063.1| unnamed protein product [Coffea canephora]
Length=298

 Score =   166 bits (421),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C + TAS    +R  F+ SGLRS  TD  DGT +HCWVPK  KP KPN++L+HGFGA+A
Sbjct  3    KCFNLTASAGGCFRSAFSCSGLRSTITDLGDGTTIHCWVPKSPKPTKPNVVLIHGFGADA  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            +WQ+ + +R   P FNVYVPDL+FFG S+TT P+R+E FQA+C+KR+MEA  VE+M LVG
Sbjct  63   VWQWFEAVRILTPHFNVYVPDLVFFGKSHTTRPDRSEAFQAQCLKRVMEAKSVEKMRLVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  MSYGG  127



>ref|XP_006472596.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X2 [Citrus 
sinensis]
Length=315

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            SRC SFT +++W  +  F   G RS  TD  DG+ MHCWVPK +   KP+L+L+HG GAN
Sbjct  2    SRCFSFTEAKNWCLKSCFKRLGFRSSVTDLQDGSVMHCWVPKTRNDSKPDLVLIHGLGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            A+WQ+ +I+ H +  FNVYVPDLLFFG S+TT PER+E FQA CV R+MEA  V+++SLV
Sbjct  62   ALWQWTNIIPHMIHYFNVYVPDLLFFGDSFTTRPERSESFQAECVMRVMEALSVKKLSLV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_006472595.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X1 [Citrus 
sinensis]
Length=321

 Score =   166 bits (421),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            SRC SFT +++W  +  F   G RS  TD  DG+ MHCWVPK +   KP+L+L+HG GAN
Sbjct  2    SRCFSFTEAKNWCLKSCFKRLGFRSSVTDLQDGSVMHCWVPKTRNDSKPDLVLIHGLGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            A+WQ+ +I+ H +  FNVYVPDLLFFG S+TT PER+E FQA CV R+MEA  V+++SLV
Sbjct  62   ALWQWTNIIPHMIHYFNVYVPDLLFFGDSFTTRPERSESFQAECVMRVMEALSVKKLSLV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_007205593.1| hypothetical protein PRUPE_ppa008883mg [Prunus persica]
 gb|EMJ06792.1| hypothetical protein PRUPE_ppa008883mg [Prunus persica]
Length=315

 Score =   166 bits (420),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C S TASRD  +RY F+  GL+S TTD  +GT MHCWVPK     KP LLL+HG GANAM
Sbjct  4    CFSLTASRDRCFRYSFSSHGLKSTTTDLGEGTIMHCWVPKSHSQSKPTLLLIHGIGANAM  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ + +     RFN+Y+PDL+FFG S++T P+R+E FQA+CV  L+EAHGV++MS+ GI
Sbjct  64   WQWHEFVAPLASRFNLYIPDLIFFGDSFSTRPDRSETFQAQCVVGLLEAHGVKKMSVAGI  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>ref|XP_008234133.1| PREDICTED: epoxide hydrolase 3 [Prunus mume]
Length=315

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C S TASRD  +RY F+  GL+S TTD  +GT MHCWVPK     KP LLL+HG GANAM
Sbjct  4    CFSLTASRDRCFRYSFSSHGLKSTTTDLGEGTIMHCWVPKSHSQSKPTLLLIHGIGANAM  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ + +     RFN+Y+PDL+FFG S++T P+R+E FQA+CV  L+EAHGV++MS+ GI
Sbjct  64   WQWHEFVAPLAARFNLYIPDLIFFGDSFSTRPDRSETFQAQCVVGLLEAHGVKKMSVAGI  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>ref|XP_010087617.1| hypothetical protein L484_022144 [Morus notabilis]
 gb|EXB29472.1| hypothetical protein L484_022144 [Morus notabilis]
Length=426

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 91/122 (75%), Gaps = 0/122 (0%)
 Frame = +2

Query  152  SFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQ  331
            S  A R+WY R  F+F+GL+S TTDF DGT MHCWVP+ +   KPNLLL+HGFGANAMWQ
Sbjct  6    SIAAVREWYLRRRFSFAGLKSTTTDFSDGTIMHCWVPRHRSDSKPNLLLIHGFGANAMWQ  65

Query  332  YGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISY  511
            + D +      FN+YVPDLLFFGGS TT PER++ FQA+C+  LME HGV  M + G+SY
Sbjct  66   FTDFVGPVARHFNLYVPDLLFFGGSTTTRPERSDSFQAQCIAVLMEGHGVRRMHVAGLSY  125

Query  512  GG  517
            GG
Sbjct  126  GG  127



>emb|CDP01476.1| unnamed protein product [Coffea canephora]
Length=315

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC SF++SR+  +++ F+ +GL S T D  DGT MH W+PK  K  KPNLLL+HG G N
Sbjct  2    ARCFSFSSSRNSCFKFSFSLAGLESSTKDLGDGTIMHFWIPKTHKDKKPNLLLIHGLGTN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+ + +     +FN+Y+PDLLFFG SYTT PER+E FQA+CV R MEA GV++MS+V
Sbjct  62   AMWQWDEFISPLSSKFNIYLPDLLFFGDSYTTRPERSEAFQAQCVMRTMEALGVKKMSVV  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>ref|XP_009334351.1| PREDICTED: uncharacterized protein LOC103927180 [Pyrus x bretschneideri]
Length=317

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 90/125 (72%), Gaps = 1/125 (1%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-TKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            C S T +++  +R     +GLRS  TD  DG T MHCWVP+   P KPNLLL+HG G NA
Sbjct  3    CFSLTQAKNSCHRSPSPRAGLRSAITDIKDGATTMHCWVPQSPNPSKPNLLLIHGLGLNA  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ D+LRH  P +NVYVPDL+FFG SYTT P+R++ FQA CV + MEAH V  +SLVG
Sbjct  63   MWQFADLLRHVTPHYNVYVPDLVFFGDSYTTQPDRSDSFQAECVMQAMEAHSVRRLSLVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_009588327.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X3 [Nicotiana 
tomentosiformis]
Length=309

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C S TA+++   +  F+  GLRS  TD  DGT MHCWVPK +K  +P+L+L+HGFGAN+
Sbjct  3    KCFSLTATKNRCLKSSFSSRGLRSTVTDLKDGTIMHCWVPKTRKSTRPDLVLIHGFGANS  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ + +R     FNVYVPDL+FFG SYTT P+R+E FQA CVKR+MEA+ V +MS+VG
Sbjct  63   MWQWSETVRILSRHFNVYVPDLVFFGDSYTTRPDRSESFQAECVKRVMEANSVVKMSVVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_006404949.1| hypothetical protein EUTSA_v10000245mg [Eutrema salsugineum]
 gb|ESQ46402.1| hypothetical protein EUTSA_v10000245mg [Eutrema salsugineum]
Length=326

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            + C S+ +SR+  Y+Y F+ +GLRS T+D  DGT +HCWVP+     KP LLLLHG GAN
Sbjct  2    ASCFSYVSSRNKCYQYSFSRAGLRSSTSDLGDGTVVHCWVPQTHIDTKPTLLLLHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+   +  F+PRFNVYVPDL+FFG S+TT P+R+E FQA CV ++M+AHGV  M++ 
Sbjct  62   AMWQWDRFIDRFIPRFNVYVPDLIFFGESHTTRPDRSESFQASCVMKVMDAHGVGTMTVA  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_011074186.1| PREDICTED: monoacylglycerol lipase abhd6-B [Sesamum indicum]
Length=319

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = +2

Query  122  INRSKASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLL  301
            +++SK S+C SFT+SR+   R  F  SGLR  + D  DGT MHCWVPK + P +PN++L+
Sbjct  1    MSKSK-SKCFSFTSSRNRCLRSAFTRSGLRPFSADLGDGTIMHCWVPKTRNPARPNVVLI  59

Query  302  HGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGV  481
            HGFGANA+WQ+ + +    P FNVYVPDL+FFG S +T  E +E FQARCVKR+MEA+ V
Sbjct  60   HGFGANALWQFCETVPFLAPHFNVYVPDLVFFGNSVSTRREWSESFQARCVKRVMEANSV  119

Query  482  EEMSLVGISYGG  517
            E+M+++G+SYGG
Sbjct  120  EKMAVMGLSYGG  131



>ref|XP_009588310.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X1 [Nicotiana 
tomentosiformis]
Length=317

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C S TA+++   +  F+  GLRS  TD  DGT MHCWVPK +K  +P+L+L+HGFGAN+
Sbjct  3    KCFSLTATKNRCLKSSFSSRGLRSTVTDLKDGTIMHCWVPKTRKSTRPDLVLIHGFGANS  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ + +R     FNVYVPDL+FFG SYTT P+R+E FQA CVKR+MEA+ V +MS+VG
Sbjct  63   MWQWSETVRILSRHFNVYVPDLVFFGDSYTTRPDRSESFQAECVKRVMEANSVVKMSVVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_009588318.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X2 [Nicotiana 
tomentosiformis]
Length=315

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C S TA+++   +  F+  GLRS  TD  DGT MHCWVPK +K  +P+L+L+HGFGAN+
Sbjct  3    KCFSLTATKNRCLKSSFSSRGLRSTVTDLKDGTIMHCWVPKTRKSTRPDLVLIHGFGANS  62

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+ + +R     FNVYVPDL+FFG SYTT P+R+E FQA CVKR+MEA+ V +MS+VG
Sbjct  63   MWQWSETVRILSRHFNVYVPDLVFFGDSYTTRPDRSESFQAECVKRVMEANSVVKMSVVG  122

Query  503  ISYGG  517
            +SYGG
Sbjct  123  LSYGG  127



>ref|XP_006411798.1| hypothetical protein EUTSA_v10025707mg [Eutrema salsugineum]
 gb|ESQ53251.1| hypothetical protein EUTSA_v10025707mg [Eutrema salsugineum]
Length=325

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            + C S+ +SR+  Y+Y F+ +GLRS  +D  DGT +HCWVP+     KP LLLLHG GAN
Sbjct  2    ASCFSYVSSRNKCYQYSFSRAGLRSSASDLGDGTVVHCWVPQTHIDAKPTLLLLHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+   +  F+PRFNVYVPDL+FFG S+TT P+R+E FQA CV + M+AHGV  M++ 
Sbjct  62   AMWQWDRFIDRFIPRFNVYVPDLVFFGDSHTTRPDRSESFQASCVMKAMDAHGVGTMTVA  121

Query  500  GISYGG  517
            GISYGG
Sbjct  122  GISYGG  127



>gb|KDP29699.1| hypothetical protein JCGZ_18634 [Jatropha curcas]
Length=316

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFTASRD  YRY F  +G +S TTD  DGT MHCWVPK     KP LLL+HGFGAN
Sbjct  2    AKCFSFTASRDSCYRYSFTKAGFKSCTTDLGDGTVMHCWVPKTHIQSKPALLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEA-HGVEEMSL  496
            AMWQ+   +      FN+Y+PDLLFFG SYTT PER+E FQA+CV  LM+A   V +M +
Sbjct  62   AMWQFNSFIPPLKSNFNIYIPDLLFFGDSYTTRPERSESFQAQCVMALMDAIANVSKMDI  121

Query  497  VGISYGG  517
            +G+SYGG
Sbjct  122  MGLSYGG  128



>ref|XP_009138545.1| PREDICTED: monoacylglycerol lipase ABHD6 [Brassica rapa]
Length=325

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            + C S+ + R+  Y+Y F+ +GLRS T+D  DGT +HCW+P+     KP LLLLHG GAN
Sbjct  2    ASCFSYVSCRNKCYQYSFSRAGLRSSTSDLGDGTVVHCWIPQTHVDAKPTLLLLHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+   +  F+PRFNVYVPDL+FFG S+TT P+R+E FQA CV ++M+AHGV  M++ 
Sbjct  62   AMWQWDRFIDRFIPRFNVYVPDLIFFGDSHTTRPDRSESFQASCVMKVMDAHGVGTMTVA  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_003615123.1| Leucine-rich repeat-containing protein [Medicago truncatula]
Length=1030

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C S T +R+W YR  F  +GLRS  TD  DGT MHCW+PK +   KPNLLL+HG GAN
Sbjct  2    TQCFSLTETRNWCYRSTFTGAGLRSTITDLKDGTIMHCWIPKTRTESKPNLLLIHGLGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            A+WQ+G  +R     FNVYVPDL+FFGGSYT+ PERTE FQA CV ++ME   V  +S+V
Sbjct  62   ALWQWGHFIRSLTQLFNVYVPDLVFFGGSYTSRPERTEGFQAECVMKVMEMKCVRSVSVV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_004152639.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Cucumis sativus]
 ref|XP_004162233.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Cucumis sativus]
 gb|KGN62693.1| hypothetical protein Csa_2G368940 [Cucumis sativus]
Length=303

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = +2

Query  152  SFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQ  331
            S   +++W++RY F  SGLRS  TD  DGT +HCWVPK     KPNLLL+HG GANA+WQ
Sbjct  8    SIVETKNWFHRYSFTKSGLRSTITDLKDGTTVHCWVPKNPIHTKPNLLLIHGIGANALWQ  67

Query  332  YGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISY  511
            +GD +   +P FN+Y+PDL+FFG S+TT P+RTE FQA+C+ R+MEA+ V + SLVG+SY
Sbjct  68   WGDFIPALIPYFNLYIPDLIFFGDSFTTQPDRTEWFQAQCLIRVMEANTVGKFSLVGLSY  127

Query  512  GG  517
            GG
Sbjct  128  GG  129



>ref|XP_010431977.1| PREDICTED: uncharacterized protein LOC104716284, partial [Camelina 
sativa]
Length=211

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            + C S+ +SR+  Y+Y F+ +GLRS T+D  DGT +HCW+P+     KP LLLLHG GAN
Sbjct  2    ASCFSYVSSRNKCYQYSFSRAGLRSSTSDLGDGTVLHCWIPQTHIDTKPTLLLLHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+   +  F+PRFNVYVPDL+FFG SYTT P+R+E FQA CV + M+ +GV  +++ 
Sbjct  62   AMWQWDRFIDRFIPRFNVYVPDLIFFGDSYTTRPDRSESFQASCVMKAMDGYGVGTVTVA  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>gb|KHN29048.1| Monoacylglycerol lipase ABHD6 [Glycine soja]
Length=306

 Score =   162 bits (409),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 92/124 (74%), Gaps = 6/124 (5%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C+SFTA+RD  +R+ F+ +GL+S TTD  DGT MH W PK  K  KPNLLLLHGFGANAM
Sbjct  4    CISFTATRDRCFRFTFSNAGLKSATTDLGDGTIMHWWAPKAPKDSKPNLLLLHGFGANAM  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+         RFNVYVPDL+FFG S+TT PER+E FQA+CV  L+ AHG+   S+VGI
Sbjct  64   WQWN------TRRFNVYVPDLVFFGDSHTTRPERSEAFQAQCVAALLLAHGLHTTSVVGI  117

Query  506  SYGG  517
            SYGG
Sbjct  118  SYGG  121



>gb|KFK30573.1| hypothetical protein AALP_AA7G279400 [Arabis alpina]
Length=327

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            + C S+ +SR+  Y+Y F+ +GLRS T+D  DGT +HCWVP+     KP LLLLHG GAN
Sbjct  2    TSCFSYVSSRNKCYQYSFSRAGLRSSTSDLGDGTVVHCWVPQTHIDTKPTLLLLHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+   +  F+PRFNVYVPDL+FFG SYTT  +R+E FQA CV ++M+ HGV  M++ 
Sbjct  62   AMWQWDRFIDRFIPRFNVYVPDLIFFGESYTTRSDRSESFQASCVMKVMDGHGVGTMTVA  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_010431979.1| PREDICTED: uncharacterized protein LOC104716285 isoform X2 [Camelina 
sativa]
Length=240

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            + C S+ +SR+  Y+Y F+ +GLRS T+D  DGT +HCW+P+     KP LLLLHG GAN
Sbjct  2    ASCFSYVSSRNKCYQYSFSRAGLRSSTSDLGDGTVLHCWIPQTHIDTKPTLLLLHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+   +  F+PRFNVYVPDL+FFG SYTT P+R+E FQA CV + M+ +GV  +++ 
Sbjct  62   AMWQWDRFIDRFIPRFNVYVPDLIFFGDSYTTRPDRSESFQASCVMKAMDGYGVGTVTVA  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_010534077.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Tarenaya hassleriana]
Length=305

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC S + +   YYR  F  SGL+ V+TD DDGT +HCW+PK +   KPNLLL+HG GA+
Sbjct  2    TRCFSLSEAVHGYYRSGFIKSGLQPVSTDLDDGTTIHCWIPKTRPDSKPNLLLIHGLGAS  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            A+WQ+  ++R   P FN++VPDLLFFG S TT P+R+E FQA+C+  LMEAH V   SLV
Sbjct  62   AVWQWSAVVRRLSPHFNLFVPDLLFFGASSTTRPDRSETFQAQCLMALMEAHSVRRFSLV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_010680530.1| PREDICTED: uncharacterized protein LOC104895664 [Beta vulgaris 
subsp. vulgaris]
Length=311

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SFT+SRD  Y+Y F  +GLRSVTT+  DGT MHCW PK  K  K NL+L+HG GAN
Sbjct  2    AKCFSFTSSRDSCYKYSFERAGLRSVTTNLGDGTTMHCWAPKKPKENKANLVLIHGLGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLM-EAHGVEEMSL  496
            AMWQ+   +   +P+FNVYVPDL+FFG SYTT  +RTE FQA+CV ++M     V++MS+
Sbjct  62   AMWQWDYFINPLIPKFNVYVPDLVFFGESYTTRSDRTESFQAQCVIKMMINEFCVKKMSV  121

Query  497  VGISYGG  517
             G+SYGG
Sbjct  122  CGVSYGG  128



>ref|XP_002866899.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH43158.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=326

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            + C S+ +SR+  Y+Y F+ +GLRS T+D  DGT +HCW+P+     KP LLLLHG GAN
Sbjct  2    ASCFSYVSSRNKCYQYSFSRAGLRSSTSDLGDGTVVHCWIPQSHIDTKPTLLLLHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+   +  F+PRFNVYVPDL+FFG SYTT P+R+E FQA CV + M+ +GV  M++ 
Sbjct  62   AMWQWDRFIDRFIPRFNVYVPDLIFFGDSYTTRPDRSESFQASCVMKAMDGYGVRTMTVA  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|NP_568075.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
 gb|ABJ98559.1| At4g39955 [Arabidopsis thaliana]
 gb|AEE87145.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana]
Length=328

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            + C S+ +SR+  Y+Y F+ +GLRS T+D  DGT  HCW+P      KP LLLLHG GAN
Sbjct  2    ASCFSYVSSRNKCYQYSFSRAGLRSSTSDLGDGTVFHCWIPLTHIHTKPTLLLLHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+   +  F+PRFNVYVPDL+FFG SYTT P+R+E FQA CV + M+A+GV  M++ 
Sbjct  62   AMWQWDRFIDRFIPRFNVYVPDLIFFGDSYTTRPDRSESFQATCVMKAMDAYGVRTMTVA  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>gb|AAM61205.1| putative hydrolase [Arabidopsis thaliana]
Length=328

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            + C S+ +SR+  Y+Y F+ +GLRS T+D  DGT  HCW+P      KP LLLLHG GAN
Sbjct  2    ASCFSYVSSRNKCYQYSFSRAGLRSSTSDLGDGTVFHCWIPLTHIHTKPTLLLLHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+   +  F+PRFNVYVPDL+FFG SYTT P+R+E FQA CV + M+A+GV  M++ 
Sbjct  62   AMWQWDRFIDRFIPRFNVYVPDLIFFGDSYTTRPDRSESFQATCVMKAMDAYGVRTMTVA  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_004490376.1| PREDICTED: 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate 
hydrolase-like [Cicer arietinum]
Length=302

 Score =   160 bits (406),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C S T +R+  +R  F  SGLRS TTD  DGT MHCWVPK +   KP+LLL+HG G N
Sbjct  2    TKCFSLTETRNRCHRSKFTGSGLRSTTTDLKDGTIMHCWVPKTRTESKPSLLLIHGIGPN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLM-EAHGVEEMSL  496
            A+WQ+G+ +R+    FNVYVPDL+FFGGSYTT PERTE FQA CV R+M E   V  +S+
Sbjct  62   ALWQWGNFIRNLTKFFNVYVPDLIFFGGSYTTRPERTEGFQAECVMRVMKEMKCVRSVSV  121

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  122  VGLSYGG  128



>ref|XP_010027907.1| PREDICTED: uncharacterized protein LOC104418304 [Eucalyptus grandis]
 gb|KCW54544.1| hypothetical protein EUGRSUZ_I00504 [Eucalyptus grandis]
Length=316

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 95/127 (75%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFD-DGTKMHCWVPKVQKPGKPNLLLLHGFGA  316
            ++C SF+A+ D + R+ ++  GL+S TTD   DGT MHCWVPK  KP KPNLLL+HG GA
Sbjct  2    AKCFSFSATYDRWLRFSYSRMGLKSTTTDLSGDGTVMHCWVPKTYKPNKPNLLLVHGLGA  61

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            + MWQ+   +  F+ RFNVYVPDLLFFG SYT  PERTE+FQA+CV  +++A GV + ++
Sbjct  62   SGMWQWNAFVSRFIERFNVYVPDLLFFGDSYTNRPERTEQFQAQCVAGVLKAEGVRKTAV  121

Query  497  VGISYGG  517
            VG SYGG
Sbjct  122  VGESYGG  128



>gb|EPS57377.1| hypothetical protein M569_17440, partial [Genlisea aurea]
Length=294

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 94/124 (76%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C S  ASR+   +  F++SGLR    D  DGT M+CW+PK + P +PN++L+HGFGANA+
Sbjct  1    CFSLVASRNRCLKISFSYSGLRPSMADLGDGTVMNCWLPKKRIPTRPNVVLIHGFGANAL  60

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ D +     RFNVYVPDLLFFG S+TT PER++ FQA+CVKR +EA+GV+++ L+G+
Sbjct  61   WQFSDAVPPLAARFNVYVPDLLFFGKSFTTRPERSDAFQAQCVKRALEAYGVDKVILLGL  120

Query  506  SYGG  517
            SYGG
Sbjct  121  SYGG  124



>ref|XP_010431978.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X1 [Camelina 
sativa]
Length=263

 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            + C S+ +SR+  Y+Y F+ +GLRS T+D  DGT +HCW+P+     KP LLLLHG GAN
Sbjct  2    ASCFSYVSSRNKCYQYSFSRAGLRSSTSDLGDGTVLHCWIPQTHIDTKPTLLLLHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+   +  F+PRFNVYVPDL+FFG SYTT P+R+E FQA CV + M+ +GV  +++ 
Sbjct  62   AMWQWDRFIDRFIPRFNVYVPDLIFFGDSYTTRPDRSESFQASCVMKAMDGYGVGTVTVA  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_004300648.1| PREDICTED: monoacylglycerol lipase abhd6-A-like, partial [Fragaria 
vesca subsp. vesca]
Length=314

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 87/129 (67%), Gaps = 1/129 (1%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDG-TKMHCWVPKVQKPGKPNLLLLHGF  310
            K   C SF  S++  +R  F  +GL S  TD +DG T MHCWVP      KPNLLLLHG 
Sbjct  1    KTMPCFSFAESKNSCFRSNFIRAGLCSTLTDLNDGGTTMHCWVPISPNSSKPNLLLLHGL  60

Query  311  GANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEM  490
            G NAMWQ+ D++ H  P FNVYVPDLLFFG S T  P+R+E FQA CV R+MEAH V   
Sbjct  61   GPNAMWQFADLIHHVTPHFNVYVPDLLFFGDSSTARPDRSESFQAECVMRVMEAHSVRVF  120

Query  491  SLVGISYGG  517
            SLVG+SYGG
Sbjct  121  SLVGLSYGG  129



>ref|XP_006284174.1| hypothetical protein CARUB_v10005320mg [Capsella rubella]
 gb|EOA17072.1| hypothetical protein CARUB_v10005320mg [Capsella rubella]
Length=306

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            + C S+ +SR+  Y+Y F+ +GLRS T+D  DGT +HCW+P+     KP LLLLHG GAN
Sbjct  2    ASCFSYVSSRNKCYQYSFSRAGLRSSTSDLGDGTVLHCWIPQTHIDSKPTLLLLHGIGAN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQ+   +  F+ RFNVYVPDLLFFG SYTT P+RTE FQA CV + M+ +GV  M++ 
Sbjct  62   AMWQWDRFIDRFIRRFNVYVPDLLFFGDSYTTRPDRTESFQASCVMKAMDGYGVGTMTVA  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GLSYGG  127



>ref|XP_010041675.1| PREDICTED: uncharacterized protein LOC104430621 [Eucalyptus grandis]
 gb|KCW44179.1| hypothetical protein EUGRSUZ_L02400 [Eucalyptus grandis]
Length=316

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 94/127 (74%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFD-DGTKMHCWVPKVQKPGKPNLLLLHGFGA  316
            + C SF+ + D + R+ +++ GL+S TTD   DGT MHCWVPK  KP KPNLLL+HG GA
Sbjct  2    AECFSFSGTYDRWLRFSYSWMGLKSTTTDLSGDGTVMHCWVPKTYKPNKPNLLLVHGLGA  61

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            + MWQ+   +  F+ RFNVYVPDLLFFG SYT  PERTE+FQA+CV  +++A GV + ++
Sbjct  62   SGMWQWNAFVSRFIERFNVYVPDLLFFGDSYTNRPERTEQFQAQCVAGVLKAEGVRKTAV  121

Query  497  VGISYGG  517
            VG SYGG
Sbjct  122  VGASYGG  128



>emb|CAN66985.1| hypothetical protein VITISV_009675 [Vitis vinifera]
Length=206

 Score =   157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 89/126 (71%), Gaps = 21/126 (17%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C SF ASRDW+YRY F  +GLR                       KPNL+L+HGFGAN
Sbjct  2    AKCFSFAASRDWWYRYSFTSAGLRQT---------------------KPNLVLVHGFGAN  40

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMWQYG +LRHF+ RFN+YVPDLLFFG S+TT PERTE FQA CV ++ME HGV +M+LV
Sbjct  41   AMWQYGYLLRHFIQRFNIYVPDLLFFGRSFTTRPERTEAFQAECVMKMMETHGVRKMNLV  100

Query  500  GISYGG  517
            G+SYGG
Sbjct  101  GVSYGG  106



>gb|KCW54547.1| hypothetical protein EUGRSUZ_I00506 [Eucalyptus grandis]
Length=250

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFD-DGTKMHCWVPKVQKPGKPNLLLLHGFGA  316
            + C SF+ + D + R+ ++  GL+S TTD   DGT MHCWVPK  KP KPNLLL+HG GA
Sbjct  2    AECFSFSGTYDRWLRFSYSRMGLKSTTTDLSGDGTVMHCWVPKTYKPNKPNLLLVHGLGA  61

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            + MWQ+   +  F+ RFNVYVPDLLFFG SYT  PERTE+FQA+CV  +++A GV + ++
Sbjct  62   SGMWQWNAFVSRFIERFNVYVPDLLFFGDSYTNRPERTEQFQAQCVAGVLKAEGVRKTAV  121

Query  497  VGISYGG  517
            VG SYGG
Sbjct  122  VGASYGG  128



>ref|XP_010087616.1| Uncharacterized protein L484_022143 [Morus notabilis]
 gb|EXB29471.1| Uncharacterized protein L484_022143 [Morus notabilis]
Length=318

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 89/124 (72%), Gaps = 2/124 (2%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            CLS  A  DWY R  F+ +GL+  TTD  DGT MHCWVP+ +   KPNLLL+HG GANAM
Sbjct  6    CLS--AVYDWYLRCRFSMAGLKPTTTDLGDGTIMHCWVPRKRADSKPNLLLIHGIGANAM  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ D +   V  FN+Y+PDL+F+G S+TT PER+E F ARCV  LMEA GV  M +VG+
Sbjct  64   WQFSDFVSPLVGHFNLYIPDLVFYGASWTTRPERSESFHARCVAVLMEAQGVRRMHVVGL  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>ref|XP_003552813.1| PREDICTED: monoacylglycerol lipase ABHD6 [Glycine max]
Length=340

 Score =   159 bits (403),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = +2

Query  131  SKASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGF  310
            S + RCLSFT  RD Y RY F+ +GL+S TTD  DGT MHCW PK       +LLL+HG 
Sbjct  3    SSSRRCLSFTTWRDRYLRYSFSRAGLKSTTTDLGDGTIMHCWAPKAHNHSTTSLLLIHGI  62

Query  311  GANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEM  490
            GANA WQ+   +      FNVYVPDLLFFG S+TT PER+E FQA+CV  L+EA GV + 
Sbjct  63   GANATWQWNHFISPLTRHFNVYVPDLLFFGDSHTTRPERSEWFQAKCVMALLEALGVRQT  122

Query  491  SLVGISYGG  517
            S+VG+SYGG
Sbjct  123  SVVGLSYGG  131



>gb|KEH20809.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=283

 Score =   158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C SFTAS D  YR+ F+ +GL+S TT   + T MHCWVPK  KP KP+LLLLHG GANAM
Sbjct  4    CFSFTASHDRCYRFSFSNTGLKSTTTGLGNTTIMHCWVPKSHKPNKPSLLLLHGMGANAM  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ + +     RFN+YVPDLLFFG ++T+ P RTE FQA+CV  LMEAH    M++VG 
Sbjct  64   WQWNEFISQLTRRFNIYVPDLLFFGEAHTSKPNRTESFQAQCVAALMEAHCARRMNVVGD  123

Query  506  SYGG  517
               G
Sbjct  124  MENG  127



>ref|XP_010027906.1| PREDICTED: uncharacterized protein LOC104418301 [Eucalyptus grandis]
 gb|KCW54546.1| hypothetical protein EUGRSUZ_I00506 [Eucalyptus grandis]
Length=316

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFD-DGTKMHCWVPKVQKPGKPNLLLLHGFGA  316
            + C SF+ + D + R+ ++  GL+S TTD   DGT MHCWVPK  KP KPNLLL+HG GA
Sbjct  2    AECFSFSGTYDRWLRFSYSRMGLKSTTTDLSGDGTVMHCWVPKTYKPNKPNLLLVHGLGA  61

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            + MWQ+   +  F+ RFNVYVPDLLFFG SYT  PERTE+FQA+CV  +++A GV + ++
Sbjct  62   SGMWQWNAFVSRFIERFNVYVPDLLFFGDSYTNRPERTEQFQAQCVAGVLKAEGVRKTAV  121

Query  497  VGISYGG  517
            VG SYGG
Sbjct  122  VGASYGG  128



>ref|XP_004143463.1| PREDICTED: 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate 
hydrolase-like [Cucumis sativus]
 ref|XP_004167032.1| PREDICTED: 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate 
hydrolase-like [Cucumis sativus]
 gb|KGN48741.1| hypothetical protein Csa_6G499850 [Cucumis sativus]
Length=317

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C S+ +  D +YR  F+  GL S TTD  +GT MHCW+PK  K  KPNL+L+HG GANA
Sbjct  4    QCFSYGSIMDAWYRSCFSRVGLTSATTDLGNGTVMHCWIPKTPKETKPNLVLIHGMGANA  63

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+   +R  V  FN+YVPDL+FFG SYTTL +R+E FQARCV  +++AHGV   + VG
Sbjct  64   MWQWNQFVRPLVSHFNIYVPDLVFFGESYTTLSDRSEAFQARCVMGVLDAHGVRTTNAVG  123

Query  503  ISYGG  517
            +SYGG
Sbjct  124  VSYGG  128



>ref|XP_008440587.1| PREDICTED: epoxide hydrolase 4-like [Cucumis melo]
Length=317

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            +C S+ +  + +YR  F+  GL+S TTD  +GT MHCW+PK  K  KPNL+L+HG GANA
Sbjct  4    QCFSYGSIMEAWYRSCFSRVGLKSATTDLGNGTVMHCWIPKTPKQTKPNLVLIHGMGANA  63

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+   +R  +  FN+YVPDL+FFG SYTTL +R+E FQARCV  +++AHGV   + VG
Sbjct  64   MWQWNQFVRPLITHFNIYVPDLVFFGESYTTLSDRSEAFQARCVMGVLDAHGVRTTNAVG  123

Query  503  ISYGG  517
            ISYGG
Sbjct  124  ISYGG  128



>ref|XP_010535465.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X2 [Tarenaya 
hassleriana]
Length=345

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFG  313
            + +RC S + +   ++R  F  SGLR V+TD +DGT +HCWVPK +   KPNLLL+HG G
Sbjct  36   QMTRCFSLSVAVHGHFRSGFIKSGLRPVSTDLNDGTIVHCWVPKTRPDSKPNLLLIHGLG  95

Query  314  ANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMS  493
            A ++WQ+  ++R   P FNV+VPDLLFFGG+ TT PER+E FQA+C+  LMEA  V+  S
Sbjct  96   ATSVWQWSAVVRRLSPHFNVFVPDLLFFGGASTTRPERSESFQAQCLMALMEALSVKRFS  155

Query  494  LVGISYGG  517
            LVG+SYGG
Sbjct  156  LVGLSYGG  163



>ref|XP_010535457.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X1 [Tarenaya 
hassleriana]
Length=358

 Score =   157 bits (398),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFG  313
            + +RC S + +   ++R  F  SGLR V+TD +DGT +HCWVPK +   KPNLLL+HG G
Sbjct  36   QMTRCFSLSVAVHGHFRSGFIKSGLRPVSTDLNDGTIVHCWVPKTRPDSKPNLLLIHGLG  95

Query  314  ANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMS  493
            A ++WQ+  ++R   P FNV+VPDLLFFGG+ TT PER+E FQA+C+  LMEA  V+  S
Sbjct  96   ATSVWQWSAVVRRLSPHFNVFVPDLLFFGGASTTRPERSESFQAQCLMALMEALSVKRFS  155

Query  494  LVGISYGG  517
            LVG+SYGG
Sbjct  156  LVGLSYGG  163



>ref|XP_010030445.1| PREDICTED: uncharacterized protein LOC104420275 [Eucalyptus grandis]
Length=253

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C S +A+ D + R+ F+ +GL+S TTD  +GT MHCWVPK  KP KPNLLLLHG G  
Sbjct  2    AKCFSLSATYDRWCRFSFSRAGLKSTTTDLGEGTVMHCWVPKTYKPNKPNLLLLHGLGPT  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
             +W +   +  F+ RFNVYVPDLLFFG SYTT PE TE FQA+CV   +++ GV + ++V
Sbjct  62   GLWTWNMFISRFIERFNVYVPDLLFFGESYTTRPEWTEHFQAQCVAGALKSQGVTKTNVV  121

Query  500  GISYGG  517
            G SYGG
Sbjct  122  GPSYGG  127



>ref|XP_010030446.1| PREDICTED: uncharacterized protein LOC104420276 [Eucalyptus grandis]
 gb|KCW54548.1| hypothetical protein EUGRSUZ_I00507 [Eucalyptus grandis]
Length=306

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++  SF A+ + ++R+ F+++GL+  T D  DGT +HCWVPK  +P KP+LLLLHG G N
Sbjct  2    TKYFSFAATCNRWFRFSFSWAGLKPTTIDLGDGTVVHCWVPKTYEPNKPDLLLLHGLGVN  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            AMW + + +  F+  FNVYVPDLLFFG SYT  PERTE+FQA+C+  ++E  GV + ++V
Sbjct  62   AMWNWNEFISSFIAGFNVYVPDLLFFGDSYTVRPERTEQFQAQCIAGVLEDQGVRKTNVV  121

Query  500  GISYGG  517
            G+SYGG
Sbjct  122  GMSYGG  127



>gb|KHN33529.1| Monoacylglycerol lipase ABHD6 [Glycine soja]
Length=282

 Score =   152 bits (385),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +2

Query  245  MHCWVPKVQKPGKPNLLLLHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPE  424
            MHCWVPK+ KP KP+L+L+HGFGANAMWQYG+ +RHF+  FNVYVPDL+FFG S+T+ PE
Sbjct  1    MHCWVPKMHKPCKPSLVLVHGFGANAMWQYGEHIRHFMGHFNVYVPDLVFFGESFTSRPE  60

Query  425  RTEEFQARCVKRLMEAHGVEEMSLVGISYGG  517
            R+E FQA CV ++MEAHGV +MSLVGISYGG
Sbjct  61   RSESFQAECVVKMMEAHGVHKMSLVGISYGG  91



>gb|KCW54543.1| hypothetical protein EUGRSUZ_I00503 [Eucalyptus grandis]
Length=311

 Score =   153 bits (386),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++C S +A+ D + R+ F+ +GL+S TTD  +GT MHCWVPK  KP KPNLLLLHG G  
Sbjct  2    AKCFSLSATYDRWCRFSFSRAGLKSTTTDLGEGTVMHCWVPKTYKPNKPNLLLLHGLGPT  61

Query  320  AMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
             +W +   +  F+ RFNVYVPDLLFFG SYTT PE TE FQA+CV   +++ GV + ++V
Sbjct  62   GLWTWNMFISRFIERFNVYVPDLLFFGESYTTRPEWTEHFQAQCVAGALKSQGVTKTNVV  121

Query  500  GISYGG  517
            G SYGG
Sbjct  122  GPSYGG  127



>gb|ABR18124.1| unknown [Picea sitchensis]
Length=298

 Score =   150 bits (378),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 90/124 (73%), Gaps = 1/124 (1%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C SFTAS +  +R +FA +G++S   + DDGT MHCWVPK +   KP L+L+HG GANAM
Sbjct  4    CFSFTASGNRCFRIYFASAGMKSKQIELDDGTTMHCWVPK-KTSNKPALILIHGLGANAM  62

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+   LR F   FN+YVPDLLFFG S+TT PE+TE FQ++CV +L+E  GV +  + G+
Sbjct  63   WQWSSQLRPFRRHFNLYVPDLLFFGRSFTTRPEKTELFQSQCVMKLVEKLGVSKFHVAGV  122

Query  506  SYGG  517
            SYGG
Sbjct  123  SYGG  126



>emb|CDX88427.1| BnaC06g38710D [Brassica napus]
Length=315

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C SF+   +  YRY F  SG+R VT D  DGT +H WV K +   KPNLLL+HG GA+A+
Sbjct  4    CFSFSEVIEGAYRYGFKRSGIRPVTIDLKDGTVVHFWVSKTRDESKPNLLLIHGLGASAI  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ D+ R   P FN+++PDL+FFGGS TT PER++ FQA+ + R +EA  V+  SLVG+
Sbjct  64   WQWYDVARRLSPHFNLFIPDLVFFGGSSTTRPERSDVFQAQTLMRALEAQSVKRFSLVGL  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>ref|XP_009106526.1| PREDICTED: uncharacterized protein LOC103832304 [Brassica rapa]
Length=315

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C SF+   +  Y+Y F  SGLR VT D  DGT +H WV K +   KPNLLL+HG GA+A+
Sbjct  4    CFSFSEVIERVYKYGFKRSGLRPVTIDLKDGTVVHFWVSKTRDESKPNLLLIHGLGASAI  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ D+ R   P FN+++PDL+FFGGS TT PER++ FQA+ + R +EA  V+  SLVG+
Sbjct  64   WQWYDVARRLSPHFNLFIPDLVFFGGSSTTRPERSDVFQAQTLMRALEAQSVKRFSLVGL  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>emb|CDX87465.1| BnaA07g34080D [Brassica napus]
Length=315

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C SF+   +  Y+Y F  SGLR VT D  DGT +H WV K +   KPNLLL+HG GA+A+
Sbjct  4    CFSFSEVIERAYKYGFKRSGLRPVTIDLKDGTVVHFWVSKTRDESKPNLLLIHGLGASAI  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ D+ R   P FN+++PDL+FFGGS TT PER++ FQA+ + R +EA  V+  SLVG+
Sbjct  64   WQWYDVARRLSPHFNLFIPDLVFFGGSSTTRPERSDVFQAQTLMRALEAQSVKRFSLVGL  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>ref|XP_008781874.1| PREDICTED: uncharacterized protein LOC103701544 isoform X3 [Phoenix 
dactylifera]
Length=310

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 87/127 (69%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RCLSFTA+RD  Y   F+ +GLRS  T   DG  +HCWVPK   P +P LLL+HGFGAN
Sbjct  2    ARCLSFTAARDRCYDRNFSAAGLRSTATVLGDGATVHCWVPKSPDPARPPLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            A WQ+   +R F+   F++Y+PDLLFFGGS    P+R++ +QARC+   MEA GV    +
Sbjct  62   AKWQWAGYVRPFLRSGFDLYIPDLLFFGGSEAPGPDRSDAYQARCLAAAMEALGVRRFGV  121

Query  497  VGISYGG  517
            VG SYGG
Sbjct  122  VGNSYGG  128



>ref|XP_008781871.1| PREDICTED: uncharacterized protein LOC103701544 isoform X1 [Phoenix 
dactylifera]
Length=348

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 87/127 (69%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RCLSFTA+RD  Y   F+ +GLRS  T   DG  +HCWVPK   P +P LLL+HGFGAN
Sbjct  2    ARCLSFTAARDRCYDRNFSAAGLRSTATVLGDGATVHCWVPKSPDPARPPLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            A WQ+   +R F+   F++Y+PDLLFFGGS    P+R++ +QARC+   MEA GV    +
Sbjct  62   AKWQWAGYVRPFLRSGFDLYIPDLLFFGGSEAPGPDRSDAYQARCLAAAMEALGVRRFGV  121

Query  497  VGISYGG  517
            VG SYGG
Sbjct  122  VGNSYGG  128



>ref|XP_008781873.1| PREDICTED: uncharacterized protein LOC103701544 isoform X2 [Phoenix 
dactylifera]
Length=346

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 87/127 (69%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RCLSFTA+RD  Y   F+ +GLRS  T   DG  +HCWVPK   P +P LLL+HGFGAN
Sbjct  2    ARCLSFTAARDRCYDRNFSAAGLRSTATVLGDGATVHCWVPKSPDPARPPLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            A WQ+   +R F+   F++Y+PDLLFFGGS    P+R++ +QARC+   MEA GV    +
Sbjct  62   AKWQWAGYVRPFLRSGFDLYIPDLLFFGGSEAPGPDRSDAYQARCLAAAMEALGVRRFGV  121

Query  497  VGISYGG  517
            VG SYGG
Sbjct  122  VGNSYGG  128



>gb|KFK42211.1| hypothetical protein AALP_AA2G225700 [Arabis alpina]
Length=319

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 91/133 (68%), Gaps = 8/133 (6%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPG-------KPNLLL  298
            + C S + + +  Y + F  SGLR VT D  DGT +H WV K  KPG       KPNLLL
Sbjct  2    TSCFSLSEAIERTYEFGFKRSGLRPVTIDLKDGTIVHFWVTKT-KPGSKSKPKPKPNLLL  60

Query  299  LHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            +HG GA A+WQ+ D++R+  P FN+YVPDL+FFGGS TT PER++ FQA+ + R +EA  
Sbjct  61   IHGLGATAIWQWYDVVRNLSPHFNIYVPDLVFFGGSSTTRPERSDVFQAQTLMRALEAQS  120

Query  479  VEEMSLVGISYGG  517
            V++ SLVG+SYGG
Sbjct  121  VKKFSLVGLSYGG  133



>gb|EPS60389.1| hypothetical protein M569_14412, partial [Genlisea aurea]
Length=301

 Score =   140 bits (352),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 89/128 (70%), Gaps = 0/128 (0%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFG  313
            K S+ LS TA R+W+ +  F   GLRSV  D  DGT M+CW+P+   P  PNL L+HGFG
Sbjct  1    KMSKFLSPTALRNWWLKASFYSLGLRSVVKDIGDGTVMNCWLPREPDPDLPNLFLIHGFG  60

Query  314  ANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMS  493
            +N++WQ+   +R  + RFN+Y+PDL+FFG S +  P+R+  FQA  VKRL E + V++M 
Sbjct  61   SNSLWQFHATVRLLIDRFNIYLPDLIFFGESTSARPDRSIAFQAESVKRLAELNSVDKMV  120

Query  494  LVGISYGG  517
            ++G+SYGG
Sbjct  121  VLGLSYGG  128



>ref|XP_009380208.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=310

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 82/126 (65%), Gaps = 1/126 (1%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            RCLSFT +RD  YR  F  +GLR  +T   DG  +HCWVP    P +P LLLLHGFGA A
Sbjct  3    RCLSFTVARDRCYRRAFLSAGLRPSSTALADGATVHCWVPARPDPSRPPLLLLHGFGATA  62

Query  323  MWQYGDILRHFV-PRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            +WQ+   LR  +   F++YVPDLLFFG S    P+R+E +QA C+   MEA GV    L+
Sbjct  63   IWQWSAYLRPLLRAGFDLYVPDLLFFGASKALGPDRSESYQASCIAAAMEAAGVRRFGLM  122

Query  500  GISYGG  517
            G+SYGG
Sbjct  123  GVSYGG  128



>ref|XP_006390007.1| hypothetical protein EUTSA_v10018907mg [Eutrema salsugineum]
 gb|ESQ27293.1| hypothetical protein EUTSA_v10018907mg [Eutrema salsugineum]
Length=313

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C SF+ + +  Y+  F  SGLR VT D  DGT ++ WV K +   KPNLLL+HG GA A+
Sbjct  4    CFSFSEAIERTYKSGFKRSGLRPVTIDLKDGTVVNFWVSKNRPESKPNLLLIHGLGATAI  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGI  505
            WQ+ D+ R   P FN+++PDL+FFGGS TT PER++ FQA+ + R +EA  V+  SLVG+
Sbjct  64   WQWYDVARRLSPHFNLFIPDLVFFGGSSTTRPERSDIFQAQTLMRALEAQSVKRFSLVGL  123

Query  506  SYGG  517
            SYGG
Sbjct  124  SYGG  127



>ref|XP_010916850.1| PREDICTED: uncharacterized protein LOC105041603 [Elaeis guineensis]
Length=310

 Score =   137 bits (346),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 82/127 (65%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RCLSFTA+RD  Y   F+ +GLR   T   DG  +HCW PK   PG   LLL+HGFGAN
Sbjct  2    ARCLSFTAARDRCYDRNFSAAGLRPTATVLGDGATVHCWAPKSPDPGHSPLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            A WQ+   LR  +   F++YVPDLLFFGGS    P+R+E +QARC+   MEA G     +
Sbjct  62   AKWQWAGYLRPLLRSGFDLYVPDLLFFGGSEAPRPDRSEAYQARCLAAAMEALGARRFGV  121

Query  497  VGISYGG  517
            VG SYGG
Sbjct  122  VGNSYGG  128



>ref|XP_009380207.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=347

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 82/126 (65%), Gaps = 1/126 (1%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            RCLSFT +RD  YR  F  +GLR  +T   DG  +HCWVP    P +P LLLLHGFGA A
Sbjct  3    RCLSFTVARDRCYRRAFLSAGLRPSSTALADGATVHCWVPARPDPSRPPLLLLHGFGATA  62

Query  323  MWQYGDILRHFV-PRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            +WQ+   LR  +   F++YVPDLLFFG S    P+R+E +QA C+   MEA GV    L+
Sbjct  63   IWQWSAYLRPLLRAGFDLYVPDLLFFGASKALGPDRSESYQASCIAAAMEAAGVRRFGLM  122

Query  500  GISYGG  517
            G+SYGG
Sbjct  123  GVSYGG  128



>ref|XP_004288186.1| PREDICTED: lipase 3-like [Fragaria vesca subsp. vesca]
Length=316

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAM  325
            C S  ASRD  +R  F+ +GL+S TTD  +GT +H WVPK   P KP LLL+HG GANAM
Sbjct  4    CFSLIASRDSCFRSSFSSAGLKSTTTDLGEGTIIHSWVPKHPSPSKPTLLLIHGIGANAM  63

Query  326  WQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVE-EMSLVG  502
            WQ+ + +     RFN+YVPDL+FFG SY++  ER+E FQA+C+  LMEAH V+ +M + G
Sbjct  64   WQWHEFITPLTSRFNLYVPDLIFFGDSYSSRSERSETFQAQCIMGLMEAHDVKGKMHVAG  123

Query  503  ISYGG  517
            ISYGG
Sbjct  124  ISYGG  128



>ref|XP_007047915.1| Alpha/beta-Hydrolases superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOX92072.1| Alpha/beta-Hydrolases superfamily protein isoform 3 [Theobroma 
cacao]
Length=279

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +2

Query  245  MHCWVPKVQKPGKPNLLLLHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPE  424
            MH W PK     KP L+L+HG GANAMWQ+ D +   + RFNVYVPDLLFFG SYTT PE
Sbjct  1    MHVWAPKAHIQSKPTLVLIHGIGANAMWQWNDFVSPLMSRFNVYVPDLLFFGESYTTRPE  60

Query  425  RTEEFQARCVKRLMEAHGVEEMSLVGISYGG  517
            R+E+FQA+CV R+M+A+GV  MS+VGISYGG
Sbjct  61   RSEQFQAQCVMRVMDAYGVTVMSVVGISYGG  91



>ref|XP_007047914.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX92071.1| Alpha/beta-Hydrolases superfamily protein isoform 2 [Theobroma 
cacao]
Length=289

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +2

Query  245  MHCWVPKVQKPGKPNLLLLHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPE  424
            MH W PK     KP L+L+HG GANAMWQ+ D +   + RFNVYVPDLLFFG SYTT PE
Sbjct  1    MHVWAPKAHIQSKPTLVLIHGIGANAMWQWNDFVSPLMSRFNVYVPDLLFFGESYTTRPE  60

Query  425  RTEEFQARCVKRLMEAHGVEEMSLVGISYGG  517
            R+E+FQA+CV R+M+A+GV  MS+VGISYGG
Sbjct  61   RSEQFQAQCVMRVMDAYGVTVMSVVGISYGG  91



>ref|XP_010926315.1| PREDICTED: monoacylglycerol lipase abhd6-B-like isoform X7 [Elaeis 
guineensis]
Length=295

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 82/127 (65%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC+SFTA RD  Y + F  +GLR   T   DG  +H W P+   P +P LLL+HGFGAN
Sbjct  2    TRCVSFTAFRDRCYDHTFYAAGLRPTNTVLGDGATVHFWAPRSPNPARPPLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            A WQ+   LR  +   F++YVPDLLFFGGS    P+R+E +QARC+   ME  GV    +
Sbjct  62   AKWQWAGYLRPLLRSGFDLYVPDLLFFGGSEAPGPDRSETYQARCLAAAMEVAGVRRFGV  121

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  122  VGVSYGG  128



>ref|XP_010926314.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X6 [Elaeis 
guineensis]
Length=310

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 82/127 (65%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC+SFTA RD  Y + F  +GLR   T   DG  +H W P+   P +P LLL+HGFGAN
Sbjct  2    TRCVSFTAFRDRCYDHTFYAAGLRPTNTVLGDGATVHFWAPRSPNPARPPLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            A WQ+   LR  +   F++YVPDLLFFGGS    P+R+E +QARC+   ME  GV    +
Sbjct  62   AKWQWAGYLRPLLRSGFDLYVPDLLFFGGSEAPGPDRSETYQARCLAAAMEVAGVRRFGV  121

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  122  VGVSYGG  128



>ref|XP_010926311.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X5 [Elaeis 
guineensis]
 ref|XP_010926313.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X5 [Elaeis 
guineensis]
Length=322

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 82/127 (65%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC+SFTA RD  Y + F  +GLR   T   DG  +H W P+   P +P LLL+HGFGAN
Sbjct  2    TRCVSFTAFRDRCYDHTFYAAGLRPTNTVLGDGATVHFWAPRSPNPARPPLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            A WQ+   LR  +   F++YVPDLLFFGGS    P+R+E +QARC+   ME  GV    +
Sbjct  62   AKWQWAGYLRPLLRSGFDLYVPDLLFFGGSEAPGPDRSETYQARCLAAAMEVAGVRRFGV  121

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  122  VGVSYGG  128



>ref|XP_010926310.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X4 [Elaeis 
guineensis]
Length=323

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 82/127 (65%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC+SFTA RD  Y + F  +GLR   T   DG  +H W P+   P +P LLL+HGFGAN
Sbjct  2    TRCVSFTAFRDRCYDHTFYAAGLRPTNTVLGDGATVHFWAPRSPNPARPPLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            A WQ+   LR  +   F++YVPDLLFFGGS    P+R+E +QARC+   ME  GV    +
Sbjct  62   AKWQWAGYLRPLLRSGFDLYVPDLLFFGGSEAPGPDRSETYQARCLAAAMEVAGVRRFGV  121

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  122  VGVSYGG  128



>ref|XP_010926309.1| PREDICTED: monoacylglycerol lipase abhd6-B-like isoform X3 [Elaeis 
guineensis]
Length=346

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 82/127 (65%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC+SFTA RD  Y + F  +GLR   T   DG  +H W P+   P +P LLL+HGFGAN
Sbjct  2    TRCVSFTAFRDRCYDHTFYAAGLRPTNTVLGDGATVHFWAPRSPNPARPPLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            A WQ+   LR  +   F++YVPDLLFFGGS    P+R+E +QARC+   ME  GV    +
Sbjct  62   AKWQWAGYLRPLLRSGFDLYVPDLLFFGGSEAPGPDRSETYQARCLAAAMEVAGVRRFGV  121

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  122  VGVSYGG  128



>ref|XP_006302572.1| hypothetical protein CARUB_v10020680mg [Capsella rubella]
 gb|EOA35470.1| hypothetical protein CARUB_v10020680mg [Capsella rubella]
Length=315

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 87/127 (69%), Gaps = 4/127 (3%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQ---KPGKPNLLLLHGFGA  316
            C S + + +  Y+  F  SGLR VT D  DGT ++ WV K Q   KP KPNLLL+HG GA
Sbjct  4    CFSLSEAIERTYKSGFKRSGLRPVTIDLKDGTVVNFWVSKTQPDSKP-KPNLLLIHGLGA  62

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
             A+WQ+ D+ R     FN+Y+PDL+FFGGS TT PER++ FQA+ + R +EA  V++ SL
Sbjct  63   TAIWQWYDVARRLSRHFNLYIPDLVFFGGSSTTRPERSDIFQAQTLMRALEAQSVKKFSL  122

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  123  VGLSYGG  129



>ref|XP_010926308.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X2 [Elaeis 
guineensis]
Length=348

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 82/127 (65%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC+SFTA RD  Y + F  +GLR   T   DG  +H W P+   P +P LLL+HGFGAN
Sbjct  2    TRCVSFTAFRDRCYDHTFYAAGLRPTNTVLGDGATVHFWAPRSPNPARPPLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            A WQ+   LR  +   F++YVPDLLFFGGS    P+R+E +QARC+   ME  GV    +
Sbjct  62   AKWQWAGYLRPLLRSGFDLYVPDLLFFGGSEAPGPDRSETYQARCLAAAMEVAGVRRFGV  121

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  122  VGVSYGG  128



>ref|XP_010926307.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X1 [Elaeis 
guineensis]
Length=361

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 82/127 (65%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            +RC+SFTA RD  Y + F  +GLR   T   DG  +H W P+   P +P LLL+HGFGAN
Sbjct  2    TRCVSFTAFRDRCYDHTFYAAGLRPTNTVLGDGATVHFWAPRSPNPARPPLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            A WQ+   LR  +   F++YVPDLLFFGGS    P+R+E +QARC+   ME  GV    +
Sbjct  62   AKWQWAGYLRPLLRSGFDLYVPDLLFFGGSEAPGPDRSETYQARCLAAAMEVAGVRRFGV  121

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  122  VGVSYGG  128



>ref|XP_007042937.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOX98768.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=335

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  122  INRSKASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLL  301
            +++ K S+C SFTASRDW+YR+  A +GLRSV TD  +GT MHCWVPK+Q   +PNLLL+
Sbjct  1    MHQFKMSKCFSFTASRDWFYRHSLANAGLRSVRTDLGEGTVMHCWVPKIQNKSRPNLLLV  60

Query  302  HGFGANAMWQYGDILRHFVPRFNVYVPD  385
            HGFGANAMWQYG+ LRHF  RFNVYV +
Sbjct  61   HGFGANAMWQYGEHLRHFTFRFNVYVQN  88



>gb|AAG52103.1|AC012680_14 hypothetical protein; 59058-58351 [Arabidopsis thaliana]
Length=235

 Score =   130 bits (326),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 87/127 (69%), Gaps = 4/127 (3%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQ---KPGKPNLLLLHGFGA  316
            C S + + +  Y+  F  SGLR VT D  DGT ++ WV K +   KP KPNLLL+HG GA
Sbjct  4    CFSLSEALERTYKSGFKRSGLRPVTIDLKDGTVVNFWVSKTKPESKP-KPNLLLIHGLGA  62

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
             A+WQ+ D+ R     FN+Y+PDL+FFGGS TT PER++ FQA+ + R +EA  V++ SL
Sbjct  63   TAIWQWYDVARRLSRYFNLYIPDLVFFGGSSTTRPERSDIFQAQTLMRALEAQSVKKFSL  122

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  123  VGLSYGG  129



>ref|NP_565173.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAL91245.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72173.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE98613.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE36082.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=314

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 87/127 (69%), Gaps = 4/127 (3%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQ---KPGKPNLLLLHGFGA  316
            C S + + +  Y+  F  SGLR VT D  DGT ++ WV K +   KP KPNLLL+HG GA
Sbjct  4    CFSLSEALERTYKSGFKRSGLRPVTIDLKDGTVVNFWVSKTKPESKP-KPNLLLIHGLGA  62

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
             A+WQ+ D+ R     FN+Y+PDL+FFGGS TT PER++ FQA+ + R +EA  V++ SL
Sbjct  63   TAIWQWYDVARRLSRYFNLYIPDLVFFGGSSTTRPERSDIFQAQTLMRALEAQSVKKFSL  122

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  123  VGLSYGG  129



>ref|XP_008782159.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X2 [Phoenix 
dactylifera]
Length=310

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 83/127 (65%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++CLSFTA RD  Y   F  +GLR   T   DG  +H W P+   P +P LLL+HGFGAN
Sbjct  2    TQCLSFTALRDRCYDRTFYAAGLRPTVTVLGDGATVHFWAPRYPDPARPPLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            A WQ+   LR  +   F++YVP+LLFFGGS    P+R+E +QARC+  +M+A GV    +
Sbjct  62   AKWQWAGYLRPLLRSGFDLYVPNLLFFGGSEAPGPDRSEAYQARCLAAVMDAAGVRRFGV  121

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  122  VGVSYGG  128



>ref|XP_008782158.1| PREDICTED: monoacylglycerol lipase abhd6-B-like isoform X1 [Phoenix 
dactylifera]
Length=345

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 83/127 (65%), Gaps = 1/127 (1%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGAN  319
            ++CLSFTA RD  Y   F  +GLR   T   DG  +H W P+   P +P LLL+HGFGAN
Sbjct  2    TQCLSFTALRDRCYDRTFYAAGLRPTVTVLGDGATVHFWAPRYPDPARPPLLLIHGFGAN  61

Query  320  AMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            A WQ+   LR  +   F++YVP+LLFFGGS    P+R+E +QARC+  +M+A GV    +
Sbjct  62   AKWQWAGYLRPLLRSGFDLYVPNLLFFGGSEAPGPDRSEAYQARCLAAVMDAAGVRRFGV  121

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  122  VGVSYGG  128



>ref|XP_010472031.1| PREDICTED: uncharacterized protein LOC104751718 [Camelina sativa]
Length=315

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 87/127 (69%), Gaps = 4/127 (3%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQ---KPGKPNLLLLHGFGA  316
            C S + + +  Y+  F  SGLR VT D  DGT ++ WV K +   KP KPNLLL+HG GA
Sbjct  4    CFSLSEAIERTYKSGFKRSGLRPVTIDLKDGTIVNFWVSKTRPDSKP-KPNLLLIHGLGA  62

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
             A+WQ+ D+ R     FN+Y+PDL+FFGGS TT PER++ FQA+ + R +EA  V++ SL
Sbjct  63   TAIWQWYDVARRLSRHFNLYIPDLVFFGGSSTTRPERSDIFQAQALMRALEALSVKKFSL  122

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  123  VGLSYGG  129



>ref|XP_010428943.1| PREDICTED: uncharacterized protein LOC104713502 [Camelina sativa]
Length=315

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 87/127 (69%), Gaps = 4/127 (3%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQ---KPGKPNLLLLHGFGA  316
            C S + + +  Y+  F  SGLR VT D  DGT ++ WV K +   KP KPNLLL+HG GA
Sbjct  4    CFSLSEAIERTYKSGFKRSGLRPVTIDLKDGTIVNFWVSKTRPDSKP-KPNLLLIHGLGA  62

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
             A+WQ+ D+ R     FN+Y+PDL+FFGGS TT PER++ FQA+ + R +EA  V++ SL
Sbjct  63   TAIWQWYDVARRLSRHFNLYIPDLVFFGGSSTTRPERSDIFQAQTLMRALEALSVKKFSL  122

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  123  VGLSYGG  129



>ref|XP_010416797.1| PREDICTED: uncharacterized protein LOC104702608 [Camelina sativa]
Length=316

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 87/127 (69%), Gaps = 4/127 (3%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQ---KPGKPNLLLLHGFGA  316
            C S + + +  Y+  F  SGLR VT D  DGT ++ WV K +   KP KPNLLL+HG GA
Sbjct  5    CFSLSEAIERTYKSGFKRSGLRPVTIDLKDGTVVNFWVSKTRPDSKP-KPNLLLIHGLGA  63

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
             A+WQ+ D+ R     FN+Y+PDL+FFGGS TT PER++ FQA+ + R +EA  V++ SL
Sbjct  64   TAIWQWYDVARRLSRHFNLYIPDLVFFGGSSTTRPERSDIFQAQTLMRALEALSVKKFSL  123

Query  497  VGISYGG  517
            VG+SYGG
Sbjct  124  VGLSYGG  130



>ref|XP_002889179.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65438.1| hydrolase, alpha/beta fold family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=315

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 86/125 (69%), Gaps = 4/125 (3%)
 Frame = +2

Query  152  SFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQ---KPGKPNLLLLHGFGANA  322
            S + + +  Y+  F  SGLR VT D  DGT ++ WV K Q   KP KPNLLL+HG GA A
Sbjct  6    SLSQAIERTYKSGFKRSGLRPVTIDLKDGTVVNFWVSKTQPETKP-KPNLLLIHGLGATA  64

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            +WQ+ D+ R     FN+Y+PDL+FFGGS TT PER++ FQA+ + R +EA  V++ SLVG
Sbjct  65   IWQWYDVARRLSRHFNLYIPDLVFFGGSSTTRPERSDIFQAQTLMRALEAQSVKKFSLVG  124

Query  503  ISYGG  517
            +SYGG
Sbjct  125  LSYGG  129



>ref|XP_009413546.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Musa acuminata 
subsp. malaccensis]
Length=324

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 79/126 (63%), Gaps = 1/126 (1%)
 Frame = +2

Query  143  RCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            R LSFT  RD  +R  F  +GLR   T   DG  +HCWVP    P +  LLLLHGFGA A
Sbjct  3    RWLSFTVFRDRCHRRAFLAAGLRPSATALADGATVHCWVPARPDPSRSPLLLLHGFGATA  62

Query  323  MWQYGDILRHFV-PRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLV  499
            +WQ+   LR  +   F++YVPDLLFFG S    P+R+E +QA+C+   MEA GV    LV
Sbjct  63   IWQWSAHLRPLLGAGFDLYVPDLLFFGVSAAPGPDRSESYQAQCIMAAMEAAGVRRFGLV  122

Query  500  GISYGG  517
            G+SYGG
Sbjct  123  GVSYGG  128



>ref|XP_011019330.1| PREDICTED: uncharacterized protein LOC105122109 [Populus euphratica]
Length=302

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 79/127 (62%), Gaps = 0/127 (0%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGA  316
            A   LSF +   +Y R+ F  SGL   + D  D T +H W P   +  KPNL+ +HGFG 
Sbjct  2    APSFLSFASLYSFYLRHCFTSSGLSQQSIDVGDETIIHFWAPTQLRQPKPNLVFIHGFGP  61

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
             ++WQ+   ++ F P FN+YVPDL+FFG S T   ER+E FQA  V +L+E  GVE+ SL
Sbjct  62   VSLWQWRQQVQFFAPDFNLYVPDLIFFGDSTTKSSERSEIFQAESVAKLLETLGVEKYSL  121

Query  497  VGISYGG  517
            VG SYGG
Sbjct  122  VGTSYGG  128



>ref|XP_006827312.1| hypothetical protein AMTR_s00010p00266510 [Amborella trichopoda]
 gb|ERM94549.1| hypothetical protein AMTR_s00010p00266510 [Amborella trichopoda]
Length=213

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 69/99 (70%), Gaps = 8/99 (8%)
 Frame = +2

Query  245  MHCWVPKVQKPG--------KPNLLLLHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFG  400
            MHCWVPK             KP+L+LLHGFGANAMWQ+ + LR  +  F+VYVPDL+FFG
Sbjct  1    MHCWVPKNPNNNHSSNTNRSKPSLVLLHGFGANAMWQWSEHLRPLMAHFDVYVPDLVFFG  60

Query  401  GSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYGG  517
             SYTT  ER E+FQARCV  LM + GV   SL+GISYGG
Sbjct  61   ESYTTGTERNEQFQARCVGHLMSSLGVTRFSLIGISYGG  99



>ref|XP_009795564.1| PREDICTED: epoxide hydrolase 4-like [Nicotiana sylvestris]
Length=341

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = +2

Query  170  DWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQYGDILR  349
            D Y    F FS L   T D D+ T +H W P  +   KPNL+L+HG+G +A WQ+   ++
Sbjct  44   DAYISLLFRFSNLSPCTLDLDEQTTVHFWAPNHRHFNKPNLVLIHGYGGDAKWQFMYQVK  103

Query  350  HFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYGG  517
                 FN+Y+PDLLFFG SYTT PERTEEFQA+CV   ++  GV++ S+  ISYGG
Sbjct  104  SLAQSFNLYIPDLLFFGKSYTTRPERTEEFQAKCVVEGLKGLGVKKCSMFSISYGG  159



>gb|KDO73662.1| hypothetical protein CISIN_1g0219211mg, partial [Citrus sinensis]
 gb|KDO73663.1| hypothetical protein CISIN_1g0219211mg, partial [Citrus sinensis]
Length=212

 Score =   119 bits (298),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 81/131 (62%), Gaps = 4/131 (3%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKP----GKPNLLLLH  304
            A   LS  +    Y R  FA +GL S T D DD T +H W PK++       KP+L+L+H
Sbjct  2    APSFLSLVSLYRIYLRRCFASAGLSSQTIDIDDETTLHFWGPKLEDDHKTLKKPSLVLIH  61

Query  305  GFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVE  484
            GFG  A+WQ+   ++ F P FNVYVPDL+FFG S T   +RTE FQA  + +L+E  GVE
Sbjct  62   GFGPEAIWQWRKQVQFFAPHFNVYVPDLIFFGHSTTRSIQRTELFQAASLGKLLEKIGVE  121

Query  485  EMSLVGISYGG  517
              S+VG SYGG
Sbjct  122  RFSVVGTSYGG  132



>ref|XP_006342917.1| PREDICTED: uncharacterized protein LOC102595617 [Solanum tuberosum]
Length=337

 Score =   122 bits (305),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 75/121 (62%), Gaps = 0/121 (0%)
 Frame = +2

Query  155  FTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQY  334
            F    D Y    F FS L   T D DD T +H W P  ++  KPNL+L+HG+G +A WQ+
Sbjct  39   FVPFIDAYISLLFRFSNLSPCTLDLDDQTTIHFWAPNHRRYDKPNLVLIHGYGGDAKWQF  98

Query  335  GDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYG  514
               ++     FN+Y+PDLLFFG SYTT  ERTEEFQA+CV + ++  GV   S+  ISYG
Sbjct  99   MYQVKSLAQSFNLYIPDLLFFGKSYTTRKERTEEFQAKCVVQGLKELGVRNCSMFAISYG  158

Query  515  G  517
            G
Sbjct  159  G  159



>ref|XP_009600030.1| PREDICTED: epoxide hydrolase 4 [Nicotiana tomentosiformis]
Length=351

 Score =   122 bits (305),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 76/121 (63%), Gaps = 0/121 (0%)
 Frame = +2

Query  155  FTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQY  334
            F    D Y    F FS L   T D D+ T +H W P  +   KPNL+L+HG+G +A WQ+
Sbjct  39   FVPFIDAYISLLFRFSNLSPCTLDLDEHTTIHFWAPNHRHFNKPNLVLIHGYGGDAKWQF  98

Query  335  GDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYG  514
               ++     FN+Y+PDLLFFG SYTT PERTEEFQA+CV   ++  GV++ S+  ISYG
Sbjct  99   MYQVQSLARSFNLYIPDLLFFGKSYTTRPERTEEFQAKCVVEGLKGLGVKKCSMFSISYG  158

Query  515  G  517
            G
Sbjct  159  G  159



>ref|XP_007223174.1| hypothetical protein PRUPE_ppa009136mg [Prunus persica]
 gb|EMJ24373.1| hypothetical protein PRUPE_ppa009136mg [Prunus persica]
Length=305

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 76/118 (64%), Gaps = 4/118 (3%)
 Frame = +2

Query  176  YYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQ----KPGKPNLLLLHGFGANAMWQYGDI  343
            Y R  FA SGL   T   D+ T +H W P  +       KP+L+L+HGFG  AMWQ+ + 
Sbjct  15   YVRRCFAASGLSQQTLQLDNETTLHFWGPNPKFSQATQKKPSLVLIHGFGPVAMWQWRNQ  74

Query  344  LRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYGG  517
            ++ F PRFNVYVPDL+FFG S TT  ER+E FQA  V +LME  GVE  S++G SYGG
Sbjct  75   VQFFSPRFNVYVPDLVFFGDSTTTSAERSEVFQAASVAKLMEKAGVERFSVIGTSYGG  132



>ref|XP_006474513.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Citrus sinensis]
Length=305

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 81/131 (62%), Gaps = 4/131 (3%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKP----GKPNLLLLH  304
            A   LS  +    Y R  FA +GL S T D DD T +H W PK++       KP+L+L+H
Sbjct  2    APSFLSLVSLYSIYLRRCFASAGLSSQTIDIDDETTLHFWGPKLEDDHKTLKKPSLVLIH  61

Query  305  GFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVE  484
            GFG  A+WQ+   ++ F P FNVYVPDL+FFG S T   +RTE FQA  + +L+E  GVE
Sbjct  62   GFGPEAIWQWRKQVQFFAPHFNVYVPDLIFFGHSTTRSIQRTELFQAASLGKLLEKIGVE  121

Query  485  EMSLVGISYGG  517
              S+VG SYGG
Sbjct  122  RFSVVGTSYGG  132



>ref|XP_008393578.1| PREDICTED: monoacylglycerol lipase ABHD6 [Malus domestica]
Length=308

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 77/121 (64%), Gaps = 7/121 (6%)
 Frame = +2

Query  176  YYRYFFAFSGLRSVTTDFD-DGTKMHCWVP------KVQKPGKPNLLLLHGFGANAMWQY  334
            Y R  FA SGL   T   D D T +H W P      + Q P KP+L+L+HGFG  AMWQ+
Sbjct  15   YVRRCFAGSGLSQQTLQLDNDQTTLHFWGPNPKLSNQTQNPEKPSLVLIHGFGPAAMWQW  74

Query  335  GDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYG  514
             + ++ F P FNVYVP+L+FFG S T  PERTE FQA  V ++ME  GVE  S++G SYG
Sbjct  75   RNQVQFFSPHFNVYVPNLVFFGNSTTGSPERTEVFQASSVAKMMEKVGVERFSVMGTSYG  134

Query  515  G  517
            G
Sbjct  135  G  135



>ref|XP_004235544.1| PREDICTED: uncharacterized protein LOC101251165 [Solanum lycopersicum]
Length=335

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 75/121 (62%), Gaps = 0/121 (0%)
 Frame = +2

Query  155  FTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQY  334
            F    D Y    F F+ L   T D DD T +H W P  ++  KPNL+L+HG+G +A WQ+
Sbjct  39   FVPFIDAYISLLFRFANLSPCTLDLDDQTTIHFWAPNHRRYDKPNLVLVHGYGGDAKWQF  98

Query  335  GDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYG  514
               ++     FN+Y+PDLLFFG SYTT  ERTEEFQA+CV + ++  GV   S+  ISYG
Sbjct  99   MYQVKSLAESFNLYIPDLLFFGKSYTTRKERTEEFQAKCVVQGLKELGVRNCSMFAISYG  158

Query  515  G  517
            G
Sbjct  159  G  159



>ref|XP_006452975.1| hypothetical protein CICLE_v10009014mg [Citrus clementina]
 gb|ESR66215.1| hypothetical protein CICLE_v10009014mg [Citrus clementina]
Length=305

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 81/131 (62%), Gaps = 4/131 (3%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKP----GKPNLLLLH  304
            A   LS  +    Y R  FA +GL S T D DD T +H W PK++       KP+L+L+H
Sbjct  2    APSFLSLVSLYRIYLRRCFASAGLSSQTIDIDDETTLHFWGPKLEDDHKTLKKPSLVLIH  61

Query  305  GFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVE  484
            GFG  A+WQ+   ++ F P FNVYVPDL+FFG S T   +RTE FQA  + +L+E  GVE
Sbjct  62   GFGPEAIWQWRKQVQFFAPHFNVYVPDLIFFGHSTTRSIQRTELFQAASLGKLLEKIGVE  121

Query  485  EMSLVGISYGG  517
              S+VG SYGG
Sbjct  122  RFSVVGTSYGG  132



>ref|XP_004303453.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component 
of acetoin cleaving system-like [Fragaria vesca subsp. 
vesca]
Length=306

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = +2

Query  176  YYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPG-KPNLLLLHGFGANAMWQYGDILRH  352
            Y R  FA SGL   +   D+ T +H W P    P  KP L+L+HGFG  AMWQ+   ++ 
Sbjct  17   YVRRCFAASGLSQQSMKLDEHTTLHFWGPHQTIPNNKPCLVLIHGFGPAAMWQWRKQVQF  76

Query  353  FVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYGG  517
            F P FNVYVPDL+FFG S TT P+R E FQA  V +L+E  GVE  S+VG SYGG
Sbjct  77   FTPNFNVYVPDLVFFGRSTTTSPDRAETFQAASVAKLLEKLGVERFSVVGTSYGG  131



>ref|XP_009362895.1| PREDICTED: uncharacterized protein LOC103952919 [Pyrus x bretschneideri]
Length=308

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 77/121 (64%), Gaps = 7/121 (6%)
 Frame = +2

Query  176  YYRYFFAFSGLRSVTTDFD-DGTKMHCWVP------KVQKPGKPNLLLLHGFGANAMWQY  334
            Y R  FA SGL   T   + D T +H W P      + Q P KP+L+L+HGFG  AMWQ+
Sbjct  15   YVRRCFAGSGLSQQTLQLNNDQTTLHFWGPNPKLSNQTQNPKKPSLVLIHGFGPAAMWQW  74

Query  335  GDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYG  514
             + ++ F P FN+YVP+L+FFG S T  PERTE FQA  V ++ME  GVE  S++G SYG
Sbjct  75   RNQVQFFSPHFNIYVPNLVFFGNSTTASPERTEVFQASSVAKMMEKVGVERFSVMGTSYG  134

Query  515  G  517
            G
Sbjct  135  G  135



>ref|XP_007012452.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 4, 
partial [Theobroma cacao]
 gb|EOY30071.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 4, 
partial [Theobroma cacao]
Length=254

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 80/130 (62%), Gaps = 3/130 (2%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPK---VQKPGKPNLLLLHG  307
            A   LSF +    Y R  FA SGL S +TD DD T +H W PK     +  KP L+LLHG
Sbjct  2    APSFLSFASLYGVYLRRCFASSGLTSQSTDIDDETTIHLWAPKPDQTTQERKPVLVLLHG  61

Query  308  FGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEE  487
            FG +A+WQ+   ++ F P F VYVPDL+FFG S T   ER+E FQA  V +LME   V++
Sbjct  62   FGPSAIWQWRRQVQFFTPYFQVYVPDLIFFGNSMTKSKERSEVFQAVSVGKLMEKLQVKK  121

Query  488  MSLVGISYGG  517
              ++G SYGG
Sbjct  122  YHVMGTSYGG  131



>ref|XP_002308516.1| hydrolase family protein [Populus trichocarpa]
 gb|ABK96720.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE92039.1| hydrolase family protein [Populus trichocarpa]
Length=302

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 77/127 (61%), Gaps = 0/127 (0%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGA  316
            A   LS  +   +Y R+ F  SGL   + +  D T +H W P      KPNL+ +HGFG 
Sbjct  2    APSFLSLASLYSFYLRHCFTSSGLSQKSINVGDETTIHYWAPTQLGQPKPNLVFIHGFGP  61

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
             ++WQ+   ++ F P FN+YVPDL+FFG S T   ER+E FQA  V +L+E  GVE+ SL
Sbjct  62   VSLWQWRQQVQFFAPDFNLYVPDLIFFGNSTTKSSERSEIFQAESVAKLLETLGVEKYSL  121

Query  497  VGISYGG  517
            VG SYGG
Sbjct  122  VGTSYGG  128



>emb|CDP13481.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 80/129 (62%), Gaps = 2/129 (2%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCW--VPKVQKPGKPNLLLLHGF  310
             + CLS       +     + +GL S  T+ DD T MH W   PK   P KP+L+L+HGF
Sbjct  2    VASCLSIVTLYGGFLHRCISAAGLASQATNIDDQTTMHFWGPTPKTFSPTKPSLILIHGF  61

Query  311  GANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEM  490
            G + +WQ+   + +F  ++N+YVPDL+FFG S T  PER+E FQA CV +++E  GV+  
Sbjct  62   GPHGVWQWRQQISYFAHKYNLYVPDLVFFGDSATKSPERSEVFQAVCVGKMLERIGVDRY  121

Query  491  SLVGISYGG  517
            S+VG SYGG
Sbjct  122  SVVGTSYGG  130



>ref|XP_008220584.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Prunus mume]
Length=306

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 75/118 (64%), Gaps = 4/118 (3%)
 Frame = +2

Query  176  YYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQ----KPGKPNLLLLHGFGANAMWQYGDI  343
            Y R  FA SGL   T   D+ T +H W P  +       KP+L+L+HGFG  AMWQ+ + 
Sbjct  15   YVRRCFAASGLSQQTLQLDNETTVHFWGPNPKFSQATQKKPSLVLIHGFGPVAMWQWRNQ  74

Query  344  LRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYGG  517
            ++   PRFNVYVPDL+FFG S TT  ER+E FQA  V +LME  GVE  S++G SYGG
Sbjct  75   VQFLSPRFNVYVPDLVFFGDSTTTSAERSEVFQAASVAKLMEKAGVERFSVIGTSYGG  132



>ref|XP_007012451.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 3 
[Theobroma cacao]
 gb|EOY30070.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 3 
[Theobroma cacao]
Length=287

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 80/130 (62%), Gaps = 3/130 (2%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPK---VQKPGKPNLLLLHG  307
            A   LSF +    Y R  FA SGL S +TD DD T +H W PK     +  KP L+LLHG
Sbjct  2    APSFLSFASLYGVYLRRCFASSGLTSQSTDIDDETTIHLWAPKPDQTTQERKPVLVLLHG  61

Query  308  FGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEE  487
            FG +A+WQ+   ++ F P F VYVPDL+FFG S T   ER+E FQA  V +LME   V++
Sbjct  62   FGPSAIWQWRRQVQFFTPYFQVYVPDLIFFGNSMTKSKERSEVFQAVSVGKLMEKLQVKK  121

Query  488  MSLVGISYGG  517
              ++G SYGG
Sbjct  122  YHVMGTSYGG  131



>ref|XP_007012449.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY30068.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=306

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 80/130 (62%), Gaps = 3/130 (2%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPK---VQKPGKPNLLLLHG  307
            A   LSF +    Y R  FA SGL S +TD DD T +H W PK     +  KP L+LLHG
Sbjct  2    APSFLSFASLYGVYLRRCFASSGLTSQSTDIDDETTIHLWAPKPDQTTQERKPVLVLLHG  61

Query  308  FGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEE  487
            FG +A+WQ+   ++ F P F VYVPDL+FFG S T   ER+E FQA  V +LME   V++
Sbjct  62   FGPSAIWQWRRQVQFFTPYFQVYVPDLIFFGNSMTKSKERSEVFQAVSVGKLMEKLQVKK  121

Query  488  MSLVGISYGG  517
              ++G SYGG
Sbjct  122  YHVMGTSYGG  131



>ref|XP_007012450.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY30069.1| Alpha/beta-Hydrolases superfamily protein, putative isoform 2 
[Theobroma cacao]
Length=299

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 80/130 (62%), Gaps = 3/130 (2%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPK---VQKPGKPNLLLLHG  307
            A   LSF +    Y R  FA SGL S +TD DD T +H W PK     +  KP L+LLHG
Sbjct  2    APSFLSFASLYGVYLRRCFASSGLTSQSTDIDDETTIHLWAPKPDQTTQERKPVLVLLHG  61

Query  308  FGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEE  487
            FG +A+WQ+   ++ F P F VYVPDL+FFG S T   ER+E FQA  V +LME   V++
Sbjct  62   FGPSAIWQWRRQVQFFTPYFQVYVPDLIFFGNSMTKSKERSEVFQAVSVGKLMEKLQVKK  121

Query  488  MSLVGISYGG  517
              ++G SYGG
Sbjct  122  YHVMGTSYGG  131



>ref|XP_007136895.1| hypothetical protein PHAVU_009G083100g [Phaseolus vulgaris]
 gb|ESW08889.1| hypothetical protein PHAVU_009G083100g [Phaseolus vulgaris]
Length=319

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 87/143 (61%), Gaps = 6/143 (4%)
 Frame = +2

Query  107  TRKDSINRSKASRCLSFTASRDW------YYRYFFAFSGLRSVTTDFDDGTKMHCWVPKV  268
            T+  S  R  A++ ++  +S ++      Y R  F  +GL S     DD T MH W P+ 
Sbjct  3    TKLASPTREGATKFINMPSSFNFVWMYSRYIRRCFTGAGLWSQALALDDQTTMHFWGPRN  62

Query  269  QKPGKPNLLLLHGFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQAR  448
            + P KP+L+L+HGFG  A WQ+   +R   P FNVY+PDL+FFGGS TT  ER+E FQA+
Sbjct  63   RTPHKPSLVLIHGFGPVATWQWRRQVRSLAPHFNVYIPDLIFFGGSSTTSTERSEVFQAK  122

Query  449  CVKRLMEAHGVEEMSLVGISYGG  517
             V +L++   V ++ +VG SYGG
Sbjct  123  SVGKLLDKLEVVKLHVVGTSYGG  145



>gb|ADE75703.1| unknown [Picea sitchensis]
Length=305

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 77/127 (61%), Gaps = 0/127 (0%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGA  316
            A  C S  +      +  F  +GL S   D DD T +HCW PK     K N++L+HGFG 
Sbjct  2    AGYCFSLISFWTKRLQKAFVSAGLESKLIDVDDSTTIHCWAPKKCDTHKQNVVLIHGFGT  61

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            NAMWQ+   ++ FV  FNVYVPDL+FFG S T   ER+E FQA  + ++++  GV + S+
Sbjct  62   NAMWQWYPQIQPFVGSFNVYVPDLVFFGDSTTRSSERSEIFQAESLMKMLKRLGVSKFSV  121

Query  497  VGISYGG  517
            VG SYGG
Sbjct  122  VGTSYGG  128



>ref|XP_004501423.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Cicer arietinum]
Length=302

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 78/123 (63%), Gaps = 0/123 (0%)
 Frame = +2

Query  149  LSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMW  328
            LSF      Y R  FA +GL S + + D+ T +H W P  Q   KP+L+L+HGFG  AMW
Sbjct  6    LSFAGLYSGYIRRCFARAGLFSQSINIDNETTLHVWGPTNQATQKPSLVLIHGFGPMAMW  65

Query  329  QYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGIS  508
            Q+ + ++   P FN+YVPDL+FFG S T   ER+E+FQA  V +L+E  GV++  + G S
Sbjct  66   QWREQVQFLSPHFNLYVPDLIFFGESNTRSKERSEKFQAASVGKLLEKLGVKKFHVAGTS  125

Query  509  YGG  517
            YGG
Sbjct  126  YGG  128



>gb|EMT26431.1| hypothetical protein F775_16327 [Aegilops tauschii]
Length=242

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 82/133 (62%), Gaps = 7/133 (5%)
 Frame = +2

Query  134  KASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDD----GTKMHCWVPKVQKPGKPNLLLL  301
            K  R  SF A+RD  +   F  +GLR V+    D    GT +H WVP   +P +  L+LL
Sbjct  11   KVGRFFSFAAARDRCFSRRFQAAGLRPVSIQLPDSADPGTTVHMWVPA--RPPRNPLVLL  68

Query  302  HGFGANAMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            HGFGA+A WQ+   LR  +   F+  VPDL+FFG S T LP+R++ FQAR +K  +EA G
Sbjct  69   HGFGASATWQWDPYLRPLIAAGFDPIVPDLVFFGNSTTRLPDRSDTFQARSIKTALEAIG  128

Query  479  VEEMSLVGISYGG  517
            V +  LVG+SYGG
Sbjct  129  VTKFGLVGVSYGG  141



>gb|KEH35884.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=245

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 77/125 (62%), Gaps = 2/125 (2%)
 Frame = +2

Query  149  LSFTASRDWYYRYFFAFSGLRS--VTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            LSF    + Y R  F  +GL S  +  D D+ T +H W P  +   KP+L+L+HGFG  A
Sbjct  6    LSFAGLYNGYLRRCFTGAGLLSQEIDIDIDNETSLHFWGPTNKSTQKPSLVLIHGFGPMA  65

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+   ++   P FN+YVPDL+FFG S T   ERTE FQA  V +L+E  GV++  +VG
Sbjct  66   MWQWRQQVQFLAPHFNLYVPDLIFFGESTTKSKERTENFQAESVGKLLEKIGVKKCHVVG  125

Query  503  ISYGG  517
             SYGG
Sbjct  126  TSYGG  130



>ref|XP_010098384.1| 4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10), 2-diene-4-oate 
hydrolase [Morus notabilis]
 gb|EXB74908.1| 4,5-9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10), 2-diene-4-oate 
hydrolase [Morus notabilis]
Length=305

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 76/127 (60%), Gaps = 4/127 (3%)
 Frame = +2

Query  149  LSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPG----KPNLLLLHGFGA  316
            LS  A    Y R  F+ +GL   T D DD T MH W P   + G    KP L+L+HGFG 
Sbjct  6    LSPVALYGSYLRRCFSAAGLSPQTLDIDDETTMHFWGPDPARSGGAGGKPALVLIHGFGP  65

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
             A WQ+   ++ F P+ +VYVPDL+FFG S T   ERTE FQA  V RLME  GV+  SL
Sbjct  66   VATWQWRRQVQFFAPKLDVYVPDLVFFGESTTKSAERTEVFQAAAVARLMERIGVKRYSL  125

Query  497  VGISYGG  517
            +G SYGG
Sbjct  126  MGTSYGG  132



>gb|EAZ40704.1| hypothetical protein OsJ_25173 [Oryza sativa Japonica Group]
Length=267

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 80/133 (60%), Gaps = 9/133 (7%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVT------TDFDDGTKMHCWVPKVQKPGKPNLLLL  301
            S  LSF A+RD  +   F  +GLR +        D D GT +H WVP    P +  LLLL
Sbjct  15   SSILSFAAARDRCFSRRFLRAGLRPLAIPLPTGVDDDAGTTVHVWVP--ANPPRNPLLLL  72

Query  302  HGFGANAMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            HGFGA+A WQ+   LR  +   ++  VPDLLFFG SYT L +R+E FQAR +K  M+A G
Sbjct  73   HGFGASATWQWAPYLRPLIAAGYDPIVPDLLFFGASYTRLADRSEAFQARSIKAAMDAIG  132

Query  479  VEEMSLVGISYGG  517
            V    LVG+SYGG
Sbjct  133  VARFGLVGVSYGG  145



>gb|ACU19094.1| unknown [Glycine max]
Length=214

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 74/123 (60%), Gaps = 0/123 (0%)
 Frame = +2

Query  149  LSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMW  328
            LS  +    Y R  F  +GL S T   DD + +H W P      KP+L+L+HGFG  ++W
Sbjct  6    LSLVSVYSLYLRRCFTGAGLSSQTLRVDDESTLHFWAPTNPTAQKPSLVLIHGFGPESIW  65

Query  329  QYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGIS  508
            Q+   ++   P FNVYVPDL+FFGGS T   ER+E FQA  V +L++   VE+  +VG S
Sbjct  66   QWRKQVQFLAPHFNVYVPDLIFFGGSSTKSSERSETFQAASVGKLLDKLEVEKFHVVGTS  125

Query  509  YGG  517
            YGG
Sbjct  126  YGG  128



>ref|NP_001060317.1| Os07g0622700 [Oryza sativa Japonica Group]
 dbj|BAC79905.1| hydrolase-like protein [Oryza sativa Japonica Group]
 dbj|BAF22231.1| Os07g0622700 [Oryza sativa Japonica Group]
 dbj|BAG97958.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82473.1| hypothetical protein OsI_26917 [Oryza sativa Indica Group]
Length=327

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 80/133 (60%), Gaps = 9/133 (7%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGLRSVT------TDFDDGTKMHCWVPKVQKPGKPNLLLL  301
            S  LSF A+RD  +   F  +GLR +        D D GT +H WVP    P +  LLLL
Sbjct  15   SSILSFAAARDRCFSRRFLRAGLRPLAIPLPTGVDDDAGTTVHVWVPA--NPPRNPLLLL  72

Query  302  HGFGANAMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHG  478
            HGFGA+A WQ+   LR  +   ++  VPDLLFFG SYT L +R+E FQAR +K  M+A G
Sbjct  73   HGFGASATWQWAPYLRPLIAAGYDPIVPDLLFFGASYTRLADRSEAFQARSIKAAMDAIG  132

Query  479  VEEMSLVGISYGG  517
            V    LVG+SYGG
Sbjct  133  VARFGLVGVSYGG  145



>ref|XP_003603229.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES73480.1| alpha/beta fold hydrolase [Medicago truncatula]
Length=304

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 77/125 (62%), Gaps = 2/125 (2%)
 Frame = +2

Query  149  LSFTASRDWYYRYFFAFSGLRS--VTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANA  322
            LSF    + Y R  F  +GL S  +  D D+ T +H W P  +   KP+L+L+HGFG  A
Sbjct  6    LSFAGLYNGYLRRCFTGAGLLSQEIDIDIDNETSLHFWGPTNKSTQKPSLVLIHGFGPMA  65

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            MWQ+   ++   P FN+YVPDL+FFG S T   ERTE FQA  V +L+E  GV++  +VG
Sbjct  66   MWQWRQQVQFLAPHFNLYVPDLIFFGESTTKSKERTENFQAESVGKLLEKIGVKKCHVVG  125

Query  503  ISYGG  517
             SYGG
Sbjct  126  TSYGG  130



>gb|EPS58835.1| hypothetical protein M569_15976, partial [Genlisea aurea]
Length=185

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 77/125 (62%), Gaps = 1/125 (1%)
 Frame = +2

Query  146  CLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPG-KPNLLLLHGFGANA  322
            C+S  +    + R   A SGL S + D D  T +H W P       KP L+L+HGFG   
Sbjct  2    CMSLVSLYGGFLRLSVAASGLSSRSVDLDGSTTIHFWGPASSSSSSKPVLVLIHGFGPPG  61

Query  323  MWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVG  502
            +WQ+   ++ F  +FNVYVPDL+FFG S++   ERTE FQA+C+  L+++ GV+  S+VG
Sbjct  62   IWQWTRQVKFFSRKFNVYVPDLVFFGESFSDSSERTEIFQAKCIASLLQSLGVQRYSVVG  121

Query  503  ISYGG  517
             SYGG
Sbjct  122  TSYGG  126



>ref|XP_003522308.1| PREDICTED: monoacylglycerol lipase ABHD6 [Glycine max]
Length=302

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 74/123 (60%), Gaps = 0/123 (0%)
 Frame = +2

Query  149  LSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMW  328
            LS  +    Y R  F  +GL S T   DD + +H W P      KP+L+L+HGFG  ++W
Sbjct  6    LSLVSVYSLYLRRCFTGAGLSSQTLRVDDESTLHFWAPTNPTAQKPSLVLIHGFGPESIW  65

Query  329  QYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGIS  508
            Q+   ++   P FNVYVPDL+FFGGS T   ER+E FQA  V +L++   VE+  +VG S
Sbjct  66   QWRKQVQFLAPHFNVYVPDLIFFGGSSTKSSERSETFQAASVGKLLDKLEVEKFHVVGTS  125

Query  509  YGG  517
            YGG
Sbjct  126  YGG  128



>gb|KHG11170.1| Uncharacterized protein F383_14589 [Gossypium arboreum]
Length=306

 Score =   113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 78/131 (60%), Gaps = 4/131 (3%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVP----KVQKPGKPNLLLLH  304
            A   LSF +    Y R  FA SGL S   D DD T +H W P    +  +  KP LLLLH
Sbjct  2    APSFLSFVSLYGIYLRRCFATSGLTSQFIDIDDHTTIHLWAPNPDHQTPQQQKPALLLLH  61

Query  305  GFGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVE  484
            GFG +AMWQ+    + F P F+VYVPDL+FFG S T   ER+E FQA  + +LME   V+
Sbjct  62   GFGPSAMWQWRRQAQFFSPHFHVYVPDLVFFGDSTTKSKERSEVFQADSMGKLMEKLQVK  121

Query  485  EMSLVGISYGG  517
            +  ++G SYGG
Sbjct  122  KYHVMGTSYGG  132



>ref|XP_003527758.1| PREDICTED: monoacylglycerol lipase ABHD6-like [Glycine max]
 gb|KHN32161.1| 2-hydroxy-6-oxononadienedioate/2-hydroxy-6- oxononatrienedioate 
hydrolase [Glycine soja]
Length=305

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 81/129 (63%), Gaps = 3/129 (2%)
 Frame = +2

Query  140  SRCLSFTASRDWYYRYFFAFSGL--RSVTTDFDDGTKMHCWVP-KVQKPGKPNLLLLHGF  310
            S   SF +    Y R  F  +GL  ++++ D D  T MH W P KV+   KP+L+L+HGF
Sbjct  3    SSSFSFVSLYSKYIRRCFTSAGLWSQALSVDKDGETTMHFWGPRKVEAAQKPSLVLIHGF  62

Query  311  GANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEM  490
            G  AMWQ+   ++   P FN+YVPDL+FFGGS+T   ER+E FQA  V +L++   VE+ 
Sbjct  63   GPAAMWQWRRQVKFLAPHFNLYVPDLVFFGGSHTKSGERSEMFQAASVGKLLDKLEVEKF  122

Query  491  SLVGISYGG  517
             +VG SYGG
Sbjct  123  HVVGTSYGG  131



>ref|XP_002521324.1| abhydrolase domain containing, putative [Ricinus communis]
 gb|EEF40992.1| abhydrolase domain containing, putative [Ricinus communis]
Length=242

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = +2

Query  191  FAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQYGDILRHFVPRFN  370
            F    +   T D DD T +H WV   ++  +PNL+L+HG+G N+ WQ+ + +R     FN
Sbjct  47   FLLCSMSPCTIDLDDQTTLHFWVTNRRQFNRPNLVLIHGYGGNSRWQFLNQVRPLSKSFN  106

Query  371  VYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYGG  517
            +Y+PDLLFFG SYT   +R++ FQA+C    ++  GVE+ ++VGISYGG
Sbjct  107  LYIPDLLFFGDSYTNRTDRSDIFQAKCASEGLKKLGVEKYNVVGISYGG  155



>ref|XP_002281808.1| PREDICTED: monoacylglycerol lipase ABHD6 [Vitis vinifera]
 emb|CBI20733.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 77/127 (61%), Gaps = 1/127 (1%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGA  316
             + CLS T+    Y R  F  SGL S T D D  T +H W P      KP LLL+HGFG 
Sbjct  2    VASCLSPTSLYGGYLRRCFTASGLSSQTIDIDHQTSIHFWGPNTAS-HKPVLLLIHGFGP  60

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
              +WQ+   +++F   F+VYVPDL+FFG S TT  +RTE FQA  + +L+E  G+E  ++
Sbjct  61   VCLWQWRRQVQYFCADFDVYVPDLIFFGDSTTTSSDRTEVFQAVSIGKLLEKVGIERYAV  120

Query  497  VGISYGG  517
            +G SYGG
Sbjct  121  MGTSYGG  127



>ref|XP_004958357.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X1 [Setaria 
italica]
 ref|XP_004958358.1| PREDICTED: monoacylglycerol lipase ABHD6-like isoform X2 [Setaria 
italica]
Length=325

 Score =   110 bits (276),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 8/131 (6%)
 Frame = +2

Query  143  RC-LSFTASRDWYYRYFFAFSGLRSVTTDF----DDGTKMHCWVPKVQKPGKPNLLLLHG  307
            RC LSF A+RD  +   F  +GLR +        D  T +H WVP   +P +  LLLLHG
Sbjct  14   RCVLSFAAARDRCFSRRFLRAGLRPLAVPLPAGPDPTTTVHMWVP--SRPPRNPLLLLHG  71

Query  308  FGANAMWQYGDILRHFVPR-FNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVE  484
            FGA+A WQ+   LR  +   F+  VPDL+FFG S T+LP+R++ FQA  +K  M+A GV 
Sbjct  72   FGASATWQWAPYLRPLIAAGFDPIVPDLVFFGASCTSLPDRSDAFQASTIKAAMDAIGVA  131

Query  485  EMSLVGISYGG  517
               LVG+SYGG
Sbjct  132  RFGLVGVSYGG  142



>ref|XP_004305753.1| PREDICTED: lipase 1-like [Fragaria vesca subsp. vesca]
Length=336

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 75/127 (59%), Gaps = 3/127 (2%)
 Frame = +2

Query  137  ASRCLSFTASRDWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGA  316
            AS  ++F    D +   +F F GL   T + D+ T MH W    ++  KP+LL+LHG+G 
Sbjct  35   ASILIAFA---DAFLDLYFRFCGLSPCTIELDEQTTMHFWSSNPRRSNKPDLLMLHGYGG  91

Query  317  NAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSL  496
            N+ WQ+   +      FN+YVPDLLFFG SYT + +RTE FQA+CV   +   GVE   +
Sbjct  92   NSKWQFMHQVGSLSRTFNLYVPDLLFFGKSYTKMSDRTEVFQAKCVAEGLRRLGVERFGV  151

Query  497  VGISYGG  517
              ISYGG
Sbjct  152  YSISYGG  158



>ref|XP_008360463.1| PREDICTED: uncharacterized protein LOC103424157 isoform X2 [Malus 
domestica]
Length=314

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 71/116 (61%), Gaps = 0/116 (0%)
 Frame = +2

Query  170  DWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQYGDILR  349
            D     +F   GL   T + DD T MH WV   ++  KP L++LHG+G N+ WQ+   + 
Sbjct  42   DLLISVYFRSCGLCPCTVELDDQTTMHFWVANPRRSQKPALVMLHGYGGNSKWQFIHQVG  101

Query  350  HFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYGG  517
                RFN+YVPDLLFFG SYTT  ERTE FQA+CV   ++  G++  S+  ISYGG
Sbjct  102  SLSQRFNLYVPDLLFFGDSYTTRLERTEIFQAKCVAEGLKRLGLDRFSVYSISYGG  157



>gb|KDP34016.1| hypothetical protein JCGZ_07587 [Jatropha curcas]
Length=304

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 76/130 (58%), Gaps = 6/130 (5%)
 Frame = +2

Query  146  CLSFTASRDWYYRYF---FAFSGLRSVTTDFDDGTKMHCWVP---KVQKPGKPNLLLLHG  307
             LSF +    Y  Y    F  +GL   + D D  T +H W P   +     KP+L+ +HG
Sbjct  2    ALSFLSPVSLYAHYLRSCFTSAGLSRHSVDIDTETTIHLWAPSSNQTSTANKPSLVFIHG  61

Query  308  FGANAMWQYGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEE  487
            FG  A+WQ+   ++ F P FN+YVPDL+FFG S T   ER+E FQA+ V + +E  GVE+
Sbjct  62   FGPVALWQWRRQVQFFWPHFNIYVPDLIFFGESTTKSSERSEIFQAKSVAKCLEKLGVEK  121

Query  488  MSLVGISYGG  517
             S+VG SYGG
Sbjct  122  YSVVGTSYGG  131



>ref|XP_008360462.1| PREDICTED: uncharacterized protein LOC103424157 isoform X1 [Malus 
domestica]
Length=328

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 71/116 (61%), Gaps = 0/116 (0%)
 Frame = +2

Query  170  DWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQYGDILR  349
            D     +F   GL   T + DD T MH WV   ++  KP L++LHG+G N+ WQ+   + 
Sbjct  42   DLLISVYFRSCGLCPCTVELDDQTTMHFWVANPRRSQKPALVMLHGYGGNSKWQFIHQVG  101

Query  350  HFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYGG  517
                RFN+YVPDLLFFG SYTT  ERTE FQA+CV   ++  G++  S+  ISYGG
Sbjct  102  SLSQRFNLYVPDLLFFGDSYTTRLERTEIFQAKCVAEGLKRLGLDRFSVYSISYGG  157



>ref|XP_004303692.1| PREDICTED: 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate 
hydrolase 1-like [Fragaria vesca subsp. vesca]
Length=327

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 71/110 (65%), Gaps = 0/110 (0%)
 Frame = +2

Query  188  FFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQYGDILRHFVPRF  367
            ++   GL   T D +D T +H W    ++  KP+L+L+HG+G N++WQ+   L     +F
Sbjct  48   YYRLCGLSPCTVDINDQTTVHFWTTNHRRFDKPSLVLIHGYGGNSLWQFVRQLSPLSKKF  107

Query  368  NVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYGG  517
            NVYVPDLLFFG SYT   +R+E FQA+CV   ++  GV+  S+ GISYGG
Sbjct  108  NVYVPDLLFFGKSYTNRSDRSESFQAKCVMEGLKKLGVDRFSVYGISYGG  157



>gb|EYU21324.1| hypothetical protein MIMGU_mgv1a009646mg [Erythranthe guttata]
Length=335

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 71/122 (58%), Gaps = 1/122 (1%)
 Frame = +2

Query  155  FTASRDWYYRYFFAFS-GLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQ  331
            F    D +  ++F F+  L   T D DD T MH W P  +K  KPNL++LHG+G N+ WQ
Sbjct  40   FVPVVDKFLSFYFTFNCNLVQSTVDLDDQTTMHFWCPSHRKFSKPNLIMLHGYGGNSKWQ  99

Query  332  YGDILRHFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISY  511
            +   +      FN+Y+PDLLFFG S+T    RTE FQA CV   +   GVE  S+  ISY
Sbjct  100  FVYQVGGLADSFNLYIPDLLFFGKSHTNRSNRTETFQAECVAAGLNRLGVERCSVYAISY  159

Query  512  GG  517
            GG
Sbjct  160  GG  161



>ref|XP_002521325.1| abhydrolase domain containing, putative [Ricinus communis]
 gb|EEF40993.1| abhydrolase domain containing, putative [Ricinus communis]
Length=333

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 71/116 (61%), Gaps = 0/116 (0%)
 Frame = +2

Query  170  DWYYRYFFAFSGLRSVTTDFDDGTKMHCWVPKVQKPGKPNLLLLHGFGANAMWQYGDILR  349
            D  +  +F   GL S T D DD T +H W    +K  KPNL+++HG+G +A WQ+   + 
Sbjct  43   DTTFSIYFGLCGLTSFTVDLDDHTTLHSWTSNTRKSDKPNLVMIHGYGGDARWQFLYQVG  102

Query  350  HFVPRFNVYVPDLLFFGGSYTTLPERTEEFQARCVKRLMEAHGVEEMSLVGISYGG  517
                RFN+Y+PDLLFFG SY+   +R+E FQA+C+ + +   GV   S+  ISYGG
Sbjct  103  FLARRFNLYMPDLLFFGKSYSNRSDRSEMFQAKCLAQGLRRLGVGRFSVYSISYGG  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508786895526