BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23596_g1_i2 len=602 path=[1544:0-274 2359:275-304 1849:305-452
2664:453-482 2005:483-601]

Length=602
                                                                      Score     E

emb|CDP07567.1|  unnamed protein product                                137   5e-36   
ref|XP_009364361.1|  PREDICTED: pathogenesis-related protein 5-like     135   3e-35   
emb|CDP18679.1|  unnamed protein product                                134   7e-35   
ref|XP_008220752.1|  PREDICTED: pathogenesis-related protein 5          133   3e-34   
ref|NP_001268088.1|  SCUTL2 precursor                                   132   5e-34   
emb|CAN70296.1|  hypothetical protein VITISV_007440                     132   6e-34   Vitis vinifera
ref|XP_008377347.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    131   7e-34   
ref|XP_008357219.1|  PREDICTED: pathogenesis-related protein 5-like     131   8e-34   
ref|XP_007223736.1|  hypothetical protein PRUPE_ppa010458mg             130   2e-33   
gb|AEV57470.1|  thaumatin-like protein 1                                130   2e-33   
ref|XP_009365665.1|  PREDICTED: pathogenesis-related protein 5-like     130   2e-33   
ref|XP_009778054.1|  PREDICTED: pathogenesis-related protein 5-like     129   5e-33   
ref|XP_004293225.1|  PREDICTED: pathogenesis-related protein 5-like     128   1e-32   
gb|AAD55270.1|AC008263_1  Identical to gb|U83490 thaumatin-like p...    125   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003549422.2|  PREDICTED: pathogenesis-related protein 5-like     127   3e-32   
ref|XP_004501042.1|  PREDICTED: pathogenesis-related protein 5-like     127   3e-32   
ref|XP_008364957.1|  PREDICTED: pathogenesis-related protein 5-like     127   4e-32   
ref|XP_009760388.1|  PREDICTED: pathogenesis-related protein 5-like     126   9e-32   
ref|XP_009595245.1|  PREDICTED: pathogenesis-related protein 5          126   1e-31   
ref|NP_177640.1|  thaumatin-like protein 3                              125   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAB71214.1|  thaumatin-like protein                                  125   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011031355.1|  PREDICTED: pathogenesis-related protein 5          125   2e-31   
ref|XP_010106041.1|  hypothetical protein L484_021218                   125   2e-31   
ref|XP_003545287.2|  PREDICTED: pathogenesis-related protein 5-like     125   3e-31   
ref|XP_006390357.1|  hypothetical protein EUTSA_v10019680mg             125   3e-31   
ref|XP_003545289.2|  PREDICTED: pathogenesis-related protein 5-like     124   4e-31   
ref|XP_010428506.1|  PREDICTED: pathogenesis-related protein 5 is...    124   4e-31   
ref|XP_010416369.1|  PREDICTED: pathogenesis-related protein 5-like     124   4e-31   
gb|EYU45112.1|  hypothetical protein MIMGU_mgv1a012469mg                124   4e-31   
ref|XP_010428505.1|  PREDICTED: pathogenesis-related protein 5 is...    124   4e-31   
ref|XP_002887572.1|  hypothetical protein ARALYDRAFT_316436             124   4e-31   
gb|KEH40091.1|  pathogenesis-related thaumatin family protein           124   4e-31   
ref|XP_006301180.1|  hypothetical protein CARUB_v10021579mg             124   5e-31   
ref|XP_002887570.1|  hypothetical protein ARALYDRAFT_476641             124   5e-31   
ref|NP_177642.2|  pathogenesis-related thaumatin-like protein pro...    123   9e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51919.1|AC013258_13  thaumatin-like protein; 23251-22305          123   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006375059.1|  hypothetical protein POPTR_0014s04020g             123   1e-30   
ref|XP_009106158.1|  PREDICTED: pathogenesis-related protein 5-like     122   2e-30   
emb|CDY68760.1|  BnaAnng28270D                                          122   2e-30   
ref|XP_009106162.1|  PREDICTED: pathogenesis-related protein 5          122   2e-30   
emb|CDX73133.1|  BnaC06g35810D                                          122   2e-30   
emb|CDY59465.1|  BnaCnng34970D                                          122   3e-30   
gb|KGN62571.1|  hypothetical protein Csa_2G361370                       122   3e-30   
emb|CDY46016.1|  BnaA02g17100D                                          122   4e-30   
ref|XP_004152784.1|  PREDICTED: pathogenesis-related protein 5-like     122   4e-30   
ref|XP_007160787.1|  hypothetical protein PHAVU_001G016600g             121   5e-30   
gb|KDP38462.1|  hypothetical protein JCGZ_04387                         121   5e-30   
ref|XP_011074598.1|  PREDICTED: pathogenesis-related protein 5-like     122   5e-30   
ref|XP_008444682.1|  PREDICTED: pathogenesis-related protein 5-like     121   5e-30   
gb|KEH36134.1|  pathogenesis-related thaumatin family protein           121   7e-30   
ref|NP_177641.1|  pathogenesis-related protein 5                        120   9e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003545288.2|  PREDICTED: pathogenesis-related protein 5-like     120   1e-29   
ref|XP_010428504.1|  PREDICTED: pathogenesis-related protein 5          120   1e-29   
gb|KFK33653.1|  hypothetical protein AALP_AA5G041900                    120   1e-29   
ref|XP_010416362.1|  PREDICTED: pathogenesis-related protein 5-like     120   1e-29   
ref|XP_010471602.1|  PREDICTED: pathogenesis-related protein 5-like     120   1e-29   
ref|XP_011083734.1|  PREDICTED: pathogenesis-related protein 5-like     120   1e-29   
ref|XP_010254957.1|  PREDICTED: pathogenesis-related protein 5          120   1e-29   
ref|XP_010246990.1|  PREDICTED: pathogenesis-related protein 5          120   1e-29   
ref|XP_010471608.1|  PREDICTED: pathogenesis-related protein 5-like     120   2e-29   
emb|CDX73137.1|  BnaC06g35850D                                          120   2e-29   
ref|XP_009128072.1|  PREDICTED: pathogenesis-related protein 5-like     120   2e-29   
ref|XP_004238220.1|  PREDICTED: pathogenesis-related protein 5          119   3e-29   
ref|XP_002887571.1|  hypothetical protein ARALYDRAFT_895371             119   3e-29   
emb|CDY37263.1|  BnaCnng08170D                                          118   7e-29   
ref|XP_009117552.1|  PREDICTED: pathogenesis-related protein 5-li...    118   8e-29   
gb|KFK41942.1|  hypothetical protein AALP_AA2G192200                    118   9e-29   
ref|XP_002510340.1|  Zeamatin precursor, putative                       118   1e-28   Ricinus communis
ref|XP_006390358.1|  hypothetical protein EUTSA_v10019046mg             117   1e-28   
ref|XP_009117553.1|  PREDICTED: pathogenesis-related protein 5-li...    117   1e-28   
ref|XP_010539926.1|  PREDICTED: pathogenesis-related protein 5-like     117   2e-28   
ref|XP_006307402.1|  hypothetical protein CARUB_v10009026mg             120   2e-28   
gb|KFK41944.1|  hypothetical protein AALP_AA2G192400                    117   2e-28   
ref|XP_004499121.1|  PREDICTED: pathogenesis-related protein 5-like     117   2e-28   
gb|KFK41943.1|  hypothetical protein AALP_AA2G192300                    116   4e-28   
ref|XP_007017454.1|  Thaumatin-like protein 3                           116   4e-28   
ref|XP_006366466.1|  PREDICTED: pathogenesis-related protein 5-like     116   5e-28   
ref|XP_010248229.1|  PREDICTED: pathogenesis-related protein 5-like     116   6e-28   
ref|XP_010678327.1|  PREDICTED: pathogenesis-related protein 5-like     116   7e-28   
ref|XP_007160788.1|  hypothetical protein PHAVU_001G016700g             114   2e-27   
ref|XP_009106161.1|  PREDICTED: pathogenesis-related protein 5-like     114   2e-27   
ref|XP_006473452.1|  PREDICTED: pathogenesis-related protein 5-like     114   2e-27   
ref|XP_010471604.1|  PREDICTED: pathogenesis-related protein 5-like     114   3e-27   
ref|XP_010428509.1|  PREDICTED: pathogenesis-related protein 5          114   3e-27   
ref|XP_010416366.1|  PREDICTED: pathogenesis-related protein 5-like     114   4e-27   
ref|XP_010471607.1|  PREDICTED: pathogenesis-related protein 5          114   4e-27   
ref|XP_006434928.1|  hypothetical protein CICLE_v10002288mg             114   5e-27   
ref|XP_010416364.1|  PREDICTED: pathogenesis-related protein 5-like     113   5e-27   
ref|XP_010416363.1|  PREDICTED: pathogenesis-related protein 5-like     113   7e-27   
ref|XP_006302689.1|  hypothetical protein CARUB_v10020799mg             113   8e-27   
emb|CDY41037.1|  BnaC05g14950D                                          113   9e-27   
ref|XP_009106493.1|  PREDICTED: pathogenesis-related protein 5-like     112   9e-27   
ref|XP_009149407.1|  PREDICTED: pathogenesis-related protein 5-like     112   1e-26   
ref|XP_010530276.1|  PREDICTED: pathogenesis-related protein 5-like     112   2e-26   
ref|XP_010026231.1|  PREDICTED: pathogenesis-related protein 5          111   3e-26   
emb|CDX73136.1|  BnaC06g35840D                                          111   3e-26   
dbj|BAD90814.1|  thaumatin-like protein                                 110   5e-26   Cryptomeria japonica
ref|XP_010529666.1|  PREDICTED: pathogenesis-related protein 5-like     110   1e-25   
gb|KFK44066.1|  hypothetical protein AALP_AA1G211800                    110   1e-25   
gb|KHG17165.1|  hypothetical protein F383_22419                         109   1e-25   
ref|XP_006390359.1|  hypothetical protein EUTSA_v10019053mg             109   2e-25   
emb|CDY64471.1|  BnaAnng19350D                                          110   4e-25   
gb|KHG08802.1|  hypothetical protein F383_35963                         108   5e-25   
gb|ABL86687.1|  TLP1                                                    108   5e-25   Gossypium barbadense [Egyptian cotton]
ref|XP_006416518.1|  hypothetical protein EUTSA_v10008604mg             107   8e-25   
ref|XP_006438972.1|  hypothetical protein CICLE_v10033952mg             106   1e-24   
ref|XP_010936134.1|  PREDICTED: pathogenesis-related protein 5          107   2e-24   
ref|XP_006482914.1|  PREDICTED: pathogenesis-related protein 5-like     106   3e-24   
ref|XP_008790236.1|  PREDICTED: pathogenesis-related protein 5          105   4e-24   
emb|CDX83773.1|  BnaC08g18720D                                          105   5e-24   
ref|XP_009149412.1|  PREDICTED: pathogenesis-related protein 5-li...    105   6e-24   
ref|NP_001031809.1|  pathogenesis-related thaumatin-like protein        106   7e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568046.1|  pathogenesis-related thaumatin-like protein           106   8e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64698.1|  putative thaumatin-like protein                         106   8e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CDX83771.1|  BnaC08g18740D                                          105   8e-24   
gb|EPS65843.1|  hypothetical protein M569_08934                         102   8e-24   
ref|XP_010446375.1|  PREDICTED: thaumatin-like protein 1                106   1e-23   
gb|KHG07208.1|  hypothetical protein F383_34305                         105   1e-23   
ref|XP_009149413.1|  PREDICTED: pathogenesis-related protein 5-li...    104   1e-23   
ref|XP_010436965.1|  PREDICTED: thaumatin-like protein 1                105   1e-23   
gb|AFW89118.1|  putative thaumatin domain family protein                102   1e-23   
ref|XP_006660362.1|  PREDICTED: thaumatin-like protein 1-like           105   2e-23   
ref|XP_006283927.1|  hypothetical protein CARUB_v10005048mg             105   2e-23   
ref|XP_007046679.1|  Pathogenesis-related thaumatin superfamily p...    105   2e-23   
ref|XP_008337996.1|  PREDICTED: thaumatin-like protein 1                104   2e-23   
emb|CDY70029.1|  BnaCnng66400D                                          102   2e-23   
ref|XP_002868852.1|  hypothetical protein ARALYDRAFT_912315             105   2e-23   
ref|XP_008788396.1|  PREDICTED: thaumatin-like protein 1b               104   3e-23   
gb|KDP46766.1|  hypothetical protein JCGZ_06554                         104   3e-23   
ref|XP_010245598.1|  PREDICTED: thaumatin-like protein 1b               104   3e-23   
gb|ADE77179.1|  unknown                                                 102   3e-23   
ref|XP_010266794.1|  PREDICTED: thaumatin-like protein 1b               104   3e-23   
ref|XP_008352435.1|  PREDICTED: thaumatin-like protein 1                104   4e-23   
ref|XP_010920168.1|  PREDICTED: thaumatin-like protein 1b isoform X2    103   4e-23   
ref|XP_004974143.1|  PREDICTED: thaumatin-like protein 1-like           104   4e-23   
ref|XP_004287804.1|  PREDICTED: thaumatin-like protein 1-like           103   4e-23   
ref|XP_006425448.1|  hypothetical protein CICLE_v10026139mg             103   4e-23   
ref|XP_009110283.1|  PREDICTED: pathogenesis-related protein 5-like     102   6e-23   
emb|CAN80000.1|  hypothetical protein VITISV_043971                     106   6e-23   Vitis vinifera
emb|CDY72463.1|  BnaAnng41250D                                          102   6e-23   
ref|XP_008781003.1|  PREDICTED: thaumatin-like protein 1b               103   6e-23   
ref|XP_010920167.1|  PREDICTED: thaumatin-like protein 1b isoform X1    103   7e-23   
ref|XP_007202291.1|  hypothetical protein PRUPE_ppa009119mg             103   7e-23   
ref|XP_009110282.1|  PREDICTED: pathogenesis-related protein 5-like     102   7e-23   
ref|XP_010431808.1|  PREDICTED: thaumatin-like protein 1                103   8e-23   
gb|KCW56621.1|  hypothetical protein EUGRSUZ_I02339                     103   9e-23   
ref|XP_010935078.1|  PREDICTED: thaumatin-like protein 1b               103   9e-23   
emb|CDY12096.1|  BnaC03g60120D                                          103   9e-23   
ref|XP_010029672.1|  PREDICTED: thaumatin-like protein 1                103   1e-22   
ref|XP_008801393.1|  PREDICTED: pathogenesis-related protein 5-li...    102   1e-22   
gb|KDP26886.1|  hypothetical protein JCGZ_18044                         101   1e-22   
gb|EAZ07901.1|  hypothetical protein OsI_30157                          103   1e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_006466958.1|  PREDICTED: pathogenesis-related protein 5-li...    102   1e-22   
ref|XP_004292943.1|  PREDICTED: pathogenesis-related protein 5-like     103   1e-22   
ref|XP_009379396.1|  PREDICTED: thaumatin-like protein 1                102   1e-22   
ref|NP_001169696.1|  putative thaumatin domain family protein pre...    102   1e-22   Zea mays [maize]
ref|XP_008801392.1|  PREDICTED: pathogenesis-related protein 5-li...    102   2e-22   
ref|XP_004505780.1|  PREDICTED: thaumatin-like protein 1-like           102   2e-22   
ref|XP_004957480.1|  PREDICTED: thaumatin-like protein 1-like           102   2e-22   
gb|KFK28279.1|  hypothetical protein AALP_AA8G495800                    101   2e-22   
emb|CDX80458.1|  BnaC07g29860D                                          102   2e-22   
ref|XP_010664831.1|  PREDICTED: thaumatin-like protein 1b               102   2e-22   
gb|KHG02944.1|  hypothetical protein F383_23941                         102   2e-22   
gb|EYU38795.1|  hypothetical protein MIMGU_mgv1a010603mg                102   2e-22   
ref|XP_002890328.1|  hypothetical protein ARALYDRAFT_472154             101   2e-22   
gb|ABR17407.1|  unknown                                                 101   2e-22   Picea sitchensis
emb|CAN79402.1|  hypothetical protein VITISV_028072                     102   2e-22   Vitis vinifera
gb|KDO71232.1|  hypothetical protein CISIN_1g045716mg                   102   2e-22   
ref|XP_010459595.1|  PREDICTED: pathogenesis-related protein 5-like     101   2e-22   
ref|XP_006466957.1|  PREDICTED: pathogenesis-related protein 5-li...    102   2e-22   
ref|XP_006851913.1|  hypothetical protein AMTR_s00041p00163280          102   3e-22   
ref|XP_008788616.1|  PREDICTED: thaumatin-like protein 1b               101   3e-22   
ref|XP_008664601.1|  PREDICTED: thaumatin-like protein 1b               101   3e-22   
ref|XP_010257784.1|  PREDICTED: thaumatin-like protein                  100   3e-22   
ref|XP_004973952.1|  PREDICTED: pathogenesis-related protein 5-like     102   3e-22   
ref|XP_008394054.1|  PREDICTED: thaumatin-like protein 1                101   3e-22   
ref|XP_010929479.1|  PREDICTED: pathogenesis-related protein 5-like     101   3e-22   
emb|CDX68151.1|  BnaA07g21910D                                          100   3e-22   
ref|XP_007041885.1|  Pathogenesis-related thaumatin superfamily p...    102   4e-22   
ref|XP_009104727.1|  PREDICTED: pathogenesis-related protein 5-like     100   4e-22   
emb|CAB45053.1|  thaumatin-like protein                                 100   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007041883.1|  Pathogenesis-related thaumatin superfamily p...    101   4e-22   
ref|NP_194149.2|  thaumatin-like protein 1                              100   4e-22   Arabidopsis thaliana [mouse-ear cress]
gb|KEH30510.1|  pathogenesis-related thaumatin family protein           101   4e-22   
gb|AAB63607.1|  thaumatin isolog                                        100   4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007041884.1|  Pathogenesis-related thaumatin superfamily p...    101   4e-22   
gb|KDP43442.1|  hypothetical protein JCGZ_16729                         100   4e-22   
ref|XP_008670298.1|  PREDICTED: thaumatin-like protein 1b               101   4e-22   
ref|XP_009389442.1|  PREDICTED: pathogenesis-related protein 5-like     100   5e-22   
ref|XP_010933320.1|  PREDICTED: thaumatin-like protein 1b               100   6e-22   
ref|XP_007160531.1|  hypothetical protein PHAVU_002G329400g             100   6e-22   
gb|KCW66968.1|  hypothetical protein EUGRSUZ_F00728                   99.4    6e-22   
ref|XP_007041882.1|  Pathogenesis-related thaumatin superfamily p...    101   6e-22   
ref|XP_004135916.1|  PREDICTED: thaumatin-like protein-like           99.8    7e-22   
gb|KFK30466.1|  hypothetical protein AALP_AA7G264700                    100   8e-22   
ref|XP_008808638.1|  PREDICTED: thaumatin-like protein 1b               100   8e-22   
ref|XP_010679923.1|  PREDICTED: thaumatin-like protein 1b               100   8e-22   
ref|XP_008461434.1|  PREDICTED: thaumatin-like protein                99.4    8e-22   
ref|XP_008448548.1|  PREDICTED: thaumatin-like protein 1                100   9e-22   
ref|XP_008444818.1|  PREDICTED: thaumatin-like protein 1b             99.8    9e-22   
ref|XP_006383093.1|  hypothetical protein POPTR_0005s11480g             100   1e-21   
ref|XP_002534154.1|  Zeamatin precursor, putative                       100   1e-21   Ricinus communis
ref|XP_002265805.1|  PREDICTED: thaumatin-like protein 1b               100   1e-21   Vitis vinifera
ref|XP_011046468.1|  PREDICTED: pathogenesis-related protein 5-li...    100   1e-21   
ref|XP_011046459.1|  PREDICTED: pathogenesis-related protein 5-li...    100   1e-21   
gb|ABK92515.1|  unknown                                                 100   1e-21   Populus trichocarpa [western balsam poplar]
gb|KDP29626.1|  hypothetical protein JCGZ_18788                         100   1e-21   
ref|XP_006379282.1|  hypothetical protein POPTR_0009s13510g             100   1e-21   
ref|XP_002313721.2|  hypothetical protein POPTR_0009s13510g             100   1e-21   Populus trichocarpa [western balsam poplar]
ref|XP_002867678.1|  hypothetical protein ARALYDRAFT_492443           99.4    1e-21   
ref|XP_010941295.1|  PREDICTED: thaumatin-like protein 1b               100   1e-21   
ref|XP_002529658.1|  Zeamatin precursor, putative                       100   1e-21   Ricinus communis
dbj|BAB11214.1|  thaumatin-like protein                               99.4    1e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDX88118.1|  BnaA06g27090D                                          100   1e-21   
ref|XP_009349687.1|  PREDICTED: thaumatin-like protein 1b               100   1e-21   
ref|XP_009150986.1|  PREDICTED: pathogenesis-related protein 5          100   1e-21   
gb|KHG27805.1|  Thaumatin-like protein 1a                             99.8    2e-21   
ref|XP_002437495.1|  hypothetical protein SORBIDRAFT_10g028130        99.4    2e-21   Sorghum bicolor [broomcorn]
ref|XP_010439075.1|  PREDICTED: thaumatin-like protein 1b isoform X2  99.8    2e-21   
ref|XP_010439074.1|  PREDICTED: thaumatin-like protein 1b isoform X1  99.8    2e-21   
ref|XP_009109535.1|  PREDICTED: thaumatin-like protein 1b               100   2e-21   
ref|XP_010454791.1|  PREDICTED: pathogenesis-related protein 5-li...    100   2e-21   
ref|XP_004172986.1|  PREDICTED: thaumatin-like protein-like           99.4    2e-21   
ref|XP_006289819.1|  hypothetical protein CARUB_v10003424mg             100   2e-21   
ref|XP_010421292.1|  PREDICTED: pathogenesis-related protein 5-li...    100   2e-21   
ref|XP_009591540.1|  PREDICTED: pathogenesis-related protein 5        99.8    2e-21   
ref|NP_001058421.1|  Os06g0691200                                     98.6    2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002264550.2|  PREDICTED: pathogenesis-related protein 5-like   98.6    2e-21   Vitis vinifera
gb|KDP36909.1|  hypothetical protein JCGZ_08200                       99.4    2e-21   
ref|XP_008463807.1|  PREDICTED: thaumatin-like protein                98.6    2e-21   
gb|EAY89154.1|  hypothetical protein OsI_10647                        99.0    2e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_004135026.1|  PREDICTED: thaumatin-like protein-like           99.4    2e-21   
ref|XP_004152647.1|  PREDICTED: thaumatin-like protein 1a-like        98.2    2e-21   
ref|NP_001049473.1|  Os03g0233200                                     99.0    2e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006413465.1|  hypothetical protein EUTSA_v10027206mg           99.0    2e-21   
ref|XP_009340234.1|  PREDICTED: thaumatin-like protein 1b             99.4    2e-21   
gb|KGN48924.1|  hypothetical protein Csa_6G506010                     99.4    2e-21   
ref|XP_006826851.1|  hypothetical protein AMTR_s00010p00113630        98.2    2e-21   
dbj|BAK00264.1|  predicted protein                                    98.6    3e-21   
ref|XP_008440826.1|  PREDICTED: thaumatin-like protein 1              99.0    3e-21   
ref|XP_008377134.1|  PREDICTED: thaumatin-like protein 1b             99.0    3e-21   
ref|XP_004137499.1|  PREDICTED: thaumatin-like protein-like           98.2    3e-21   
ref|XP_002445738.1|  hypothetical protein SORBIDRAFT_07g024920        99.0    3e-21   Sorghum bicolor [broomcorn]
ref|XP_009412932.1|  PREDICTED: thaumatin-like protein 1b             99.0    3e-21   
dbj|BAJ92744.1|  predicted protein                                    98.2    3e-21   
emb|CDO98353.1|  unnamed protein product                              98.2    3e-21   
ref|XP_002519620.1|  Osmotin precursor, putative                      99.0    3e-21   Ricinus communis
ref|XP_010090318.1|  hypothetical protein L484_024983                 99.0    3e-21   
ref|XP_009363485.1|  PREDICTED: thaumatin-like protein 1              98.6    4e-21   
dbj|BAJ86559.1|  predicted protein                                    98.6    4e-21   
ref|XP_010499973.1|  PREDICTED: basic endochitinase CHB4-like           100   4e-21   
ref|XP_006284161.1|  hypothetical protein CARUB_v10005297mg           98.6    4e-21   
ref|XP_010433805.1|  PREDICTED: thaumatin-like protein 1b isoform X2  97.8    4e-21   
ref|XP_011087313.1|  PREDICTED: pathogenesis-related protein 5-like   97.4    5e-21   
ref|XP_002277548.1|  PREDICTED: thaumatin-like protein 1b             98.6    5e-21   Vitis vinifera
tpg|DAA64364.1|  TPA: putative thaumatin domain family protein        97.4    5e-21   
ref|XP_009767579.1|  PREDICTED: pathogenesis-related protein 5-like   98.6    5e-21   
gb|KGN62685.1|  hypothetical protein Csa_2G368860                     98.2    5e-21   
ref|XP_009391981.1|  PREDICTED: thaumatin-like protein 1b             98.2    5e-21   
ref|XP_010531542.1|  PREDICTED: thaumatin-like protein 1b             98.6    5e-21   
emb|CDX72995.1|  BnaC06g34430D                                        97.8    5e-21   
ref|XP_008372899.1|  PREDICTED: thaumatin-like protein 1b             98.6    5e-21   
ref|NP_197850.2|  pathogenesis-related thaumatin-like protein         99.0    6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433804.1|  PREDICTED: thaumatin-like protein 1b isoform X1  98.2    6e-21   
ref|XP_002872122.1|  hypothetical protein ARALYDRAFT_489325           98.6    6e-21   
ref|XP_007160649.1|  hypothetical protein PHAVU_001G005100g           98.2    6e-21   
ref|XP_002460468.1|  hypothetical protein SORBIDRAFT_02g028890        98.2    6e-21   Sorghum bicolor [broomcorn]
ref|XP_003540838.1|  PREDICTED: thaumatin-like protein 1-like         98.2    7e-21   
ref|XP_009106020.1|  PREDICTED: thaumatin-like protein isoform X2     97.4    7e-21   
ref|XP_011016697.1|  PREDICTED: thaumatin-like protein 1b             97.8    7e-21   
gb|KFK41500.1|  hypothetical protein AALP_AA2G137800                  97.8    7e-21   
ref|XP_002513184.1|  Zeamatin precursor, putative                     97.1    7e-21   Ricinus communis
ref|XP_009795150.1|  PREDICTED: pathogenesis-related protein 5-li...  97.1    7e-21   
gb|ABL86688.1|  TLP2                                                  95.9    7e-21   Gossypium barbadense [Egyptian cotton]
ref|XP_008653575.1|  PREDICTED: pathogenesis-related protein 5-like   97.8    8e-21   
emb|CDO96933.1|  unnamed protein product                              97.8    8e-21   
ref|XP_007201407.1|  hypothetical protein PRUPE_ppa008035mg           97.8    8e-21   
ref|XP_004146144.1|  PREDICTED: thaumatin-like protein 1-like         97.8    8e-21   
ref|XP_004159719.1|  PREDICTED: thaumatin-like protein 1-like         97.8    8e-21   
gb|KGN55655.1|  hypothetical protein Csa_3G002750                     97.4    9e-21   
gb|EYU36791.1|  hypothetical protein MIMGU_mgv1a018939mg              97.4    9e-21   
ref|NP_001288837.1|  thaumatin-like protein precursor                 96.7    9e-21   
emb|CDX96487.1|  BnaA07g30980D                                        96.7    9e-21   
ref|XP_003530957.2|  PREDICTED: thaumatin-like protein-like           96.7    1e-20   
ref|XP_011008805.1|  PREDICTED: thaumatin-like protein                96.7    1e-20   
gb|KFK41805.1|  hypothetical protein AALP_AA2G174200                  96.7    1e-20   
ref|XP_010692057.1|  PREDICTED: thaumatin-like protein 1b             96.7    1e-20   
ref|XP_008393422.1|  PREDICTED: thaumatin-like protein                96.7    1e-20   
ref|XP_010033498.1|  PREDICTED: thaumatin-like protein 1b             97.4    1e-20   
gb|KHG02193.1|  Thaumatin-like protein 1                              97.4    1e-20   
ref|XP_006394718.1|  hypothetical protein EUTSA_v10004269mg           98.2    1e-20   
ref|NP_001147654.1|  LOC100281263 precursor                           96.7    1e-20   
ref|XP_009795149.1|  PREDICTED: pathogenesis-related protein 5-li...  97.4    1e-20   
ref|XP_009607714.1|  PREDICTED: pathogenesis-related protein 5-like   97.4    1e-20   
ref|XP_007131695.1|  hypothetical protein PHAVU_011G0342001g          96.3    1e-20   
gb|EYU24132.1|  hypothetical protein MIMGU_mgv1a012513mg              96.3    1e-20   
ref|XP_010448599.1|  PREDICTED: thaumatin-like protein 1b isoform X2  97.1    1e-20   
ref|XP_010555234.1|  PREDICTED: thaumatin-like protein 1b             97.1    1e-20   
ref|XP_010448598.1|  PREDICTED: thaumatin-like protein 1b isoform X1  97.1    1e-20   
gb|AAM62907.1|  thaumatin-like protein                                96.3    1e-20   
ref|XP_011083577.1|  PREDICTED: thaumatin-like protein 1b             97.1    1e-20   
ref|XP_009137426.1|  PREDICTED: thaumatin-like protein 1b isoform X3  96.3    1e-20   
ref|XP_010066268.1|  PREDICTED: thaumatin-like protein 1b             97.1    1e-20   
ref|XP_009130006.1|  PREDICTED: pathogenesis-related protein 5-like   97.8    2e-20   
ref|XP_008361553.1|  PREDICTED: pathogenesis-related protein 5-like   97.1    2e-20   
ref|NP_177503.1|  pathogenesis-related thaumatin-like protein         96.3    2e-20   
ref|XP_009356044.1|  PREDICTED: thaumatin-like protein                96.3    2e-20   
ref|XP_008352662.1|  PREDICTED: pathogenesis-related protein 5-like   96.3    2e-20   
ref|XP_009415311.1|  PREDICTED: pathogenesis-related protein 5-like   96.3    2e-20   
ref|XP_003576776.1|  PREDICTED: thaumatin-like protein 1              96.7    2e-20   
ref|XP_009630387.1|  PREDICTED: thaumatin-like protein 1b             96.3    2e-20   
ref|XP_009596997.1|  PREDICTED: thaumatin-like protein                95.9    2e-20   
ref|XP_004512141.1|  PREDICTED: thaumatin-like protein 1-like         96.3    2e-20   
ref|XP_002459540.1|  hypothetical protein SORBIDRAFT_02g006300        96.3    2e-20   
ref|XP_002305506.2|  hypothetical protein POPTR_0004s17890g           96.3    2e-20   
gb|KEH27590.1|  pathogenesis-related thaumatin family protein         95.5    2e-20   
emb|CDY05403.1|  BnaC02g41110D                                        97.4    2e-20   
ref|XP_002317851.1|  thaumatin-like family protein                    96.3    2e-20   
ref|XP_002460577.1|  hypothetical protein SORBIDRAFT_02g031130        96.3    2e-20   
ref|XP_004957250.1|  PREDICTED: pathogenesis-related protein 5-like   96.7    2e-20   
ref|XP_006850117.1|  hypothetical protein AMTR_s00022p00227010        95.5    2e-20   
emb|CDY64470.1|  BnaAnng19340D                                        95.5    2e-20   
gb|EAZ09619.1|  hypothetical protein OsI_31903                        96.3    3e-20   
ref|XP_010519216.1|  PREDICTED: thaumatin-like protein                95.5    3e-20   
gb|AFW61513.1|  putative thaumatin domain family protein              94.0    3e-20   
ref|XP_009137425.1|  PREDICTED: thaumatin-like protein 1b isoform X2  95.9    3e-20   
ref|XP_006342237.1|  PREDICTED: pathogenesis-related protein 5-like   95.9    3e-20   
ref|XP_006384568.1|  hypothetical protein POPTR_0004s17890g           96.3    3e-20   
ref|XP_011005385.1|  PREDICTED: thaumatin-like protein 1b             95.9    3e-20   
ref|XP_009785058.1|  PREDICTED: thaumatin-like protein isoform X1     95.1    3e-20   
ref|XP_006661394.1|  PREDICTED: pathogenesis-related protein 5-like   95.9    3e-20   
ref|XP_004503284.1|  PREDICTED: thaumatin-like protein-like           95.5    3e-20   
emb|CDY10991.1|  BnaA03g46500D                                        95.9    3e-20   
gb|KCW53162.1|  hypothetical protein EUGRSUZ_J02446                   96.3    3e-20   
ref|XP_009785059.1|  PREDICTED: thaumatin-like protein isoform X2     95.1    3e-20   
ref|XP_009137424.1|  PREDICTED: thaumatin-like protein 1b isoform X1  95.9    3e-20   
gb|KDO74709.1|  hypothetical protein CISIN_1g047437mg                 94.7    4e-20   
dbj|BAA95165.1|  pistil transmitting tissue specific thaumatin (S...  94.0    4e-20   
ref|XP_010069813.1|  PREDICTED: thaumatin-like protein 1b             95.9    4e-20   
emb|CDX92619.1|  BnaC07g38770D                                        95.9    4e-20   
ref|XP_011001989.1|  PREDICTED: thaumatin-like protein 1b isoform X2  95.9    4e-20   
ref|XP_011001987.1|  PREDICTED: thaumatin-like protein 1b isoform X1  95.9    4e-20   
ref|XP_002887494.1|  hypothetical protein ARALYDRAFT_476498           95.1    4e-20   
ref|XP_009400364.1|  PREDICTED: thaumatin-like protein 1b             95.5    4e-20   
ref|XP_008374844.1|  PREDICTED: thaumatin-like protein                95.1    4e-20   
ref|XP_004516152.1|  PREDICTED: thaumatin-like protein-like           94.4    4e-20   
ref|XP_002306940.2|  hypothetical protein POPTR_0005s26250g           95.9    4e-20   
ref|NP_173365.2|  pathogenesis-related thaumatin-like protein         94.7    4e-20   
ref|XP_003612190.1|  Thaumatin-like protein                           95.5    4e-20   
emb|CDY34263.1|  BnaA01g13660D                                        95.1    4e-20   
ref|XP_009397988.1|  PREDICTED: thaumatin-like protein 1b             95.5    5e-20   
emb|CDY03478.1|  BnaC01g16040D                                        94.7    5e-20   
ref|XP_004238367.1|  PREDICTED: pathogenesis-related protein 5        95.5    5e-20   
ref|XP_006422635.1|  hypothetical protein CICLE_v10028716mg           95.5    5e-20   
ref|XP_006422634.1|  hypothetical protein CICLE_v10028716mg           95.5    5e-20   
gb|KDO68004.1|  hypothetical protein CISIN_1g018813mg                 95.5    5e-20   
gb|EPS72785.1|  hypothetical protein M569_01971                       92.0    5e-20   
ref|XP_006486762.1|  PREDICTED: thaumatin-like protein 1-like         95.5    5e-20   
gb|KDO68003.1|  hypothetical protein CISIN_1g018813mg                 95.5    6e-20   
ref|XP_008240157.1|  PREDICTED: thaumatin-like protein                94.7    6e-20   
ref|XP_006590727.1|  PREDICTED: thaumatin-like protein 1-like iso...  94.4    6e-20   
ref|XP_010239414.1|  PREDICTED: thaumatin-like protein 1b             95.5    6e-20   
gb|KDP23919.1|  hypothetical protein JCGZ_27079                       94.4    6e-20   
gb|AIR93918.1|  thaumatin                                             95.1    6e-20   
ref|XP_002322099.1|  hypothetical protein POPTR_0015s04510g           94.4    6e-20   
ref|XP_010690395.1|  PREDICTED: thaumatin-like protein 1              95.5    6e-20   
emb|CDP07385.1|  unnamed protein product                              95.1    7e-20   
ref|XP_009137765.1|  PREDICTED: thaumatin-like protein 1b             95.1    7e-20   
ref|XP_008676788.1|  PREDICTED: uncharacterized protein LOC100273...  95.1    7e-20   
ref|XP_003537638.1|  PREDICTED: thaumatin-like protein 1-like iso...  95.1    7e-20   
ref|XP_002445849.1|  hypothetical protein SORBIDRAFT_07g026880        95.5    7e-20   
ref|XP_008676789.1|  PREDICTED: uncharacterized protein LOC100273...  94.7    7e-20   
ref|XP_006419875.1|  hypothetical protein CICLE_v10005506mg           94.7    7e-20   
ref|XP_003563464.1|  PREDICTED: thaumatin-like protein                94.4    8e-20   
ref|XP_006366508.1|  PREDICTED: pathogenesis-related protein 5-like   94.0    8e-20   
ref|XP_010102631.1|  hypothetical protein L484_010920                 94.0    8e-20   
gb|ABK94543.1|  unknown                                               95.1    8e-20   
ref|XP_006489344.1|  PREDICTED: thaumatin-like protein 1-like         94.7    8e-20   
ref|XP_004490542.1|  PREDICTED: pathogenesis-related protein 5-li...  94.7    9e-20   
ref|XP_009774886.1|  PREDICTED: thaumatin-like protein 1b             94.7    9e-20   
ref|XP_009612390.1|  PREDICTED: thaumatin-like protein                94.0    9e-20   
ref|XP_002532822.1|  Protein P21, putative                            94.0    9e-20   
ref|XP_006390535.1|  hypothetical protein EUTSA_v10019050mg           94.0    1e-19   
gb|EYU27084.1|  hypothetical protein MIMGU_mgv1a012534mg              94.0    1e-19   
ref|XP_010671348.1|  PREDICTED: pathogenesis-related protein 5        95.1    1e-19   
gb|ABX10753.1|  thaumatin                                             90.9    1e-19   
ref|XP_011084258.1|  PREDICTED: thaumatin-like protein                93.6    1e-19   
gb|EYU32807.1|  hypothetical protein MIMGU_mgv1a020484mg              92.8    1e-19   
dbj|BAJ98532.1|  predicted protein                                    94.4    1e-19   
ref|XP_004235045.1|  PREDICTED: thaumatin-like protein 1b             94.0    1e-19   
ref|XP_010086932.1|  hypothetical protein L484_001577                 94.4    1e-19   
emb|CDP04967.1|  unnamed protein product                              94.0    1e-19   
ref|XP_009389178.1|  PREDICTED: thaumatin-like protein 1              94.0    1e-19   
dbj|BAK01608.1|  predicted protein                                    94.4    1e-19   
ref|XP_010416173.1|  PREDICTED: thaumatin-like protein                93.6    1e-19   
ref|XP_010471424.1|  PREDICTED: thaumatin-like protein                93.2    2e-19   
ref|XP_006302686.1|  hypothetical protein CARUB_v10020795mg           93.6    2e-19   
ref|XP_009382031.1|  PREDICTED: thaumatin-like protein 1b             94.0    2e-19   
ref|XP_006601355.1|  PREDICTED: pathogenesis-related protein 5-like   94.0    2e-19   
ref|XP_007046683.1|  Pathogenesis-related thaumatin superfamily p...  93.6    2e-19   
gb|KHG03900.1|  hypothetical protein F383_27474                       93.2    2e-19   
ref|XP_010539098.1|  PREDICTED: thaumatin-like protein 1b             94.0    2e-19   
ref|XP_002465570.1|  hypothetical protein SORBIDRAFT_01g041290        94.0    2e-19   
ref|XP_006660895.1|  PREDICTED: thaumatin-like protein 1-like iso...  93.6    2e-19   
ref|XP_009419984.1|  PREDICTED: pathogenesis-related protein 5-like   93.6    2e-19   
ref|XP_004235810.1|  PREDICTED: thaumatin-like protein                93.2    2e-19   
ref|XP_007209509.1|  hypothetical protein PRUPE_ppa010418mg           93.2    2e-19   
ref|XP_011039126.1|  PREDICTED: thaumatin-like protein                93.6    2e-19   
ref|XP_010109991.1|  hypothetical protein L484_021879                 94.0    2e-19   
gb|KDO83347.1|  hypothetical protein CISIN_1g029619mg                 92.0    2e-19   
gb|AHC69780.1|  thuamatin-like protein                                92.8    2e-19   
ref|XP_006649687.1|  PREDICTED: pathogenesis-related protein 5-like   93.2    2e-19   
ref|XP_010550787.1|  PREDICTED: thaumatin-like protein 1b             93.6    2e-19   
ref|XP_002317878.2|  hypothetical protein POPTR_0012s04520g           93.6    2e-19   
gb|KEH19055.1|  pathogenesis-related thaumatin family protein         92.8    2e-19   
ref|XP_004952394.1|  PREDICTED: thaumatin-like protein 1-like         93.6    2e-19   
ref|XP_009391386.1|  PREDICTED: thaumatin-like protein                92.8    2e-19   
ref|XP_008364687.1|  PREDICTED: LOW QUALITY PROTEIN: thaumatin-li...  92.4    3e-19   
gb|AAO64168.1|  putative pathogenesis-related protein 5 precursor     92.8    3e-19   
ref|NP_001131821.2|  putative thaumatin domain family protein pre...  92.8    3e-19   
ref|NP_001063786.1|  Os09g0536400                                     93.2    3e-19   
ref|XP_007157907.1|  hypothetical protein PHAVU_002G107800g           93.2    3e-19   
ref|XP_010230207.1|  PREDICTED: pathogenesis-related protein 5-like   92.8    3e-19   
ref|XP_004291353.1|  PREDICTED: thaumatin-like protein 1-like         93.2    3e-19   
ref|XP_008680256.1|  PREDICTED: thaumatin-like protein 1b             93.2    3e-19   
gb|KHG18980.1|  hypothetical protein F383_08602                       92.4    3e-19   
gb|EAZ09890.1|  hypothetical protein OsI_32183                        93.2    3e-19   
ref|XP_011083579.1|  PREDICTED: thaumatin-like protein 1              93.2    3e-19   
gb|KHG05099.1|  Thaumatin-like protein 1                              95.5    4e-19   
ref|XP_010113338.1|  hypothetical protein L484_026669                 93.2    4e-19   
gb|EYU38797.1|  hypothetical protein MIMGU_mgv1a010302mg              92.8    4e-19   
gb|EMT02621.1|  hypothetical protein F775_30768                       92.0    4e-19   
ref|XP_009361238.1|  PREDICTED: thaumatin-like protein 1              92.8    4e-19   
ref|XP_004966180.1|  PREDICTED: thaumatin-like protein-like           92.4    4e-19   
ref|XP_008650876.1|  PREDICTED: putative thaumatin domain family ...  92.8    4e-19   
ref|XP_009401910.1|  PREDICTED: thaumatin-like protein 1b             92.8    4e-19   
gb|EYU45345.1|  hypothetical protein MIMGU_mgv1a011005mg              92.8    4e-19   
ref|XP_006369399.1|  hypothetical protein POPTR_0001s22870g           92.0    4e-19   
ref|XP_006347542.1|  PREDICTED: thaumatin-like protein 1-like         92.8    4e-19   
ref|XP_010277230.1|  PREDICTED: pathogenesis-related protein 5        92.4    4e-19   
ref|XP_010477142.1|  PREDICTED: pathogenesis-related protein 5-like   92.0    5e-19   
ref|XP_010928530.1|  PREDICTED: pathogenesis-related protein 5-like   91.7    5e-19   
ref|XP_009794244.1|  PREDICTED: thaumatin-like protein 1b             92.4    5e-19   
gb|KHG05671.1|  Thaumatin-like protein 1                              92.4    5e-19   
ref|XP_002510549.1|  Zeamatin precursor, putative                     92.4    5e-19   
ref|XP_006856120.1|  hypothetical protein AMTR_s00059p00148770        91.7    5e-19   
ref|XP_002321939.2|  hypothetical protein POPTR_0015s00310g           92.4    6e-19   
ref|XP_008221246.1|  PREDICTED: thaumatin-like protein 1b             91.7    6e-19   
ref|XP_003538880.1|  PREDICTED: thaumatin-like protein 1-like         92.4    6e-19   
ref|XP_009386957.1|  PREDICTED: thaumatin-like protein 1b             92.4    6e-19   
ref|XP_003525190.1|  PREDICTED: thaumatin-like protein-like           91.7    6e-19   
ref|XP_011003321.1|  PREDICTED: pathogenesis-related protein 5-like   92.4    7e-19   
ref|XP_010097569.1|  hypothetical protein L484_017379                 91.7    7e-19   
emb|CDP07730.1|  unnamed protein product                              91.3    7e-19   
ref|XP_004512140.1|  PREDICTED: thaumatin-like protein 1-like         92.0    7e-19   
ref|XP_009351888.1|  PREDICTED: thaumatin-like protein 1              92.0    7e-19   
ref|XP_003517170.1|  PREDICTED: thaumatin-like protein 1-like         92.0    7e-19   
ref|XP_009588211.1|  PREDICTED: thaumatin-like protein 1b             92.0    8e-19   
ref|XP_011045068.1|  PREDICTED: thaumatin-like protein 1b             92.0    8e-19   
ref|XP_009391054.1|  PREDICTED: thaumatin-like protein 1b isoform X2  92.0    8e-19   
ref|XP_009391045.1|  PREDICTED: thaumatin-like protein 1b isoform X1  92.0    8e-19   
ref|XP_008781004.1|  PREDICTED: thaumatin-like protein 1              92.0    8e-19   
dbj|BAE71242.1|  putative thaumatin-like protein                      92.0    9e-19   
gb|KEH20376.1|  pathogenesis-related thaumatin family protein         91.3    9e-19   
ref|XP_006648600.1|  PREDICTED: thaumatin-like protein 1-like         91.7    1e-18   
ref|XP_003629298.1|  Thaumatin-like protein                           91.7    1e-18   
ref|XP_006573555.1|  PREDICTED: thaumatin-like protein 1-like         91.7    1e-18   
ref|XP_004232498.1|  PREDICTED: pathogenesis-related protein 5        91.7    1e-18   
ref|XP_011088584.1|  PREDICTED: thaumatin-like protein 1b             91.7    1e-18   
ref|XP_006369396.1|  hypothetical protein POPTR_0001s22850g           90.9    1e-18   
ref|XP_006340942.1|  PREDICTED: pathogenesis-related protein 5-like   91.7    1e-18   
ref|XP_006369397.1|  hypothetical protein POPTR_0001s22850g           90.9    1e-18   
ref|XP_006850900.1|  hypothetical protein AMTR_s00025p00166890        91.3    1e-18   
ref|XP_002990777.1|  hypothetical protein SELMODRAFT_236128           90.9    1e-18   
gb|ADN33945.1|  thaumatin-like protein                                90.9    1e-18   
ref|XP_010272861.1|  PREDICTED: pathogenesis-related protein 5        91.3    1e-18   
ref|XP_004232497.1|  PREDICTED: thaumatin-like protein 1              91.3    1e-18   
ref|XP_010035339.1|  PREDICTED: thaumatin-like protein 1b isoform X2  90.9    1e-18   
ref|XP_008448547.1|  PREDICTED: thaumatin-like protein 1b             91.3    1e-18   
ref|XP_003628396.1|  Thaumatin-like protein                           90.9    1e-18   
gb|KCW46674.1|  hypothetical protein EUGRSUZ_K00478                   90.9    1e-18   
ref|XP_004985030.1|  PREDICTED: thaumatin-like protein 1-like         91.3    1e-18   
ref|XP_010035338.1|  PREDICTED: thaumatin-like protein 1b isoform X1  91.3    1e-18   
ref|XP_002468235.1|  hypothetical protein SORBIDRAFT_01g042220        90.9    1e-18   
ref|XP_008659675.1|  PREDICTED: thaumatin-like protein 1b             91.3    1e-18   
ref|XP_002991832.1|  hypothetical protein SELMODRAFT_430120           91.3    1e-18   
ref|XP_006369407.1|  hypothetical protein POPTR_0001s22960g           90.5    1e-18   
gb|KEH26933.1|  pathogenesis-related thaumatin family protein         90.5    1e-18   
gb|AIU34433.1|  thaumatin-like protein 2                              90.5    2e-18   
gb|KHN40016.1|  Pathogenesis-related protein 5                        91.3    2e-18   
ref|XP_010662946.1|  PREDICTED: thaumatin-like protein 1              90.9    2e-18   
gb|EYU26305.1|  hypothetical protein MIMGU_mgv1a012734mg              90.5    2e-18   
ref|XP_006341532.1|  PREDICTED: thaumatin-like protein-like           90.5    2e-18   
ref|XP_008457672.1|  PREDICTED: thaumatin-like protein 1b             91.3    2e-18   
ref|XP_004985133.1|  PREDICTED: pathogenesis-related protein 5-like   90.9    2e-18   
ref|XP_009391063.1|  PREDICTED: thaumatin-like protein 1b             90.9    2e-18   
ref|XP_003518288.1|  PREDICTED: thaumatin-like protein 1-like         90.9    2e-18   
ref|XP_004135463.1|  PREDICTED: pathogenesis-related protein 5-like   90.5    2e-18   
ref|XP_003544273.2|  PREDICTED: thaumatin-like protein 1-like         90.9    2e-18   
ref|XP_004952393.1|  PREDICTED: thaumatin-like protein 1a-like        90.9    2e-18   



>emb|CDP07567.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            +T++ +A  FTL N+C++TVWPGTLSGNG A+LG+GGFAL PG +++L APAGWSGRFWA
Sbjct  20   VTSIVSATVFTLQNSCSHTVWPGTLSGNGAAILGDGGFALPPGATIQLSAPAGWSGRFWA  79

Query  190  RTGCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  11
            RTGCNFD SG+G+C TGDCGGLKC GGGVPPV+LAEFTIANG+  KDFYDVSLVDGYNV 
Sbjct  80   RTGCNFDDSGHGSCSTGDCGGLKCTGGGVPPVSLAEFTIANGDNAKDFYDVSLVDGYNVG  139

Query  10   LGI  2
            LGI
Sbjct  140  LGI  142



>ref|XP_009364361.1| PREDICTED: pathogenesis-related protein 5-like [Pyrus x bretschneideri]
Length=246

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            +V  A  FTL N CTYTVWPGTLSGNG A+LGEGGFAL+PG SV+L AP GWSGRFWART
Sbjct  18   DVVYATQFTLQNRCTYTVWPGTLSGNGAAILGEGGFALAPGISVQLTAPLGWSGRFWART  77

Query  184  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            GC FD +GNGNCVTGDCG LKC GGG PPVTLAEFTI +   DKDFYDVSLVDGYNV +G
Sbjct  78   GCTFDDAGNGNCVTGDCGSLKCAGGGAPPVTLAEFTIGSNQGDKDFYDVSLVDGYNVGMG  137

Query  4    I  2
            +
Sbjct  138  L  138



>emb|CDP18679.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   134 bits (337),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            +T++ +A  FTL N+C++TVWPGTLS NG A+LG+GGFALSP  +++L APAGWSGRFWA
Sbjct  14   MTSIVSATVFTLQNSCSHTVWPGTLSSNGAAVLGDGGFALSPTATIQLSAPAGWSGRFWA  73

Query  190  RTGCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  11
             TGCNFD SG+G+C TGDCGGLKC GGGVPPVTLAEFTIANG+  KDFYDVSLVDGYNV+
Sbjct  74   CTGCNFDDSGHGSCSTGDCGGLKCTGGGVPPVTLAEFTIANGDNAKDFYDVSLVDGYNVE  133

Query  10   LGI  2
            LGI
Sbjct  134  LGI  136



>ref|XP_008220752.1| PREDICTED: pathogenesis-related protein 5 [Prunus mume]
Length=249

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV  A  FTL N CTYTVWPGTLSGNG A+LG+GGFAL+P  SV+L AP GWSGRFWART
Sbjct  23   NVVYATVFTLQNRCTYTVWPGTLSGNGAAVLGDGGFALAPDSSVQLTAPRGWSGRFWART  82

Query  184  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            GCNFD SGNG C+TGDCG LKC GGG PPVTLAEFTI +   DKDFYDVSLVDGYNV +G
Sbjct  83   GCNFDDSGNGKCLTGDCGSLKCVGGGAPPVTLAEFTIGSTPGDKDFYDVSLVDGYNVAMG  142

Query  4    I  2
            +
Sbjct  143  L  143



>ref|NP_001268088.1| SCUTL2 precursor [Vitis vinifera]
 gb|AAF06347.1|AF195654_1 SCUTL2 [Vitis vinifera]
Length=243

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            + +  +A  FTL N C+YT+WPGTLSGNG ALLG GGF L PG S++LQAP GWSGRFWA
Sbjct  16   VVSTVSATVFTLENHCSYTIWPGTLSGNGAALLGNGGFVLPPGASIQLQAPFGWSGRFWA  75

Query  190  RTGCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  11
            RTGCNFD++G G C+TGDCG L C GGGVPPV+LAEFTI   +ADKDFYDVSLVDGYNV 
Sbjct  76   RTGCNFDSAGKGTCITGDCGALNCIGGGVPPVSLAEFTIGADSADKDFYDVSLVDGYNVG  135

Query  10   LGI  2
            + I
Sbjct  136  MSI  138



>emb|CAN70296.1| hypothetical protein VITISV_007440 [Vitis vinifera]
Length=243

 Score =   132 bits (331),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C+YT+WPGTLSGNG ALLG GGF L PG S++LQAP GWSGRFWARTGCNFD++
Sbjct  25   FTLENHCSYTIWPGTLSGNGAALLGNGGFVLPPGASIQLQAPFGWSGRFWARTGCNFDSA  84

Query  163  GNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G G C+TGDCG L C GGGVPPV+LAEFTI   +ADKDFYDVSLVDGYNV + I
Sbjct  85   GKGTCITGDCGALNCIGGGVPPVSLAEFTIGADSADKDFYDVSLVDGYNVGMSI  138



>ref|XP_008377347.1| PREDICTED: LOW QUALITY PROTEIN: pathogenesis-related protein 
5-like [Malus domestica]
Length=246

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV  A   TL N CTYTVWPGTLSGNG A+LG+GGFAL+PG SV+L AP GWSGRFW RT
Sbjct  18   NVVYATXVTLQNRCTYTVWPGTLSGNGAAILGDGGFALAPGTSVQLTAPPGWSGRFWGRT  77

Query  184  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            GC FD +GNGNCVTGDCG LKC GGG PPVTLAEFTI +   DKDFYDVSLVDGYNV +G
Sbjct  78   GCTFDDAGNGNCVTGDCGSLKCAGGGAPPVTLAEFTIGSNPGDKDFYDVSLVDGYNVGMG  137

Query  4    I  2
            +
Sbjct  138  L  138



>ref|XP_008357219.1| PREDICTED: pathogenesis-related protein 5-like, partial [Malus 
domestica]
Length=248

 Score =   131 bits (330),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV  A   TL N CTYTVWPGTLSGNG A+LG+GGFAL+PG SV+L AP GWSGRFW RT
Sbjct  20   NVVYATQVTLQNRCTYTVWPGTLSGNGAAILGDGGFALAPGTSVQLTAPPGWSGRFWGRT  79

Query  184  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            GC FD +GNGNCVTGDCG LKC GGG PPVTLAEFTI +   DKDFYDVSLVDGYNV +G
Sbjct  80   GCTFDDAGNGNCVTGDCGSLKCAGGGAPPVTLAEFTIGSNPGDKDFYDVSLVDGYNVGMG  139

Query  4    I  2
            +
Sbjct  140  L  140



>ref|XP_007223736.1| hypothetical protein PRUPE_ppa010458mg [Prunus persica]
 gb|EMJ24935.1| hypothetical protein PRUPE_ppa010458mg [Prunus persica]
Length=249

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV  A  FTL N CTYTVWPGTLSGNG A+LG+GGFAL+P  SV+L AP GWSGRFWART
Sbjct  23   NVVYATVFTLQNRCTYTVWPGTLSGNGAAVLGDGGFALAPDSSVQLTAPRGWSGRFWART  82

Query  184  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            GCNFD SGNG C+TGDCG LKC GGG PPVTLAEFT  +   DKDFYDVSLVDGYNV +G
Sbjct  83   GCNFDDSGNGKCLTGDCGSLKCVGGGAPPVTLAEFTTGSTPGDKDFYDVSLVDGYNVAMG  142

Query  4    I  2
            +
Sbjct  143  L  143



>gb|AEV57470.1| thaumatin-like protein 1 [Prunus persica]
Length=249

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV  A  FTL N CTYTVWPGTLSGNG A+LG+GGFAL+P  SV+L AP GWSGRFWART
Sbjct  23   NVVYATVFTLQNRCTYTVWPGTLSGNGAAVLGDGGFALAPDSSVQLTAPRGWSGRFWART  82

Query  184  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            GCNFD SGNG C+TGDCG LKC GGG PPVTLAEFT  +   DKDFYDVSLVDGYNV +G
Sbjct  83   GCNFDDSGNGKCLTGDCGSLKCVGGGAPPVTLAEFTTGSTPGDKDFYDVSLVDGYNVAMG  142

Query  4    I  2
            +
Sbjct  143  L  143



>ref|XP_009365665.1| PREDICTED: pathogenesis-related protein 5-like [Pyrus x bretschneideri]
Length=246

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV  A  FTL N C+YTVWPGTLSGNG A+LGEGGFAL+PG SV+  AP GWSGRFWART
Sbjct  18   NVVRATQFTLQNRCSYTVWPGTLSGNGAAILGEGGFALAPGTSVQFTAPPGWSGRFWART  77

Query  184  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            GC FD  GNG CVTGDCG LKC GGG PPVTLAEFTI +   DKDFYD+SLVDGYNV +G
Sbjct  78   GCTFDDLGNGKCVTGDCGSLKCAGGGTPPVTLAEFTIGSNPGDKDFYDISLVDGYNVGMG  137

Query  4    I  2
            +
Sbjct  138  L  138



>ref|XP_009778054.1| PREDICTED: pathogenesis-related protein 5-like [Nicotiana sylvestris]
Length=247

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = -2

Query  361  VWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTG  182
            V +A  FTL N C YTVWPGTLS  G A+ G+GGF+LS G S  L AP+GWSGRFWARTG
Sbjct  22   VISATVFTLQNNCPYTVWPGTLSAKGAAISGDGGFSLSHGASASLPAPSGWSGRFWARTG  81

Query  181  CNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            C FD SGNG C+TGDCG LKC G GVPPV+LAEFTIA  N +KDFYD+SLVDGYNV +GI
Sbjct  82   CTFDNSGNGKCITGDCGALKCTGAGVPPVSLAEFTIAKSNNEKDFYDLSLVDGYNVGVGI  141



>ref|XP_004293225.1| PREDICTED: pathogenesis-related protein 5-like [Fragaria vesca 
subsp. vesca]
Length=251

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 97/123 (79%), Gaps = 1/123 (1%)
 Frame = -2

Query  367  TNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWAR  188
            TNV  A  FTL N C YTVWPGTLSGNG A+LGEGGFA+ PG  ++L APAGWSGRFWAR
Sbjct  21   TNVVYATIFTLQNHCPYTVWPGTLSGNGAAVLGEGGFAMFPGAEIQLTAPAGWSGRFWAR  80

Query  187  TGCNFDASGNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  11
            TGCNFD +GNG CVT    G LKC GGG PPVTLAEFT+ +   DKDFYDVSLVDGYNV 
Sbjct  81   TGCNFDEAGNGKCVTGDCGGALKCTGGGEPPVTLAEFTVGSTLTDKDFYDVSLVDGYNVG  140

Query  10   LGI  2
            +G+
Sbjct  141  MGL  143



>gb|AAD55270.1|AC008263_1 Identical to gb|U83490 thaumatin-like protein from Arabidopsis 
thaliana. (This gene is cut off.) EST gb|T20787 comes from 
this gene, partial [Arabidopsis thaliana]
Length=172

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N+C YTVWPGTLSGN   L   G     PG SV+L AP GWSGRFWARTGCN
Sbjct  22   SATVFTLQNSCAYTVWPGTLSGNSITLGDGGFPLT-PGASVQLTAPTGWSGRFWARTGCN  80

Query  175  FDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASG+G CVTG   G LKC GGGVPP TLAEFT+ + NA  DFYDVSLVDGYNV +GI
Sbjct  81   FDASGHGTCVTGDCGGVLKCTGGGVPPATLAEFTVGSSNAGMDFYDVSLVDGYNVKMGI  139



>ref|XP_003549422.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=248

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 102/123 (83%), Gaps = 2/123 (2%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV  A  FTL N C+YTVWPGTLSGNG ALLGEGGFAL+PG +V+L APAGWSGRFWART
Sbjct  22   NVAYATVFTLENHCSYTVWPGTLSGNGAALLGEGGFALAPGSAVQLTAPAGWSGRFWART  81

Query  184  GCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANG-NADKDFYDVSLVDGYNVD  11
            GC+FDASG+G CVTG    GLKC GGGVPP TLAEFT+ +  N +KDFYDVSLVDGYNV 
Sbjct  82   GCSFDASGSGKCVTGDCGSGLKCSGGGVPPATLAEFTLGSASNGNKDFYDVSLVDGYNVG  141

Query  10   LGI  2
            +G+
Sbjct  142  MGV  144



>ref|XP_004501042.1| PREDICTED: pathogenesis-related protein 5-like [Cicer arietinum]
Length=250

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 97/122 (80%), Gaps = 1/122 (1%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV     FT+ N C  T+WPGTLSGNG ALLG+GGF+L PG SV+L A +GWSGRFW RT
Sbjct  22   NVALGTVFTIENHCNNTIWPGTLSGNGAALLGDGGFSLPPGSSVQLTAASGWSGRFWGRT  81

Query  184  GCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            GCNFD +GNGNC+TG   GG+ C GGG PPVTLAEFTI +GN DKDFYDVSLVDGYNV +
Sbjct  82   GCNFDGAGNGNCITGDCAGGMNCNGGGTPPVTLAEFTIGSGNEDKDFYDVSLVDGYNVGM  141

Query  7    GI  2
            GI
Sbjct  142  GI  143



>ref|XP_008364957.1| PREDICTED: pathogenesis-related protein 5-like [Malus domestica]
Length=246

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 95/121 (79%), Gaps = 0/121 (0%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV  A  FTL N C YTVWPGTLSGNG A+LGEGGFAL+PG SV   AP GWSGRFWART
Sbjct  18   NVVRATQFTLQNRCGYTVWPGTLSGNGAAILGEGGFALAPGTSVXFTAPPGWSGRFWART  77

Query  184  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            GC FD  G G CVTGDCG LKC GGG PPVTLAEFTI +   DKDFYDVSLVDGYNV +G
Sbjct  78   GCTFDDXGKGKCVTGDCGSLKCXGGGAPPVTLAEFTIGSXPGDKDFYDVSLVDGYNVGMG  137

Query  4    I  2
            +
Sbjct  138  L  138



>ref|XP_009760388.1| PREDICTED: pathogenesis-related protein 5-like [Nicotiana sylvestris]
Length=248

 Score =   126 bits (316),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N C YTVWPGTLSGNG ++ G+ GFAL+PG +++L AP GWSGRFWARTGC+
Sbjct  24   SATQFTLQNNCGYTVWPGTLSGNGVSISGDAGFALTPGATIQLSAPGGWSGRFWARTGCS  83

Query  175  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTI--ANGNADKDFYDVSLVDGYNVDLGI  2
            FD SGNG C TGDCG LKC GGG PPV+L EFTI  ANGN  KDFYDVSLVDGYNV +G+
Sbjct  84   FDDSGNGKCTTGDCGALKCIGGGEPPVSLVEFTIANANGNDQKDFYDVSLVDGYNVGIGV  143



>ref|XP_009595245.1| PREDICTED: pathogenesis-related protein 5 [Nicotiana tomentosiformis]
Length=248

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N C YTVWPGTLSGNG ++ G+ GFAL+PG +++L AP GWSGRFWARTGC+
Sbjct  24   SATQFTLQNNCGYTVWPGTLSGNGVSISGDAGFALTPGATIQLSAPGGWSGRFWARTGCS  83

Query  175  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTI--ANGNADKDFYDVSLVDGYNVDLGI  2
            FD SGNG C TGDCG LKC GGG PPV+L EFTI  ANGN  KDFYDVSLVDGYNV +G+
Sbjct  84   FDDSGNGKCKTGDCGALKCIGGGEPPVSLVEFTIANANGNDQKDFYDVSLVDGYNVGIGV  143



>ref|NP_177640.1| thaumatin-like protein 3 [Arabidopsis thaliana]
 gb|AAG51927.1|AC013258_21 thaumatin-like protein; 28949-28112 [Arabidopsis thaliana]
 dbj|BAD43106.1| thaumatin-like protein [Arabidopsis thaliana]
 gb|ABN04791.1| At1g75030 [Arabidopsis thaliana]
 gb|AEE35664.1| thaumatin-like protein 3 [Arabidopsis thaliana]
Length=246

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 87/115 (76%), Gaps = 2/115 (2%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N+C YTVWPGTLSGN   L   G     PG SV+L AP GWSGRFWARTGCNFDAS
Sbjct  26   FTLQNSCAYTVWPGTLSGNSITLGDGGFPLT-PGASVQLTAPTGWSGRFWARTGCNFDAS  84

Query  163  GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G+G CVTG   G LKC GGGVPP TLAEFT+ + NA  DFYDVSLVDGYNV +GI
Sbjct  85   GHGTCVTGDCGGVLKCTGGGVPPATLAEFTVGSSNAGMDFYDVSLVDGYNVKMGI  139



>gb|AAB71214.1| thaumatin-like protein [Arabidopsis thaliana]
Length=245

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 87/115 (76%), Gaps = 2/115 (2%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N+C YTVWPGTLSGN   L   G     PG SV+L AP GWSGRFWARTGCNFDAS
Sbjct  26   FTLQNSCAYTVWPGTLSGNSITLGDGGFPLT-PGASVQLTAPTGWSGRFWARTGCNFDAS  84

Query  163  GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G+G CVTG   G LKC GGGVPP TLAEFT+ + NA  DFYDVSLVDGYNV +GI
Sbjct  85   GHGTCVTGDCGGVLKCTGGGVPPATLAEFTVGSSNAGMDFYDVSLVDGYNVKMGI  139



>ref|XP_011031355.1| PREDICTED: pathogenesis-related protein 5 [Populus euphratica]
Length=247

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 94/122 (77%), Gaps = 1/122 (1%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV  A  FTL N C+YT+WPGTLSGNG A LG+GGF L+PG S++LQAP GWSGRFWART
Sbjct  20   NVGNATVFTLQNQCSYTLWPGTLSGNGAATLGDGGFTLAPGASIQLQAPPGWSGRFWART  79

Query  184  GCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            GC FD SG+G CVTG   G L C GGG PPV+L EFTI     DKDFYDVSLVDGYNV L
Sbjct  80   GCVFDESGSGKCVTGDCGGILNCIGGGAPPVSLVEFTIGTNRNDKDFYDVSLVDGYNVGL  139

Query  7    GI  2
            G+
Sbjct  140  GV  141



>ref|XP_010106041.1| hypothetical protein L484_021218 [Morus notabilis]
 gb|EXC07311.1| hypothetical protein L484_021218 [Morus notabilis]
Length=251

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV  A  FTL N C YTVWPGTLSGNG   LG+GGF L PGESV+  AP GWSGRFW RT
Sbjct  22   NVGDATVFTLQNRCGYTVWPGTLSGNGAGNLGDGGFVLPPGESVQFTAPPGWSGRFWGRT  81

Query  184  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            GC FD SG G C TGDCG LKC GGG PPVTL EFT+ + +++KDFYDVSLVDGYNV +G
Sbjct  82   GCTFDKSGKGKCATGDCGPLKCTGGGAPPVTLVEFTVGSTSSEKDFYDVSLVDGYNVGMG  141

Query  4    I  2
            +
Sbjct  142  V  142



>ref|XP_003545287.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=246

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            + NV  A  FTL N C+YTVWPGTLSGNG A +G+GGF ++PG SV+L AP+GWSGR W 
Sbjct  20   LGNVAYATVFTLENHCSYTVWPGTLSGNGAATIGDGGFPMAPGSSVQLTAPSGWSGRLWP  79

Query  190  RTGCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNV  14
            RTGCNFDASGNG C+TG   GG++C GGGVPP TLAEFTI +G   KDFYDVSLVDGYNV
Sbjct  80   RTGCNFDASGNGKCLTGYCAGGMRCTGGGVPPATLAEFTIGSGG--KDFYDVSLVDGYNV  137

Query  13   DLGI  2
             +G+
Sbjct  138  GVGV  141



>ref|XP_006390357.1| hypothetical protein EUTSA_v10019680mg [Eutrema salsugineum]
 gb|ESQ27643.1| hypothetical protein EUTSA_v10019680mg [Eutrema salsugineum]
Length=246

 Score =   125 bits (313),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N+C YTVWPG LSGN   L   G     PG SV+L AP GWSGRFWARTGC+
Sbjct  22   SATVFTLQNSCPYTVWPGILSGNSNTLGDGGFPLT-PGASVQLTAPPGWSGRFWARTGCS  80

Query  175  FDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD+SG+GNCVTG   G LKC GGGVPP TLAEFT+ +G++ KDFYDVSLVDGYNV++GI
Sbjct  81   FDSSGHGNCVTGDCGGVLKCIGGGVPPTTLAEFTVGSGDSGKDFYDVSLVDGYNVEMGI  139



>ref|XP_003545289.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=251

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 96/123 (78%), Gaps = 2/123 (2%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV  A  FTL N C+YTVWPGTLSGN  A+LG GGFAL+PG +V L APAGWSGRFWART
Sbjct  22   NVANATVFTLENHCSYTVWPGTLSGNSAAILGGGGFALAPGSAVRLIAPAGWSGRFWART  81

Query  184  GCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANG-NADKDFYDVSLVDGYNVD  11
            GC FD SG G C TG   GGL+C G GVPPVTLAEFTI +  N +KDFYDVSLVDGYNV 
Sbjct  82   GCRFDGSGAGKCTTGDCAGGLRCTGSGVPPVTLAEFTIGSASNGNKDFYDVSLVDGYNVG  141

Query  10   LGI  2
            +G+
Sbjct  142  MGV  144



>ref|XP_010428506.1| PREDICTED: pathogenesis-related protein 5 isoform X2 [Camelina 
sativa]
Length=246

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N+C YTVWPG LSGN   L   G     PG SV+L APAGWSGRFWARTGCN
Sbjct  23   SATVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLT-PGASVQLTAPAGWSGRFWARTGCN  81

Query  175  FDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASG+GNCVTG   G LKC GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV++GI
Sbjct  82   FDASGHGNCVTGDCGGVLKCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMGI  139



>ref|XP_010416369.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=246

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 91/119 (76%), Gaps = 3/119 (3%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N+C YTVWPG LSGN   L   G     PG SV+L APAGWSGRFWARTGCN
Sbjct  23   SATVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLT-PGASVQLTAPAGWSGRFWARTGCN  81

Query  175  FDASGNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASG+GNCVT    G LKC GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV++GI
Sbjct  82   FDASGHGNCVTGDCGGVLKCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMGI  139



>gb|EYU45112.1| hypothetical protein MIMGU_mgv1a012469mg [Erythranthe guttata]
Length=249

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            ++N  +A  FTL N+C YT+WPGT  GNG +LLGEGGFALSPG + +  AP GWSGRFWA
Sbjct  21   LSNYVSATVFTLQNSCNYTIWPGTHCGNGASLLGEGGFALSPGATTQFPAPPGWSGRFWA  80

Query  190  RTGCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNV  14
            RTGCNFD++GNGNC TG   G L C GGG PPV+LAEFTI  G++  DFYDVSLVDGYNV
Sbjct  81   RTGCNFDSAGNGNCTTGDCGGKLNCAGGGEPPVSLAEFTIGGGSSTMDFYDVSLVDGYNV  140

Query  13   DLGI  2
             LG+
Sbjct  141  GLGV  144



>ref|XP_010428505.1| PREDICTED: pathogenesis-related protein 5 isoform X1 [Camelina 
sativa]
Length=245

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N+C YTVWPG LSGN   L   G     PG SV+L APAGWSGRFWARTGCN
Sbjct  22   SATVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLT-PGASVQLTAPAGWSGRFWARTGCN  80

Query  175  FDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASG+GNCVTG   G LKC GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV++GI
Sbjct  81   FDASGHGNCVTGDCGGVLKCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMGI  138



>ref|XP_002887572.1| hypothetical protein ARALYDRAFT_316436 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63831.1| hypothetical protein ARALYDRAFT_316436 [Arabidopsis lyrata subsp. 
lyrata]
Length=245

 Score =   124 bits (311),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 92/119 (77%), Gaps = 3/119 (3%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N+C YTVWPG LSGN   L   G     PG SV+L APAGWSGRFWARTGCN
Sbjct  22   SATVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLT-PGASVQLTAPAGWSGRFWARTGCN  80

Query  175  FDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASG+GNCVTG   G LKC GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV++GI
Sbjct  81   FDASGHGNCVTGDCGGVLKCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMGI  138



>gb|KEH40091.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=249

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 100/123 (81%), Gaps = 2/123 (2%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            N+ +A  FT+ N C+YT+WPGTLSGNG A+LG+GGF L+PG SV L APAGWSGRFWART
Sbjct  21   NLASATVFTIQNQCSYTIWPGTLSGNGAAILGQGGFLLAPGASVSLTAPAGWSGRFWART  80

Query  184  GCNFDASGNGNCVTgdc-gglkcgggGVPPVTLAEFTIAN-GNADKDFYDVSLVDGYNVD  11
            GC FD +GNG CVTGDC GGL C GGG PPVTLAEFTI + GN  KDFYDVSLVDGYN  
Sbjct  81   GCEFDGAGNGKCVTGDCPGGLNCIGGGTPPVTLAEFTIGSAGNGGKDFYDVSLVDGYNAG  140

Query  10   LGI  2
            +G+
Sbjct  141  MGV  143



>ref|XP_006301180.1| hypothetical protein CARUB_v10021579mg [Capsella rubella]
 gb|EOA34078.1| hypothetical protein CARUB_v10021579mg [Capsella rubella]
Length=247

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 91/119 (76%), Gaps = 3/119 (3%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N+C YTVWPG LSGN   L   G     PG SV+L APAGWSGRFWARTGCN
Sbjct  24   SATVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLT-PGASVQLTAPAGWSGRFWARTGCN  82

Query  175  FDASGNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASG+GNCVT    G LKC GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV++GI
Sbjct  83   FDASGHGNCVTGDCGGVLKCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMGI  140



>ref|XP_002887570.1| hypothetical protein ARALYDRAFT_476641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63829.1| hypothetical protein ARALYDRAFT_476641 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 89/119 (75%), Gaps = 2/119 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N+C YTVWPGTLSGN   L   G     PG SV+L AP GWSGRFWARTGCN
Sbjct  22   SATVFTLLNSCPYTVWPGTLSGNSVTLGDGGFPLT-PGASVQLTAPTGWSGRFWARTGCN  80

Query  175  FDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASG+G CVTG   G LKC GGGVPP TLAEFT+ + NA  DFYDVSLVDGYNV +GI
Sbjct  81   FDASGHGTCVTGDCGGVLKCTGGGVPPATLAEFTVGSSNAGMDFYDVSLVDGYNVKMGI  139



>ref|NP_177642.2| pathogenesis-related thaumatin-like protein protein [Arabidopsis 
thaliana]
 gb|ABE65774.1| thaumatin-like protein/pathogenesis-like protein [Arabidopsis 
thaliana]
 gb|AEE35666.1| pathogenesis-related thaumatin-like protein protein [Arabidopsis 
thaliana]
Length=246

 Score =   123 bits (309),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 92/121 (76%), Gaps = 3/121 (2%)
 Frame = -2

Query  361  VWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTG  182
            V AA  FTL N+C YTVWPG LSGN   L   G     PG SV+L APAGWSGRFWARTG
Sbjct  21   VSAATVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLT-PGASVQLTAPAGWSGRFWARTG  79

Query  181  CNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            CNFDASG+GNC TG   G LKC GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV++G
Sbjct  80   CNFDASGHGNCGTGDCGGVLKCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMG  138

Query  4    I  2
            I
Sbjct  139  I  139



>gb|AAG51919.1|AC013258_13 thaumatin-like protein; 23251-22305 [Arabidopsis thaliana]
Length=257

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 92/121 (76%), Gaps = 3/121 (2%)
 Frame = -2

Query  361  VWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTG  182
            V AA  FTL N+C YTVWPG LSGN   L   G     PG SV+L APAGWSGRFWARTG
Sbjct  32   VSAATVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLT-PGASVQLTAPAGWSGRFWARTG  90

Query  181  CNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            CNFDASG+GNC TG   G LKC GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV++G
Sbjct  91   CNFDASGHGNCGTGDCGGVLKCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMG  149

Query  4    I  2
            I
Sbjct  150  I  150



>ref|XP_006375059.1| hypothetical protein POPTR_0014s04020g [Populus trichocarpa]
 gb|ERP52856.1| hypothetical protein POPTR_0014s04020g [Populus trichocarpa]
Length=247

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV  A  FTL N C+YT+WPGTLSGNG A LG+GGF L+PG S++ QAP GWSGRFWART
Sbjct  20   NVGNATVFTLQNQCSYTLWPGTLSGNGAATLGDGGFTLAPGASIQFQAPPGWSGRFWART  79

Query  184  GCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            GC FD SG+G CVTG   G L C GGG PPV+L EFTI     DKDFYDVSLVDGYNV L
Sbjct  80   GCVFDESGSGKCVTGDCGGTLNCIGGGAPPVSLVEFTIGTNPNDKDFYDVSLVDGYNVGL  139

Query  7    GI  2
            G+
Sbjct  140  GV  141



>ref|XP_009106158.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=243

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
             FTL N C YTVWPGTL+GNGG +LG+GG+ L+PG SV+L+AP GW+GRFWARTGCNFD+
Sbjct  25   EFTLQNNCPYTVWPGTLTGNGGNILGDGGYQLNPGASVQLRAPPGWTGRFWARTGCNFDS  84

Query  166  SGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            SGNG CVTGDC       G GGVPPVTLAEFT+     +KD+YDVSLVDGYNV +GI
Sbjct  85   SGNGKCVTGDCGGVLKCAGAGGVPPVTLAEFTV----GEKDYYDVSLVDGYNVKMGI  137



>emb|CDY68760.1| BnaAnng28270D [Brassica napus]
Length=246

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 87/115 (76%), Gaps = 2/115 (2%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N+C YTVWPG LSGN   L   G     PG S +L AP GWSGRFWARTGC+FD+S
Sbjct  26   FTLQNSCPYTVWPGILSGNSNTLGDGGFPLT-PGASKQLTAPQGWSGRFWARTGCSFDSS  84

Query  163  GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            GNGNCVTG   G LKC GGGVPP TLAEFT+  G + KDFYDVSLVDGYNV++GI
Sbjct  85   GNGNCVTGDCGGVLKCIGGGVPPTTLAEFTVGTGVSGKDFYDVSLVDGYNVEMGI  139



>ref|XP_009106162.1| PREDICTED: pathogenesis-related protein 5 [Brassica rapa]
Length=246

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 87/115 (76%), Gaps = 2/115 (2%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N+C YTVWPG LSGN   L   G     PG S +L AP GWSGRFWARTGC+FD+S
Sbjct  26   FTLQNSCPYTVWPGILSGNSNTLGDGGFPLT-PGASKQLTAPQGWSGRFWARTGCSFDSS  84

Query  163  GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            GNGNCVTG   G LKC GGGVPP TLAEFT+  G + KDFYDVSLVDGYNV++GI
Sbjct  85   GNGNCVTGDCGGVLKCIGGGVPPTTLAEFTVGTGVSGKDFYDVSLVDGYNVEMGI  139



>emb|CDX73133.1| BnaC06g35810D [Brassica napus]
Length=243

 Score =   122 bits (306),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 6/117 (5%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
             FTL N C YTVWPGTL+GNGG +LG+GG+ L+PG SV+L+AP GW+GRFWARTGCNFD+
Sbjct  25   EFTLQNNCPYTVWPGTLTGNGGNILGDGGYQLNPGASVQLRAPPGWTGRFWARTGCNFDS  84

Query  166  SGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            SGNG CVTGDC       G GGVPPVTLAEFT+     +KD+YDVSLVDGYNV +GI
Sbjct  85   SGNGKCVTGDCGGVLKCAGAGGVPPVTLAEFTV----GEKDYYDVSLVDGYNVKMGI  137



>emb|CDY59465.1| BnaCnng34970D [Brassica napus]
Length=247

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 94/126 (75%), Gaps = 4/126 (3%)
 Frame = -2

Query  370  ITNVWAAGS--FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRF  197
            ITNV A  +  FTL N+C YTVWPG LSGN   L   G    S G SV+L AP GWSGRF
Sbjct  16   ITNVIAVSATVFTLQNSCPYTVWPGILSGNSNTLGDGGFPLTS-GASVQLTAPPGWSGRF  74

Query  196  WARTGCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
            WARTGC+FD+SG+GNCVTG   G LKC GGGVPP TLAEFT+ +G   KDFYDVSLVDGY
Sbjct  75   WARTGCSFDSSGHGNCVTGDCGGVLKCIGGGVPPTTLAEFTVGSGAYGKDFYDVSLVDGY  134

Query  19   NVDLGI  2
            NV++GI
Sbjct  135  NVEMGI  140



>gb|KGN62571.1| hypothetical protein Csa_2G361370 [Cucumis sativus]
Length=243

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 98/122 (80%), Gaps = 1/122 (1%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            N+  A  FTL N C+YT+WPGTLSGNG A+LG+GGF L+PG SV+L AP GWSGRFWART
Sbjct  18   NLAFATVFTLQNHCSYTLWPGTLSGNGAAVLGDGGFPLAPGASVQLPAPPGWSGRFWART  77

Query  184  GCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            GC+FD SGNG C TG   G LKC GGG+PPVTLAEFTI + + + DFYD+SLVDGYNV +
Sbjct  78   GCDFDGSGNGKCQTGDCGGTLKCNGGGLPPVTLAEFTIGSSSGNMDFYDISLVDGYNVGM  137

Query  7    GI  2
            G+
Sbjct  138  GV  139



>emb|CDY46016.1| BnaA02g17100D [Brassica napus]
Length=247

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 85/115 (74%), Gaps = 2/115 (2%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N+C YTVWPG LSGN   L   G     PG SVEL AP GWSGRFWARTGCNFD+S
Sbjct  26   FTLENSCPYTVWPGILSGNANTLGEGGFPLT-PGASVELNAPPGWSGRFWARTGCNFDSS  84

Query  163  GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G+G CVTG   G LKC G GVPP TLAEFT+ + N+  DFYDVSLVDGYNV +GI
Sbjct  85   GHGTCVTGDCGGALKCTGNGVPPATLAEFTVGSSNSGMDFYDVSLVDGYNVKMGI  139



>ref|XP_004152784.1| PREDICTED: pathogenesis-related protein 5-like [Cucumis sativus]
 ref|XP_004160053.1| PREDICTED: pathogenesis-related protein 5-like [Cucumis sativus]
Length=260

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 98/122 (80%), Gaps = 1/122 (1%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            N+  A  FTL N C+YT+WPGTLSGNG A+LG+GGF L+PG SV+L AP GWSGRFWART
Sbjct  35   NLAFATVFTLQNHCSYTLWPGTLSGNGAAVLGDGGFPLAPGASVQLPAPPGWSGRFWART  94

Query  184  GCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            GC+FD SGNG C TG   G LKC GGG+PPVTLAEFTI + + + DFYD+SLVDGYNV +
Sbjct  95   GCDFDGSGNGKCQTGDCGGTLKCNGGGLPPVTLAEFTIGSSSGNMDFYDISLVDGYNVGM  154

Query  7    GI  2
            G+
Sbjct  155  GV  156



>ref|XP_007160787.1| hypothetical protein PHAVU_001G016600g [Phaseolus vulgaris]
 gb|ESW32781.1| hypothetical protein PHAVU_001G016600g [Phaseolus vulgaris]
Length=244

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 96/125 (77%), Gaps = 2/125 (2%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            + NV +   FTL N C+YTVWPGTLSGNG A LG+GGF L PG  V+L AP+GWSGR WA
Sbjct  17   LGNVVSGAVFTLQNRCSYTVWPGTLSGNGVATLGDGGFPLEPGAEVQLTAPSGWSGRIWA  76

Query  190  RTGCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIA-NGNADKDFYDVSLVDGYN  17
            RTGC+FD SG G C TG   GGL+C GGGVPP TLAEFTI   GN DKDFYDVSLVDGYN
Sbjct  77   RTGCSFDGSGIGTCATGDCAGGLRCTGGGVPPATLAEFTIGFAGNGDKDFYDVSLVDGYN  136

Query  16   VDLGI  2
            V +G+
Sbjct  137  VGIGV  141



>gb|KDP38462.1| hypothetical protein JCGZ_04387 [Jatropha curcas]
Length=244

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            N+  A  FT+ N C+YT+WPGTLSGNG A+LG+GGFAL  G S++LQAP  WSGRFWART
Sbjct  18   NLANAAVFTIQNLCSYTIWPGTLSGNGAAILGDGGFALPSGTSIQLQAPPNWSGRFWART  77

Query  184  GCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            GC FD SGNG CVTG   G LKC GGG PPVTL EFTIA    DKDFYDVSLVDGYNV +
Sbjct  78   GCTFDESGNGKCVTGDCGGLLKCTGGGAPPVTLVEFTIAANANDKDFYDVSLVDGYNVGV  137

Query  7    GI  2
            G+
Sbjct  138  GV  139



>ref|XP_011074598.1| PREDICTED: pathogenesis-related protein 5-like [Sesamum indicum]
Length=265

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 104/128 (81%), Gaps = 4/128 (3%)
 Frame = -2

Query  373  GITNVWAAGS-FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRF  197
            G+  + A+G+ FTL N+C+YTVWPGTLSGNG A+LG GGFA++PG+++EL AP GWSGRF
Sbjct  33   GVFTINASGTVFTLQNSCSYTVWPGTLSGNGPAILGGGGFAMAPGDTIELPAPPGWSGRF  92

Query  196  WARTGCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNAD--KDFYDVSLVD  26
            WARTGC FD +G GNC TG   G LKC GGGVPPV+L EFTIA+G A+  KDFYDVSLVD
Sbjct  93   WARTGCLFDDAGTGNCTTGDCGGILKCTGGGVPPVSLVEFTIASGGANLGKDFYDVSLVD  152

Query  25   GYNVDLGI  2
            GYNV L +
Sbjct  153  GYNVGLSV  160



>ref|XP_008444682.1| PREDICTED: pathogenesis-related protein 5-like [Cucumis melo]
Length=243

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            N+  A  FTL N C+YT+WPGTLSGNG A+LG+GGF L+PG S++L AP GWSGRFWART
Sbjct  18   NLAFATVFTLQNHCSYTLWPGTLSGNGAAVLGDGGFPLAPGTSMQLTAPPGWSGRFWART  77

Query  184  GCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            GC+FD+SGNG C TG   G LKC GGG+PPVTLAEFTI + + + DFYD+SLVDGYNV +
Sbjct  78   GCDFDSSGNGKCQTGDCGGTLKCTGGGMPPVTLAEFTIGSSSNNMDFYDISLVDGYNVGM  137

Query  7    GI  2
            G+
Sbjct  138  GV  139



>gb|KEH36134.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=250

 Score =   121 bits (303),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 96/122 (79%), Gaps = 1/122 (1%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV +   FT+ N C  T+WPGTLSGNG  LLG+GGF+L PG S ++ AP GWSGRFW RT
Sbjct  22   NVASGTMFTIENRCNNTIWPGTLSGNGAELLGDGGFSLPPGSSFDVTAPPGWSGRFWGRT  81

Query  184  GCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            GCNFD +GNGNC+TG   GGLKC GGG PPVTLAEFTI + + DKDFYDVSLVDGYNV +
Sbjct  82   GCNFDGAGNGNCITGDCTGGLKCNGGGAPPVTLAEFTIGSVSGDKDFYDVSLVDGYNVGI  141

Query  7    GI  2
            GI
Sbjct  142  GI  143



>ref|NP_177641.1| pathogenesis-related protein 5 [Arabidopsis thaliana]
 sp|P28493.1|PR5_ARATH RecName: Full=Pathogenesis-related protein 5; Short=PR-5; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51923.1|AC013258_17 thaumatin-like protein; 25613-24636 [Arabidopsis thaliana]
 gb|AAA32865.1| thaumatin-like protein [Arabidopsis thaliana]
 gb|AAB68336.1| thaumatin-like protein [Arabidopsis thaliana]
 gb|AAK59672.1| putative thaumatin protein [Arabidopsis thaliana]
 gb|AAL15220.1| putative thaumatin protein [Arabidopsis thaliana]
 gb|AEE35665.1| pathogenesis-related protein 5 [Arabidopsis thaliana]
Length=239

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 89/117 (76%), Gaps = 2/117 (2%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A  FTL N C  TVW GTL+G G  L   G     PG S +L APAGWSGRFWARTGCNF
Sbjct  23   ATDFTLRNNCPTTVWAGTLAGQGPKLGDGGFELT-PGASRQLTAPAGWSGRFWARTGCNF  81

Query  172  DASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            DASGNG CVTGDCGGL+C GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV LGI
Sbjct  82   DASGNGRCVTGDCGGLRCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVKLGI  137



>ref|XP_003545288.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=250

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            + N+  A  FTL N C+YTVWPGTLSGNG A LG+GGF ++PG S +L AP+GWSGR WA
Sbjct  20   LGNIAYATVFTLENHCSYTVWPGTLSGNGVATLGDGGFPMAPGSSAQLTAPSGWSGRLWA  79

Query  190  RTGCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTI--ANGNADKDFYDVSLVDGY  20
            RTGC+FDASGNG C+TG   GG++C G GVPP TLAEFT+  A     KDFYDVSLVDGY
Sbjct  80   RTGCSFDASGNGKCLTGDCAGGMRCTGAGVPPATLAEFTVGSAGKGGGKDFYDVSLVDGY  139

Query  19   NVDLGI  2
            NV +G+
Sbjct  140  NVGVGV  145



>ref|XP_010428504.1| PREDICTED: pathogenesis-related protein 5 [Camelina sativa]
Length=246

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N+C YTVWPGTLSGN   L   G     PG SV+L AP GWSGRFWART CN
Sbjct  22   SATVFTLQNSCPYTVWPGTLSGNSITLGDGGFQLT-PGASVQLTAPVGWSGRFWARTSCN  80

Query  175  FDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASG G CVTG   G LKC GGG PP TLAEFT+ + NA  DFYDVSLVDGYNV +GI
Sbjct  81   FDASGRGTCVTGDCGGVLKCIGGGEPPATLAEFTVGSSNAGMDFYDVSLVDGYNVKMGI  139



>gb|KFK33653.1| hypothetical protein AALP_AA5G041900 [Arabis alpina]
Length=249

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 88/121 (73%), Gaps = 2/121 (2%)
 Frame = -2

Query  361  VWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTG  182
            V +A  FTL N C YTVWPG LSGN   L   G     PG SV+L +P GWSGRFWARTG
Sbjct  20   VVSATVFTLQNNCPYTVWPGILSGNSNNLGDGGFPLT-PGASVQLTSPPGWSGRFWARTG  78

Query  181  CNFDASGNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            CNFD++G G+CVT    G LKC G GVPP TLAEFT+ +  +DKDFYDVSLVDGYNV++G
Sbjct  79   CNFDSTGRGSCVTGDCGGILKCTGSGVPPATLAEFTVGSSISDKDFYDVSLVDGYNVEMG  138

Query  4    I  2
            I
Sbjct  139  I  139



>ref|XP_010416362.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=246

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FT+ N+C YTVWPGTLSGN   L   G     PG SV+L AP GWSGRFW RTGCN
Sbjct  22   SATVFTIQNSCPYTVWPGTLSGNSITLGDGGFQLT-PGASVQLTAPVGWSGRFWGRTGCN  80

Query  175  FDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASG G CVTG   G LKC GGG PP TLAEFT+ + NA  DFYDVSLVDGYNV +GI
Sbjct  81   FDASGRGTCVTGDCGGVLKCIGGGEPPATLAEFTVGSSNAGMDFYDVSLVDGYNVKMGI  139



>ref|XP_010471602.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=246

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 86/119 (72%), Gaps = 2/119 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FT+ N+C YTVWPGTLSGN   L   G     PG SV+L AP GWSGRFW RTGCN
Sbjct  22   SATVFTIQNSCPYTVWPGTLSGNSITLGDGGFQLT-PGASVQLTAPVGWSGRFWGRTGCN  80

Query  175  FDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASG G CVTG   G LKC GGG PP TLAEFT+ + NA  DFYDVSLVDGYNV +GI
Sbjct  81   FDASGRGTCVTGDCGGVLKCIGGGEPPATLAEFTVGSSNAGMDFYDVSLVDGYNVKMGI  139



>ref|XP_011083734.1| PREDICTED: pathogenesis-related protein 5-like [Sesamum indicum]
Length=246

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = -2

Query  373  GITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFW  194
            G+ +   A  FTL N+C+YT+WPGTL+GNGGA+LG+GGFAL+PG +++L AP GWSGRFW
Sbjct  17   GMVSSVMATVFTLQNSCSYTIWPGTLTGNGGAILGDGGFALAPGATIQLPAPPGWSGRFW  76

Query  193  ARTGCNFDASGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
            ARTGCNFD SGNG+C+T          G GG PPV+L E TI++   DKDFYDVSLVDGY
Sbjct  77   ARTGCNFDDSGNGHCITGDCGGTLKCGGRGGAPPVSLVELTISS-RGDKDFYDVSLVDGY  135

Query  19   NVDLGI  2
            NV +G+
Sbjct  136  NVGIGV  141



>ref|XP_010254957.1| PREDICTED: pathogenesis-related protein 5 [Nelumbo nucifera]
Length=244

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C Y VWPGTLSGNGGA+LGEGGF+L+PG SV+L AP GWSGRFWARTGCNF  S
Sbjct  25   FTLQNHCAYMVWPGTLSGNGGAVLGEGGFSLAPGASVQLTAPPGWSGRFWARTGCNFHDS  84

Query  163  GNGNCVTgdcgglkcgggGVPPVTLAEFTIA-NGNADKDFYDVSLVDGYNVDLGI  2
            GNG C+TGDCGGLKC GGG PPVTLAEFT   +G  + DFYDVSLVDGYNV +G+
Sbjct  85   GNGKCITGDCGGLKCAGGGAPPVTLAEFTTGVSGTNNMDFYDVSLVDGYNVGMGV  139



>ref|XP_010246990.1| PREDICTED: pathogenesis-related protein 5 [Nelumbo nucifera]
Length=248

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 93/116 (80%), Gaps = 2/116 (2%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C YTVWPG LSGNG A+LG+GGF+L PG S++L AP GWSGRFWARTGCNFD S
Sbjct  26   FTLQNFCGYTVWPGVLSGNGAAVLGDGGFSLPPGASLQLTAPPGWSGRFWARTGCNFDES  85

Query  163  GNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNAD--KDFYDVSLVDGYNVDLGI  2
            GNG C TGDCGGL C GGG PPVTL EFTI   + D  KDFYDVSLVDGYNV +G+
Sbjct  86   GNGKCATGDCGGLNCAGGGAPPVTLVEFTIGTNDNDNNKDFYDVSLVDGYNVGMGV  141



>ref|XP_010471608.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=247

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 89/119 (75%), Gaps = 3/119 (3%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N+C YTVWPG LSGN   L   G     PG SV+L APAGWSGRFWARTGCN
Sbjct  24   SATVFTLQNSCPYTVWPGILSGNDNTLGDGGFPLT-PGASVQLTAPAGWSGRFWARTGCN  82

Query  175  FDASGNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASG+GNC T    G LKC GGG PPVTLAEFT+  G+  KDFYDVSLVDGYNV++GI
Sbjct  83   FDASGHGNCETGDCGGVLKCNGGGFPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMGI  140



>emb|CDX73137.1| BnaC06g35850D [Brassica napus]
Length=246

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N+C YT+WPG LSGN   L   G     PG S +L AP GWSGRFW RTGC+
Sbjct  22   SATVFTLQNSCPYTIWPGILSGNSNTLGDGGFPLT-PGASKQLTAPQGWSGRFWPRTGCS  80

Query  175  FDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD+SGNGNCVTG   G LKC GGGVPP TLAEFT+  G + KDFYDVSLVDGYNV++GI
Sbjct  81   FDSSGNGNCVTGDCGGVLKCIGGGVPPTTLAEFTVETGVSGKDFYDVSLVDGYNVEMGI  139



>ref|XP_009128072.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=247

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 84/115 (73%), Gaps = 2/115 (2%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N+C Y VWPG LSGN   L   G     PG SVEL AP GWSGRFWARTGCNFD+S
Sbjct  26   FTLENSCPYIVWPGILSGNANTLGEGGFPLT-PGASVELNAPPGWSGRFWARTGCNFDSS  84

Query  163  GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G+G CVTG   G LKC G GVPP TLAEFT+ + N+  DFYDVSLVDGYNV +GI
Sbjct  85   GHGTCVTGDCGGALKCTGNGVPPATLAEFTVGSSNSGMDFYDVSLVDGYNVKMGI  139



>ref|XP_004238220.1| PREDICTED: pathogenesis-related protein 5 [Solanum lycopersicum]
Length=247

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 89/120 (74%), Gaps = 2/120 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N C YTVWPGTLSGNG  + G+ GFAL+PG +++L AP G+SGRFW RTGCN
Sbjct  23   SATQFTLQNNCGYTVWPGTLSGNGVPISGDSGFALTPGATIQLSAPGGFSGRFWGRTGCN  82

Query  175  FDASGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            F+++G G C+T          G GG PPV+L EFTIA  NA+KDFYDVSLVDGYNV +G+
Sbjct  83   FNSTGAGKCITGDCGALKCPSGAGGAPPVSLVEFTIAKTNAEKDFYDVSLVDGYNVGIGV  142



>ref|XP_002887571.1| hypothetical protein ARALYDRAFT_895371 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63830.1| hypothetical protein ARALYDRAFT_895371 [Arabidopsis lyrata subsp. 
lyrata]
Length=239

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 90/118 (76%), Gaps = 2/118 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FT+ N C  TVW GTL+G G  L   G     PG S +L APAGWSGRFWARTGCN
Sbjct  22   SATDFTIKNNCPNTVWAGTLAGQGPKLGDGGFELT-PGASRQLTAPAGWSGRFWARTGCN  80

Query  175  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASGNG CVTGDCGGL+C GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV LGI
Sbjct  81   FDASGNGRCVTGDCGGLRCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVKLGI  137



>emb|CDY37263.1| BnaCnng08170D [Brassica napus]
Length=247

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 84/115 (73%), Gaps = 2/115 (2%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N+C YTVWPG LSGN   L   G     PG S++L AP GWSGRFWARTGC+FD+S
Sbjct  26   FTLENSCPYTVWPGILSGNTNTLGEGGFPLT-PGASIQLNAPPGWSGRFWARTGCSFDSS  84

Query  163  GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G G CVTG   G LKC G GVPP TLAEFT+ + N+  DFYDVSLVDGYNV +GI
Sbjct  85   GRGTCVTGDCGGALKCTGNGVPPATLAEFTVGSSNSGMDFYDVSLVDGYNVKMGI  139



>ref|XP_009117552.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Brassica 
rapa]
 emb|CDY21672.1| BnaA09g44230D [Brassica napus]
Length=246

 Score =   118 bits (296),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 91/126 (72%), Gaps = 3/126 (2%)
 Frame = -2

Query  373  GITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFW  194
            G  +V +   FT+ N+C++ VWPG L+GNGGA L +GGF L+PG SV + APAGWSGR W
Sbjct  19   GAVSVVSGTVFTIQNSCSFPVWPGILTGNGGAQLNDGGFTLNPGASVAVTAPAGWSGRIW  78

Query  193  ARTGCNFDASGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
             RTGCNFD SG G C+T          G GGVPPVTLAEFTI NG A KDFYDVSLVDGY
Sbjct  79   GRTGCNFDGSGAGRCLTGDCGNKLKCAGAGGVPPVTLAEFTIGNGGA-KDFYDVSLVDGY  137

Query  19   NVDLGI  2
            NV +G+
Sbjct  138  NVQMGV  143



>gb|KFK41942.1| hypothetical protein AALP_AA2G192200 [Arabis alpina]
Length=240

 Score =   118 bits (295),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 90/119 (76%), Gaps = 6/119 (5%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N+C YT+WPG L+GNGG  +GEG    + G+SV+L+AP GWSGRFWARTGC 
Sbjct  23   SATEFTLQNSCPYTIWPGILTGNGGNPIGEGTPLNT-GDSVQLRAPPGWSGRFWARTGCT  81

Query  175  FDASGNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASG+GNCVT    G  KC G G PPVTLAEFT+     DKDFYDVSLVDGYNV LGI
Sbjct  82   FDASGHGNCVTGDCGGVQKCTGTGAPPVTLAEFTV----GDKDFYDVSLVDGYNVKLGI  136



>ref|XP_002510340.1| Zeamatin precursor, putative [Ricinus communis]
 gb|EEF52527.1| Zeamatin precursor, putative [Ricinus communis]
Length=257

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 90/115 (78%), Gaps = 1/115 (1%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C+Y +WPGTLSGNG   LG+GGFAL PG S++LQAP  WSGRFWARTGC FD  
Sbjct  35   FTLQNHCSYMIWPGTLSGNGAGTLGDGGFALPPGSSIQLQAPPTWSGRFWARTGCTFDDL  94

Query  163  GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            GNG C TG   G LKC GGG PPV+LAEFTIA  + +KDFYDVSLVDGYNV LG+
Sbjct  95   GNGKCDTGDCGGALKCTGGGAPPVSLAEFTIAPSSNEKDFYDVSLVDGYNVGLGV  149



>ref|XP_006390358.1| hypothetical protein EUTSA_v10019046mg [Eutrema salsugineum]
 gb|ESQ27644.1| hypothetical protein EUTSA_v10019046mg [Eutrema salsugineum]
Length=247

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 85/119 (71%), Gaps = 2/119 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N C YTVWPG LSGN   L   G     PG SV+L +P  WSGRFWARTGCN
Sbjct  22   SATVFTLENLCPYTVWPGILSGNSNTLGDGGFPLT-PGASVQLTSPPRWSGRFWARTGCN  80

Query  175  FDASGNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD+SG GNCVT    G LKC GGGVPP TLAEFT+ +G +  DFYDVSLVDGYNV +GI
Sbjct  81   FDSSGRGNCVTGDCGGVLKCIGGGVPPATLAEFTVGSGESGMDFYDVSLVDGYNVQMGI  139



>ref|XP_009117553.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Brassica 
rapa]
Length=244

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 87/116 (75%), Gaps = 3/116 (3%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FT+ N+C++ VWPG L+GNGGA L +GGF L+PG SV + APAGWSGR W RTGCNFD S
Sbjct  27   FTIQNSCSFPVWPGILTGNGGAQLNDGGFTLNPGASVAVTAPAGWSGRIWGRTGCNFDGS  86

Query  163  GNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G G C+T          G GGVPPVTLAEFTI NG A KDFYDVSLVDGYNV +G+
Sbjct  87   GAGRCLTGDCGNKLKCAGAGGVPPVTLAEFTIGNGGA-KDFYDVSLVDGYNVQMGV  141



>ref|XP_010539926.1| PREDICTED: pathogenesis-related protein 5-like [Tarenaya hassleriana]
Length=245

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 87/117 (74%), Gaps = 4/117 (3%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N+C YTVWPG LSGNG  L   G     PG SV+L  P GWSGRFWARTGCNFD S
Sbjct  23   FTLENSCRYTVWPGVLSGNGDTLGDGGFPLP-PGSSVKLTGPPGWSGRFWARTGCNFDPS  81

Query  163  GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANG--NADKDFYDVSLVDGYNVDLGI  2
            G GNC+TG   G LKC GGG PPVTLAEFT+A    +A KDFYDVSLVDGYNV++GI
Sbjct  82   GQGNCLTGDCGGVLKCIGGGAPPVTLAEFTVATAGDSASKDFYDVSLVDGYNVEMGI  138



>ref|XP_006307402.1| hypothetical protein CARUB_v10009026mg [Capsella rubella]
 gb|EOA40300.1| hypothetical protein CARUB_v10009026mg [Capsella rubella]
Length=475

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 89/114 (78%), Gaps = 2/114 (2%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C++TVW  TL+G G  L G G    S G S +LQAPAGWSGRFWARTGC FDAS
Sbjct  261  FTLKNKCSHTVWAATLAGRGPRLGGGGFKLTS-GASQKLQAPAGWSGRFWARTGCKFDAS  319

Query  163  GNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            GNG C+TGDCGGL+C GG VPPVTLAEFT+  G+  KDFYDVSLVDGYNV LGI
Sbjct  320  GNGRCITGDCGGLRCNGGAVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVKLGI  372



>gb|KFK41944.1| hypothetical protein AALP_AA2G192400 [Arabis alpina]
Length=246

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 86/115 (75%), Gaps = 3/115 (3%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N+C YTVWPG LSGN   L   G      G SV+L AP GWSGRFWARTGCNFD++
Sbjct  26   FTLQNSCPYTVWPGILSGNSNTLGDGGFPLTQ-GASVQLTAPQGWSGRFWARTGCNFDST  84

Query  163  GNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G+GNCVT    G L C GGGVPP TLAEFT+  G++ KDFYDVSLVDGYNV++GI
Sbjct  85   GHGNCVTGDCGGVLNCIGGGVPPTTLAEFTV-QGDSGKDFYDVSLVDGYNVEMGI  138



>ref|XP_004499121.1| PREDICTED: pathogenesis-related protein 5-like [Cicer arietinum]
Length=251

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 94/116 (81%), Gaps = 2/116 (2%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FT+ N C+YT+WPGTLSGNG A+LG+GGF L PG S+ L APAGWSGRFWARTGC FD +
Sbjct  28   FTIQNQCSYTIWPGTLSGNGAAVLGQGGFVLPPGASINLNAPAGWSGRFWARTGCKFDDA  87

Query  163  GNGNCVTgdc-gglkcgggGVPPVTLAEFTIANG-NADKDFYDVSLVDGYNVDLGI  2
            G G C+TGDC GGL C GGG PPVTLAEFTI +  N  KDFYDVSLVDGYNV +G+
Sbjct  88   GTGKCLTGDCPGGLNCNGGGTPPVTLAEFTIGSADNGGKDFYDVSLVDGYNVGMGV  143



>gb|KFK41943.1| hypothetical protein AALP_AA2G192300 [Arabis alpina]
Length=240

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 87/121 (72%), Gaps = 7/121 (6%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQ--APAGWSGRFWARTG  182
            +A  FTL N+C YTVWPGT S +     G    +   G SV+L   +P GW+GRFWARTG
Sbjct  22   SATVFTLQNSCPYTVWPGTFSDSNKLEGGLELTS---GASVQLTLTSPPGWTGRFWARTG  78

Query  181  CNFDASGNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            CNFD+SGNGNCVT    GGLKC G GVPPVTLAEFTI  G+  KDFYDVSLVDG+NV LG
Sbjct  79   CNFDSSGNGNCVTGNCGGGLKCTGTGVPPVTLAEFTI-QGDGGKDFYDVSLVDGFNVKLG  137

Query  4    I  2
            I
Sbjct  138  I  138



>ref|XP_007017454.1| Thaumatin-like protein 3 [Theobroma cacao]
 gb|EOY14679.1| Thaumatin-like protein 3 [Theobroma cacao]
Length=247

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 84/115 (73%), Gaps = 2/115 (2%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C++TVWPG+LSGN  AL   G     PG S + QAP GWSGRFW RTGC FD S
Sbjct  29   FTLQNHCSFTVWPGSLSGNSAALGDGGFALP-PGSSAKYQAPPGWSGRFWGRTGCTFDNS  87

Query  163  GNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G+G C+T    G LKC GGG PPVTL EFTIA  ++DKDFYDVSLVDGYNV LG+
Sbjct  88   GSGKCITGDCDGVLKCTGGGAPPVTLVEFTIAGDSSDKDFYDVSLVDGYNVALGV  142



>ref|XP_006366466.1| PREDICTED: pathogenesis-related protein 5-like [Solanum tuberosum]
Length=247

 Score =   116 bits (291),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 92/120 (77%), Gaps = 2/120 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N C YTVWPGTLSGNG  + G+ GFAL+PG +++L AP G+SGRFW RTGCN
Sbjct  23   SATQFTLQNNCGYTVWPGTLSGNGVPISGDSGFALTPGATIQLSAPGGFSGRFWGRTGCN  82

Query  175  FDASGNGNCVTgdcgglkcgggG--VPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD++G G C+TGDCG LKC  G   VPPV+L EFTIA    + DFYDVSLVDGYNV +G+
Sbjct  83   FDSTGAGKCITGDCGALKCPSGAGGVPPVSLVEFTIAKTKDEMDFYDVSLVDGYNVGIGV  142



>ref|XP_010248229.1| PREDICTED: pathogenesis-related protein 5-like [Nelumbo nucifera]
Length=244

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 93/118 (79%), Gaps = 1/118 (1%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FT  N C+YTVWPGTL+ NGG +LG+GGF L+PG + ++ AP GW GRFWARTGCN
Sbjct  25   SATVFTFKNQCSYTVWPGTLANNGGPVLGDGGFLLAPGATSQVTAPPGWEGRFWARTGCN  84

Query  175  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD SGNG C TGDCGGLKC G GVPPVTLAEF     N D ++YD+SLVDGYNV++GI
Sbjct  85   FDGSGNGRCTTGDCGGLKCRGAGVPPVTLAEFKTGTNN-DMEYYDISLVDGYNVNMGI  141



>ref|XP_010678327.1| PREDICTED: pathogenesis-related protein 5-like [Beta vulgaris 
subsp. vulgaris]
Length=249

 Score =   116 bits (290),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 97/125 (78%), Gaps = 2/125 (2%)
 Frame = -2

Query  373  GITNVWAAGS-FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRF  197
            G++    +G+ FTL N C YTVWPGTLSGNG  L GEG + LSPG S++L  P GWSGRF
Sbjct  18   GVSTKRTSGTIFTLLNNCPYTVWPGTLSGNGPTLAGEGNYILSPGTSMQLNPPVGWSGRF  77

Query  196  WARTGCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYN  17
            WARTGCNFD +G G C TGDCGGL+C GGGVPPV+L EFT+ NG   +DFYDVSLVDGYN
Sbjct  78   WARTGCNFDTNGAGTCSTGDCGGLQCTGGGVPPVSLVEFTL-NGAGGQDFYDVSLVDGYN  136

Query  16   VDLGI  2
            V +G+
Sbjct  137  VGIGV  141



>ref|XP_007160788.1| hypothetical protein PHAVU_001G016700g [Phaseolus vulgaris]
 gb|ESW32782.1| hypothetical protein PHAVU_001G016700g [Phaseolus vulgaris]
Length=248

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 95/123 (77%), Gaps = 2/123 (2%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            NV +   F L N C++TVWPGTLSGNG A+LG GGFAL PG SV   AP+GWSGRFW RT
Sbjct  18   NVASDTVFYLENHCSHTVWPGTLSGNGAAVLGSGGFALPPGSSVHFSAPSGWSGRFWGRT  77

Query  184  GCNFDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTI-ANGNADKDFYDVSLVDGYNVD  11
            GC FD SG G+C TG   GGLKC GGGVPPVTL EFT  ++GN +KDFYDVSLVDGYNV 
Sbjct  78   GCTFDESGVGSCATGDCAGGLKCNGGGVPPVTLVEFTTGSSGNGNKDFYDVSLVDGYNVG  137

Query  10   LGI  2
            +G+
Sbjct  138  MGV  140



>ref|XP_009106161.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=245

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            F L N+C YTVWPG LSGN    LG+GG  L+PG SV+L AP GWSGRFWARTGC+FD S
Sbjct  23   FVLENSCPYTVWPGILSGNSTTTLGDGGVPLTPGASVQLTAPPGWSGRFWARTGCSFDPS  82

Query  163  GNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
              G+CVT    G L C  G  PP  LAEFT+ +GN+D D Y VSLVDGYNV +GI
Sbjct  83   SRGSCVTGDCGGILNCNRGRFPPAILAEFTVGSGNSDTDIYGVSLVDGYNVKMGI  137



>ref|XP_006473452.1| PREDICTED: pathogenesis-related protein 5-like [Citrus sinensis]
 gb|KDO84436.1| hypothetical protein CISIN_1g026001mg [Citrus sinensis]
Length=245

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C+YTVWPGTL GNG A LG+GGFAL  G SV+   PA WSGR W RTGCNFDAS
Sbjct  28   FTLENHCSYTVWPGTLCGNGVATLGDGGFALPTGASVQFPVPAAWSGRIWGRTGCNFDAS  87

Query  163  GNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G G C T    G LKC GGG PPV+L EFTIAN   +KDFYDVSLVDGYN+ LG+
Sbjct  88   GTGKCTTGDCGGVLKCTGGGAPPVSLVEFTIANNPNEKDFYDVSLVDGYNIGLGV  142



>ref|XP_010471604.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=240

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FT+ N C  TVW GTL+G G  L   G     PG S +L APAGWSGRFWARTGC 
Sbjct  22   SATVFTIKNNCPSTVWAGTLAGRGPKLGEGGFELT-PGASRQLNAPAGWSGRFWARTGCR  80

Query  175  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD +GNG CVTGDCGGL+C GGGVPPV+LAEFT+  G+  KDFYDVSLVDGYNV LGI
Sbjct  81   FDGAGNGRCVTGDCGGLRCIGGGVPPVSLAEFTLV-GDGGKDFYDVSLVDGYNVKLGI  137



>ref|XP_010428509.1| PREDICTED: pathogenesis-related protein 5 [Camelina sativa]
Length=240

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 89/118 (75%), Gaps = 2/118 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FT+ N C  TVW GTL+G G  L   G     PG S +L APAGWSGRFWARTGC+
Sbjct  22   SATVFTIKNNCPTTVWAGTLAGKGPKLGDGGFELT-PGASRQLTAPAGWSGRFWARTGCS  80

Query  175  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD +GNG CVTGDCGGL+C GGGVPPV+LAEFT+  G+  KDFYDVSLVDGYNV LGI
Sbjct  81   FDGAGNGRCVTGDCGGLRCNGGGVPPVSLAEFTLV-GDGGKDFYDVSLVDGYNVKLGI  137



>ref|XP_010416366.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=240

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 89/118 (75%), Gaps = 2/118 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FT+ N C  TVW GTL+G G  L   G     PG S +L APAGWSGRFWARTGC+
Sbjct  22   SATVFTIKNNCPTTVWAGTLAGQGPKLGDGGFELT-PGASRQLTAPAGWSGRFWARTGCS  80

Query  175  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD +GNG CVTGDCGGL+C GGGVPPV+LAEFT+  G+  KDFYDVSLVDGYNV LGI
Sbjct  81   FDGAGNGRCVTGDCGGLRCNGGGVPPVSLAEFTLV-GDGGKDFYDVSLVDGYNVKLGI  137



>ref|XP_010471607.1| PREDICTED: pathogenesis-related protein 5 [Camelina sativa]
Length=240

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 89/118 (75%), Gaps = 2/118 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FT+ N C  TVW GTL+G G  L   G     PG S +L APAGWSGRFWARTGC+
Sbjct  22   SATVFTIKNNCPTTVWAGTLAGQGPKLGDGGFELT-PGASRQLTAPAGWSGRFWARTGCS  80

Query  175  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD +GNG CVTGDCGGL+C GGGVPPV+LAEFT+  G+  KDFYDVSLVDGYNV LGI
Sbjct  81   FDGAGNGRCVTGDCGGLRCIGGGVPPVSLAEFTLV-GDGGKDFYDVSLVDGYNVKLGI  137



>ref|XP_006434928.1| hypothetical protein CICLE_v10002288mg [Citrus clementina]
 gb|ESR48168.1| hypothetical protein CICLE_v10002288mg [Citrus clementina]
Length=245

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 86/115 (75%), Gaps = 1/115 (1%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C+YTVWPGTL GNG A LG+GGFAL  G SV+   PA WSGR W RTGCNFDAS
Sbjct  28   FTLENHCSYTVWPGTLCGNGVATLGDGGFALPTGASVQFPVPATWSGRIWGRTGCNFDAS  87

Query  163  GNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G G C T    G LKC GGG PPV+L EFTIAN   +KDFYDVSLVDGYN+ LG+
Sbjct  88   GTGKCTTGDCGGVLKCTGGGAPPVSLVEFTIANNPNEKDFYDVSLVDGYNIGLGV  142



>ref|XP_010416364.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=240

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FT+ N C  TVW G+L+G G  L   G     PG S +L APAGWSGRFWARTGC 
Sbjct  22   SATVFTIRNNCPSTVWAGSLAGRGPKLGEGGFELT-PGASRQLNAPAGWSGRFWARTGCR  80

Query  175  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD +GNG CVTGDCGGL+C GGGVPPV+LAEFT+  G+  KDFYDVSLVDGYNV LGI
Sbjct  81   FDGAGNGRCVTGDCGGLRCNGGGVPPVSLAEFTLV-GDGGKDFYDVSLVDGYNVKLGI  137



>ref|XP_010416363.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=239

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 81/115 (70%), Gaps = 3/115 (3%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C YTVWPGTL+  G  L   G      G S +L AP GWSGRFWARTGCNFD S
Sbjct  27   FTLQNNCPYTVWPGTLASKGITLGDGGFELTQ-GASKQLTAPDGWSGRFWARTGCNFDGS  85

Query  163  GNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            GNG C T    GGLKC G G PPVTLAEFT+  G+A +DFYDVSLVDGYNV LGI
Sbjct  86   GNGKCDTGDCTGGLKCTGTGFPPVTLAEFTLV-GDAGQDFYDVSLVDGYNVKLGI  139



>ref|XP_006302689.1| hypothetical protein CARUB_v10020799mg [Capsella rubella]
 gb|EOA35587.1| hypothetical protein CARUB_v10020799mg [Capsella rubella]
Length=267

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 89/118 (75%), Gaps = 2/118 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FT+ N C  TVW GTL+G G  L   G     PG S +L APAGWSGRFWARTGC+
Sbjct  49   SATVFTIKNNCPTTVWAGTLAGRGPKLGDGGFQLT-PGASRQLTAPAGWSGRFWARTGCS  107

Query  175  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD +GNG CVTGDCGGL+C GGGVPPV+LAEFT+  G+  KDFYDVSLVDGYNV +GI
Sbjct  108  FDGAGNGRCVTGDCGGLRCSGGGVPPVSLAEFTLV-GDGGKDFYDVSLVDGYNVKIGI  164



>emb|CDY41037.1| BnaC05g14950D [Brassica napus]
Length=246

 Score =   113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  373  GITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFW  194
            G  +V +   FT+ N+C++ VWPG L+GNG  L   G     PG SV+L APAGWSGR W
Sbjct  19   GTLSVVSGTVFTIVNSCSFNVWPGVLTGNGAQLNDGGFLLT-PGASVDLTAPAGWSGRIW  77

Query  193  ARTGCNFDASGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
             RTGCNFD SG G C+T          G GGVPPVTLAEFTI NG   +DFYDVSLVDGY
Sbjct  78   GRTGCNFDGSGAGRCLTGDCGNKLKCAGAGGVPPVTLAEFTIGNGGG-QDFYDVSLVDGY  136

Query  19   NVDLGI  2
            NV +GI
Sbjct  137  NVQMGI  142



>ref|XP_009106493.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=214

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 80/115 (70%), Gaps = 2/115 (2%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            F L N+C +TVWPG LSGN   L   G     PG SV+L AP GW GRFWARTGC+FDAS
Sbjct  23   FVLENSCPFTVWPGILSGNRTTLGDGGVPLT-PGASVQLTAPPGWPGRFWARTGCSFDAS  81

Query  163  GNGNCVTgdc-gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G G CVT DC G L C   G PP TLAEFT  +G++D DFYD SLVDGYNV +GI
Sbjct  82   GRGGCVTRDCGGVLNCNRRGFPPATLAEFTFGSGDSDVDFYDASLVDGYNVKIGI  136



>ref|XP_009149407.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=246

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  373  GITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFW  194
            G  +V +   FT+ N+C++ VWPG L+GNG  L   G     PG SV+L APAGWSGR W
Sbjct  19   GTLSVVSGTVFTIVNSCSFNVWPGVLTGNGAQLNDGGFLLT-PGASVDLTAPAGWSGRIW  77

Query  193  ARTGCNFDASGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
             RTGCNFD SG G C+T          G GGVPPVTLAEFTI NG   +DFYDVSLVDGY
Sbjct  78   GRTGCNFDGSGAGRCLTGDCGNKLKCAGAGGVPPVTLAEFTIGNGGG-QDFYDVSLVDGY  136

Query  19   NVDLGI  2
            NV +GI
Sbjct  137  NVQMGI  142



>ref|XP_010530276.1| PREDICTED: pathogenesis-related protein 5-like [Tarenaya hassleriana]
Length=246

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 85/116 (73%), Gaps = 3/116 (3%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C+YT+WPG LSGNG A    G     P  SV+  AP GWSGRFWARTGCNFD S
Sbjct  25   FTLENRCSYTIWPGILSGNGAAFGDGGFALP-PAASVQFPAPPGWSGRFWARTGCNFDGS  83

Query  163  -GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
             G G C+TG   G LKC GGG+PPV+LAEFTIA+   +KDFYDVSLVDGYNV +GI
Sbjct  84   TGTGRCLTGDCGGTLKCSGGGIPPVSLAEFTIASSPGEKDFYDVSLVDGYNVGIGI  139



>ref|XP_010026231.1| PREDICTED: pathogenesis-related protein 5 [Eucalyptus grandis]
 gb|KCW88067.1| hypothetical protein EUGRSUZ_A00487 [Eucalyptus grandis]
Length=248

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 92/126 (73%), Gaps = 4/126 (3%)
 Frame = -2

Query  370  ITNVWAAGS-FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFW  194
            I NV A+ +  TL N C YTVWPGTLSGNG  L G G     PG SV+LQAPAGWSGRFW
Sbjct  18   IGNVLASATVITLQNQCGYTVWPGTLSGNGPTLGGGGFSLP-PGGSVQLQAPAGWSGRFW  76

Query  193  ARTGCNFDASGNGNCVTgdc-gglkcgggGVPPVTLAEFTIANGNA-DKDFYDVSLVDGY  20
             RTGC+FD SG G CVTGDC GGLKC GGG PP TL EFT+A  NA   DFYDVSLVDGY
Sbjct  77   GRTGCSFDGSGAGTCVTGDCPGGLKCTGGGAPPATLVEFTVAAPNAGGMDFYDVSLVDGY  136

Query  19   NVDLGI  2
            NV + +
Sbjct  137  NVGMAV  142



>emb|CDX73136.1| BnaC06g35840D [Brassica napus]
Length=245

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 92/127 (72%), Gaps = 4/127 (3%)
 Frame = -2

Query  370  ITNVWAAGS---FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGR  200
            IT+   AG+   F L N+C YTVWPG LSGN    LG GG  L+PG SV+L AP GWSGR
Sbjct  12   ITSSGIAGTATIFVLENSCPYTVWPGILSGNSTTTLGNGGVPLTPGASVQLTAPPGWSGR  71

Query  199  FWARTGCNFDASGNGNCVTgdcgglk-cgggGVPPVTLAEFTIANGNADKDFYDVSLVDG  23
            F ARTGC+FDASG G+CV G CGG+  C  GG PP  LAEFT+ +G+++ DFY VSLVDG
Sbjct  72   FCARTGCSFDASGRGSCVPGVCGGVLNCNRGGFPPAILAEFTVGSGDSEMDFYGVSLVDG  131

Query  22   YNVDLGI  2
            +NV +GI
Sbjct  132  FNVKMGI  138



>dbj|BAD90814.1| thaumatin-like protein [Cryptomeria japonica]
Length=240

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 88/116 (76%), Gaps = 6/116 (5%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C+YTVWPGTLSG+G ++LGEGGF L+PG+SV L A + WSGRFW RT C+FDAS
Sbjct  25   FTLVNKCSYTVWPGTLSGSGSSVLGEGGFTLAPGQSVPLTASSRWSGRFWGRTDCSFDAS  84

Query  163  GNGNCVTgdcgglkcgggG--VPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G G+C+TGDCG +         PPV+LAEFT+     DKDFYDVSLVDGYNV L I
Sbjct  85   GKGSCITGDCGNVLNCAQAGGTPPVSLAEFTL----GDKDFYDVSLVDGYNVPLSI  136



>ref|XP_010529666.1| PREDICTED: pathogenesis-related protein 5-like [Tarenaya hassleriana]
Length=242

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 88/119 (74%), Gaps = 3/119 (3%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FT+ N+C +TVWPG LSGNG  L   G     PG SV+L A  GWSGRFWARTGCN
Sbjct  19   SATVFTIENSCRFTVWPGVLSGNGATLGDGGFPLP-PGSSVKLTAHPGWSGRFWARTGCN  77

Query  175  FDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD+ G+GNC+TG   G L C GGG PPVTLAEFT+  G + KDFYDVSLVDGYNV++GI
Sbjct  78   FDSYGHGNCLTGDCGGVLNCIGGGAPPVTLAEFTLV-GASGKDFYDVSLVDGYNVEMGI  135



>gb|KFK44066.1| hypothetical protein AALP_AA1G211800 [Arabis alpina]
Length=244

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 82/126 (65%), Gaps = 4/126 (3%)
 Frame = -2

Query  373  GITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFW  194
            G  +V +   FT+ N+C++TVWPG L+GNG  L   G     PG SV +  PAGWSGR W
Sbjct  19   GTISVVSGAVFTIRNSCSFTVWPGILTGNGAQLSDGGFTLA-PGASVTVTPPAGWSGRIW  77

Query  193  ARTGCNFDASGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
             RTGCNFD SG G+C T          G GG PP TLAEFTI NG A+ DFYDVSLVDGY
Sbjct  78   GRTGCNFDGSGAGSCQTGDCGNKLKCNGAGGAPPATLAEFTIGNGGAN-DFYDVSLVDGY  136

Query  19   NVDLGI  2
            NV +GI
Sbjct  137  NVKMGI  142



>gb|KHG17165.1| hypothetical protein F383_22419 [Gossypium arboreum]
Length=247

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 81/116 (70%), Gaps = 3/116 (3%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FT+ N C++T+WP +LSGNG  L   G    S G S + QAP GWSGRFW RTGC FD S
Sbjct  28   FTVQNHCSFTIWPASLSGNGAPLGNGGFELSS-GSSAQFQAPPGWSGRFWGRTGCEFDPS  86

Query  163  GNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNAD-KDFYDVSLVDGYNVDLGI  2
            G+G C+T    G   C  GGVPPVTL EFTIA G+ D KDFYDVSLVDGYNV LG+
Sbjct  87   GSGKCITGDCGGIQNCTFGGVPPVTLVEFTIAGGSTDNKDFYDVSLVDGYNVALGV  142



>ref|XP_006390359.1| hypothetical protein EUTSA_v10019053mg [Eutrema salsugineum]
 gb|ESQ27645.1| hypothetical protein EUTSA_v10019053mg [Eutrema salsugineum]
Length=243

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 85/120 (71%), Gaps = 6/120 (5%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A  FTL N C YTVWPG L+GNGG  LG+GG  L+   SV+L AP GW+GRFWARTGC 
Sbjct  22   SATVFTLENLCPYTVWPGILTGNGGKALGDGGLELATDASVQLTAPPGWTGRFWARTGCK  81

Query  175  FDASGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD++G+G CVT          G GGVPPVTLAEFT+      KDFYDVSLVDGYNV +GI
Sbjct  82   FDSTGHGICVTGDCGGVLKCAGAGGVPPVTLAEFTVGG----KDFYDVSLVDGYNVKMGI  137



>emb|CDY64471.1| BnaAnng19350D [Brassica napus]
Length=346

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 85/115 (74%), Gaps = 5/115 (4%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C YTVWPG  SGNG  +L +GGF L+PG SV+L AP+GW+GR WARTGCNF +S
Sbjct  157  FTLQNNCPYTVWPGIFSGNGNDILADGGFQLNPGASVQLTAPSGWAGRIWARTGCNFSSS  216

Query  163  GNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G G C T    G LKC GGGVPPVTLAEFTI       DFYDVSLVDGYNV +GI
Sbjct  217  GQGKCATGDCGGVLKCAGGGVPPVTLAEFTIGV----TDFYDVSLVDGYNVKIGI  267


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 73/117 (62%), Gaps = 8/117 (7%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +F   ++C  T W GTL+      LG GGF L+ G SV+L A + WSG  WARTGC FD+
Sbjct  21   AFATEDSCPSTAWQGTLTRKDDNNLGAGGFQLNRGASVQLTASSEWSGHVWARTGCKFDS  80

Query  166  SGNGNCVTgdcgglkcgggG--VPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            SG+G+CVTGDCG ++   G      V +AEFT    + +KD Y+  LVDG NV +G+
Sbjct  81   SGHGSCVTGDCGVVRTCSGSGGDSSVAMAEFT----HGEKDSYE--LVDGTNVKVGV  131



>gb|KHG08802.1| hypothetical protein F383_35963 [Gossypium arboreum]
Length=236

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A SFTL N C++TVWPG+L+ NG  L   G     PG S  L  P GWSGRFW RTGCN
Sbjct  16   SATSFTLENRCSFTVWPGSLTANGPPLGDGGFALA-PGSSSRLHPPPGWSGRFWGRTGCN  74

Query  175  FDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD SG+G CVTG   G LKC GGG+PPV+L EFT+ NG+ +KDFYD+SLVDGYN+ + +
Sbjct  75   FDNSGSGKCVTGDCGGALKCNGGGIPPVSLIEFTL-NGHDNKDFYDISLVDGYNMAVAV  132



>gb|ABL86687.1| TLP1 [Gossypium barbadense]
Length=244

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A SFTL N C++TVWPG+L+ NG  L   G     PG S  L  P GWSGRFW RTGCN
Sbjct  24   SATSFTLENRCSFTVWPGSLTANGPPLGDGGFALA-PGSSSRLHPPPGWSGRFWGRTGCN  82

Query  175  FDASGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FD SG+G CVTG   G LKC GGG+PPV+L EFT+ NG+ +KDFYD+SLVDGYN+ + +
Sbjct  83   FDNSGSGKCVTGDCGGALKCNGGGIPPVSLIEFTL-NGHDNKDFYDISLVDGYNMAVAV  140



>ref|XP_006416518.1| hypothetical protein EUTSA_v10008604mg [Eutrema salsugineum]
 gb|ESQ34871.1| hypothetical protein EUTSA_v10008604mg [Eutrema salsugineum]
Length=245

 Score =   107 bits (268),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  373  GITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFW  194
            G  +V +   FT+ N+C++TVWPG L+GNG  L+  G     PG SV++ APAGWSGRFW
Sbjct  19   GTISVVSGTVFTIVNSCSFTVWPGILTGNGAQLMDGGFALN-PGASVDVTAPAGWSGRFW  77

Query  193  ARTGCNFDASGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
             RTGCNFD+SG G+C+T          G GG PP TLAEFTI   N   DFYDVSLVDGY
Sbjct  78   GRTGCNFDSSGAGSCITGDCGNKLKCGGAGGAPPATLAEFTIGT-NGGNDFYDVSLVDGY  136

Query  19   NVDLGI  2
            NV + I
Sbjct  137  NVQMEI  142



>ref|XP_006438972.1| hypothetical protein CICLE_v10033952mg, partial [Citrus clementina]
 gb|ESR52212.1| hypothetical protein CICLE_v10033952mg, partial [Citrus clementina]
Length=208

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 84/119 (71%), Gaps = 5/119 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A  FTL N C  T+WPG L+G+G  +L  GG  L+ GE+++++AP GWSGRFW RTGC F
Sbjct  20   AAIFTLENKCKETIWPGILAGSGKPVLMNGGVRLNAGENIKIEAPKGWSGRFWPRTGCTF  79

Query  172  DASGNGNCVTgdcgglkcgggG--VPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            D SGNG CVTGDCG      G    PPV+LAEFT+   ++ +DFYDVSLVDGYNV + I
Sbjct  80   DQSGNGKCVTGDCGAKLNCNGAGGEPPVSLAEFTL---DSPEDFYDVSLVDGYNVPMSI  135



>ref|XP_010936134.1| PREDICTED: pathogenesis-related protein 5 [Elaeis guineensis]
Length=259

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 89/118 (75%), Gaps = 4/118 (3%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C+YTVWPGTLSGNG A+LG GGF LSP  +V L AP GWSGRFWART C F  S
Sbjct  34   FTLQNKCSYTVWPGTLSGNGAAVLGGGGFELSPNAAVSLTAPPGWSGRFWARTACVFPPS  93

Query  163  G-NGNCVTgdcgglkcgg-gGVPPVTLAEFTIANG--NADKDFYDVSLVDGYNVDLGI  2
            G +G+C TGDCGG      GG PPVTLAEFT+A G   A KDFYDVSLVDGYNV +G+
Sbjct  94   GVSGSCTTGDCGGAIRCSFGGTPPVTLAEFTLAGGGNGAAKDFYDVSLVDGYNVGMGV  151



>ref|XP_006482914.1| PREDICTED: pathogenesis-related protein 5-like [Citrus sinensis]
Length=236

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 84/119 (71%), Gaps = 5/119 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A  FTL N C  T+WPG L+G+G  +L  GG  L+ GE+++++AP GWSGRFW RTGC F
Sbjct  20   AAIFTLENKCKETIWPGILAGSGKPVLMNGGVRLNAGENIKIEAPKGWSGRFWPRTGCTF  79

Query  172  DASGNGNCVTgdcgglkcgggG--VPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            D SGNG CVTGDCG      G    PPV+LAEFT+   ++ +DFYDVSLVDGYNV + I
Sbjct  80   DQSGNGKCVTGDCGAKLNCNGAGGEPPVSLAEFTL---DSPEDFYDVSLVDGYNVPMSI  135



>ref|XP_008790236.1| PREDICTED: pathogenesis-related protein 5 [Phoenix dactylifera]
Length=243

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 88/118 (75%), Gaps = 4/118 (3%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C YTVWPGTLSGNG A+LG GGF L P  +V L AP GWSGRFWART C F  S
Sbjct  18   FTLQNKCPYTVWPGTLSGNGAAVLGGGGFELPPNAAVSLTAPPGWSGRFWARTACVFPPS  77

Query  163  G-NGNCVTg-dcgglkcgggGVPPVTLAEFTIANG--NADKDFYDVSLVDGYNVDLGI  2
            G +G+C TG   G L+C GGG PPVTLAEFT+A G   A KDFYDVSLVDGYNV +G+
Sbjct  78   GVSGSCATGDCGGALRCSGGGAPPVTLAEFTLAGGGNGATKDFYDVSLVDGYNVGMGL  135



>emb|CDX83773.1| BnaC08g18720D [Brassica napus]
Length=247

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 85/126 (67%), Gaps = 3/126 (2%)
 Frame = -2

Query  373  GITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFW  194
            G  +V +   FT+ N C++ VWPG L+G+ G  L  GGFAL  G SV++ APAGWSGR W
Sbjct  19   GAISVVSGTVFTIVNRCSFPVWPGILTGDNGVQLNGGGFALKTGASVDVAAPAGWSGRIW  78

Query  193  ARTGCNFDASGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
             RTGCNFDA G G+C+T          G GGVPP TLAEFTI +G A  DFYDVSLVDGY
Sbjct  79   GRTGCNFDAFGTGSCLTGDCGNKLQCSGAGGVPPATLAEFTIGHGGA-MDFYDVSLVDGY  137

Query  19   NVDLGI  2
            NV + I
Sbjct  138  NVQMEI  143



>ref|XP_009149412.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Brassica 
rapa]
Length=248

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 88/126 (70%), Gaps = 3/126 (2%)
 Frame = -2

Query  373  GITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFW  194
            G   V +   FT+ N+C++ VWPG L+G+ G  L +GGF L+PG SV++ APAGWSGR W
Sbjct  19   GTVTVVSGTVFTVVNSCSFPVWPGILTGDNGVQLNDGGFELAPGASVDVTAPAGWSGRIW  78

Query  193  ARTGCNFDASGNGNCVTgdcgglkcgggG--VPPVTLAEFTIANGNADKDFYDVSLVDGY  20
             RTGCNFD SG G+C+TGDCG      G   VPPVTLAEFTI  G   +D YDVSLVDGY
Sbjct  79   GRTGCNFDGSGAGSCLTGDCGNKLKCAGAGGVPPVTLAEFTIGTGGG-QDNYDVSLVDGY  137

Query  19   NVDLGI  2
            N+ + +
Sbjct  138  NIQMAL  143



>ref|NP_001031809.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
 emb|CAB37522.1| putative thaumatin-like protein [Arabidopsis thaliana]
 emb|CAB80530.1| putative thaumatin-like protein [Arabidopsis thaliana]
 gb|AEE86960.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
Length=323

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YTVWPG LS  G   L   GF L  G S  LQAP GWSGRFWARTGC FD+
Sbjct  9    TFTFANRCGYTVWPGILSNAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCKFDS  68

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C TGDCG       G+   PPVTLAEFT+  G    DFYDVSLVDGYN+ +
Sbjct  69   SGSGTCKTGDCGSNAVECAGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNIPM  122



>ref|NP_568046.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
 gb|AAL49903.1| putative thaumatin protein [Arabidopsis thaliana]
 gb|AAM20232.1| putative thaumatin [Arabidopsis thaliana]
 dbj|BAF00500.1| thaumatin-like protein [Arabidopsis thaliana]
 gb|AEE86959.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
Length=345

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YTVWPG LS  G   L   GF L  G S  LQAP GWSGRFWARTGC FD+
Sbjct  31   TFTFANRCGYTVWPGILSNAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCKFDS  90

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C TGDCG       G+   PPVTLAEFT+  G    DFYDVSLVDGYN+ +
Sbjct  91   SGSGTCKTGDCGSNAVECAGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNIPM  144



>gb|AAM64698.1| putative thaumatin-like protein [Arabidopsis thaliana]
Length=345

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YTVWPG LS  G   L   GF L  G S  LQAP GWSGRFWARTGC FD+
Sbjct  31   TFTFANRCGYTVWPGILSNAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCKFDS  90

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C TGDCG       G+   PPVTLAEFT+  G    DFYDVSLVDGYN+ +
Sbjct  91   SGSGTCKTGDCGSNSVECAGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNIPM  144



>emb|CDX83771.1| BnaC08g18740D [Brassica napus]
Length=247

 Score =   105 bits (261),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 83/116 (72%), Gaps = 3/116 (3%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FT+ N C++ VWPG L+G+ G  L  GGFAL+PG SV++ APAGWSGR W RTGCNFDA 
Sbjct  29   FTIVNRCSFPVWPGILTGDNGVQLNGGGFALTPGASVDVAAPAGWSGRIWGRTGCNFDAF  88

Query  163  GNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G+G+C+T          G GGV P TLAEFTI +G A  DFYDVSLVDGYNV + I
Sbjct  89   GSGSCLTGDCGNKLQCSGAGGVSPATLAEFTIGHGGA-MDFYDVSLVDGYNVQMEI  143



>gb|EPS65843.1| hypothetical protein M569_08934, partial [Genlisea aurea]
Length=123

 Score =   102 bits (253),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 81/117 (69%), Gaps = 5/117 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            + TL+N C Y VWPG   G+G  +L  GGF L+PG+S  LQ P+GWSGR W R GCNFDA
Sbjct  3    TLTLYNKCGYHVWPGIQPGSGKPILANGGFELAPGKSYTLQLPSGWSGRVWGRHGCNFDA  62

Query  166  SGNGNCVTgdcgglk--cgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            SG G C TGDCGG     G GG PP TLAE T+ +   D+DFYDVSLVDGYN+ + I
Sbjct  63   SGRGRCATGDCGGALFCNGLGGAPPATLAEITLGD---DQDFYDVSLVDGYNIPISI  116



>ref|XP_010446375.1| PREDICTED: thaumatin-like protein 1 [Camelina sativa]
Length=341

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YTVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC FD 
Sbjct  30   TFTFANRCGYTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCQFDG  89

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C TGDCG  +    G+   PPVTLAEFT+  G    DFYDVSLVDGYN+ +
Sbjct  90   SGSGTCTTGDCGSNQVECVGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNIPM  143



>gb|KHG07208.1| hypothetical protein F383_34305 [Gossypium arboreum]
Length=313

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 80/118 (68%), Gaps = 5/118 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A +FT  N C YTVWPG L+  G   L   GF L+ G S   QAP GW+GRFW RTGCNF
Sbjct  28   AATFTFINKCDYTVWPGILANPGSPKLESTGFELTKGSSRSFQAPTGWAGRFWGRTGCNF  87

Query  172  DASGNGNCVTgdcgglkcg---ggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            D SG+G+C TGDCG  +      G +PP TLAEFT+ +G+  +DFYDVSLVDGYN+ +
Sbjct  88   DDSGHGSCATGDCGSGEMECNGAGAIPPATLAEFTLGSGS--QDFYDVSLVDGYNLPM  143



>ref|XP_009149413.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Brassica 
rapa]
Length=246

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 85/116 (73%), Gaps = 3/116 (3%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FT+ N+C++ VWPG L+G+ G  L +GGF L+PG SV++ APAGWSGR W RTGCNFD S
Sbjct  27   FTVVNSCSFPVWPGILTGDNGVQLNDGGFELAPGASVDVTAPAGWSGRIWGRTGCNFDGS  86

Query  163  GNGNCVTgdcgglkcgggG--VPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G G+C+TGDCG      G   VPPVTLAEFTI  G   +D YDVSLVDGYN+ + +
Sbjct  87   GAGSCLTGDCGNKLKCAGAGGVPPVTLAEFTIGTGGG-QDNYDVSLVDGYNIQMAL  141



>ref|XP_010436965.1| PREDICTED: thaumatin-like protein 1 [Camelina sativa]
Length=349

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 76/116 (66%), Gaps = 4/116 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YTVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC FD 
Sbjct  30   TFTFANRCGYTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCKFDG  89

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C TGDCG  +    G+   PPVTLAEFT+     D DFYDVSLVDGYN+ +
Sbjct  90   SGSGTCTTGDCGSNQVECVGLGAAPPVTLAEFTLGTTGGD-DFYDVSLVDGYNIPM  144



>gb|AFW89118.1| putative thaumatin domain family protein, partial [Zea mays]
Length=162

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 84/119 (71%), Gaps = 7/119 (6%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTLHN CT+TVWP TLSGN  A +G GGF LSPG +V   APAGWSGR WARTGC   +S
Sbjct  12   FTLHNNCTHTVWPATLSGNSAAAVGGGGFELSPGATVSFPAPAGWSGRLWARTGCVASSS  71

Query  163  ---GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNAD-KDFYDVSLVDGYNVDLGI  2
               G  +C TG   G   C  GG PPVTLAEFT+  G AD KDFYDVSLVDGYNV +G+
Sbjct  72   SPAGRLSCATGDCSGAASCSLGGAPPVTLAEFTL--GGADGKDFYDVSLVDGYNVGIGV  128



>ref|XP_006660362.1| PREDICTED: thaumatin-like protein 1-like [Oryza brachyantha]
Length=322

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 80/116 (69%), Gaps = 4/116 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C  TVWPG LSG+G   L   GFALSPGES  L AP+GWSGRFWAR+GC+FD+
Sbjct  37   TFTFTNRCADTVWPGVLSGSGTPPLQTTGFALSPGESRSLYAPSGWSGRFWARSGCDFDS  96

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG G+C T   G       G G  PP TLAEFT+ +G   KDFYDVSLVDGYN+ +
Sbjct  97   SGKGSCATGDCGSGQVECRGAGASPPATLAEFTL-DGAGGKDFYDVSLVDGYNLPM  151



>ref|XP_006283927.1| hypothetical protein CARUB_v10005048mg, partial [Capsella rubella]
 gb|EOA16825.1| hypothetical protein CARUB_v10005048mg, partial [Capsella rubella]
Length=378

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YTVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC FD 
Sbjct  63   TFTFANRCGYTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCKFDV  122

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C TGDCG  +    G+   PPVTLAEFT+  G    DFYDVSLVDGYN+ +
Sbjct  123  SGSGTCTTGDCGSNQVECVGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNIPM  176



>ref|XP_007046679.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
 gb|EOX90836.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
Length=317

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 77/118 (65%), Gaps = 5/118 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A +FT  N C YTVWPG L+  G   L   GF L+ G S   QAP GW+GRFW RTGCNF
Sbjct  28   AATFTFINKCDYTVWPGILANPGSPKLESTGFELTKGSSRSFQAPTGWAGRFWGRTGCNF  87

Query  172  DASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            D SG+G+C T   G       G G +PP TLAEFT+ +G+  +DFYDVSLVDGYN+ +
Sbjct  88   DDSGHGSCATGDCGSGEVECNGAGAIPPATLAEFTLGSGS--QDFYDVSLVDGYNLPM  143



>ref|XP_008337996.1| PREDICTED: thaumatin-like protein 1 [Malus domestica]
Length=253

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 78/124 (63%), Gaps = 5/124 (4%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            IT   +A +FT  N C +TVWPG L+ +G   L   GF L  G S   QAP GWSGRFW 
Sbjct  26   ITRGVSAATFTFTNKCDFTVWPGILASSGSEKLDSTGFELPKGSSRVFQAPTGWSGRFWG  85

Query  190  RTGCNFDASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
            RTGC+FD SG G+C T   G       G G  PP TLAEFT+ +G+  +DFYDVSLVDGY
Sbjct  86   RTGCSFDGSGRGSCSTGDCGSGELECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGY  143

Query  19   NVDL  8
            N+ +
Sbjct  144  NLPM  147



>emb|CDY70029.1| BnaCnng66400D [Brassica napus]
Length=193

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 74/116 (64%), Gaps = 9/116 (8%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C YTVWPG LSGN  +  G       P  SV+L  P+ WSGR WARTGCNF +S
Sbjct  14   FTLQNNCPYTVWPGILSGNILSDGGFRLS---PNASVQLTPPSRWSGRIWARTGCNFSSS  70

Query  163  GNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G G C TGDC         GGVPPVTLAEF I     D DFYDVSLVDGYNV +GI
Sbjct  71   GQGKCATGDCGGVLKCAAAGGVPPVTLAEFAI----GDTDFYDVSLVDGYNVKIGI  122



>ref|XP_002868852.1| hypothetical protein ARALYDRAFT_912315 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45111.1| hypothetical protein ARALYDRAFT_912315 [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 75/116 (65%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C +TVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC FD 
Sbjct  30   TFTFANRCGFTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCKFDG  89

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C TGDCG       G+   PPVTLAEFT+  G    DFYDVSLVDGYN+ +
Sbjct  90   SGSGTCTTGDCGSNTVECAGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNIPM  143



>ref|XP_008788396.1| PREDICTED: thaumatin-like protein 1b [Phoenix dactylifera]
Length=315

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 76/116 (66%), Gaps = 3/116 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YTVWPG LS +G + L   GF L+ G S   QAP GWSGRFWARTGC FD 
Sbjct  33   TFTFANKCGYTVWPGILSSSGSSELETTGFELAAGGSRSFQAPTGWSGRFWARTGCTFDG  92

Query  166  SGNGNCVTgdcgglkcggg---GVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
             G G+C TGDCG  +         PP TLAEFT+A   + KDFYDVSLVDGYN+ +
Sbjct  93   DGKGSCATGDCGTGEVECKGGGAAPPATLAEFTLARPASAKDFYDVSLVDGYNLPM  148



>gb|KDP46766.1| hypothetical protein JCGZ_06554 [Jatropha curcas]
Length=314

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 70/118 (59%), Gaps = 8/118 (7%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            + +FTL N C YTVWPG L        G        G S   QAP GWSGRFWARTGCNF
Sbjct  25   SATFTLVNKCDYTVWPGILGSPKLETTGFELP---KGSSRSFQAPTGWSGRFWARTGCNF  81

Query  172  DASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            D+SG+G+C T           G    PP TLAEFT+ +G   +DFYDVSLVDGYN+ +
Sbjct  82   DSSGHGSCSTADCGSSQLECNGNTATPPATLAEFTLGSGT--QDFYDVSLVDGYNLPM  137



>ref|XP_010245598.1| PREDICTED: thaumatin-like protein 1b [Nelumbo nucifera]
Length=324

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 74/116 (64%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YTVWPG L+  G   L   GF L+ G S   QAP GWSGRFW RTGCNFD 
Sbjct  27   TFTFVNKCDYTVWPGILANAGSPKLDSTGFELAKGSSRSFQAPTGWSGRFWGRTGCNFDG  86

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG G+C T   G       G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ +
Sbjct  87   SGRGSCSTGDCGSGQIECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGYNLPM  140



>gb|ADE77179.1| unknown [Picea sitchensis]
Length=199

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 72/124 (58%), Gaps = 5/124 (4%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            N  +A SFTL N+C YTVWPG  +G G   L   GF L PG+S+ L+AP GWSGR W RT
Sbjct  15   NRASASSFTLINSCEYTVWPGIQAGAGTEELSSTGFELRPGQSMTLEAPTGWSGRLWGRT  74

Query  184  GCNFDASGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANG---NADKDFYDVSLVDGY  20
             C FD  G G C T          G    PP TL EFT+  G      +DFYDVSLVDG+
Sbjct  75   LCTFDGEGEGKCATGDCGGSLQCNGKNAEPPATLVEFTLGQGVGVALAQDFYDVSLVDGF  134

Query  19   NVDL  8
            N+ L
Sbjct  135  NLPL  138



>ref|XP_010266794.1| PREDICTED: thaumatin-like protein 1b [Nelumbo nucifera]
Length=330

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 74/116 (64%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YT+WPG L+  G   L   GF L+ G S   QAP GWSGRFW RTGCNFD 
Sbjct  27   TFTFVNKCDYTIWPGILANAGSPRLDSTGFELTQGSSRSFQAPTGWSGRFWGRTGCNFDG  86

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG G+C T   G       G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ +
Sbjct  87   SGQGSCATGDCGSGQIECKGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGYNLPM  140



>ref|XP_008352435.1| PREDICTED: thaumatin-like protein 1 [Malus domestica]
Length=318

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 78/124 (63%), Gaps = 5/124 (4%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            IT   +A +FT  N C +TVWPG L+ +G   L   GF L  G S   QAP GWSGRFW 
Sbjct  26   ITRGVSAATFTFTNKCDFTVWPGILASSGSEKLDSTGFELPKGSSRVFQAPTGWSGRFWG  85

Query  190  RTGCNFDASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
            RTGC+FD SG G+C T   G       G G  PP TLAEFT+ +G+  +DFYDVSLVDGY
Sbjct  86   RTGCSFDGSGRGSCSTGDCGSGELECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGY  143

Query  19   NVDL  8
            N+ +
Sbjct  144  NLPM  147



>ref|XP_010920168.1| PREDICTED: thaumatin-like protein 1b isoform X2 [Elaeis guineensis]
Length=296

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C Y VWPG LSG+G   L   GF L+ G+S   QAP GWSGRFWART CNFD 
Sbjct  14   TFTFVNKCGYGVWPGILSGSGSPELETTGFELAAGDSRRFQAPTGWSGRFWARTACNFDG  73

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNV  14
            +G G+C T   G       G G  PP TLAEFT+A   + +DFYDVSLVDGYN+
Sbjct  74   AGKGSCATGDCGSGEVECKGRGATPPATLAEFTLAGTASSRDFYDVSLVDGYNL  127



>ref|XP_004974143.1| PREDICTED: thaumatin-like protein 1-like [Setaria italica]
Length=316

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 78/116 (67%), Gaps = 4/116 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C  TVWPG LSG+G   L   GFAL PG+S  L AP GWSGRFW R+GCNFDA
Sbjct  31   TFTFTNRCPDTVWPGLLSGSGTPPLETTGFALEPGQSRSLYAPQGWSGRFWGRSGCNFDA  90

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG G+C T   G       G G  PP TLAEFT+ +G + KDFYDVSLVDGYN+ +
Sbjct  91   SGKGSCATGDCGSGEVECRGAGASPPATLAEFTL-DGASGKDFYDVSLVDGYNLPM  145



>ref|XP_004287804.1| PREDICTED: thaumatin-like protein 1-like [Fragaria vesca subsp. 
vesca]
Length=310

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            IT   +  +FT  N C +TVWPG L+  G   L   GF L+ G S   QAPAGWSGRFWA
Sbjct  18   ITKGVSGATFTFVNKCEFTVWPGILASAGSPNLDSTGFELAKGASRTFQAPAGWSGRFWA  77

Query  190  RTGCNFDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGN-ADKDFYDVSLVDG  23
            RT C+FDASG G+C T           G G  PP TLAEFT+ +G+   +DFYDVSLVDG
Sbjct  78   RTRCSFDASGLGSCATADCGSGQLECNGAGAAPPATLAEFTLGSGSGGTQDFYDVSLVDG  137

Query  22   YNVDL  8
            YN+ +
Sbjct  138  YNLPM  142



>ref|XP_006425448.1| hypothetical protein CICLE_v10026139mg [Citrus clementina]
 gb|ESR38688.1| hypothetical protein CICLE_v10026139mg [Citrus clementina]
Length=309

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 73/124 (59%), Gaps = 8/124 (6%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            I+    AG+FT  N C YTVWPG L        G        G S   QAP GWSGRFW 
Sbjct  17   ISKGVTAGTFTFVNKCDYTVWPGLLGSPKLDSTGFELQK---GGSRSFQAPTGWSGRFWG  73

Query  190  RTGCNFDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
            RTGCNFD+SG+G+C T           G G  PP TLAEFT+ +G+  +DFYDVSLVDGY
Sbjct  74   RTGCNFDSSGHGSCATADCGSNQVECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGY  131

Query  19   NVDL  8
            N+ +
Sbjct  132  NIPI  135



>ref|XP_009110283.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=247

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 86/126 (68%), Gaps = 3/126 (2%)
 Frame = -2

Query  373  GITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFW  194
            G  +V +   FT+ N C + VWPG L+G+ G  L  GGFAL+ G SV++ APAGWSGR W
Sbjct  19   GALSVVSGTVFTIVNRCNFPVWPGILTGDNGVQLNGGGFALNTGASVDVAAPAGWSGRIW  78

Query  193  ARTGCNFDASGNGNCVTgdcgglkcgggG--VPPVTLAEFTIANGNADKDFYDVSLVDGY  20
             RTGCNFDA G G+C+TG+CG      G    PP TLAEFTI +G A  DFYDVSLVDGY
Sbjct  79   GRTGCNFDAFGTGSCLTGNCGNKVQCSGAGGAPPATLAEFTIGHGGA-MDFYDVSLVDGY  137

Query  19   NVDLGI  2
            NV + I
Sbjct  138  NVQMEI  143



>emb|CAN80000.1| hypothetical protein VITISV_043971 [Vitis vinifera]
Length=634

 Score =   106 bits (264),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 65/119 (55%), Positives = 78/119 (66%), Gaps = 5/119 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A  FTL N C  ++WPG   G+G   L +GGF L PGESV++ AP GWSGRFW R  C+F
Sbjct  418  AAVFTLKNGCGESIWPGIQPGSGTPQLMDGGFELRPGESVDITAPEGWSGRFWGRRRCSF  477

Query  172  DASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            D SG G+CVTG         G GG PP TLAEFT+   ++  DFYDVSLVDGYN+ + I
Sbjct  478  DDSGKGSCVTGDCGGVLKCAGAGGAPPATLAEFTL---DSPVDFYDVSLVDGYNMPVSI  533



>emb|CDY72463.1| BnaAnng41250D, partial [Brassica napus]
Length=247

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 77/116 (66%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C +TVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC+FD 
Sbjct  30   TFTFANRCGFTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCSFDG  89

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C TGDCG  +    G+   PPVTLAEFT+  G    DFYDVSLVDGYN+ +
Sbjct  90   SGSGTCKTGDCGSNQVECVGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNLPM  143



>ref|XP_008781003.1| PREDICTED: thaumatin-like protein 1b [Phoenix dactylifera]
Length=312

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 77/116 (66%), Gaps = 3/116 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YTVWPG LSG+G   L   GF L+ G+S  LQAP GWSGRFW RT C+FD 
Sbjct  32   AFTFVNKCGYTVWPGILSGSGSPELETTGFELATGDSRSLQAPTGWSGRFWGRTECSFDG  91

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            +G G+C T   G  G    G G  PP TLAEFT+A   + KDFYDVSLVDGYN+ +
Sbjct  92   AGKGSCATGDCGTGGVECKGSGAAPPATLAEFTLAGPASAKDFYDVSLVDGYNLPM  147



>ref|XP_010920167.1| PREDICTED: thaumatin-like protein 1b isoform X1 [Elaeis guineensis]
Length=315

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 74/114 (65%), Gaps = 3/114 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C Y VWPG LSG+G   L   GF L+ G+S   QAP GWSGRFWART CNFD 
Sbjct  33   TFTFVNKCGYGVWPGILSGSGSPELETTGFELAAGDSRRFQAPTGWSGRFWARTACNFDG  92

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNV  14
            +G G+C T   G       G G  PP TLAEFT+A   + +DFYDVSLVDGYN+
Sbjct  93   AGKGSCATGDCGSGEVECKGRGATPPATLAEFTLAGTASSRDFYDVSLVDGYNL  146



>ref|XP_007202291.1| hypothetical protein PRUPE_ppa009119mg [Prunus persica]
 gb|EMJ03490.1| hypothetical protein PRUPE_ppa009119mg [Prunus persica]
Length=306

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 75/116 (65%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C +TVWPG L+  G   L   GF L+ G +   QAP GWSGRFW RTGCNFD 
Sbjct  24   TFTFTNKCDFTVWPGILASAGTPKLDSTGFELAKGSTRSFQAPTGWSGRFWGRTGCNFDG  83

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G+C T   G       G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ +
Sbjct  84   SGHGSCSTGDCGSGQLECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGYNLPM  137



>ref|XP_009110282.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=247

 Score =   102 bits (254),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 86/126 (68%), Gaps = 3/126 (2%)
 Frame = -2

Query  373  GITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFW  194
            G  +V +   FT+ N C + VWPG L+G+ G  L  GGFAL+ G SV++ APAGWSGR W
Sbjct  19   GALSVVSGTVFTIVNRCNFPVWPGILTGDNGVQLNGGGFALNTGASVDVAAPAGWSGRIW  78

Query  193  ARTGCNFDASGNGNCVTgdcgglkcgggG--VPPVTLAEFTIANGNADKDFYDVSLVDGY  20
             RTGCNFDA G G+C+TG+CG      G    PP TLAEFTI +G A  DFYDVSLVDGY
Sbjct  79   GRTGCNFDAFGTGSCLTGNCGNKVQCSGAGGAPPATLAEFTIGHGGA-MDFYDVSLVDGY  137

Query  19   NVDLGI  2
            NV + I
Sbjct  138  NVQMEI  143



>ref|XP_010431808.1| PREDICTED: thaumatin-like protein 1 [Camelina sativa]
Length=346

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C +TVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC FD 
Sbjct  30   TFTFANRCGFTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCKFDG  89

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C TGDCG  +    G+   PPVTLAEFT+  G    DFYDVSLVDGYN+ +
Sbjct  90   SGSGACTTGDCGSNQVECVGLGAAPPVTLAEFTL--GTCGDDFYDVSLVDGYNIPM  143



>gb|KCW56621.1| hypothetical protein EUGRSUZ_I02339 [Eucalyptus grandis]
Length=306

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 80/121 (66%), Gaps = 4/121 (3%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            ++ +FT  N C + VWPG LSG G   L   GF L+ GES  LQ PAGWSGRFW R+GC+
Sbjct  9    SSATFTFVNKCNFPVWPGILSGAGSPPLETTGFELAKGESHSLQVPAGWSGRFWGRSGCS  68

Query  175  FDASGNGNCVTgdcgglkcggg---GVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            FD+SG G+C T DCG  +         PP TLAEFT+  G+  +DFYDVSLVDGYN+ + 
Sbjct  69   FDSSGRGSCATADCGSGEVECKGGNAAPPATLAEFTLG-GSGSQDFYDVSLVDGYNLPMV  127

Query  4    I  2
            I
Sbjct  128  I  128



>ref|XP_010935078.1| PREDICTED: thaumatin-like protein 1b [Elaeis guineensis]
Length=379

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 76/113 (67%), Gaps = 4/113 (4%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FT  N C YTVWPG L+ +G A L   GF L+ G+S  L APAGWSGRFWARTGCNFD+S
Sbjct  105  FTFVNNCGYTVWPGVLANSGNANLDSTGFTLAAGDSRVLLAPAGWSGRFWARTGCNFDSS  164

Query  163  GNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNV  14
            G G+C T   G       G G  PP TLAEFT+     DKD+YDVSLVDGYN+
Sbjct  165  GRGSCATGDCGSGQVECNGAGAAPPATLAEFTLGKA-GDKDYYDVSLVDGYNL  216



>emb|CDY12096.1| BnaC03g60120D [Brassica napus]
Length=346

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 77/116 (66%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C +TVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC+FD 
Sbjct  30   TFTFANRCGFTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCSFDG  89

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C TGDCG  +    G+   PPVTLAEFT+  G    DFYDVSLVDGYN+ +
Sbjct  90   SGSGTCKTGDCGSNQVECVGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNLPM  143



>ref|XP_010029672.1| PREDICTED: thaumatin-like protein 1 [Eucalyptus grandis]
Length=325

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 80/121 (66%), Gaps = 4/121 (3%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            ++ +FT  N C + VWPG LSG G   L   GF L+ GES  LQ PAGWSGRFW R+GC+
Sbjct  28   SSATFTFVNKCNFPVWPGILSGAGSPPLETTGFELAKGESHSLQVPAGWSGRFWGRSGCS  87

Query  175  FDASGNGNCVTgdcgglkcggg---GVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            FD+SG G+C T DCG  +         PP TLAEFT+  G+  +DFYDVSLVDGYN+ + 
Sbjct  88   FDSSGRGSCATADCGSGEVECKGGNAAPPATLAEFTLG-GSGSQDFYDVSLVDGYNLPMV  146

Query  4    I  2
            I
Sbjct  147  I  147



>ref|XP_008801393.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Phoenix 
dactylifera]
Length=279

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 76/115 (66%), Gaps = 3/115 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT++N C + +WPGTL+G G   L   GF L PG S  + AP GWSGRFWARTGC FDA
Sbjct  25   TFTIYNNCPHAIWPGTLAGAGTPQLPTTGFRLEPGRSERIAAPPGWSGRFWARTGCKFDA  84

Query  166  SGNGNCVTgdcgglkcg--ggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
             G G C TGDC G       G +PP TL E T+  G  D+DFYDVSLVDGYN+ +
Sbjct  85   EGAGTCQTGDCAGRMECGGAGALPPATLFEITLGKGK-DRDFYDVSLVDGYNLPI  138



>gb|KDP26886.1| hypothetical protein JCGZ_18044 [Jatropha curcas]
Length=232

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 77/119 (65%), Gaps = 5/119 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A  FT  N C  TVWPG LSG G   L  GGF L PG+SV L AP GWSGRFW RTGC+F
Sbjct  19   AAVFTFSNRCRTTVWPGILSGAGKPQLMGGGFELRPGQSVTLNAPQGWSGRFWGRTGCSF  78

Query  172  DASGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            D SG G C+T          G GGVPP +LAEFT+   N+  D+YDVSLVDG+N+ + I
Sbjct  79   DRSGRGRCLTGDCGGVLKCAGAGGVPPASLAEFTL---NSPLDYYDVSLVDGFNLPISI  134



>gb|EAZ07901.1| hypothetical protein OsI_30157 [Oryza sativa Indica Group]
Length=352

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 79/116 (68%), Gaps = 4/116 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N CT TVWPG LSG+G   L   GFALSPG S  L AP+GWSGRFWAR+GC+FD 
Sbjct  37   TFTFTNRCTDTVWPGVLSGSGTPPLETTGFALSPGGSRSLYAPSGWSGRFWARSGCDFDD  96

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG G+C T   G       G G  PP TLAEFT+ NG   KDFYDVSLVDGYN+ +
Sbjct  97   SGKGSCATGDCGSGQVECRGAGASPPATLAEFTL-NGADGKDFYDVSLVDGYNLPM  151



>ref|XP_006466958.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Citrus 
sinensis]
Length=238

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 72/124 (58%), Gaps = 8/124 (6%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            I+    A +FT  N C YTVWPG L        G        G S   QAP GWSGRFW 
Sbjct  17   ISKGVTAATFTFVNKCDYTVWPGILGSPKLDSTGFELQK---GGSRSFQAPTGWSGRFWG  73

Query  190  RTGCNFDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
            RTGCNFD+SG+G+C T           G G  PP TLAEFT+ +G+  +DFYDVSLVDGY
Sbjct  74   RTGCNFDSSGHGSCATADCGSNQVECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGY  131

Query  19   NVDL  8
            N+ +
Sbjct  132  NIPI  135



>ref|XP_004292943.1| PREDICTED: pathogenesis-related protein 5-like [Fragaria vesca 
subsp. vesca]
Length=341

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 76/117 (65%), Gaps = 5/117 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFD-  170
            +FT  N C Y V+PGTLSG+    L   GF L PGES  LQAP  WSGRFW RTGCNFD 
Sbjct  29   TFTFINRCDYAVYPGTLSGSSSPPLETTGFQLQPGESRSLQAPPSWSGRFWGRTGCNFDP  88

Query  169  ASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
             +G G+C +           G G +PP TLAEFTI +G+  KDFYDVSLVDG+N+ +
Sbjct  89   TTGQGSCTSADCGSNQLQCNGAGAIPPATLAEFTIGSGDT-KDFYDVSLVDGFNLPM  144



>ref|XP_009379396.1| PREDICTED: thaumatin-like protein 1 [Pyrus x bretschneideri]
Length=305

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 76/126 (60%), Gaps = 5/126 (4%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            +T      +FT  N C +TVWPG L+  G   L   GF L  G S   QAP GWSGRFW 
Sbjct  16   VTEGVLGATFTFTNKCDFTVWPGILASAGSNKLDSTGFELPKGSSRVFQAPTGWSGRFWG  75

Query  190  RTGCNFDASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
            RTGC FD SG G+C T   G       G G VPP TLAEFT+ +G+  +DFYDVSLVDGY
Sbjct  76   RTGCTFDGSGQGSCSTGDCGSGELECNGAGAVPPATLAEFTLGSGS--QDFYDVSLVDGY  133

Query  19   NVDLGI  2
            N+ + +
Sbjct  134  NLPMTV  139



>ref|NP_001169696.1| putative thaumatin domain family protein precursor [Zea mays]
 gb|ACN34559.1| unknown [Zea mays]
 gb|AFW89119.1| putative thaumatin domain family protein [Zea mays]
Length=263

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 84/119 (71%), Gaps = 7/119 (6%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTLHN CT+TVWP TLSGN  A +G GGF LSPG +V   APAGWSGR WARTGC   +S
Sbjct  33   FTLHNNCTHTVWPATLSGNSAAAVGGGGFELSPGATVSFPAPAGWSGRLWARTGCVASSS  92

Query  163  ---GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNAD-KDFYDVSLVDGYNVDLGI  2
               G  +C TG   G   C  GG PPVTLAEFT+  G AD KDFYDVSLVDGYNV +G+
Sbjct  93   SPAGRLSCATGDCSGAASCSLGGAPPVTLAEFTL--GGADGKDFYDVSLVDGYNVGIGV  149



>ref|XP_008801392.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Phoenix 
dactylifera]
Length=292

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 76/115 (66%), Gaps = 3/115 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT++N C + +WPGTL+G G   L   GF L PG S  + AP GWSGRFWARTGC FDA
Sbjct  25   TFTIYNNCPHAIWPGTLAGAGTPQLPTTGFRLEPGRSERIAAPPGWSGRFWARTGCKFDA  84

Query  166  SGNGNCVTgdcgglkcg--ggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
             G G C TGDC G       G +PP TL E T+  G  D+DFYDVSLVDGYN+ +
Sbjct  85   EGAGTCQTGDCAGRMECGGAGALPPATLFEITLGKGK-DRDFYDVSLVDGYNLPI  138



>ref|XP_004505780.1| PREDICTED: thaumatin-like protein 1-like [Cicer arietinum]
Length=336

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 75/116 (65%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YTVWPG L+  G   LG  GF L    S   QAPAGWSGRFWARTGCNFD 
Sbjct  26   TFTFVNRCDYTVWPGILANAGTPTLGSTGFELPQETSRTFQAPAGWSGRFWARTGCNFDR  85

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G+C+T   G       G G  PP TLAEFT+  G   +DFYDVSLVDGYN+ +
Sbjct  86   SGSGSCLTGDCGSGMIECNGAGAAPPATLAEFTL--GTIGQDFYDVSLVDGYNLPM  139



>ref|XP_004957480.1| PREDICTED: thaumatin-like protein 1-like [Setaria italica]
Length=310

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 77/116 (66%), Gaps = 4/116 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C  TVWPG L+ +G + L   GFAL  GE+  L APAGWSGRFWARTGC FDA
Sbjct  30   TFTFTNRCGGTVWPGVLANSGSSPLQTTGFALGAGETRSLTAPAGWSGRFWARTGCAFDA  89

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG G+C T   G       G G  PP TLAEFT+  G+  KD+YDVSLVDGYN+ +
Sbjct  90   SGKGSCATGDCGSGEVECHGEGAAPPATLAEFTL-GGSGGKDYYDVSLVDGYNLPM  144



>gb|KFK28279.1| hypothetical protein AALP_AA8G495800 [Arabis alpina]
Length=236

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 77/118 (65%), Gaps = 5/118 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FTL N C +TVWPG L+ +  + L   GF L  GES    AP GWSGRFW RTGCNFD 
Sbjct  14   TFTLVNKCDFTVWPGILASSDSSRLDTTGFELPRGESRSFPAPPGWSGRFWGRTGCNFDG  73

Query  166  SGNGNCVTgdcgglkcg---ggGVPPVTLAEFTIAN--GNADKDFYDVSLVDGYNVDL  8
             G G+C  GDCG  +      G VPP TLAEFTIA+  G   +DFYDVS+VDGYN+ +
Sbjct  74   QGLGSCAVGDCGSGQVECNGAGAVPPATLAEFTIASVAGTGTQDFYDVSMVDGYNLPM  131



>emb|CDX80458.1| BnaC07g29860D [Brassica napus]
Length=388

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 84/121 (69%), Gaps = 2/121 (2%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            +V  + +F + N C +T+WPGTLSG+G   L   GF L  G+SV++ +  GWSGR WART
Sbjct  15   SVSYSSTFVITNNCPFTIWPGTLSGSGTRPLPTTGFRLDVGQSVKIPSVLGWSGRIWART  74

Query  184  GCNFDASGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  11
            GCNFDASG G CVTGDC       G G  PP +L E T+ +G++DKDFYDVSLVDGYN+ 
Sbjct  75   GCNFDASGAGKCVTGDCGGKLECAGNGAAPPTSLFEITLGHGSSDKDFYDVSLVDGYNLP  134

Query  10   L  8
            +
Sbjct  135  I  135



>ref|XP_010664831.1| PREDICTED: thaumatin-like protein 1b [Vitis vinifera]
 emb|CBI19884.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 77/116 (66%), Gaps = 4/116 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +F + N C +TVWPG LS  G + L   GF LS G S  L+ P GWSGRFW R+GC FDA
Sbjct  28   TFAITNRCDFTVWPGILSNAGSSRLETTGFELSSGGSRSLEVPVGWSGRFWGRSGCTFDA  87

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            +G+GNC T   G       G G +PP TLAEFTI +G + +DFYDVSLVDGYN+ +
Sbjct  88   TGHGNCTTGDCGSGQVECNGAGAIPPATLAEFTIGSG-SQQDFYDVSLVDGYNLPM  142



>gb|KHG02944.1| hypothetical protein F383_23941 [Gossypium arboreum]
Length=354

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 75/116 (65%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            SFT  N C YTVWPG L+  G   L   GF L    S   QAP GWSGRFW RTGC FD 
Sbjct  30   SFTFVNRCGYTVWPGILANAGSPTLDSTGFELPKDSSRSFQAPTGWSGRFWGRTGCTFDG  89

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G CVTGDCG  +    G+   PPVTLAEFT+  G   +DFYDVSLVDGYN+ +
Sbjct  90   SGSGTCVTGDCGSGQMECNGLGAAPPVTLAEFTLGTGG--QDFYDVSLVDGYNIPM  143



>gb|EYU38795.1| hypothetical protein MIMGU_mgv1a010603mg [Erythranthe guttata]
Length=307

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 73/117 (62%), Gaps = 4/117 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFD-  170
            +FTL N C YTVWPG L  +G   L   GF L P  +  LQAP GWSGR WARTGC+FD 
Sbjct  30   TFTLLNRCDYTVWPGILPNHGSPGLDTTGFELPPRAARSLQAPPGWSGRLWARTGCSFDP  89

Query  169  ASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
             +G G C T             G VPP TLAEFT+ +G+A  DFYDVSLVDGYN+ +
Sbjct  90   TTGAGRCATADCGSNRVECGSNGAVPPATLAEFTVGSGSAALDFYDVSLVDGYNLPM  146



>ref|XP_002890328.1| hypothetical protein ARALYDRAFT_472154 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66587.1| hypothetical protein ARALYDRAFT_472154 [Arabidopsis lyrata subsp. 
lyrata]
Length=244

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 75/119 (63%), Gaps = 6/119 (5%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C+ T+WPG L+ NG  +   G    + G SV L   AGWSGRFW RTGCNFDAS
Sbjct  28   FTLTNHCSSTIWPGILTANGTPIGDGGFALAA-GSSVTLTVSAGWSGRFWGRTGCNFDAS  86

Query  163  GNGNCVT--gdcgglkcgggGVPPVTLAEFTIANG---NADKDFYDVSLVDGYNVDLGI  2
            G+G C T          G GG PP TLAEFTI +    NA +DFYDVSLVDGYNV + I
Sbjct  87   GSGKCTTGDCGGKLKCAGAGGAPPATLAEFTIGSSGKKNAVQDFYDVSLVDGYNVQMKI  145



>gb|ABR17407.1| unknown [Picea sitchensis]
Length=246

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 75/116 (65%), Gaps = 4/116 (3%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C+ T+WPG     G +L G G    + G+SV + AP GWSGRFW RTGC F AS
Sbjct  26   FTLVNRCSETIWPGLAGNGGTSLAGGGFALST-GQSVPVNAPTGWSGRFWGRTGCAFSAS  84

Query  163  GNGNCVTgdcgglkcgggGV--PPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G G+C TG+C       G    PP TLAEFTI  G+A KDFYDVSLVDGYNV L I
Sbjct  85   GVGSCATGNCVHGLKCAGSTGEPPATLAEFTI-GGDAGKDFYDVSLVDGYNVPLSI  139



>emb|CAN79402.1| hypothetical protein VITISV_028072 [Vitis vinifera]
Length=295

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 77/116 (66%), Gaps = 4/116 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +F + N C +TVWPG LS  G + L   GF LS G S  L+ P GWSGRFW R+GC FDA
Sbjct  28   TFAITNRCDFTVWPGILSNAGSSRLETTGFELSSGGSRSLEVPVGWSGRFWGRSGCTFDA  87

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            +G+GNC T   G       G G +PP TLAEFTI +G + +DFYDVSLVDGYN+ +
Sbjct  88   TGHGNCTTGDCGSGQVECNGAGAIPPATLAEFTIGSG-SQQDFYDVSLVDGYNLPM  142



>gb|KDO71232.1| hypothetical protein CISIN_1g045716mg, partial [Citrus sinensis]
Length=283

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 70/118 (59%), Gaps = 8/118 (7%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A +FT  N C YTVWPG L        G        G S   QAP GWSGRFW RTGCNF
Sbjct  3    AATFTFVNKCDYTVWPGILGSPKLDSTGFELQK---GGSRSFQAPTGWSGRFWGRTGCNF  59

Query  172  DASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            D+SG+G+C T           G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ +
Sbjct  60   DSSGHGSCATADCGSNQVECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGYNIPI  115



>ref|XP_010459595.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=249

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 73/120 (61%), Gaps = 7/120 (6%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N C+ TVWPG L+  G  L   G    S G SV L A  GWSGRFW RTGCNFDAS
Sbjct  29   FTLTNHCSSTVWPGILTSKGTQLGDGGLALAS-GSSVTLTASPGWSGRFWGRTGCNFDAS  87

Query  163  GNGNCVT--gdcgglkcgggGVPPVTLAEFTIA----NGNADKDFYDVSLVDGYNVDLGI  2
            G G CVT          G GG PP TLAEFTI       N+ +DFYDVSLVDGYNV + I
Sbjct  88   GVGKCVTGDCGGKLKCAGAGGAPPATLAEFTIGTPGPRSNSVQDFYDVSLVDGYNVQMKI  147



>ref|XP_006466957.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Citrus 
sinensis]
Length=309

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 72/124 (58%), Gaps = 8/124 (6%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            I+    A +FT  N C YTVWPG L        G        G S   QAP GWSGRFW 
Sbjct  17   ISKGVTAATFTFVNKCDYTVWPGILGSPKLDSTGFELQK---GGSRSFQAPTGWSGRFWG  73

Query  190  RTGCNFDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
            RTGCNFD+SG+G+C T           G G  PP TLAEFT+ +G+  +DFYDVSLVDGY
Sbjct  74   RTGCNFDSSGHGSCATADCGSNQVECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGY  131

Query  19   NVDL  8
            N+ +
Sbjct  132  NIPI  135



>ref|XP_006851913.1| hypothetical protein AMTR_s00041p00163280 [Amborella trichopoda]
 gb|ERN13380.1| hypothetical protein AMTR_s00041p00163280 [Amborella trichopoda]
Length=319

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 77/120 (64%), Gaps = 6/120 (5%)
 Frame = -2

Query  355  AAGS-FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGC  179
            AAGS FT+ N C YTVWPG LS  G A L   GF L  G+   LQ PAGWSGRFW RTGC
Sbjct  19   AAGSTFTIINNCDYTVWPGILSNAGSAKLSTTGFELQKGQFQTLQPPAGWSGRFWGRTGC  78

Query  178  NFDASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
             FD+SG G+C T   G       G G  PP TLAEFT+  G   +DFYDVSLVDGYN+ +
Sbjct  79   TFDSSGRGSCATGDCGSNQIECNGAGAAPPATLAEFTL--GVETQDFYDVSLVDGYNLPM  136



>ref|XP_008788616.1| PREDICTED: thaumatin-like protein 1b [Phoenix dactylifera]
Length=305

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 79/114 (69%), Gaps = 6/114 (5%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FT  N C YTVWPG LS +G   L   GF L+ G+S  L AP GWSGRFWARTGCNFD++
Sbjct  30   FTFVNNCGYTVWPGVLSSSGSPKLDSTGFTLAAGDSRVLLAPTGWSGRFWARTGCNFDSA  89

Query  163  GNGNCVTgdcgglkcg---ggGVPPVTLAEFTIANGNAD-KDFYDVSLVDGYNV  14
            G G+C TGDCG  +      G  PP TLAEFT+  G AD KDFYDVSLVDGYN+
Sbjct  90   GRGSCTTGDCGSGQVECNGAGATPPATLAEFTL--GGADGKDFYDVSLVDGYNL  141



>ref|XP_008664601.1| PREDICTED: thaumatin-like protein 1b [Zea mays]
 tpg|DAA48749.1| TPA: putative thaumatin domain family protein [Zea mays]
Length=319

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 78/116 (67%), Gaps = 4/116 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C  TVWPG LSG+G   L   GFAL+PG+S  L AP GWSGRFW R+GC FDA
Sbjct  30   TFTFTNRCGDTVWPGLLSGSGTPPLETTGFALAPGQSRSLYAPQGWSGRFWGRSGCAFDA  89

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG G+C T   G       G G  PP TLAEFT+ +G+  KDFYDVSLVDGYN+ +
Sbjct  90   SGKGSCATGDCGSGEVECRGAGASPPATLAEFTL-DGDGGKDFYDVSLVDGYNLPM  144



>ref|XP_010257784.1| PREDICTED: thaumatin-like protein [Nelumbo nucifera]
Length=235

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 77/116 (66%), Gaps = 5/116 (4%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL+N C  T+WPG     G   L  GGF L PGE+V + APA WSGRFW R  C+FD S
Sbjct  22   FTLNNNCRKTIWPGIQPSAGKPDLEAGGFPLKPGETVSISAPAAWSGRFWGRRSCSFDPS  81

Query  163  GNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            G G+C+TGDC       G GG PPVTLAEFT+   N+  D+YD+SLVDGYN+ + I
Sbjct  82   GKGSCITGDCGGLLACSGMGGAPPVTLAEFTL---NSPDDYYDISLVDGYNMAVSI  134



>ref|XP_004973952.1| PREDICTED: pathogenesis-related protein 5-like [Setaria italica]
Length=392

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 76/118 (64%), Gaps = 2/118 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            A+ SFT+ N C+  +WPGTL+G G   L   GF L PG++V++ AP GWSGR WARTGC 
Sbjct  29   ASCSFTVSNYCSQPIWPGTLAGAGTPQLPTTGFRLDPGQTVQVPAPTGWSGRLWARTGCA  88

Query  175  FDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            FDA GNG C TG         G G  PPVTL E T+     D D+YDVSLVDGYN+ +
Sbjct  89   FDAGGNGTCQTGDCGGRLECAGTGATPPVTLFEVTLGKAAGDLDYYDVSLVDGYNLPV  146



>ref|XP_008394054.1| PREDICTED: thaumatin-like protein 1, partial [Malus domestica]
Length=297

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 73/116 (63%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C +TVWPG L+  G   L   GF L  G S   QAP GWSGRFW RTGC FD 
Sbjct  16   TFTFTNKCDFTVWPGILASAGSDKLDSTGFELPKGSSRVFQAPTGWSGRFWGRTGCXFDG  75

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG G+C T   G       G G VPP TLAEFT+ +G+  +DFYDVSLVDGYN+ +
Sbjct  76   SGRGSCSTGDCGSGELECNGAGAVPPATLAEFTLGSGS--QDFYDVSLVDGYNLPM  129



>ref|XP_010929479.1| PREDICTED: pathogenesis-related protein 5-like [Elaeis guineensis]
Length=310

 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 72/113 (64%), Gaps = 3/113 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT++N C +T+WPGTL+G G   L   GF L PG SV + AP GWSGR WARTGC FDA
Sbjct  25   TFTIYNNCPHTIWPGTLAGAGTPQLSTTGFQLEPGRSVRMAAPPGWSGRMWARTGCEFDA  84

Query  166  SGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNV  14
             G G C T          G G +PP TL E T+  G  D D+YDVSLVDGYN+
Sbjct  85   QGAGTCQTGDCGGRMECGGAGALPPATLFEITLGKGK-DPDYYDVSLVDGYNL  136



>emb|CDX68151.1| BnaA07g21910D [Brassica napus]
Length=242

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 78/121 (64%), Gaps = 5/121 (4%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQA--PAGWSGRFWARTG  182
            +A  FTL N+C YTVWP T +G G  L   G     PG SV+L      GWSGRFW RTG
Sbjct  19   SATVFTLKNSCPYTVWPATFAGKGSTLGEGGFQLD-PGASVQLTLTNEPGWSGRFWGRTG  77

Query  181  CNFDASGNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            CNFD+SG+GNC T      LKC   G  P TLAEFTI  G++  DFYD+SLVDGYNV +G
Sbjct  78   CNFDSSGHGNCATGDCGNSLKCTVTGATPSTLAEFTI-QGHSGNDFYDLSLVDGYNVKMG  136

Query  4    I  2
            I
Sbjct  137  I  137



>ref|XP_007041885.1| Pathogenesis-related thaumatin superfamily protein isoform 5 
[Theobroma cacao]
 gb|EOX97716.1| Pathogenesis-related thaumatin superfamily protein isoform 5 
[Theobroma cacao]
Length=376

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 75/116 (65%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            SFT  N C YTVWPG L+  G   L   GF L    S   QAP GWSGRFW RTGC FD 
Sbjct  44   SFTFVNRCAYTVWPGILANAGSPRLDSTGFELPKDSSRSFQAPTGWSGRFWGRTGCTFDG  103

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C+TGDCG  +    G+   PPVTLAEFT+  G   +DFYDVSLVDGYN+ +
Sbjct  104  SGSGACLTGDCGAGQMECNGLGAAPPVTLAEFTLGTGG--QDFYDVSLVDGYNLPM  157



>ref|XP_009104727.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=242

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 78/121 (64%), Gaps = 5/121 (4%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQA--PAGWSGRFWARTG  182
            +A  FTL N+C YTVWP T +G G  L   G     PG SV+L      GWSGRFW RTG
Sbjct  19   SATVFTLKNSCPYTVWPATFAGKGSTLGEGGFQLD-PGASVQLTLTNEPGWSGRFWGRTG  77

Query  181  CNFDASGNGNCVT-gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            CNFD+SG+GNC T      LKC   G  P TLAEFTI  G++  DFYD+SLVDGYNV +G
Sbjct  78   CNFDSSGHGNCATGDCGNSLKCTVTGATPSTLAEFTI-QGDSGNDFYDLSLVDGYNVKMG  136

Query  4    I  2
            I
Sbjct  137  I  137



>emb|CAB45053.1| thaumatin-like protein [Arabidopsis thaliana]
 emb|CAB79328.1| thaumatin-like protein [Arabidopsis thaliana]
Length=255

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 80/121 (66%), Gaps = 8/121 (7%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            + T+ N C++TVWPG LS +G   +G  GF L PG S   QAPA WSGRFWARTGCNF++
Sbjct  29   TITIVNRCSFTVWPGILSNSGSGDIGTTGFELVPGGSRSFQAPASWSGRFWARTGCNFNS  88

Query  166  -SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNAD----KDFYDVSLVDGYNVD  11
             +G G C+T   G       G G  PP TLAEFTI +G AD    +DFYDVSLVDGYNV 
Sbjct  89   DTGQGTCLTGDCGSNQVECNGAGAKPPATLAEFTIGSGPADPARKQDFYDVSLVDGYNVP  148

Query  10   L  8
            +
Sbjct  149  M  149



>ref|XP_007041883.1| Pathogenesis-related thaumatin superfamily protein isoform 2 
[Theobroma cacao]
 gb|EOX97714.1| Pathogenesis-related thaumatin superfamily protein isoform 2 
[Theobroma cacao]
Length=372

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 75/116 (65%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            SFT  N C YTVWPG L+  G   L   GF L    S   QAP GWSGRFW RTGC FD 
Sbjct  44   SFTFVNRCAYTVWPGILANAGSPRLDSTGFELPKDSSRSFQAPTGWSGRFWGRTGCTFDG  103

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C+TGDCG  +    G+   PPVTLAEFT+  G   +DFYDVSLVDGYN+ +
Sbjct  104  SGSGACLTGDCGAGQMECNGLGAAPPVTLAEFTLGTGG--QDFYDVSLVDGYNLPM  157



>ref|NP_194149.2| thaumatin-like protein 1 [Arabidopsis thaliana]
 gb|AEE84860.1| thaumatin-like protein 1 [Arabidopsis thaliana]
Length=260

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 80/121 (66%), Gaps = 8/121 (7%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            + T+ N C++TVWPG LS +G   +G  GF L PG S   QAPA WSGRFWARTGCNF++
Sbjct  34   TITIVNRCSFTVWPGILSNSGSGDIGTTGFELVPGGSRSFQAPASWSGRFWARTGCNFNS  93

Query  166  -SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNAD----KDFYDVSLVDGYNVD  11
             +G G C+T   G       G G  PP TLAEFTI +G AD    +DFYDVSLVDGYNV 
Sbjct  94   DTGQGTCLTGDCGSNQVECNGAGAKPPATLAEFTIGSGPADPARKQDFYDVSLVDGYNVP  153

Query  10   L  8
            +
Sbjct  154  M  154



>gb|KEH30510.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=344

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 74/116 (64%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YTVWPG L+  G   LG  GF L    +   QAPAGWSGRFWARTGCNFD 
Sbjct  26   TFTFVNKCDYTVWPGILANAGSPTLGSTGFELPQETTRTFQAPAGWSGRFWARTGCNFDG  85

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG G+C+T   G       G G  PP TLAEFT+  G   +DFYDVSLVDGYN+ +
Sbjct  86   SGTGSCLTGDCGSNMVECNGAGAAPPATLAEFTL--GTIGQDFYDVSLVDGYNLPM  139



>gb|AAB63607.1| thaumatin isolog [Arabidopsis thaliana]
Length=262

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 80/121 (66%), Gaps = 8/121 (7%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            + T+ N C++TVWPG LS +G   +G  GF L PG S   QAPA WSGRFWARTGCNF++
Sbjct  36   TITIVNRCSFTVWPGILSNSGSGDIGTTGFELVPGGSRSFQAPASWSGRFWARTGCNFNS  95

Query  166  -SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNAD----KDFYDVSLVDGYNVD  11
             +G G C+T   G       G G  PP TLAEFTI +G AD    +DFYDVSLVDGYNV 
Sbjct  96   DTGQGTCLTGDCGSNQVECNGAGAKPPATLAEFTIGSGPADPARKQDFYDVSLVDGYNVP  155

Query  10   L  8
            +
Sbjct  156  M  156



>ref|XP_007041884.1| Pathogenesis-related thaumatin superfamily protein isoform 4, 
partial [Theobroma cacao]
 gb|EOX97715.1| Pathogenesis-related thaumatin superfamily protein isoform 4, 
partial [Theobroma cacao]
Length=305

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 75/116 (65%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            SFT  N C YTVWPG L+  G   L   GF L    S   QAP GWSGRFW RTGC FD 
Sbjct  13   SFTFVNRCAYTVWPGILANAGSPRLDSTGFELPKDSSRSFQAPTGWSGRFWGRTGCTFDG  72

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C+TGDCG  +    G+   PPVTLAEFT+  G   +DFYDVSLVDGYN+ +
Sbjct  73   SGSGACLTGDCGAGQMECNGLGAAPPVTLAEFTLGTGG--QDFYDVSLVDGYNLPM  126



>gb|KDP43442.1| hypothetical protein JCGZ_16729 [Jatropha curcas]
Length=234

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 78/119 (66%), Gaps = 7/119 (6%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A  FTL N C  T+WPGTLSG G  LLG G     PG S+ +  P  WSGRFWARTGC F
Sbjct  20   AAVFTLQNQCRITIWPGTLSGKGPLLLGGGTKLR-PGLSITIDVPHQWSGRFWARTGCRF  78

Query  172  DASGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            D+SG G C TGDC       G GGVPPVTLAEFT+ N N    FYDVSLVDGYN+ + I
Sbjct  79   DSSGKGKCATGDCGGLTHCAGAGGVPPVTLAEFTLDNQN----FYDVSLVDGYNIPISI  133



>ref|XP_008670298.1| PREDICTED: thaumatin-like protein 1b [Zea mays]
 tpg|DAA40436.1| TPA: putative thaumatin domain family protein [Zea mays]
Length=329

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 75/121 (62%), Gaps = 2/121 (2%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            +V  A +FT+ N C + +WPGTL+G G + L   GF L PG++ +L APAGWSGR WART
Sbjct  21   HVSVAMTFTISNYCPHPIWPGTLAGAGTSQLSTTGFKLEPGQTAQLAAPAGWSGRIWART  80

Query  184  GCNFDASGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  11
            GC FDA G G C T          G G  PP TL E T+  G    DFYDVSLVDGYN+ 
Sbjct  81   GCVFDAEGAGVCQTGDCGGRVECRGSGATPPATLFEVTLGQGGGQLDFYDVSLVDGYNLP  140

Query  10   L  8
            +
Sbjct  141  V  141



>ref|XP_009389442.1| PREDICTED: pathogenesis-related protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=259

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 80/116 (69%), Gaps = 2/116 (2%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            F L N C YTVWPG LSGNG  LLG G F L P  +     P GWSGRFWART C FD+S
Sbjct  34   FILENNCPYTVWPGALSGNGAVLLGNGSFELPPNATSSFSGPPGWSGRFWARTSCLFDSS  93

Query  163  -GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
              NG+C TG   G L+C  GG PPV+LAEFT+  G+  KDFYDVSLVDGYNV +G+
Sbjct  94   SANGSCATGDCGGALRCSIGGAPPVSLAEFTLGGGDGAKDFYDVSLVDGYNVGIGV  149



>ref|XP_010933320.1| PREDICTED: thaumatin-like protein 1b [Elaeis guineensis]
Length=313

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 78/118 (66%), Gaps = 3/118 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YTVWPG LSG+G   L   GF L+ G+S  L AP GWSGRFWART C+FD 
Sbjct  32   TFTFLNKCGYTVWPGILSGSGSPELETTGFELATGDSRSLLAPTGWSGRFWARTECSFDG  91

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            +G G+C T   G  G    G G  PP TLAEFT+A   + KD+YDVSLVDGYN+ + +
Sbjct  92   AGKGSCNTGDCGSGGVECKGSGAAPPATLAEFTLAGPASAKDYYDVSLVDGYNLPMMV  149



>ref|XP_007160531.1| hypothetical protein PHAVU_002G329400g [Phaseolus vulgaris]
 gb|ESW32525.1| hypothetical protein PHAVU_002G329400g [Phaseolus vulgaris]
Length=248

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 76/120 (63%), Gaps = 5/120 (4%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            AA SF  +N C + VWPG     G  +L  GGF L+P  +  LQ PA WSGRFW R GC 
Sbjct  25   AASSFVFYNKCPHPVWPGIQPSAGKPILARGGFKLAPNRAYSLQLPALWSGRFWGRHGCA  84

Query  175  FDASGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASG G C TGDC       G GG PP TLAEFT+ N   ++DFYDVSLVDGYN+ + I
Sbjct  85   FDASGRGRCATGDCGGSLYCNGIGGTPPATLAEFTLGN---EQDFYDVSLVDGYNLPISI  141



>gb|KCW66968.1| hypothetical protein EUGRSUZ_F00728 [Eucalyptus grandis]
Length=211

 Score = 99.4 bits (246),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 79/125 (63%), Gaps = 15/125 (12%)
 Frame = -2

Query  370  ITNVWAAGS-FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFW  194
            I NV A+ +  TL N C YTVWPGTLSGNG  L   G     PG S++LQAPAGWSGRFW
Sbjct  18   IGNVLASATVITLQNQCGYTVWPGTLSGNGPTLGDSGFAQP-PGGSIQLQAPAGWSGRFW  76

Query  193  ARTGCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNA-DKDFYDVSLVDGYN  17
             RT C+FD SG G CVTGD                A+FT+A  NA   DFYDVSLV+GYN
Sbjct  77   GRTDCSFDGSGTGTCVTGDYPSG------------AQFTVAAANAGGMDFYDVSLVNGYN  124

Query  16   VDLGI  2
            V +G+
Sbjct  125  VGMGV  129



>ref|XP_007041882.1| Pathogenesis-related thaumatin superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOX97713.1| Pathogenesis-related thaumatin superfamily protein isoform 1 
[Theobroma cacao]
Length=416

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 75/116 (65%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            SFT  N C YTVWPG L+  G   L   GF L    S   QAP GWSGRFW RTGC FD 
Sbjct  44   SFTFVNRCAYTVWPGILANAGSPRLDSTGFELPKDSSRSFQAPTGWSGRFWGRTGCTFDG  103

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C+TGDCG  +    G+   PPVTLAEFT+  G   +DFYDVSLVDGYN+ +
Sbjct  104  SGSGACLTGDCGAGQMECNGLGAAPPVTLAEFTLGTGG--QDFYDVSLVDGYNLPM  157



>ref|XP_004135916.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 ref|XP_004167983.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 gb|KGN45153.1| hypothetical protein Csa_7G428900 [Cucumis sativus]
Length=234

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 76/119 (64%), Gaps = 5/119 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A  FTL N C   +WPG   G G   L  GGF L PGE+V + AP GWSGRFW R GC+F
Sbjct  18   AAVFTLENKCNDIIWPGIQPGAGRPQLMNGGFQLKPGETVTINAPTGWSGRFWGRRGCSF  77

Query  172  DASGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            D SG G C TGDC       G GGVPP TLAEFT+   ++  DFYDVSLVDGYN+ + I
Sbjct  78   DVSGKGTCQTGDCGGVLECAGAGGVPPATLAEFTL---DSPLDFYDVSLVDGYNIPISI  133



>gb|KFK30466.1| hypothetical protein AALP_AA7G264700 [Arabis alpina]
Length=358

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 74/116 (64%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C+YTVWPG L+  G   L   GF L    S  LQAP GWSGRFW RTGC+FD 
Sbjct  30   TFTFANRCSYTVWPGILANAGSPTLSTTGFELPKDTSRSLQAPTGWSGRFWGRTGCSFDN  89

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            +G+G C T   G       GGG  PPVTLAEFT+  G+   DFYDVSLVDGYN+ +
Sbjct  90   TGSGTCKTGDCGSNQVECGGGGAAPPVTLAEFTLGTGS--DDFYDVSLVDGYNIPM  143



>ref|XP_008808638.1| PREDICTED: thaumatin-like protein 1b [Phoenix dactylifera]
Length=282

 Score =   100 bits (248),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 78/113 (69%), Gaps = 4/113 (4%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FT  N C  TVWPG LS +G   L   GFAL+ G+S  L APAGWSGRFWARTGCNFD++
Sbjct  7    FTFVNNCGDTVWPGVLSNSGSPKLDSTGFALAAGDSRVLMAPAGWSGRFWARTGCNFDSA  66

Query  163  GNGNCVTgdcgglkcg---ggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNV  14
            G G+C TGDCG  +      G  PP TLAEFT+  G   KDFYDVSLVDGYN+
Sbjct  67   GRGSCATGDCGSGQVECNGAGAAPPATLAEFTL-GGAEGKDFYDVSLVDGYNL  118



>ref|XP_010679923.1| PREDICTED: thaumatin-like protein 1b [Beta vulgaris subsp. vulgaris]
Length=332

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 74/116 (64%), Gaps = 4/116 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YTVWPG L+G     L   GF L  G +   QAPAGWSGRFW R+GC FD+
Sbjct  28   TFTFVNRCDYTVWPGLLAGASSPKLDSTGFELQHGGTRTFQAPAGWSGRFWGRSGCTFDS  87

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            +G G+C T   G       G G  PP TLAEFT+ NG+  +DFYDVSLVDGYN+ +
Sbjct  88   TGQGSCSTGDCGSGTIECNGSGATPPATLAEFTL-NGSGGQDFYDVSLVDGYNLPM  142



>ref|XP_008461434.1| PREDICTED: thaumatin-like protein, partial [Cucumis melo]
Length=224

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 76/119 (64%), Gaps = 5/119 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A  FTL N C   +WPG   G G   L  GGF L PGE+V + AP GWSGRFW R GC+F
Sbjct  8    AAVFTLENKCNDIIWPGIQPGAGRPQLMNGGFQLKPGETVTINAPTGWSGRFWGRRGCSF  67

Query  172  DASGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            D SG G C TGDC       G GGVPP TLAEFT+   ++  DFYDVSLVDGYN+ + I
Sbjct  68   DVSGKGTCETGDCGGVLECVGAGGVPPATLAEFTL---DSPLDFYDVSLVDGYNIPISI  123



>ref|XP_008448548.1| PREDICTED: thaumatin-like protein 1 [Cucumis melo]
 gb|ADN33946.1| zeamatin precursor [Cucumis melo subsp. melo]
Length=323

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 71/115 (62%), Gaps = 4/115 (3%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FT  N C +TVWPG LSG G       GF L  G S   QAPAGWSGRFW RT CNFD S
Sbjct  31   FTFVNKCDFTVWPGVLSGAGSLKFDTTGFELRKGSSRSFQAPAGWSGRFWGRTDCNFDGS  90

Query  163  GNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            G G C T   G       G G  PP TLAEFT+ +GN+  DFYDVSLVDGYN+ +
Sbjct  91   GRGVCNTGDCGSGEIECNGAGAAPPATLAEFTLGSGNS-PDFYDVSLVDGYNLAM  144



>ref|XP_008444818.1| PREDICTED: thaumatin-like protein 1b [Cucumis melo]
Length=250

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 66/116 (57%), Gaps = 7/116 (6%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFD-A  167
            FT  N C +TVWPG L        G       PG +   QAP GWSGRFW RTGC+FD A
Sbjct  33   FTFVNRCDFTVWPGILGNPQLESTGFELS---PGATRSFQAPPGWSGRFWGRTGCSFDPA  89

Query  166  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            +G GNC T           G G  PP TLAEFTI  G   +DFYDVSLVDGYN+ +
Sbjct  90   TGQGNCQTADCGSNQIECNGAGATPPATLAEFTIGGGAGGQDFYDVSLVDGYNIPM  145



>ref|XP_006383093.1| hypothetical protein POPTR_0005s11480g [Populus trichocarpa]
 gb|ERP60890.1| hypothetical protein POPTR_0005s11480g [Populus trichocarpa]
Length=325

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 69/115 (60%), Gaps = 8/115 (7%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FT  N C ++VWPG L        G        G S   QAP GWSGRFW RTGCNFD+S
Sbjct  32   FTFVNKCDFSVWPGILGSPELDSTGFELR---KGSSRSFQAPTGWSGRFWGRTGCNFDSS  88

Query  163  GNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            G+G+CVT           G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ +
Sbjct  89   GHGSCVTADCGSGQVECNGAGATPPATLAEFTLGSGS--QDFYDVSLVDGYNLPM  141



>ref|XP_002534154.1| Zeamatin precursor, putative [Ricinus communis]
 gb|EEF28230.1| Zeamatin precursor, putative [Ricinus communis]
Length=338

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 77/118 (65%), Gaps = 5/118 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A +FT  N C YTVWPG L+  G   L   GF L    S   QAP GWSGRFWARTGC F
Sbjct  23   AATFTFVNRCEYTVWPGILANAGSPRLDTTGFELPKDTSRSFQAPTGWSGRFWARTGCAF  82

Query  172  DASGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            D SG+G+C+TGDCG       G+   PP TLAEFT+ +G   +DFYDVSLVDGYN+ +
Sbjct  83   DDSGSGSCLTGDCGSGLVECNGLGAAPPATLAEFTLGSGG--QDFYDVSLVDGYNLPM  138



>ref|XP_002265805.1| PREDICTED: thaumatin-like protein 1b [Vitis vinifera]
 emb|CBI17366.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 76/126 (60%), Gaps = 5/126 (4%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            I+   +  +FT  N C +TVWPG L   G   L   GF L  G S   QAP GWSGRFW 
Sbjct  26   ISEGVSGSTFTFLNRCDFTVWPGILDSAGSPKLETTGFVLPKGSSRGFQAPTGWSGRFWG  85

Query  190  RTGCNFDASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
            RTGCNFD SG+G C T   G       G G  PP TLAEFT+ +G+  +D+YDVSLVDGY
Sbjct  86   RTGCNFDGSGHGTCATGDCGSGQVECNGAGASPPATLAEFTLGSGS--QDYYDVSLVDGY  143

Query  19   NVDLGI  2
            N+ + +
Sbjct  144  NLPMMV  149



>ref|XP_011046468.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Populus 
euphratica]
Length=339

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A +FT  N C YTVWPG L+  G   L   GF L    S    AP GWSGRFWARTGCNF
Sbjct  29   AATFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDSSRSFIAPTGWSGRFWARTGCNF  88

Query  172  DASGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            D SG G+C TGDCG  +    G+   PP TLAEFT+ +G   +DFYDVSLVDGYN+ +
Sbjct  89   DESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLGSGG--QDFYDVSLVDGYNLPM  144



>ref|XP_011046459.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Populus 
euphratica]
Length=340

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A +FT  N C YTVWPG L+  G   L   GF L    S    AP GWSGRFWARTGCNF
Sbjct  29   AATFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDSSRSFIAPTGWSGRFWARTGCNF  88

Query  172  DASGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            D SG G+C TGDCG  +    G+   PP TLAEFT+ +G   +DFYDVSLVDGYN+ +
Sbjct  89   DESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLGSGG--QDFYDVSLVDGYNLPM  144



>gb|ABK92515.1| unknown [Populus trichocarpa]
 gb|AFZ78665.1| thaumatin [Populus tomentosa]
Length=344

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A +FT  N C YTVWPG L+  G   L   GF L    S    AP GWSGRFWARTGCNF
Sbjct  29   AATFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDSSRSFIAPTGWSGRFWARTGCNF  88

Query  172  DASGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            D SG G+C TGDCG  +    G+   PP TLAEFT+ +G   +DFYDVSLVDGYN+ +
Sbjct  89   DESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLGSGG--QDFYDVSLVDGYNLPM  144



>gb|KDP29626.1| hypothetical protein JCGZ_18788 [Jatropha curcas]
Length=346

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C YTVWPG L+  G   L   GF L    S   QAP GWSGRFWARTGCNFD 
Sbjct  25   TFTFVNRCEYTVWPGILANAGSPRLDSTGFELPKDTSRSFQAPTGWSGRFWARTGCNFDD  84

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C+TGDCG  +    G+   PP TLAEFT+  G   +DFYDVSLVDGYN+ +
Sbjct  85   SGSGFCLTGDCGSGQVECNGLGAAPPATLAEFTLGTGG--QDFYDVSLVDGYNLPM  138



>ref|XP_006379282.1| hypothetical protein POPTR_0009s13510g [Populus trichocarpa]
 gb|ERP57079.1| hypothetical protein POPTR_0009s13510g [Populus trichocarpa]
Length=343

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A +FT  N C YTVWPG L+  G   L   GF L    S    AP GWSGRFWARTGCNF
Sbjct  29   AATFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDSSRSFIAPTGWSGRFWARTGCNF  88

Query  172  DASGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            D SG G+C TGDCG  +    G+   PP TLAEFT+ +G   +DFYDVSLVDGYN+ +
Sbjct  89   DESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLGSGG--QDFYDVSLVDGYNLPM  144



>ref|XP_002313721.2| hypothetical protein POPTR_0009s13510g [Populus trichocarpa]
 gb|EEE87676.2| hypothetical protein POPTR_0009s13510g [Populus trichocarpa]
Length=344

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 76/118 (64%), Gaps = 5/118 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A +FT  N C YTVWPG L+  G   L   GF L    S    AP GWSGRFWARTGCNF
Sbjct  29   AATFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDSSRSFIAPTGWSGRFWARTGCNF  88

Query  172  DASGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            D SG G+C TGDCG  +    G+   PP TLAEFT+ +G   +DFYDVSLVDGYN+ +
Sbjct  89   DESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLGSGG--QDFYDVSLVDGYNLPM  144



>ref|XP_002867678.1| hypothetical protein ARALYDRAFT_492443 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43937.1| hypothetical protein ARALYDRAFT_492443 [Arabidopsis lyrata subsp. 
lyrata]
Length=260

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 79/121 (65%), Gaps = 8/121 (7%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            + T+ N C++TVWPG LS +G   +G  GF L PG S   QAPA WSGRFWARTGCNF++
Sbjct  34   TITIVNRCSFTVWPGILSNSGSGDIGTTGFELVPGGSRSFQAPASWSGRFWARTGCNFNS  93

Query  166  -SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNAD----KDFYDVSLVDGYNVD  11
             +G G C+T   G       G G  PP TLAEFTI +G  D    +DFYDVSLVDGYNV 
Sbjct  94   DTGQGTCITGDCGSNQVECNGAGAKPPATLAEFTIGSGPEDPARKQDFYDVSLVDGYNVP  153

Query  10   L  8
            +
Sbjct  154  M  154



>ref|XP_010941295.1| PREDICTED: thaumatin-like protein 1b [Elaeis guineensis]
Length=300

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 78/114 (68%), Gaps = 6/114 (5%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FT  N C  TVWPG LS +G   L   GFAL+ GES  L APAGWSGRFWARTGCNFD++
Sbjct  30   FTFVNNCGDTVWPGVLSNSGSPKLDSTGFALAAGESRVLLAPAGWSGRFWARTGCNFDSA  89

Query  163  GNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNAD-KDFYDVSLVDGYNV  14
            G+G+C T   G       G G  PP TLAEF++  G AD KDFYDVSLVDGYN+
Sbjct  90   GSGSCATGDCGSGQVECNGAGATPPATLAEFSL--GGADGKDFYDVSLVDGYNL  141



>ref|XP_002529658.1| Zeamatin precursor, putative [Ricinus communis]
 gb|EEF32745.1| Zeamatin precursor, putative [Ricinus communis]
Length=316

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 70/116 (60%), Gaps = 8/116 (7%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FTL N C YTVWPG L        G        G S   QAP GWSGRFW RTGC FD 
Sbjct  22   TFTLINKCDYTVWPGILGNPKLDSTGFELPK---GSSRSFQAPTGWSGRFWGRTGCTFDT  78

Query  166  SGNGNCVTgdcgglkcgg---gGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G+C T DCG  +         PP TLAEFT+ +G+  +DFYDVSLVDGYN+ +
Sbjct  79   SGHGSCSTADCGSSQLECNGNSAAPPATLAEFTLGSGS--QDFYDVSLVDGYNLPM  132



>dbj|BAB11214.1| thaumatin-like protein [Arabidopsis thaliana]
Length=255

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 78/121 (64%), Gaps = 2/121 (2%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            +V  + +F + N C +T+WPGTL+G+G   L   GF L  G+SV +    GWSGR WART
Sbjct  20   SVSYSSTFVITNNCPFTIWPGTLAGSGTQPLPTTGFRLDVGQSVRIPTALGWSGRIWART  79

Query  184  GCNFDASGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  11
            GCNFDA+G G C+T          G G  PP +L E T+ +G+ DKDFYDVSLVDGYN+ 
Sbjct  80   GCNFDANGAGKCMTGDCGGKLECAGNGAAPPTSLFEITLGHGSDDKDFYDVSLVDGYNLP  139

Query  10   L  8
            +
Sbjct  140  I  140



>emb|CDX88118.1| BnaA06g27090D [Brassica napus]
Length=389

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 83/121 (69%), Gaps = 2/121 (2%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            +V  + +F + N C +T+WPGTLSG+G   L   GF L  G+SV++ +  GWSGR WART
Sbjct  20   SVSYSSTFVITNNCPFTIWPGTLSGSGTQPLPTTGFRLDVGQSVKIPSVLGWSGRIWART  79

Query  184  GCNFDASGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  11
            GCNFDA+G G C+TGDC       G G  PP +L E T+ +G+ DKDFYDVSLVDGYN+ 
Sbjct  80   GCNFDANGAGKCITGDCGGKLECAGNGAAPPTSLFEITLGHGSGDKDFYDVSLVDGYNLP  139

Query  10   L  8
            +
Sbjct  140  I  140



>ref|XP_009349687.1| PREDICTED: thaumatin-like protein 1b [Pyrus x bretschneideri]
Length=355

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 72/116 (62%), Gaps = 5/116 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A +FT  N C YTVWPG L+      L   GF L    +   QAP GWSGRFWARTGC+F
Sbjct  28   ATTFTFVNRCDYTVWPGILANANSPSLDSTGFELPKQTARTFQAPTGWSGRFWARTGCSF  87

Query  172  DASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNV  14
            D SG+G+C T   G       G G  PP TLAEFT+ NG   +DFYDVSLVDGYN+
Sbjct  88   DGSGSGSCTTGDCGSGQVECNGAGASPPATLAEFTLGNGG--QDFYDVSLVDGYNL  141



>ref|XP_009150986.1| PREDICTED: pathogenesis-related protein 5 [Brassica rapa]
Length=402

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 83/121 (69%), Gaps = 2/121 (2%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            +V  + +F + N C +T+WPGTLSG+G   L   GF L  G+SV++ +  GWSGR WART
Sbjct  20   SVSYSSTFVITNNCPFTIWPGTLSGSGTQPLPTTGFRLDVGQSVKIPSVLGWSGRIWART  79

Query  184  GCNFDASGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  11
            GCNFDA+G G C+TGDC       G G  PP +L E T+ +G+ DKDFYDVSLVDGYN+ 
Sbjct  80   GCNFDANGAGKCITGDCGGKLECAGNGAAPPTSLFEITLGHGSGDKDFYDVSLVDGYNLP  139

Query  10   L  8
            +
Sbjct  140  I  140



>gb|KHG27805.1| Thaumatin-like protein 1a [Gossypium arboreum]
Length=310

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 75/121 (62%), Gaps = 5/121 (4%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            AA +FT  N C +TVWPG L+  G   L   GF L  G S   Q P GWSGRFW RTGC 
Sbjct  27   AAATFTFINRCDHTVWPGILANPGRPNLESTGFELKKGSSRSFQGPTGWSGRFWGRTGCK  86

Query  175  FDASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  5
            FD SG+G+C T   G       G G  PP TLAEFT+ +G+  +DFYDVSLV+GYN+ L 
Sbjct  87   FDDSGHGSCATGDCGSGQVECNGAGVTPPATLAEFTLGSGS--QDFYDVSLVNGYNLPLT  144

Query  4    I  2
            +
Sbjct  145  V  145



>ref|XP_002437495.1| hypothetical protein SORBIDRAFT_10g028130 [Sorghum bicolor]
 gb|EER88862.1| hypothetical protein SORBIDRAFT_10g028130 [Sorghum bicolor]
Length=263

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 78/122 (64%), Gaps = 2/122 (2%)
 Frame = -2

Query  361  VWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTG  182
            V +A +  L+N C  TVWPG     G  +L  GG  LSPG S  ++ PAGWSGR W R G
Sbjct  30   VASAATLALYNRCGETVWPGIQPSAGKEILARGGLQLSPGHSTSIRLPAGWSGRVWGRQG  89

Query  181  CNFDASGNGNCVTgdcggl--kcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            C FDASG+G C TGDCGG     G GG PP TLAE T+    + +DFYDVSLVDGYN+ +
Sbjct  90   CAFDASGHGRCATGDCGGAFFCNGAGGAPPATLAEITLGATASAQDFYDVSLVDGYNIPI  149

Query  7    GI  2
             +
Sbjct  150  AM  151



>ref|XP_010439075.1| PREDICTED: thaumatin-like protein 1b isoform X2 [Camelina sativa]
Length=316

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 79/121 (65%), Gaps = 8/121 (7%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            + T+ N C++TVWPG LS  G   +G  GF L+ G S   QAPA WSGRFWARTGCNFD+
Sbjct  29   TITIVNRCSFTVWPGILSNAGSGDIGTTGFELASGGSRSFQAPASWSGRFWARTGCNFDS  88

Query  166  -SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNAD----KDFYDVSLVDGYNVD  11
             +G G C+T   G       G G  PP TLAEFTI +G AD    +DFYDVSLVDGYNV 
Sbjct  89   DTGQGTCLTGDCGSNQVECNGAGAKPPATLAEFTIGSGPADPARKQDFYDVSLVDGYNVP  148

Query  10   L  8
            +
Sbjct  149  M  149



>ref|XP_010439074.1| PREDICTED: thaumatin-like protein 1b isoform X1 [Camelina sativa]
Length=321

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 79/121 (65%), Gaps = 8/121 (7%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            + T+ N C++TVWPG LS  G   +G  GF L+ G S   QAPA WSGRFWARTGCNFD+
Sbjct  34   TITIVNRCSFTVWPGILSNAGSGDIGTTGFELASGGSRSFQAPASWSGRFWARTGCNFDS  93

Query  166  -SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNAD----KDFYDVSLVDGYNVD  11
             +G G C+T   G       G G  PP TLAEFTI +G AD    +DFYDVSLVDGYNV 
Sbjct  94   DTGQGTCLTGDCGSNQVECNGAGAKPPATLAEFTIGSGPADPARKQDFYDVSLVDGYNVP  153

Query  10   L  8
            +
Sbjct  154  M  154



>ref|XP_009109535.1| PREDICTED: thaumatin-like protein 1b [Brassica rapa]
Length=355

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C +TVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC+FD 
Sbjct  30   TFTFANRCGFTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCSFDG  89

Query  166  SGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG+G C TGDCG  +    G+   PPVTLAEFT+  G     FYDVSLVDGYN+ +
Sbjct  90   SGSGTCKTGDCGSNQVECVGLGAAPPVTLAEFTLGTGG--DVFYDVSLVDGYNLPM  143



>ref|XP_010454791.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Camelina 
sativa]
Length=406

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 82/121 (68%), Gaps = 2/121 (2%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            +V  A +F + N C +T+WPGTL+G+G   L   GF L  G+SV + +  GWSGR WART
Sbjct  20   SVSYASTFVITNNCPFTIWPGTLAGSGTQALPTTGFRLDVGQSVRIPSALGWSGRIWART  79

Query  184  GCNFDASGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  11
            GCNFDA+G G C+TGDC       G G  PP +L E T+ +G+ DKDFYD+SLVDGYN+ 
Sbjct  80   GCNFDANGMGKCMTGDCGGKLECAGNGAAPPTSLFEITLGHGSDDKDFYDISLVDGYNLP  139

Query  10   L  8
            +
Sbjct  140  I  140



>ref|XP_004172986.1| PREDICTED: thaumatin-like protein-like, partial [Cucumis sativus]
Length=304

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            ++ +FT  N C YTVWPG L+ +G   L   GF L  G S  LQA  GWSGRFW RT C 
Sbjct  5    SSATFTFVNKCDYTVWPGILASSGSPKLETTGFELKAGNSRSLQASTGWSGRFWGRTNCK  64

Query  175  FDASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            FD SG GNC T   G       G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ +
Sbjct  65   FDDSGRGNCNTGDCGSGEIECNGAGATPPATLAEFTLGSGS--QDFYDVSLVDGYNLPM  121



>ref|XP_006289819.1| hypothetical protein CARUB_v10003424mg [Capsella rubella]
 gb|EOA22717.1| hypothetical protein CARUB_v10003424mg [Capsella rubella]
Length=429

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 82/121 (68%), Gaps = 2/121 (2%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            +V  A +F + N C +T+WPGTL+G+G   L   GF L  G+SV + +  GWSGR WART
Sbjct  46   SVSYASTFVITNNCPFTIWPGTLAGSGTQALPTTGFRLDVGQSVRIPSTLGWSGRIWART  105

Query  184  GCNFDASGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  11
            GCNFDA+G G C+TGDC       G G  PP +L E T+ +G+ DKDFYD+SLVDGYN+ 
Sbjct  106  GCNFDANGMGKCMTGDCGGKLECAGNGAAPPTSLFEITLGHGSDDKDFYDISLVDGYNLP  165

Query  10   L  8
            +
Sbjct  166  I  166



>ref|XP_010421292.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Camelina 
sativa]
Length=406

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 82/121 (68%), Gaps = 2/121 (2%)
 Frame = -2

Query  364  NVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWART  185
            +V  A +F + N C +T+WPGTL+G+G   L   GF L  G+SV + +  GWSGR WART
Sbjct  20   SVSYASTFVITNNCPFTIWPGTLAGSGTQALPTTGFRLDVGQSVRIPSTLGWSGRIWART  79

Query  184  GCNFDASGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  11
            GCNFDA+G G C+TGDC       G G  PP +L E T+ +G+ DKDFYD+SLVDGYN+ 
Sbjct  80   GCNFDANGMGKCMTGDCGGKLECAGNGAAPPTSLFEITLGHGSDDKDFYDISLVDGYNLP  139

Query  10   L  8
            +
Sbjct  140  I  140



>ref|XP_009591540.1| PREDICTED: pathogenesis-related protein 5 [Nicotiana tomentosiformis]
Length=322

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 75/122 (61%), Gaps = 5/122 (4%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +  SF L N C Y VWPG L+  G   L   GF L+PG+S   QAP  WSGR W RTGCN
Sbjct  24   SGASFNLINRCDYNVWPGILANAGSQKLDSTGFMLAPGDSRVFQAPQEWSGRIWGRTGCN  83

Query  175  FDA-SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            FD  +G GNC T   G       G G +PP TLAEFTI +G   +DFYDVSLVDGYN+ +
Sbjct  84   FDGNTGQGNCATGDCGSNQIECNGAGAIPPATLAEFTIFSGTK-QDFYDVSLVDGYNLPM  142

Query  7    GI  2
             +
Sbjct  143  AV  144



>ref|NP_001058421.1| Os06g0691200 [Oryza sativa Japonica Group]
 dbj|BAD45633.1| putative thaumatin-protein [Oryza sativa Japonica Group]
 dbj|BAD54510.1| putative thaumatin-protein [Oryza sativa Japonica Group]
 dbj|BAF20335.1| Os06g0691200 [Oryza sativa Japonica Group]
 dbj|BAG98320.1| unnamed protein product [Oryza sativa Japonica Group]
Length=251

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A +  L+N C  TVWPG     G  LL  GGF L+P  +  ++ PAGWSGR W R GC+
Sbjct  22   SAATLALYNRCAETVWPGIQPSAGKELLARGGFQLAPNRATSIRLPAGWSGRVWGRQGCS  81

Query  175  FDASGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDA+G G C T          G GG PP TLAE T+A+  A +DFYDVSLVDGYN+ + +
Sbjct  82   FDAAGRGRCATGDCGGALYCNGAGGAPPATLAEITLASTPAAQDFYDVSLVDGYNIPIAM  141



>ref|XP_002264550.2| PREDICTED: pathogenesis-related protein 5-like [Vitis vinifera]
Length=235

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 80/119 (67%), Gaps = 5/119 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A  FTL N C  ++WPG   G+G   L +GGF L PGESV++ AP GWSGRFW R  C+F
Sbjct  19   AAVFTLKNGCGESIWPGIQPGSGTPQLMDGGFELRPGESVDITAPEGWSGRFWGRRRCSF  78

Query  172  DASGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            D SG G+CVTGDC       G GG PP TLAEFT+   ++  DFYDVSLVDGYN+ + I
Sbjct  79   DDSGKGSCVTGDCGGVLKCAGAGGAPPATLAEFTL---DSPVDFYDVSLVDGYNMPVSI  134



>gb|KDP36909.1| hypothetical protein JCGZ_08200 [Jatropha curcas]
Length=316

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 78/125 (62%), Gaps = 6/125 (5%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            I+   +  +FTL N C YTVWPG LS  G + L   GF L PG S   Q+P  WSGRFW 
Sbjct  19   ISKGISGATFTLINRCGYTVWPGILSNAGSSPLETTGFQLPPGGSRSFQSPPNWSGRFWG  78

Query  190  RTGCNFD-ASGNGNCVTgdcgglkcg---ggGVPPVTLAEFTIANGNADKDFYDVSLVDG  23
            RTGC FD A+G G+C+T DC   +         PP TLAEFTI +G   +DFYDVSLVDG
Sbjct  79   RTGCTFDPATGQGSCLTADCASNQIECNGRNAKPPATLAEFTIGSGT--QDFYDVSLVDG  136

Query  22   YNVDL  8
            YN+ +
Sbjct  137  YNLPM  141



>ref|XP_008463807.1| PREDICTED: thaumatin-like protein [Cucumis melo]
Length=250

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 80/125 (64%), Gaps = 5/125 (4%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            I+ + +A + TL+N C++ VWPG     G  LL  GGF L P ++  LQ PA WSGRFW 
Sbjct  22   ISVLVSATTITLYNKCSHPVWPGIQPSAGKPLLARGGFKLPPNKAYTLQLPALWSGRFWG  81

Query  190  RTGCNFDASGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYN  17
            R GC FDASG G C TGDC       G GG PP TLAE T+ N   D+DFYDVSLVDGYN
Sbjct  82   RHGCAFDASGRGKCATGDCGGALFCNGIGGTPPATLAEITLGN---DQDFYDVSLVDGYN  138

Query  16   VDLGI  2
            + + I
Sbjct  139  LAISI  143



>gb|EAY89154.1| hypothetical protein OsI_10647 [Oryza sativa Indica Group]
Length=265

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 81/116 (70%), Gaps = 4/116 (3%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N CTYTVWP TLSGN    +G GGF LSPG +V   APAGWSGR WART C    +
Sbjct  32   FTLRNNCTYTVWPATLSGNTAVAVGGGGFELSPGANVSFPAPAGWSGRLWARTDCAPSGT  91

Query  163  GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNAD-KDFYDVSLVDGYNVDLGI  2
             +  CVTG   G + C  GG PPVTLAEFT+  G AD KDFYDVSLVDGYNV +G+
Sbjct  92   ASLACVTGDCGGAVSCSLGGAPPVTLAEFTL--GGADGKDFYDVSLVDGYNVGIGV  145



>ref|XP_004135026.1| PREDICTED: thaumatin-like protein-like, partial [Cucumis sativus]
Length=318

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            ++ +FT  N C YTVWPG L+ +G   L   GF L  G S  LQA  GWSGRFW RT C 
Sbjct  19   SSATFTFVNKCDYTVWPGILASSGSPKLETTGFELKAGNSRSLQASTGWSGRFWGRTNCK  78

Query  175  FDASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            FD SG GNC T   G       G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ +
Sbjct  79   FDDSGRGNCNTGDCGSGEIECNGAGATPPATLAEFTLGSGS--QDFYDVSLVDGYNLPM  135



>ref|XP_004152647.1| PREDICTED: thaumatin-like protein 1a-like, partial [Cucumis sativus]
 ref|XP_004171184.1| PREDICTED: thaumatin-like protein 1a-like, partial [Cucumis sativus]
Length=226

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 69/125 (55%), Gaps = 8/125 (6%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            +  V  AG FT  N C +T+WPG L        G       PG     QAP GWSGRFW 
Sbjct  1    LKGVSGAG-FTFVNRCDFTIWPGILGNPKLESTGFELS---PGAVRSFQAPPGWSGRFWG  56

Query  190  RTGCNFD-ASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDG  23
            RTGC+FD A+G GNC T           G G  PP TLAEFTI  G   +DFYDVSLVDG
Sbjct  57   RTGCSFDPATGQGNCQTADCGSNQIECNGAGATPPATLAEFTIGGGAGGQDFYDVSLVDG  116

Query  22   YNVDL  8
            YN+ +
Sbjct  117  YNIPM  121



>ref|NP_001049473.1| Os03g0233200 [Oryza sativa Japonica Group]
 gb|AAM19131.1|AC103891_11 Putative thaumatin-like protein [Oryza sativa Japonica Group]
 gb|ABF94814.1| Pathogenesis-related protein 5 precursor, putative [Oryza sativa 
Japonica Group]
 dbj|BAF11387.1| Os03g0233200 [Oryza sativa Japonica Group]
 gb|EAZ26174.1| hypothetical protein OsJ_10041 [Oryza sativa Japonica Group]
Length=265

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 79/115 (69%), Gaps = 2/115 (2%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N CTYTVWP TLSGN    +G GGF LSPG +V   APAGWSGR WART C    +
Sbjct  32   FTLRNNCTYTVWPATLSGNTAVAVGGGGFELSPGANVSFPAPAGWSGRLWARTDCAPSGT  91

Query  163  GNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
             +  CVTG   G + C  GG PPVTLAEFT+  G   KDFYDVSLVDGYNV +G+
Sbjct  92   ASLACVTGDCGGAVSCSLGGAPPVTLAEFTL-GGTDGKDFYDVSLVDGYNVGIGV  145



>ref|XP_006413465.1| hypothetical protein EUTSA_v10027206mg [Eutrema salsugineum]
 gb|ESQ54918.1| hypothetical protein EUTSA_v10027206mg [Eutrema salsugineum]
Length=268

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 80/122 (66%), Gaps = 8/122 (7%)
 Frame = -2

Query  349  GSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFD  170
             + T+ N C++TVWPG LS +G A +G  GF L+ G S   QAPA WSGRFWARTGCNFD
Sbjct  36   ATITIVNRCSFTVWPGVLSNSGSASIGTTGFELASGGSRSFQAPASWSGRFWARTGCNFD  95

Query  169  A-SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNAD----KDFYDVSLVDGYNV  14
            + +G G C+T   G       G G  PP TLAEFTI +G  D    +DFYDVSLVDGYNV
Sbjct  96   SETGQGTCLTGDCGSNQVECNGSGAKPPATLAEFTIGSGPEDPTRKQDFYDVSLVDGYNV  155

Query  13   DL  8
             +
Sbjct  156  PM  157



>ref|XP_009340234.1| PREDICTED: thaumatin-like protein 1b [Pyrus x bretschneideri]
Length=354

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 72/118 (61%), Gaps = 5/118 (4%)
 Frame = -2

Query  352  AGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNF  173
            A +FT  N C YTVWPG L+      L   GF L    +   QAP GWSGRFWARTGC+F
Sbjct  28   ATTFTFVNRCDYTVWPGILANANSPTLDSTGFELPQQTARTFQAPTGWSGRFWARTGCSF  87

Query  172  DASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            D SG+G+C T   G       G G  PP TLAEFT+  G   +DFYDVSLVDGYN+ L
Sbjct  88   DGSGSGSCTTGDCGSGQVECNGAGAAPPATLAEFTLGTGG--QDFYDVSLVDGYNLPL  143



>gb|KGN48924.1| hypothetical protein Csa_6G506010 [Cucumis sativus]
Length=326

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            ++ +FT  N C YTVWPG L+ +G   L   GF L  G S  LQA  GWSGRFW RT C 
Sbjct  27   SSATFTFVNKCDYTVWPGILASSGSPKLETTGFELKAGNSRSLQASTGWSGRFWGRTNCK  86

Query  175  FDASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            FD SG GNC T   G       G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ +
Sbjct  87   FDDSGRGNCNTGDCGSGEIECNGAGATPPATLAEFTLGSGS--QDFYDVSLVDGYNLPM  143



>ref|XP_006826851.1| hypothetical protein AMTR_s00010p00113630 [Amborella trichopoda]
 gb|ERM94088.1| hypothetical protein AMTR_s00010p00113630 [Amborella trichopoda]
Length=239

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 74/116 (64%), Gaps = 5/116 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FTLHN C YTVWPG     G ++L  GG  L P +   L+AP+GWSGRFW R  C FD 
Sbjct  24   TFTLHNRCPYTVWPGIQPSAGQSILANGGLRLLPNQIFSLKAPSGWSGRFWGRQDCVFDH  83

Query  166  SGNGNCVTg-dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            SG G+C TG   G    G GG PP TLAE T+     ++DFYDVSLVDGYN+ + I
Sbjct  84   SGKGHCATGDCGGLYCNGLGGAPPATLAEITL----GEQDFYDVSLVDGYNLGISI  135



>dbj|BAK00264.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=259

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 82/117 (70%), Gaps = 5/117 (4%)
 Frame = -2

Query  343  FTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDAS  164
            FTL N CTYT+WP TLSGN    +G GGF L+PG +V   AP GWSGR WARTGC   AS
Sbjct  32   FTLRNNCTYTIWPATLSGNSAVAVGGGGFELAPGANVSFPAPTGWSGRLWARTGCVAAAS  91

Query  163  GNG-NCVTg-dcgglkcgggGVPPVTLAEFTIANGNAD-KDFYDVSLVDGYNVDLGI  2
            G    C TG   G ++C  GG PPVTLAEFT+  G AD KDFYDVSLVDGYNV +G+
Sbjct  92   GASLACATGDCGGAVRCTLGGAPPVTLAEFTL--GGADGKDFYDVSLVDGYNVGIGV  146



>ref|XP_008440826.1| PREDICTED: thaumatin-like protein 1 [Cucumis melo]
Length=325

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +  +FT  N C YTVWPG L+ +G   L   GF L  G S  LQA  GWSGRFW RT CN
Sbjct  27   SGATFTFVNKCDYTVWPGILASSGSPKLETTGFELQAGNSRSLQASTGWSGRFWGRTKCN  86

Query  175  FDASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            FD SG G+C T   G       G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ +
Sbjct  87   FDDSGRGSCNTGDCGSGEIECNGAGATPPATLAEFTLGSGS--QDFYDVSLVDGYNLPM  143



>ref|XP_008377134.1| PREDICTED: thaumatin-like protein 1b [Malus domestica]
Length=329

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 72/119 (61%), Gaps = 5/119 (4%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFD-  170
            +FT+ N C YTVWPG LS  G   L   G  L PG S   Q+P  WSGRFW RTGCNFD 
Sbjct  30   TFTMMNKCDYTVWPGILSNAGTTSLDSTGLELQPGGSRSFQSPPNWSGRFWGRTGCNFDP  89

Query  169  ASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
             +G G C T           G G  PP TLAEFTI  G+ ++DFYDVSLVDGYN+ + +
Sbjct  90   TTGAGTCATADCGSNQXECNGAGATPPATLAEFTIG-GSDNQDFYDVSLVDGYNLPMMV  147



>ref|XP_004137499.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 ref|XP_004163817.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 gb|KGN64169.1| Protein P21 [Cucumis sativus]
Length=250

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 79/125 (63%), Gaps = 5/125 (4%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            I+ + +A + T +N C++ VWPG     G  LL  GGF L P +S  LQ PA WSGRFW 
Sbjct  22   ISVLVSATTITFYNKCSHPVWPGIQPSAGKPLLARGGFKLPPNKSYNLQLPALWSGRFWG  81

Query  190  RTGCNFDASGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYN  17
            R GC FDASG G C TGDC       G GG PP TLAE T+ N   D+DFYDVSLVDGYN
Sbjct  82   RHGCAFDASGRGKCATGDCGGSLFCNGIGGTPPATLAEITLGN---DQDFYDVSLVDGYN  138

Query  16   VDLGI  2
            + + I
Sbjct  139  LAISI  143



>ref|XP_002445738.1| hypothetical protein SORBIDRAFT_07g024920 [Sorghum bicolor]
 gb|EES15233.1| hypothetical protein SORBIDRAFT_07g024920 [Sorghum bicolor]
Length=318

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 76/116 (66%), Gaps = 4/116 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C  TVWPG LSG+G   L   GFALSPG+S  L AP GWSGRFW R+GC FD 
Sbjct  30   TFTFTNRCGDTVWPGLLSGSGTPPLETTGFALSPGQSRSLYAPQGWSGRFWGRSGCAFDG  89

Query  166  SGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG G+C T   G       G G  PP TLAEFT+ +G   KDFYDVSLVDGYN+ +
Sbjct  90   SGKGSCATGDCGSGEVECRGAGASPPATLAEFTL-DGAGGKDFYDVSLVDGYNLPM  144



>ref|XP_009412932.1| PREDICTED: thaumatin-like protein 1b [Musa acuminata subsp. malaccensis]
Length=312

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 76/116 (66%), Gaps = 4/116 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT  N C  T+WPG LSG+G   L   GF L  G S  L AP+GWSGRFWARTGC+FDA
Sbjct  28   AFTFVNRCGDTIWPGVLSGSGSPRLETTGFELPAGSSRTLPAPSGWSGRFWARTGCSFDA  87

Query  166  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            +G G+C T           G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ +
Sbjct  88   AGRGSCATADCGSGQVECNGAGATPPATLAEFTL-DGSDGRDFYDVSLVDGYNLPM  142



>dbj|BAJ92744.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=256

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 78/121 (64%), Gaps = 5/121 (4%)
 Frame = -2

Query  361  VWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTG  182
            V  A +FT  N CT TVWPG LSG+    L   GFALSPG+S  L  P GWSGRFW R+G
Sbjct  26   VAGAITFTFANRCTDTVWPGLLSGSTSPPLETTGFALSPGQSRSLYGPTGWSGRFWGRSG  85

Query  181  CNFDASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  11
            CNF+  G G CVT   G       G G  PP TLAEFT+ +G+  KDFYDVSLVDGYN+ 
Sbjct  86   CNFNG-GKGTCVTGDCGSGEIECRGAGATPPATLAEFTL-DGDGGKDFYDVSLVDGYNLP  143

Query  10   L  8
            +
Sbjct  144  M  144



>emb|CDO98353.1| unnamed protein product [Coffea canephora]
Length=249

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 77/120 (64%), Gaps = 5/120 (4%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A + T +N C++ VWPG     G  +L  GGF L P  S  L+ PAGWSGRFW R GC+
Sbjct  26   SATTMTFYNKCSHPVWPGIQPSAGKPILARGGFKLPPNRSYSLRLPAGWSGRFWGRHGCS  85

Query  175  FDASGNGNCVTgdc--gglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  2
            FDASG G C TGDC       G GG PP TLAE T+ N   ++DFYDVSLVDGYN+ + I
Sbjct  86   FDASGRGRCATGDCGGSLFCNGLGGTPPATLAEITLGN---EQDFYDVSLVDGYNLAISI  142



>ref|XP_002519620.1| Osmotin precursor, putative [Ricinus communis]
 gb|EEF42765.1| Osmotin precursor, putative [Ricinus communis]
Length=320

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = -2

Query  346  SFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCNFDA  167
            +FT+ N C  T+WPGTL+G+G   L   GF L PG+S+++ A  GWSGR WARTGC FD 
Sbjct  47   TFTITNNCPQTIWPGTLAGSGSPQLATTGFQLDPGQSIQIPAVPGWSGRIWARTGCKFDV  106

Query  166  SGNGNCVT--gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            SG G+C T   D      G G  PP +L E T+ +GN DKDFYDVS+VDGYN+ L
Sbjct  107  SGVGSCQTGDCDGKLECNGIGATPPASLFEITLGSGN-DKDFYDVSIVDGYNLPL  160



>ref|XP_010090318.1| hypothetical protein L484_024983 [Morus notabilis]
 gb|EXB39288.1| hypothetical protein L484_024983 [Morus notabilis]
Length=365

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 76/119 (64%), Gaps = 5/119 (4%)
 Frame = -2

Query  355  AAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTGCN  176
            +A +FT  N C YTVWPG L+  G   L   GF L    S    AP GWSGRFWARTGC 
Sbjct  27   SAATFTFVNRCDYTVWPGILANAGSPRLDSTGFELPKDTSRSFLAPTGWSGRFWARTGCT  86

Query  175  FDASGNGNCVTgdcgglkcg---ggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  8
            FD SG+G+C+TGDCG  +      G  PP TLAEFT+  G   +DFYDVSLVDGYN+ +
Sbjct  87   FDESGSGSCLTGDCGSGQMECNGAGAAPPATLAEFTLGTGG--QDFYDVSLVDGYNLPM  143



>ref|XP_009363485.1| PREDICTED: thaumatin-like protein 1 [Pyrus x bretschneideri]
Length=319

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 76/124 (61%), Gaps = 5/124 (4%)
 Frame = -2

Query  370  ITNVWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWA  191
            IT   +A +FT  N C +TVWPG L+ +G   L   GF L  G      AP GWSGRFW 
Sbjct  26   ITRGVSAATFTFTNKCDFTVWPGILASSGSEKLDSTGFELPQGNPPGFPAPTGWSGRFWG  85

Query  190  RTGCNFDASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  20
            RTGC+FD SG G+C T   G       G G  PP TLAEFT+ +G+  +DFYDVSLVDGY
Sbjct  86   RTGCSFDGSGRGSCSTGDCGSGELECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGY  143

Query  19   NVDL  8
            N+ +
Sbjct  144  NLPM  147



>dbj|BAJ86559.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=319

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 78/121 (64%), Gaps = 5/121 (4%)
 Frame = -2

Query  361  VWAAGSFTLHNACTYTVWPGTlsgnggallgeggfalSPGESVELQAPAGWSGRFWARTG  182
            V  A +FT  N CT TVWPG LSG+    L   GFALSPG+S  L  P GWSGRFW R+G
Sbjct  26   VAGAITFTFANRCTDTVWPGLLSGSTSPPLETTGFALSPGQSRSLYGPTGWSGRFWGRSG  85

Query  181  CNFDASGNGNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  11
            CNF+  G G CVT   G       G G  PP TLAEFT+ +G+  KDFYDVSLVDGYN+ 
Sbjct  86   CNFNG-GKGTCVTGDCGSGEIECRGAGATPPATLAEFTL-DGDGGKDFYDVSLVDGYNLP  143

Query  10   L  8
            +
Sbjct  144  M  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 760021576229