BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23596_g1_i1 len=1073 path=[1051:0-237 1289:238-340 1392:341-423
1475:424-466 1518:467-490 1542:491-492 1544:493-767 1819:768-797
1849:798-945 1997:946-953 2005:954-1072]

Length=1073
                                                                      Score     E

emb|CDP07567.1|  unnamed protein product                                332   3e-109   
gb|AEV57470.1|  thaumatin-like protein 1                                327   1e-107   
ref|XP_008220752.1|  PREDICTED: pathogenesis-related protein 5          326   4e-107   
ref|XP_007223736.1|  hypothetical protein PRUPE_ppa010458mg             326   4e-107   
emb|CDP18679.1|  unnamed protein product                                325   6e-107   
ref|XP_009364361.1|  PREDICTED: pathogenesis-related protein 5-like     323   3e-106   
ref|XP_009760388.1|  PREDICTED: pathogenesis-related protein 5-like     323   4e-106   
ref|NP_001268088.1|  SCUTL2 precursor                                   323   5e-106   
emb|CAN70296.1|  hypothetical protein VITISV_007440                     322   8e-106   Vitis vinifera
ref|XP_009595245.1|  PREDICTED: pathogenesis-related protein 5          322   2e-105   
ref|XP_011083734.1|  PREDICTED: pathogenesis-related protein 5-like     319   2e-104   
ref|XP_004293225.1|  PREDICTED: pathogenesis-related protein 5-like     319   2e-104   
ref|XP_009778054.1|  PREDICTED: pathogenesis-related protein 5-like     317   2e-103   
ref|XP_006366466.1|  PREDICTED: pathogenesis-related protein 5-like     316   2e-103   
ref|XP_009365665.1|  PREDICTED: pathogenesis-related protein 5-like     316   3e-103   
ref|XP_008377347.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    315   5e-103   
ref|XP_008357219.1|  PREDICTED: pathogenesis-related protein 5-like     315   7e-103   
ref|XP_010254957.1|  PREDICTED: pathogenesis-related protein 5          315   1e-102   
ref|XP_010246990.1|  PREDICTED: pathogenesis-related protein 5          313   6e-102   
ref|XP_011031355.1|  PREDICTED: pathogenesis-related protein 5          312   1e-101   
ref|XP_004238220.1|  PREDICTED: pathogenesis-related protein 5          312   1e-101   
ref|XP_008364957.1|  PREDICTED: pathogenesis-related protein 5-like     311   2e-101   
ref|XP_006473452.1|  PREDICTED: pathogenesis-related protein 5-like     311   2e-101   
ref|XP_004501042.1|  PREDICTED: pathogenesis-related protein 5-like     311   3e-101   
ref|XP_006434928.1|  hypothetical protein CICLE_v10002288mg             310   5e-101   
gb|KDP38462.1|  hypothetical protein JCGZ_04387                         310   5e-101   
ref|XP_007017454.1|  Thaumatin-like protein 3                           310   6e-101   
ref|XP_010106041.1|  hypothetical protein L484_021218                   310   6e-101   
ref|XP_011074598.1|  PREDICTED: pathogenesis-related protein 5-like     311   6e-101   
ref|XP_006375059.1|  hypothetical protein POPTR_0014s04020g             310   8e-101   
ref|XP_003549422.2|  PREDICTED: pathogenesis-related protein 5-like     310   9e-101   
gb|KGN62571.1|  hypothetical protein Csa_2G361370                       309   2e-100   
ref|XP_004152784.1|  PREDICTED: pathogenesis-related protein 5-like     310   2e-100   
ref|XP_008444682.1|  PREDICTED: pathogenesis-related protein 5-like     309   2e-100   
ref|XP_002510340.1|  Zeamatin precursor, putative                       309   2e-100   Ricinus communis
ref|XP_003545289.2|  PREDICTED: pathogenesis-related protein 5-like     303   3e-98    
ref|XP_006390357.1|  hypothetical protein EUTSA_v10019680mg             303   3e-98    
ref|XP_003545287.2|  PREDICTED: pathogenesis-related protein 5-like     302   1e-97    
emb|CDY68760.1|  BnaAnng28270D                                          302   1e-97    
ref|XP_002887571.1|  hypothetical protein ARALYDRAFT_895371             301   2e-97    
ref|XP_010248229.1|  PREDICTED: pathogenesis-related protein 5-like     301   3e-97    
ref|XP_010539926.1|  PREDICTED: pathogenesis-related protein 5-like     300   4e-97    
gb|KHG17165.1|  hypothetical protein F383_22419                         300   5e-97    
gb|EYU45112.1|  hypothetical protein MIMGU_mgv1a012469mg                300   7e-97    
ref|NP_177641.1|  pathogenesis-related protein 5                        299   8e-97    Arabidopsis thaliana [mouse-ear cress]
emb|CDX73137.1|  BnaC06g35850D                                          300   9e-97    
ref|NP_177640.1|  thaumatin-like protein 3                              299   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887570.1|  hypothetical protein ARALYDRAFT_476641             299   1e-96    
emb|CDY46016.1|  BnaA02g17100D                                          299   2e-96    
ref|XP_009106162.1|  PREDICTED: pathogenesis-related protein 5          298   4e-96    
gb|KEH40091.1|  pathogenesis-related thaumatin family protein           298   4e-96    
ref|XP_007160787.1|  hypothetical protein PHAVU_001G016600g             298   4e-96    
gb|KHG08802.1|  hypothetical protein F383_35963                         297   5e-96    
ref|XP_006390358.1|  hypothetical protein EUTSA_v10019046mg             297   6e-96    
gb|ABL86687.1|  TLP1                                                    297   8e-96    Gossypium barbadense [Egyptian cotton]
ref|XP_003545288.2|  PREDICTED: pathogenesis-related protein 5-like     297   9e-96    
ref|XP_009128072.1|  PREDICTED: pathogenesis-related protein 5-like     297   1e-95    
emb|CDY37263.1|  BnaCnng08170D                                          295   4e-95    
emb|CDY59465.1|  BnaCnng34970D                                          295   6e-95    
gb|AAB71214.1|  thaumatin-like protein                                  295   7e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007160788.1|  hypothetical protein PHAVU_001G016700g             295   8e-95    
ref|XP_010416369.1|  PREDICTED: pathogenesis-related protein 5-like     294   1e-94    
ref|XP_010428505.1|  PREDICTED: pathogenesis-related protein 5 is...    293   2e-94    
gb|KEH36134.1|  pathogenesis-related thaumatin family protein           293   3e-94    
ref|XP_002887572.1|  hypothetical protein ARALYDRAFT_316436             293   3e-94    
ref|XP_010428506.1|  PREDICTED: pathogenesis-related protein 5 is...    293   3e-94    
ref|XP_010428504.1|  PREDICTED: pathogenesis-related protein 5          293   3e-94    
ref|XP_010471602.1|  PREDICTED: pathogenesis-related protein 5-like     292   5e-94    
ref|XP_010416362.1|  PREDICTED: pathogenesis-related protein 5-like     292   5e-94    
ref|XP_009106158.1|  PREDICTED: pathogenesis-related protein 5-like     292   8e-94    
emb|CDX73133.1|  BnaC06g35810D                                          291   1e-93    
ref|NP_177642.2|  pathogenesis-related thaumatin-like protein pro...    291   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010678327.1|  PREDICTED: pathogenesis-related protein 5-like     291   2e-93    
gb|AAG51919.1|AC013258_13  thaumatin-like protein; 23251-22305          291   2e-93    Arabidopsis thaliana [mouse-ear cress]
gb|KFK33653.1|  hypothetical protein AALP_AA5G041900                    291   2e-93    
ref|XP_010471604.1|  PREDICTED: pathogenesis-related protein 5-like     291   2e-93    
ref|XP_006301180.1|  hypothetical protein CARUB_v10021579mg             291   3e-93    
gb|KFK41942.1|  hypothetical protein AALP_AA2G192200                    290   3e-93    
ref|XP_010471608.1|  PREDICTED: pathogenesis-related protein 5-like     290   6e-93    
ref|XP_009117552.1|  PREDICTED: pathogenesis-related protein 5-li...    289   8e-93    
gb|KFK41944.1|  hypothetical protein AALP_AA2G192400                    289   8e-93    
ref|XP_009117553.1|  PREDICTED: pathogenesis-related protein 5-li...    289   1e-92    
ref|XP_010416364.1|  PREDICTED: pathogenesis-related protein 5-like     288   2e-92    
ref|XP_006302689.1|  hypothetical protein CARUB_v10020799mg             289   3e-92    
ref|XP_010428509.1|  PREDICTED: pathogenesis-related protein 5          288   3e-92    
ref|XP_010529666.1|  PREDICTED: pathogenesis-related protein 5-like     287   6e-92    
ref|XP_010530276.1|  PREDICTED: pathogenesis-related protein 5-like     287   8e-92    
dbj|BAD90814.1|  thaumatin-like protein                                 285   2e-91    Cryptomeria japonica
ref|XP_004499121.1|  PREDICTED: pathogenesis-related protein 5-like     283   4e-90    
ref|XP_006390359.1|  hypothetical protein EUTSA_v10019053mg             282   4e-90    
ref|XP_010471607.1|  PREDICTED: pathogenesis-related protein 5          281   8e-90    
gb|KFK44066.1|  hypothetical protein AALP_AA1G211800                    281   1e-89    
emb|CDY41037.1|  BnaC05g14950D                                          280   3e-89    
ref|XP_010416366.1|  PREDICTED: pathogenesis-related protein 5-like     280   4e-89    
ref|XP_006416518.1|  hypothetical protein EUTSA_v10008604mg             280   5e-89    
ref|XP_009149407.1|  PREDICTED: pathogenesis-related protein 5-like     280   5e-89    
ref|XP_009104727.1|  PREDICTED: pathogenesis-related protein 5-like     278   2e-88    
emb|CDX68151.1|  BnaA07g21910D                                          274   5e-87    
gb|KFK41943.1|  hypothetical protein AALP_AA2G192300                    273   9e-87    
ref|XP_010026231.1|  PREDICTED: pathogenesis-related protein 5          271   2e-85    
emb|CDX83773.1|  BnaC08g18720D                                          269   5e-85    
ref|XP_009106161.1|  PREDICTED: pathogenesis-related protein 5-like     268   1e-84    
ref|XP_008790236.1|  PREDICTED: pathogenesis-related protein 5          268   2e-84    
emb|CDX83771.1|  BnaC08g18740D                                          268   2e-84    
ref|XP_009110282.1|  PREDICTED: pathogenesis-related protein 5-like     266   8e-84    
ref|XP_009110283.1|  PREDICTED: pathogenesis-related protein 5-like     266   1e-83    
ref|XP_010936134.1|  PREDICTED: pathogenesis-related protein 5          266   1e-83    
ref|XP_002890328.1|  hypothetical protein ARALYDRAFT_472154             264   5e-83    
ref|NP_173365.2|  pathogenesis-related thaumatin-like protein           262   5e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307402.1|  hypothetical protein CARUB_v10009026mg             266   6e-81    
ref|XP_010416363.1|  PREDICTED: pathogenesis-related protein 5-like     259   6e-81    
gb|AAO64168.1|  putative pathogenesis-related protein 5 precursor       259   8e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006482914.1|  PREDICTED: pathogenesis-related protein 5-like     258   1e-80    
emb|CDX73136.1|  BnaC06g35840D                                          257   3e-80    
gb|ABL86688.1|  TLP2                                                    254   4e-80    Gossypium barbadense [Egyptian cotton]
ref|XP_010459595.1|  PREDICTED: pathogenesis-related protein 5-like     256   6e-80    
gb|ABR17407.1|  unknown                                                 256   1e-79    Picea sitchensis
ref|XP_009389442.1|  PREDICTED: pathogenesis-related protein 5-like     256   1e-79    
dbj|BAA95017.1|  thaumatin-like protein                                 248   1e-77    Cestrum elegans
ref|XP_002264550.2|  PREDICTED: pathogenesis-related protein 5-like     250   1e-77    Vitis vinifera
gb|EYU27084.1|  hypothetical protein MIMGU_mgv1a012534mg                250   1e-77    
ref|XP_010257784.1|  PREDICTED: thaumatin-like protein                  248   1e-76    
ref|XP_010477142.1|  PREDICTED: pathogenesis-related protein 5-like     248   1e-76    
ref|XP_007160531.1|  hypothetical protein PHAVU_002G329400g             248   1e-76    
ref|XP_009149412.1|  PREDICTED: pathogenesis-related protein 5-li...    247   3e-76    
ref|XP_006856120.1|  hypothetical protein AMTR_s00059p00148770          246   5e-76    
ref|XP_009149413.1|  PREDICTED: pathogenesis-related protein 5-li...    246   6e-76    
ref|XP_010266794.1|  PREDICTED: thaumatin-like protein 1b               248   1e-75    
emb|CDY64470.1|  BnaAnng19340D                                          245   2e-75    
ref|XP_008463807.1|  PREDICTED: thaumatin-like protein                  245   2e-75    
gb|EYU24132.1|  hypothetical protein MIMGU_mgv1a012513mg                244   3e-75    
ref|XP_010245598.1|  PREDICTED: thaumatin-like protein 1b               247   3e-75    
ref|XP_004516152.1|  PREDICTED: thaumatin-like protein-like             243   4e-75    
emb|CAN80000.1|  hypothetical protein VITISV_043971                     255   4e-75    Vitis vinifera
ref|XP_004137499.1|  PREDICTED: thaumatin-like protein-like             244   4e-75    
ref|XP_003530957.2|  PREDICTED: thaumatin-like protein-like             243   7e-75    
ref|XP_010539098.1|  PREDICTED: thaumatin-like protein 1b               245   8e-75    
gb|KEH19055.1|  pathogenesis-related thaumatin family protein           243   1e-74    
ref|XP_009785059.1|  PREDICTED: thaumatin-like protein isoform X2       243   1e-74    
ref|XP_009785058.1|  PREDICTED: thaumatin-like protein isoform X1       243   1e-74    
emb|CDX72995.1|  BnaC06g34430D                                          243   2e-74    
gb|KDP26886.1|  hypothetical protein JCGZ_18044                         242   2e-74    
ref|XP_007046679.1|  Pathogenesis-related thaumatin superfamily p...    244   2e-74    
gb|EYU32807.1|  hypothetical protein MIMGU_mgv1a020484mg                240   2e-74    
ref|XP_009596997.1|  PREDICTED: thaumatin-like protein                  242   3e-74    
ref|XP_009612390.1|  PREDICTED: thaumatin-like protein                  241   4e-74    
gb|KHG07208.1|  hypothetical protein F383_34305                         244   4e-74    
ref|XP_011008805.1|  PREDICTED: thaumatin-like protein                  241   4e-74    
ref|XP_004235810.1|  PREDICTED: thaumatin-like protein                  241   6e-74    
gb|AHC69780.1|  thuamatin-like protein                                  241   7e-74    
gb|KDP46766.1|  hypothetical protein JCGZ_06554                         243   8e-74    
ref|XP_006383093.1|  hypothetical protein POPTR_0005s11480g             243   1e-73    
ref|XP_004503284.1|  PREDICTED: thaumatin-like protein-like             240   1e-73    
ref|XP_008461434.1|  PREDICTED: thaumatin-like protein                  239   1e-73    
ref|XP_009415311.1|  PREDICTED: pathogenesis-related protein 5-like     240   2e-73    
ref|XP_009106020.1|  PREDICTED: thaumatin-like protein isoform X2       240   2e-73    
ref|XP_004297839.1|  PREDICTED: thaumatin-like protein 1-like           240   2e-73    
gb|KHG18980.1|  hypothetical protein F383_08602                         239   2e-73    
ref|XP_004135916.1|  PREDICTED: thaumatin-like protein-like             239   2e-73    
ref|XP_002513184.1|  Zeamatin precursor, putative                       239   2e-73    Ricinus communis
ref|XP_007202291.1|  hypothetical protein PRUPE_ppa009119mg             241   2e-73    
ref|XP_003538880.1|  PREDICTED: thaumatin-like protein 1-like           241   2e-73    
ref|XP_006425448.1|  hypothetical protein CICLE_v10026139mg             241   3e-73    
emb|CDO98353.1|  unnamed protein product                                239   3e-73    
ref|NP_001288837.1|  thaumatin-like protein precursor                   239   3e-73    
ref|XP_010436965.1|  PREDICTED: thaumatin-like protein 1                243   3e-73    
ref|XP_002868852.1|  hypothetical protein ARALYDRAFT_912315             242   4e-73    
ref|XP_008440826.1|  PREDICTED: thaumatin-like protein 1                241   4e-73    
gb|ABK25809.1|  unknown                                                 239   4e-73    Picea sitchensis
ref|XP_006366508.1|  PREDICTED: pathogenesis-related protein 5-like     238   4e-73    
ref|XP_006341532.1|  PREDICTED: thaumatin-like protein-like             239   4e-73    
ref|XP_006466958.1|  PREDICTED: pathogenesis-related protein 5-li...    238   5e-73    
emb|CDX96487.1|  BnaA07g30980D                                          238   5e-73    
ref|XP_010097569.1|  hypothetical protein L484_017379                   239   5e-73    
ref|XP_008448548.1|  PREDICTED: thaumatin-like protein 1                241   5e-73    
ref|XP_010446375.1|  PREDICTED: thaumatin-like protein 1                242   5e-73    
gb|KCW56621.1|  hypothetical protein EUGRSUZ_I02339                     241   5e-73    
ref|XP_004292943.1|  PREDICTED: pathogenesis-related protein 5-like     241   5e-73    
ref|XP_009356044.1|  PREDICTED: thaumatin-like protein                  238   5e-73    
ref|XP_011046459.1|  PREDICTED: pathogenesis-related protein 5-li...    241   6e-73    
ref|XP_011046468.1|  PREDICTED: pathogenesis-related protein 5-li...    241   6e-73    
gb|ABK92515.1|  unknown                                                 241   7e-73    Populus trichocarpa [western balsam poplar]
ref|XP_008801393.1|  PREDICTED: pathogenesis-related protein 5-li...    239   7e-73    
ref|XP_004287804.1|  PREDICTED: thaumatin-like protein 1-like           240   8e-73    
ref|XP_010029672.1|  PREDICTED: thaumatin-like protein 1                241   8e-73    
ref|XP_002313721.2|  hypothetical protein POPTR_0009s13510g             241   8e-73    Populus trichocarpa [western balsam poplar]
ref|XP_006451631.1|  hypothetical protein CICLE_v10009291mg             238   8e-73    
ref|XP_002322099.1|  hypothetical protein POPTR_0015s04510g             238   8e-73    Populus trichocarpa [western balsam poplar]
gb|AAM64698.1|  putative thaumatin-like protein                         241   8e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011084258.1|  PREDICTED: thaumatin-like protein                  238   9e-73    
ref|XP_006379282.1|  hypothetical protein POPTR_0009s13510g             241   9e-73    
ref|XP_008444818.1|  PREDICTED: thaumatin-like protein 1b               238   9e-73    
ref|XP_011087313.1|  PREDICTED: pathogenesis-related protein 5-like     238   9e-73    
ref|XP_002529658.1|  Zeamatin precursor, putative                       240   1e-72    Ricinus communis
ref|XP_008337996.1|  PREDICTED: thaumatin-like protein 1                238   1e-72    
ref|NP_568046.1|  pathogenesis-related thaumatin-like protein           241   1e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011016697.1|  PREDICTED: thaumatin-like protein 1b               240   1e-72    
ref|XP_006466957.1|  PREDICTED: pathogenesis-related protein 5-li...    239   1e-72    
gb|KFK41805.1|  hypothetical protein AALP_AA2G174200                    238   1e-72    
ref|XP_006573555.1|  PREDICTED: thaumatin-like protein 1-like           239   1e-72    
ref|XP_009379396.1|  PREDICTED: thaumatin-like protein 1                239   1e-72    
ref|XP_008393422.1|  PREDICTED: thaumatin-like protein                  238   1e-72    
ref|NP_001031809.1|  pathogenesis-related thaumatin-like protein        240   1e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933320.1|  PREDICTED: thaumatin-like protein 1b               239   2e-72    
ref|XP_008801392.1|  PREDICTED: pathogenesis-related protein 5-li...    239   2e-72    
ref|XP_002277548.1|  PREDICTED: thaumatin-like protein 1b               240   2e-72    Vitis vinifera
ref|XP_007041885.1|  Pathogenesis-related thaumatin superfamily p...    241   2e-72    
ref|XP_007041883.1|  Pathogenesis-related thaumatin superfamily p...    241   2e-72    
ref|XP_004159719.1|  PREDICTED: thaumatin-like protein 1-like           239   2e-72    
ref|NP_177503.1|  pathogenesis-related thaumatin-like protein           237   2e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010679923.1|  PREDICTED: thaumatin-like protein 1b               239   3e-72    
gb|AIU34434.1|  thaumatin-like protein 5                                236   3e-72    
gb|AAM62907.1|  thaumatin-like protein                                  236   3e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007041884.1|  Pathogenesis-related thaumatin superfamily p...    238   3e-72    
ref|XP_004172986.1|  PREDICTED: thaumatin-like protein-like             238   3e-72    
ref|XP_003634206.1|  PREDICTED: thaumatin-like protein                  236   3e-72    
ref|XP_003525190.1|  PREDICTED: thaumatin-like protein-like             236   3e-72    
gb|KDP23919.1|  hypothetical protein JCGZ_27079                         236   3e-72    
ref|XP_010664831.1|  PREDICTED: thaumatin-like protein 1b               239   3e-72    
emb|CDY72463.1|  BnaAnng41250D                                          236   4e-72    
gb|KHG05671.1|  Thaumatin-like protein 1                                238   4e-72    
ref|XP_006283927.1|  hypothetical protein CARUB_v10005048mg             240   4e-72    
gb|KGN55655.1|  hypothetical protein Csa_3G002750                       238   5e-72    
gb|KEH30510.1|  pathogenesis-related thaumatin family protein           239   5e-72    
emb|CAN59843.1|  hypothetical protein VITISV_030359                     236   5e-72    Vitis vinifera
ref|XP_008240157.1|  PREDICTED: thaumatin-like protein                  236   5e-72    
ref|XP_010929479.1|  PREDICTED: pathogenesis-related protein 5-like     238   5e-72    
ref|XP_008352435.1|  PREDICTED: thaumatin-like protein 1                238   5e-72    
ref|XP_003631101.1|  Thaumatin-like protein                             236   5e-72    
gb|KGN48924.1|  hypothetical protein Csa_6G506010                       238   6e-72    
ref|XP_004152647.1|  PREDICTED: thaumatin-like protein 1a-like          235   6e-72    
emb|CDP07385.1|  unnamed protein product                                238   6e-72    
ref|XP_010692057.1|  PREDICTED: thaumatin-like protein 1b               236   6e-72    
ref|XP_002534154.1|  Zeamatin precursor, putative                       239   6e-72    Ricinus communis
ref|XP_002532822.1|  Protein P21, putative                              236   6e-72    Ricinus communis
ref|XP_004135026.1|  PREDICTED: thaumatin-like protein-like             238   6e-72    
gb|AFK48181.1|  unknown                                                 236   7e-72    
emb|CAN79402.1|  hypothetical protein VITISV_028072                     237   7e-72    Vitis vinifera
ref|XP_002887494.1|  hypothetical protein ARALYDRAFT_476498             235   7e-72    
gb|KHG02944.1|  hypothetical protein F383_23941                         239   8e-72    
emb|CDY12096.1|  BnaC03g60120D                                          239   8e-72    
ref|XP_010431808.1|  PREDICTED: thaumatin-like protein 1                238   1e-71    
ref|XP_010519216.1|  PREDICTED: thaumatin-like protein                  235   1e-71    
ref|XP_006390535.1|  hypothetical protein EUTSA_v10019050mg             235   1e-71    
ref|XP_010935078.1|  PREDICTED: thaumatin-like protein 1b               239   1e-71    
ref|XP_010928530.1|  PREDICTED: pathogenesis-related protein 5-like     234   1e-71    
gb|KDP29626.1|  hypothetical protein JCGZ_18788                         238   1e-71    
ref|XP_007041882.1|  Pathogenesis-related thaumatin superfamily p...    240   1e-71    
ref|XP_007209509.1|  hypothetical protein PRUPE_ppa010418mg             235   1e-71    
ref|XP_010531542.1|  PREDICTED: thaumatin-like protein 1b               238   1e-71    
ref|XP_002317878.2|  hypothetical protein POPTR_0012s04520g             237   2e-71    Populus trichocarpa [western balsam poplar]
gb|KDP36909.1|  hypothetical protein JCGZ_08200                         237   2e-71    
ref|XP_006384568.1|  hypothetical protein POPTR_0004s17890g             238   2e-71    
ref|XP_008781003.1|  PREDICTED: thaumatin-like protein 1b               237   2e-71    
ref|XP_009591540.1|  PREDICTED: pathogenesis-related protein 5          237   2e-71    
ref|XP_006302686.1|  hypothetical protein CARUB_v10020795mg             235   3e-71    
ref|XP_010471424.1|  PREDICTED: thaumatin-like protein                  234   3e-71    
ref|XP_008364687.1|  PREDICTED: LOW QUALITY PROTEIN: thaumatin-li...    233   3e-71    
emb|CDO96933.1|  unnamed protein product                                237   4e-71    
ref|XP_010271556.1|  PREDICTED: thaumatin-like protein 1                236   4e-71    
ref|XP_011039126.1|  PREDICTED: thaumatin-like protein                  235   4e-71    
emb|CDY64471.1|  BnaAnng19350D                                          237   4e-71    
ref|XP_008788616.1|  PREDICTED: thaumatin-like protein 1b               236   4e-71    
ref|XP_010416173.1|  PREDICTED: thaumatin-like protein                  234   4e-71    
emb|CDP07386.1|  unnamed protein product                                236   4e-71    
ref|XP_008394054.1|  PREDICTED: thaumatin-like protein 1                235   4e-71    
ref|XP_007157908.1|  hypothetical protein PHAVU_002G107900g             237   4e-71    
ref|XP_009767579.1|  PREDICTED: pathogenesis-related protein 5-like     236   4e-71    
gb|KHG03900.1|  hypothetical protein F383_27474                         233   4e-71    
gb|KGN62685.1|  hypothetical protein Csa_2G368860                       236   5e-71    
gb|ABK94543.1|  unknown                                                 236   5e-71    Populus trichocarpa [western balsam poplar]
ref|NP_001169696.1|  putative thaumatin domain family protein pre...    234   5e-71    Zea mays [maize]
ref|XP_008374844.1|  PREDICTED: thaumatin-like protein                  233   6e-71    
ref|XP_006342237.1|  PREDICTED: pathogenesis-related protein 5-like     234   6e-71    
gb|KEH26933.1|  pathogenesis-related thaumatin family protein           233   7e-71    
ref|XP_010066268.1|  PREDICTED: thaumatin-like protein 1b               236   7e-71    
ref|XP_009334939.1|  PREDICTED: thaumatin-like protein 1b               236   7e-71    
dbj|BAK00264.1|  predicted protein                                      233   8e-71    
ref|XP_008466475.1|  PREDICTED: thaumatin-like protein 1                235   8e-71    
ref|XP_008375859.1|  PREDICTED: thaumatin-like protein 1b               233   8e-71    
ref|XP_004238367.1|  PREDICTED: pathogenesis-related protein 5          235   8e-71    
ref|XP_009373566.1|  PREDICTED: thaumatin-like protein 1b               233   9e-71    
ref|XP_011001989.1|  PREDICTED: thaumatin-like protein 1b isoform X2    236   9e-71    
ref|XP_011001987.1|  PREDICTED: thaumatin-like protein 1b isoform X1    236   9e-71    
ref|XP_004146144.1|  PREDICTED: thaumatin-like protein 1-like           235   1e-70    
ref|XP_006851913.1|  hypothetical protein AMTR_s00041p00163280          235   1e-70    
emb|CDY24827.1|  BnaA08g14830D                                          234   1e-70    
ref|XP_008377134.1|  PREDICTED: thaumatin-like protein 1b               235   1e-70    
ref|XP_009607714.1|  PREDICTED: pathogenesis-related protein 5-like     235   1e-70    
ref|XP_010113338.1|  hypothetical protein L484_026669                   236   2e-70    
ref|XP_001769333.1|  predicted protein                                  232   2e-70    
gb|EYU38795.1|  hypothetical protein MIMGU_mgv1a010603mg                234   2e-70    
ref|XP_002306940.2|  hypothetical protein POPTR_0005s26250g             235   2e-70    
ref|XP_009363485.1|  PREDICTED: thaumatin-like protein 1                234   2e-70    
emb|CDX69192.1|  BnaC01g02610D                                          233   2e-70    
ref|XP_009148123.1|  PREDICTED: thaumatin-like protein 1b isoform X1    233   2e-70    
ref|XP_009349687.1|  PREDICTED: thaumatin-like protein 1b               235   3e-70    
ref|XP_010274714.1|  PREDICTED: thaumatin-like protein                  231   3e-70    
ref|XP_010499973.1|  PREDICTED: basic endochitinase CHB4-like           239   3e-70    
ref|XP_008387927.1|  PREDICTED: thaumatin-like protein 1b               234   3e-70    
ref|XP_011045068.1|  PREDICTED: thaumatin-like protein 1b               234   3e-70    
ref|XP_009358005.1|  PREDICTED: thaumatin-like protein 1b               231   3e-70    
ref|XP_010555234.1|  PREDICTED: thaumatin-like protein 1b               234   3e-70    
ref|XP_007215862.1|  hypothetical protein PRUPE_ppa010471mg             231   3e-70    
emb|CDP01890.1|  unnamed protein product                                234   3e-70    
ref|XP_009109535.1|  PREDICTED: thaumatin-like protein 1b               235   3e-70    
ref|XP_010033495.1|  PREDICTED: thaumatin-like protein 1b               233   4e-70    
ref|XP_008808638.1|  PREDICTED: thaumatin-like protein 1b               232   4e-70    
ref|XP_007201407.1|  hypothetical protein PRUPE_ppa008035mg             234   4e-70    
gb|KHG27805.1|  Thaumatin-like protein 1a                               233   4e-70    
gb|KDO83347.1|  hypothetical protein CISIN_1g029619mg                   229   4e-70    
emb|CDX75545.1|  BnaA01g01570D                                          233   4e-70    
ref|XP_010033496.1|  PREDICTED: thaumatin-like protein 1                233   5e-70    
gb|KFK30466.1|  hypothetical protein AALP_AA7G264700                    234   5e-70    
ref|XP_010262463.1|  PREDICTED: thaumatin-like protein isoform X1       231   5e-70    
gb|AAB63607.1|  thaumatin isolog                                        231   5e-70    
ref|XP_009109259.1|  PREDICTED: thaumatin-like protein 1b               233   6e-70    
ref|XP_010262514.1|  PREDICTED: thaumatin-like protein isoform X2       231   6e-70    
ref|XP_006412032.1|  hypothetical protein EUTSA_v10025825mg             233   6e-70    
dbj|BAB11214.1|  thaumatin-like protein                                 231   6e-70    
ref|XP_006369404.1|  hypothetical protein POPTR_0001s22920g             230   6e-70    
ref|XP_009795150.1|  PREDICTED: pathogenesis-related protein 5-li...    231   6e-70    
ref|XP_008380461.1|  PREDICTED: thaumatin-like protein 1b               231   6e-70    
ref|XP_002468235.1|  hypothetical protein SORBIDRAFT_01g042220          231   6e-70    
ref|XP_007215865.1|  hypothetical protein PRUPE_ppa010479mg             231   6e-70    
ref|XP_010033497.1|  PREDICTED: thaumatin-like protein 1b               233   6e-70    
emb|CAB45053.1|  thaumatin-like protein                                 231   6e-70    
ref|XP_002510549.1|  Zeamatin precursor, putative                       233   6e-70    
ref|XP_008229270.1|  PREDICTED: thaumatin-like protein 1                231   7e-70    
gb|ACE80956.1|  putative allergen Pru du 2.01A                          230   7e-70    
ref|XP_008444817.1|  PREDICTED: thaumatin-like protein 1b               233   7e-70    
ref|XP_011083577.1|  PREDICTED: thaumatin-like protein 1b               233   7e-70    
ref|NP_194149.2|  thaumatin-like protein 1                              231   7e-70    
ref|XP_006660362.1|  PREDICTED: thaumatin-like protein 1-like           233   8e-70    
ref|XP_009340234.1|  PREDICTED: thaumatin-like protein 1b               234   8e-70    
ref|XP_006369405.1|  hypothetical protein POPTR_0001s22920g             230   8e-70    
ref|XP_007036794.1|  Pathogenesis-related thaumatin superfamily p...    231   8e-70    
ref|XP_003629301.1|  Thaumatin-like protein                             232   9e-70    
ref|XP_006649687.1|  PREDICTED: pathogenesis-related protein 5-like     231   9e-70    
gb|AEV57471.1|  thaumatin-like protein 2                                230   9e-70    
ref|XP_010941295.1|  PREDICTED: thaumatin-like protein 1b               232   9e-70    
ref|XP_006826851.1|  hypothetical protein AMTR_s00010p00113630          229   1e-69    
ref|XP_006299870.1|  hypothetical protein CARUB_v10016074mg             232   1e-69    
ref|XP_010467584.1|  PREDICTED: thaumatin-like protein 1b               230   1e-69    
ref|XP_007046683.1|  Pathogenesis-related thaumatin superfamily p...    231   1e-69    
ref|XP_002306938.2|  pathogenesis-related thaumatin family protein      232   1e-69    
ref|XP_006850117.1|  hypothetical protein AMTR_s00022p00227010          229   1e-69    
ref|XP_004301252.1|  PREDICTED: thaumatin-like protein-like             230   1e-69    
ref|XP_010413368.1|  PREDICTED: thaumatin-like protein 1b               230   1e-69    
ref|XP_002459540.1|  hypothetical protein SORBIDRAFT_02g006300          231   1e-69    
gb|ACE80959.1|  putative allergen Pru p 2.01B                           229   2e-69    
emb|CDX88118.1|  BnaA06g27090D                                          234   2e-69    
ref|XP_006369403.1|  hypothetical protein POPTR_0001s22910g             229   2e-69    
ref|XP_004974143.1|  PREDICTED: thaumatin-like protein 1-like           232   2e-69    
gb|KDP46765.1|  hypothetical protein JCGZ_06553                         231   2e-69    
ref|XP_010428288.1|  PREDICTED: thaumatin-like protein                  229   2e-69    
ref|XP_007215864.1|  hypothetical protein PRUPE_ppa010473mg             229   2e-69    
gb|KFK28279.1|  hypothetical protein AALP_AA8G495800                    229   2e-69    
ref|XP_004505780.1|  PREDICTED: thaumatin-like protein 1-like           232   2e-69    
gb|EAY89154.1|  hypothetical protein OsI_10647                          230   2e-69    
ref|XP_011045069.1|  PREDICTED: thaumatin-like protein 1b               231   2e-69    
ref|XP_009150986.1|  PREDICTED: pathogenesis-related protein 5          234   2e-69    
ref|XP_008372899.1|  PREDICTED: thaumatin-like protein 1b               233   2e-69    
ref|NP_001049473.1|  Os03g0233200                                       230   2e-69    
ref|XP_003627755.1|  Thaumatin-like protein                             231   2e-69    
ref|XP_010230207.1|  PREDICTED: pathogenesis-related protein 5-like     230   2e-69    
gb|KFK30233.1|  hypothetical protein AALP_AA7G234900                    231   2e-69    
ref|XP_004152646.1|  PREDICTED: thaumatin-like protein 1-like           231   2e-69    
ref|XP_007215871.1|  hypothetical protein PRUPE_ppa010522mg             229   3e-69    
ref|XP_002867678.1|  hypothetical protein ARALYDRAFT_492443             229   3e-69    
ref|XP_010033498.1|  PREDICTED: thaumatin-like protein 1b               232   3e-69    
ref|XP_003628396.1|  Thaumatin-like protein                             229   3e-69    
ref|XP_009389178.1|  PREDICTED: thaumatin-like protein 1                231   3e-69    
gb|KCW66968.1|  hypothetical protein EUGRSUZ_F00728                     228   3e-69    
ref|XP_010489424.1|  PREDICTED: thaumatin-like protein 1b               229   3e-69    
ref|XP_010090318.1|  hypothetical protein L484_024983                   233   4e-69    
ref|XP_007131695.1|  hypothetical protein PHAVU_011G0342001g            228   4e-69    
ref|XP_004232497.1|  PREDICTED: thaumatin-like protein 1                230   4e-69    
ref|XP_003540838.1|  PREDICTED: thaumatin-like protein 1-like           232   4e-69    
gb|AIU34433.1|  thaumatin-like protein 2                                228   4e-69    
ref|XP_010033700.1|  PREDICTED: thaumatin-like protein                  228   4e-69    
ref|XP_009106493.1|  PREDICTED: pathogenesis-related protein 5-like     227   4e-69    
ref|XP_003612190.1|  Thaumatin-like protein                             231   5e-69    
ref|NP_001147654.1|  LOC100281263 precursor                             228   5e-69    
ref|XP_006409236.1|  hypothetical protein EUTSA_v10022970mg             230   6e-69    
ref|XP_006422635.1|  hypothetical protein CICLE_v10028716mg             232   6e-69    
ref|XP_008664601.1|  PREDICTED: thaumatin-like protein 1b               230   6e-69    
emb|CDY62047.1|  BnaC03g76850D                                          230   6e-69    
ref|XP_004136377.1|  PREDICTED: thaumatin-like protein 1-like           230   6e-69    
gb|KDO68004.1|  hypothetical protein CISIN_1g018813mg                   231   6e-69    
emb|CDY03478.1|  BnaC01g16040D                                          228   6e-69    
ref|XP_009386565.1|  PREDICTED: thaumatin-like protein 1b isoform X2    228   7e-69    
ref|XP_006422634.1|  hypothetical protein CICLE_v10028716mg             231   7e-69    
ref|NP_001058421.1|  Os06g0691200                                       228   7e-69    
ref|XP_004143367.1|  PREDICTED: thaumatin-like protein 1a-like          227   7e-69    
ref|XP_004512141.1|  PREDICTED: thaumatin-like protein 1-like           230   7e-69    
gb|EAZ07901.1|  hypothetical protein OsI_30157                          231   7e-69    
ref|XP_006486762.1|  PREDICTED: thaumatin-like protein 1-like           231   8e-69    
ref|XP_008347349.1|  PREDICTED: thaumatin-like protein 1b               230   8e-69    
ref|XP_008221247.1|  PREDICTED: thaumatin-like protein 1                230   9e-69    
gb|KDO68003.1|  hypothetical protein CISIN_1g018813mg                   231   9e-69    
ref|XP_009386564.1|  PREDICTED: thaumatin-like protein 1b isoform X1    229   1e-68    
ref|XP_003539647.1|  PREDICTED: thaumatin-like protein-like             227   1e-68    
ref|XP_010069813.1|  PREDICTED: thaumatin-like protein 1b               230   1e-68    
ref|XP_008221246.1|  PREDICTED: thaumatin-like protein 1b               227   1e-68    
ref|NP_001131821.2|  putative thaumatin domain family protein pre...    227   1e-68    
ref|XP_006340742.1|  PREDICTED: thaumatin-like protein 1-like           229   1e-68    
gb|ACE80958.1|  putative allergen Pru du 2.01B                          227   1e-68    
ref|XP_007160647.1|  hypothetical protein PHAVU_001G005000g             228   1e-68    
ref|XP_007157907.1|  hypothetical protein PHAVU_002G107800g             229   2e-68    
ref|XP_010690395.1|  PREDICTED: thaumatin-like protein 1                230   2e-68    
ref|XP_009622122.1|  PREDICTED: thaumatin-like protein 1                231   2e-68    
gb|KDP32764.1|  hypothetical protein JCGZ_12056                         228   2e-68    
ref|XP_002265852.1|  PREDICTED: thaumatin-like protein 1                226   2e-68    
ref|XP_010691877.1|  PREDICTED: thaumatin-like protein 1b               229   2e-68    
ref|XP_011035009.1|  PREDICTED: thaumatin-like protein                  229   2e-68    
ref|XP_004985133.1|  PREDICTED: pathogenesis-related protein 5-like     228   2e-68    
gb|KHG02193.1|  Thaumatin-like protein 1                                229   2e-68    
ref|XP_007160648.1|  hypothetical protein PHAVU_001G005000g             229   2e-68    
ref|XP_010102631.1|  hypothetical protein L484_010920                   226   2e-68    
ref|XP_002265805.1|  PREDICTED: thaumatin-like protein 1b               229   2e-68    
ref|XP_004291353.1|  PREDICTED: thaumatin-like protein 1-like           229   3e-68    
ref|XP_002445738.1|  hypothetical protein SORBIDRAFT_07g024920          229   3e-68    
ref|XP_009391386.1|  PREDICTED: thaumatin-like protein                  226   3e-68    
ref|XP_004973952.1|  PREDICTED: pathogenesis-related protein 5-like     231   3e-68    
gb|KCW53162.1|  hypothetical protein EUGRSUZ_J02446                     230   3e-68    
ref|XP_004229603.1|  PREDICTED: thaumatin-like protein 1b               226   3e-68    
ref|XP_009794244.1|  PREDICTED: thaumatin-like protein 1b               228   3e-68    
ref|XP_011035010.1|  PREDICTED: thaumatin-like protein 1                229   3e-68    
ref|XP_003537638.1|  PREDICTED: thaumatin-like protein 1-like iso...    228   3e-68    
ref|XP_011088584.1|  PREDICTED: thaumatin-like protein 1b               229   3e-68    
ref|XP_010454791.1|  PREDICTED: pathogenesis-related protein 5-li...    231   3e-68    
dbj|BAE71242.1|  putative thaumatin-like protein                        228   3e-68    
gb|AFK34461.1|  unknown                                                 226   3e-68    
ref|XP_006590727.1|  PREDICTED: thaumatin-like protein 1-like iso...    226   4e-68    
ref|XP_009387427.1|  PREDICTED: thaumatin-like protein 1b               228   4e-68    
ref|NP_197850.2|  pathogenesis-related thaumatin-like protein           231   4e-68    
ref|XP_006284201.1|  hypothetical protein CARUB_v10005355mg             228   4e-68    
ref|XP_010421292.1|  PREDICTED: pathogenesis-related protein 5-li...    231   5e-68    
ref|XP_008650876.1|  PREDICTED: putative thaumatin domain family ...    227   5e-68    
gb|EPS57841.1|  hypothetical protein M569_16976                         228   5e-68    
ref|XP_006289819.1|  hypothetical protein CARUB_v10003424mg             231   5e-68    
ref|XP_002301968.2|  hypothetical protein POPTR_0002s02200g             228   5e-68    
ref|XP_008670298.1|  PREDICTED: thaumatin-like protein 1b               228   5e-68    
gb|KCW53161.1|  hypothetical protein EUGRSUZ_J02445                     227   6e-68    
ref|XP_010920168.1|  PREDICTED: thaumatin-like protein 1b isoform X2    227   6e-68    
ref|XP_010034697.1|  PREDICTED: thaumatin-like protein 1b               227   6e-68    
ref|XP_009588211.1|  PREDICTED: thaumatin-like protein 1b               227   6e-68    
gb|ACE80963.1|  putative allergen Pru p 2.04                            228   7e-68    
ref|XP_002301969.2|  hypothetical protein POPTR_0002s02200g             227   7e-68    
ref|XP_009795149.1|  PREDICTED: pathogenesis-related protein 5-li...    228   7e-68    
ref|XP_003563464.1|  PREDICTED: thaumatin-like protein                  225   7e-68    
ref|XP_002990777.1|  hypothetical protein SELMODRAFT_236128             226   7e-68    
ref|XP_007222615.1|  hypothetical protein PRUPE_ppa008483mg             228   8e-68    
ref|XP_007211860.1|  hypothetical protein PRUPE_ppa010031mg             226   8e-68    
ref|XP_006284161.1|  hypothetical protein CARUB_v10005297mg             227   8e-68    
ref|XP_010272861.1|  PREDICTED: pathogenesis-related protein 5          226   8e-68    
gb|ACE80962.1|  putative allergen Pru du 2.04                           228   8e-68    
emb|CDY34263.1|  BnaA01g13660D                                          225   8e-68    
ref|XP_010536400.1|  PREDICTED: thaumatin-like protein 1b               228   1e-67    
gb|KDP43442.1|  hypothetical protein JCGZ_16729                         224   1e-67    
ref|XP_002301966.2|  hypothetical protein POPTR_0002s02190g             227   1e-67    
ref|XP_010672697.1|  PREDICTED: thaumatin-like protein                  225   1e-67    
ref|XP_009128246.1|  PREDICTED: pathogenesis-related protein 5-like     226   1e-67    
ref|XP_008781004.1|  PREDICTED: thaumatin-like protein 1                227   1e-67    
emb|CDY44520.1|  BnaCnng11310D                                          226   1e-67    
ref|XP_007136098.1|  hypothetical protein PHAVU_009G017700g             227   1e-67    
ref|XP_009137426.1|  PREDICTED: thaumatin-like protein 1b isoform X3    225   1e-67    
sp|P83332.1|TLP1_PRUPE  RecName: Full=Thaumatin-like protein 1; A...    224   1e-67    
ref|XP_009391981.1|  PREDICTED: thaumatin-like protein 1b               227   1e-67    
gb|KFK42166.1|  hypothetical protein AALP_AA2G219700                    226   1e-67    
ref|XP_009630387.1|  PREDICTED: thaumatin-like protein 1b               226   1e-67    
ref|XP_007224286.1|  hypothetical protein PRUPE_ppa019465mg             227   2e-67    
ref|XP_011083579.1|  PREDICTED: thaumatin-like protein 1                226   2e-67    
ref|XP_003523547.1|  PREDICTED: thaumatin-like protein 1-like           227   2e-67    
ref|XP_010920167.1|  PREDICTED: thaumatin-like protein 1b isoform X1    226   2e-67    
gb|KFK42012.1|  hypothetical protein AALP_AA2G201100                    227   2e-67    
emb|CDY20846.1|  BnaC07g06950D                                          224   2e-67    
ref|XP_010433805.1|  PREDICTED: thaumatin-like protein 1b isoform X2    225   2e-67    
emb|CDX80458.1|  BnaC07g29860D                                          229   2e-67    
dbj|BAJ92744.1|  predicted protein                                      224   2e-67    
ref|XP_006394718.1|  hypothetical protein EUTSA_v10004269mg             230   2e-67    
gb|EYU38797.1|  hypothetical protein MIMGU_mgv1a010302mg                226   2e-67    
ref|XP_004952393.1|  PREDICTED: thaumatin-like protein 1a-like          226   2e-67    
ref|XP_007018987.1|  Pathogenesis-related thaumatin superfamily p...    225   2e-67    
emb|CDY38139.1|  BnaA07g02440D                                          224   2e-67    
ref|XP_006369406.1|  hypothetical protein POPTR_0001s22930g             224   2e-67    
ref|XP_008352662.1|  PREDICTED: pathogenesis-related protein 5-like     225   2e-67    
ref|XP_002510548.1|  Zeamatin precursor, putative                       226   2e-67    
gb|KDO84883.1|  hypothetical protein CISIN_1g026056mg                   224   2e-67    
ref|XP_008361553.1|  PREDICTED: pathogenesis-related protein 5-like     226   2e-67    
ref|XP_002991832.1|  hypothetical protein SELMODRAFT_430120             226   2e-67    
ref|XP_001784610.1|  predicted protein                                  223   3e-67    
ref|XP_010439075.1|  PREDICTED: thaumatin-like protein 1b isoform X2    226   3e-67    
ref|XP_010920174.1|  PREDICTED: thaumatin-like protein 1b               226   3e-67    
ref|XP_010439074.1|  PREDICTED: thaumatin-like protein 1b isoform X1    226   3e-67    
ref|XP_006425450.1|  hypothetical protein CICLE_v10026181mg             225   3e-67    
ref|XP_010109991.1|  hypothetical protein L484_021879                   227   3e-67    
ref|XP_009130006.1|  PREDICTED: pathogenesis-related protein 5-like     229   3e-67    
ref|XP_004512140.1|  PREDICTED: thaumatin-like protein 1-like           225   3e-67    



>emb|CDP07567.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   332 bits (850),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 194/226 (86%), Gaps = 1/226 (0%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            +T++ +A  FTL N+C++TVWPGTLSGNG A LG+GGFAL PG +++L APAGWSGRFWA
Sbjct  20   VTSIVSATVFTLQNSCSHTVWPGTLSGNGAAILGDGGFALPPGATIQLSAPAGWSGRFWA  79

Query  683  RTGCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  504
            RTGCNFD SG+G+C TGDCGGLKC GGGVPPV+LAEFTIANG+  KDFYDVSLVDGYNV 
Sbjct  80   RTGCNFDDSGHGSCSTGDCGGLKCTGGGVPPVSLAEFTIANGDNAKDFYDVSLVDGYNVG  139

Query  503  LGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGS-VVACKSACAQFNTPEYCCTGDHN  327
            LGIRPSGG GDC Y+GCVADLN NCPE LQVTDS   VVACKSAC  FNTP+YCCTGDH+
Sbjct  140  LGIRPSGGLGDCNYSGCVADLNQNCPEELQVTDSDKVVVACKSACDAFNTPQYCCTGDHS  199

Query  326  THATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            T  TC PT YSR FK ACP AYSYAYDD SSTFTCAGSDYLITFCP
Sbjct  200  TPETCPPTNYSRKFKEACPAAYSYAYDDASSTFTCAGSDYLITFCP  245



>gb|AEV57470.1| thaumatin-like protein 1 [Prunus persica]
Length=249

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 173/223 (78%), Positives = 186/223 (83%), Gaps = 0/223 (0%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV  A  FTL N CTYTVWPGTLSGNG A LG+GGFAL+P  SV+L AP GWSGRFWART
Sbjct  23   NVVYATVFTLQNRCTYTVWPGTLSGNGAAVLGDGGFALAPDSSVQLTAPRGWSGRFWART  82

Query  677  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            GCNFD SGNG C+TGDCG LKC GGG PPVTLAEFT  +   DKDFYDVSLVDGYNV +G
Sbjct  83   GCNFDDSGNGKCLTGDCGSLKCVGGGAPPVTLAEFTTGSTPGDKDFYDVSLVDGYNVAMG  142

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            +R +GG+GDCQYAGCVADLN NCP  LQVTDSG+VVAC+SACA FN PE+CCTGDH T  
Sbjct  143  LRANGGTGDCQYAGCVADLNGNCPPELQVTDSGNVVACRSACAAFNAPEFCCTGDHATPQ  202

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPTQYS +FK ACP AYSYAYDD SST TCAGSDYLITFCP
Sbjct  203  TCSPTQYSVMFKTACPTAYSYAYDDASSTCTCAGSDYLITFCP  245



>ref|XP_008220752.1| PREDICTED: pathogenesis-related protein 5 [Prunus mume]
Length=249

 Score =   326 bits (836),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 185/223 (83%), Gaps = 0/223 (0%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV  A  FTL N CTYTVWPGTLSGNG A LG+GGFAL+P  SV+L AP GWSGRFWART
Sbjct  23   NVVYATVFTLQNRCTYTVWPGTLSGNGAAVLGDGGFALAPDSSVQLTAPRGWSGRFWART  82

Query  677  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            GCNFD SGNG C+TGDCG LKC GGG PPVTLAEFTI +   DKDFYDVSLVDGYNV +G
Sbjct  83   GCNFDDSGNGKCLTGDCGSLKCVGGGAPPVTLAEFTIGSTPGDKDFYDVSLVDGYNVAMG  142

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            +R +GG+GDCQYAGCVADLN NCP  L+VTDSG VVAC+SACA F  PE+CCTGDH T  
Sbjct  143  LRANGGTGDCQYAGCVADLNGNCPPELRVTDSGKVVACRSACAAFKAPEFCCTGDHATPQ  202

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPTQYS +FK ACP AYSYAYDD SST TCAGSDYLITFCP
Sbjct  203  TCSPTQYSVMFKTACPTAYSYAYDDASSTCTCAGSDYLITFCP  245



>ref|XP_007223736.1| hypothetical protein PRUPE_ppa010458mg [Prunus persica]
 gb|EMJ24935.1| hypothetical protein PRUPE_ppa010458mg [Prunus persica]
Length=249

 Score =   326 bits (835),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 185/223 (83%), Gaps = 0/223 (0%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV  A  FTL N CTYTVWPGTLSGNG A LG+GGFAL+P  SV+L AP GWSGRFWART
Sbjct  23   NVVYATVFTLQNRCTYTVWPGTLSGNGAAVLGDGGFALAPDSSVQLTAPRGWSGRFWART  82

Query  677  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            GCNFD SGNG C+TGDCG LKC GGG PPVTLAEFT  +   DKDFYDVSLVDGYNV +G
Sbjct  83   GCNFDDSGNGKCLTGDCGSLKCVGGGAPPVTLAEFTTGSTPGDKDFYDVSLVDGYNVAMG  142

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            +R +GG+GDCQYAGCVADLN NCP  L+VTDSG VVAC+SACA FN PE+CCTGDH T  
Sbjct  143  LRANGGTGDCQYAGCVADLNGNCPPELRVTDSGKVVACRSACAAFNAPEFCCTGDHATPQ  202

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPTQYS +FK ACP AYSYAYDD SST TCAGSDYLITFCP
Sbjct  203  TCSPTQYSVMFKTACPTAYSYAYDDASSTCTCAGSDYLITFCP  245



>emb|CDP18679.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   325 bits (833),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 193/226 (85%), Gaps = 1/226 (0%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            +T++ +A  FTL N+C++TVWPGTLS NG A LG+GGFALSP  +++L APAGWSGRFWA
Sbjct  14   MTSIVSATVFTLQNSCSHTVWPGTLSSNGAAVLGDGGFALSPTATIQLSAPAGWSGRFWA  73

Query  683  RTGCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  504
             TGCNFD SG+G+C TGDCGGLKC GGGVPPVTLAEFTIANG+  KDFYDVSLVDGYNV+
Sbjct  74   CTGCNFDDSGHGSCSTGDCGGLKCTGGGVPPVTLAEFTIANGDNAKDFYDVSLVDGYNVE  133

Query  503  LGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGS-VVACKSACAQFNTPEYCCTGDHN  327
            LGIRPSGG GDC Y+GCVADLN NCPE LQVTDS   VVACKSAC  FNTP+YCCTGDH+
Sbjct  134  LGIRPSGGLGDCNYSGCVADLNQNCPEELQVTDSDKVVVACKSACLAFNTPQYCCTGDHS  193

Query  326  THATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            T  TC PT YSR FK ACP AYSYAYDD SSTFTCAGSDY+ITFCP
Sbjct  194  TPETCPPTDYSRKFKEACPAAYSYAYDDASSTFTCAGSDYVITFCP  239



>ref|XP_009364361.1| PREDICTED: pathogenesis-related protein 5-like [Pyrus x bretschneideri]
Length=246

 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 172/225 (76%), Positives = 187/225 (83%), Gaps = 2/225 (1%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            +V  A  FTL N CTYTVWPGTLSGNG A LGEGGFAL+PG SV+L AP GWSGRFWART
Sbjct  18   DVVYATQFTLQNRCTYTVWPGTLSGNGAAILGEGGFALAPGISVQLTAPLGWSGRFWART  77

Query  677  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            GC FD +GNGNCVTGDCG LKC GGG PPVTLAEFTI +   DKDFYDVSLVDGYNV +G
Sbjct  78   GCTFDDAGNGNCVTGDCGSLKCAGGGAPPVTLAEFTIGSNQGDKDFYDVSLVDGYNVGMG  137

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGS--VVACKSACAQFNTPEYCCTGDHNT  324
            +  +GG+GDCQYAGCV DLN +CPE L+V DSGS  VVAC+SACA FNTPE+CCTGDH T
Sbjct  138  LWATGGTGDCQYAGCVTDLNGSCPEELRVMDSGSGVVVACRSACAAFNTPEFCCTGDHAT  197

Query  323  HATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              TCSPTQYS +FK ACP AYSYAYDD SST TC+GSDYLITFCP
Sbjct  198  PQTCSPTQYSEMFKTACPTAYSYAYDDASSTCTCSGSDYLITFCP  242



>ref|XP_009760388.1| PREDICTED: pathogenesis-related protein 5-like [Nicotiana sylvestris]
Length=248

 Score =   323 bits (829),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/222 (76%), Positives = 188/222 (85%), Gaps = 2/222 (1%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N C YTVWPGTLSGNG +  G+ GFAL+PG +++L AP GWSGRFWARTGC+
Sbjct  24   SATQFTLQNNCGYTVWPGTLSGNGVSISGDAGFALTPGATIQLSAPGGWSGRFWARTGCS  83

Query  668  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIAN--GNADKDFYDVSLVDGYNVDLGI  495
            FD SGNG C TGDCG LKC GGG PPV+L EFTIAN  GN  KDFYDVSLVDGYNV +G+
Sbjct  84   FDDSGNGKCTTGDCGALKCIGGGEPPVSLVEFTIANANGNDQKDFYDVSLVDGYNVGIGV  143

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
            RP+GGSGDCQYAGCV DLN NCP+ LQV D+G+VVACKSACAQFNT EYCCTGDH T AT
Sbjct  144  RPTGGSGDCQYAGCVNDLNLNCPKELQVMDNGAVVACKSACAQFNTSEYCCTGDHATPAT  203

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            CSPTQYS++FK+ACP AYSYAYDD +ST TC+GSDYLITFCP
Sbjct  204  CSPTQYSKLFKDACPSAYSYAYDDATSTCTCSGSDYLITFCP  245



>ref|NP_001268088.1| SCUTL2 precursor [Vitis vinifera]
 gb|AAF06347.1|AF195654_1 SCUTL2 [Vitis vinifera]
Length=243

 Score =   323 bits (828),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 165/225 (73%), Positives = 186/225 (83%), Gaps = 0/225 (0%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            + +  +A  FTL N C+YT+WPGTLSGNG A LG GGF L PG S++LQAP GWSGRFWA
Sbjct  16   VVSTVSATVFTLENHCSYTIWPGTLSGNGAALLGNGGFVLPPGASIQLQAPFGWSGRFWA  75

Query  683  RTGCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  504
            RTGCNFD++G G C+TGDCG L C GGGVPPV+LAEFTI   +ADKDFYDVSLVDGYNV 
Sbjct  76   RTGCNFDSAGKGTCITGDCGALNCIGGGVPPVSLAEFTIGADSADKDFYDVSLVDGYNVG  135

Query  503  LGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNT  324
            + I  SGG+GDCQ AGCVADLN+NCP  LQ+TDSGSVVACKSACA FNT +YCCTGDH+T
Sbjct  136  MSIESSGGTGDCQRAGCVADLNSNCPAELQITDSGSVVACKSACAAFNTAQYCCTGDHST  195

Query  323  HATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              TCSPTQYS IFK ACP AYSYAYDD +ST TC G++YLITFCP
Sbjct  196  PQTCSPTQYSEIFKKACPTAYSYAYDDPTSTCTCTGANYLITFCP  240



>emb|CAN70296.1| hypothetical protein VITISV_007440 [Vitis vinifera]
Length=243

 Score =   322 bits (826),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 184/220 (84%), Gaps = 0/220 (0%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N C+YT+WPGTLSGNG A LG GGF L PG S++LQAP GWSGRFWARTGCN
Sbjct  21   SATVFTLENHCSYTIWPGTLSGNGAALLGNGGFVLPPGASIQLQAPFGWSGRFWARTGCN  80

Query  668  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            FD++G G C+TGDCG L C GGGVPPV+LAEFTI   +ADKDFYDVSLVDGYNV + I  
Sbjct  81   FDSAGKGTCITGDCGALNCIGGGVPPVSLAEFTIGADSADKDFYDVSLVDGYNVGMSIES  140

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGG+GDCQ AGCVADLN+NCP  LQ+TDSGSVVACKSACA FNT +YCCTGDH+T  TCS
Sbjct  141  SGGTGDCQRAGCVADLNSNCPAELQITDSGSVVACKSACAAFNTAQYCCTGDHSTPQTCS  200

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            PTQYS IFK ACP AYSYAYDD +ST TC G++YLITFCP
Sbjct  201  PTQYSEIFKKACPTAYSYAYDDPTSTCTCTGANYLITFCP  240



>ref|XP_009595245.1| PREDICTED: pathogenesis-related protein 5 [Nicotiana tomentosiformis]
Length=248

 Score =   322 bits (824),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/222 (75%), Positives = 188/222 (85%), Gaps = 2/222 (1%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N C YTVWPGTLSGNG +  G+ GFAL+PG +++L AP GWSGRFWARTGC+
Sbjct  24   SATQFTLQNNCGYTVWPGTLSGNGVSISGDAGFALTPGATIQLSAPGGWSGRFWARTGCS  83

Query  668  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIAN--GNADKDFYDVSLVDGYNVDLGI  495
            FD SGNG C TGDCG LKC GGG PPV+L EFTIAN  GN  KDFYDVSLVDGYNV +G+
Sbjct  84   FDDSGNGKCKTGDCGALKCIGGGEPPVSLVEFTIANANGNDQKDFYDVSLVDGYNVGIGV  143

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
            RP+GGSGDCQYAGCV DLN NCP+ LQV D+G+VVACKSACAQFNT EYCCTGDH T AT
Sbjct  144  RPTGGSGDCQYAGCVNDLNLNCPKELQVIDTGAVVACKSACAQFNTSEYCCTGDHATPAT  203

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            CSPTQYS++FK+ACP AYSYAYDD +ST TC+G+DYLITFCP
Sbjct  204  CSPTQYSKMFKDACPTAYSYAYDDATSTCTCSGTDYLITFCP  245



>ref|XP_011083734.1| PREDICTED: pathogenesis-related protein 5-like [Sesamum indicum]
Length=246

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 159/229 (69%), Positives = 185/229 (81%), Gaps = 4/229 (2%)
 Frame = -1

Query  866  GITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFW  687
            G+ +   A  FTL N+C+YT+WPGTL+GNGGA LG+GGFAL+PG +++L AP GWSGRFW
Sbjct  17   GMVSSVMATVFTLQNSCSYTIWPGTLTGNGGAILGDGGFALAPGATIQLPAPPGWSGRFW  76

Query  686  ARTGCNFDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
            ARTGCNFD SGNG+C+TG         G GG PPV+L E TI++   DKDFYDVSLVDGY
Sbjct  77   ARTGCNFDDSGNGHCITGDCGGTLKCGGRGGAPPVSLVELTISS-RGDKDFYDVSLVDGY  135

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSG-SVVACKSACAQFNTPEYCCTG  336
            NV +G+RPSGGSGDC+YAGCVAD+N NCP+ LQV D G +VVAC+SACA FN PEYCC+G
Sbjct  136  NVGIGVRPSGGSGDCKYAGCVADVNANCPQELQVVDGGGAVVACRSACAAFNKPEYCCSG  195

Query  335  DHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            DH T  TC PTQYS IFKNACP AYSYAYDD +STFTC G+DYLITFCP
Sbjct  196  DHGTPETCGPTQYSLIFKNACPAAYSYAYDDQTSTFTCTGADYLITFCP  244



>ref|XP_004293225.1| PREDICTED: pathogenesis-related protein 5-like [Fragaria vesca 
subsp. vesca]
Length=251

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 169/227 (74%), Positives = 184/227 (81%), Gaps = 3/227 (1%)
 Frame = -1

Query  860  TNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWAR  681
            TNV  A  FTL N C YTVWPGTLSGNG A LGEGGFA+ PG  ++L APAGWSGRFWAR
Sbjct  21   TNVVYATIFTLQNHCPYTVWPGTLSGNGAAVLGEGGFAMFPGAEIQLTAPAGWSGRFWAR  80

Query  680  TGCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVD  504
            TGCNFD +GNG CVTGDCGG     GGG PPVTLAEFT+ +   DKDFYDVSLVDGYNV 
Sbjct  81   TGCNFDEAGNGKCVTGDCGGALKCTGGGEPPVTLAEFTVGSTLTDKDFYDVSLVDGYNVG  140

Query  503  LGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGS--VVACKSACAQFNTPEYCCTGDH  330
            +G+R +GG GDCQYAGCV+DLNTNCP  L+VTDSGS  VVACKSAC  FN PE+CCTGDH
Sbjct  141  MGLRATGGDGDCQYAGCVSDLNTNCPPELRVTDSGSGVVVACKSACEAFNAPEFCCTGDH  200

Query  329  NTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             T  TCSPTQYS +FK+ACP AYSYAYDD +ST TC GSDYLITFCP
Sbjct  201  ATPQTCSPTQYSAMFKSACPTAYSYAYDDATSTCTCTGSDYLITFCP  247



>ref|XP_009778054.1| PREDICTED: pathogenesis-related protein 5-like [Nicotiana sylvestris]
Length=247

 Score =   317 bits (811),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 182/225 (81%), Gaps = 1/225 (0%)
 Frame = -1

Query  854  VWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTG  675
            V +A  FTL N C YTVWPGTLS  G A  G+GGF+LS G S  L AP+GWSGRFWARTG
Sbjct  22   VISATVFTLQNNCPYTVWPGTLSAKGAAISGDGGFSLSHGASASLPAPSGWSGRFWARTG  81

Query  674  CNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            C FD SGNG C+TGDCG LKC G GVPPV+LAEFTIA  N +KDFYD+SLVDGYNV +GI
Sbjct  82   CTFDNSGNGKCITGDCGALKCTGAGVPPVSLAEFTIAKSNNEKDFYDLSLVDGYNVGVGI  141

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            + SGGSGDCQYA C+AD+N NCP+ LQV D SG VVACKSACAQFN PEYCCTGDH T  
Sbjct  142  QTSGGSGDCQYASCIADVNGNCPKELQVLDNSGKVVACKSACAQFNKPEYCCTGDHATPQ  201

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            TC PT YS++FKNACP AYSYAYD  SSTFTC+GSDYLITFCP S
Sbjct  202  TCQPTHYSQLFKNACPTAYSYAYDHASSTFTCSGSDYLITFCPSS  246



>ref|XP_006366466.1| PREDICTED: pathogenesis-related protein 5-like [Solanum tuberosum]
Length=247

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 184/222 (83%), Gaps = 2/222 (1%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N C YTVWPGTLSGNG    G+ GFAL+PG +++L AP G+SGRFW RTGCN
Sbjct  23   SATQFTLQNNCGYTVWPGTLSGNGVPISGDSGFALTPGATIQLSAPGGFSGRFWGRTGCN  82

Query  668  FDASGNGNCVTgdcgglk--cgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FD++G G C+TGDCG LK   G GGVPPV+L EFTIA    + DFYDVSLVDGYNV +G+
Sbjct  83   FDSTGAGKCITGDCGALKCPSGAGGVPPVSLVEFTIAKTKDEMDFYDVSLVDGYNVGIGV  142

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
            R SGGSGDCQYAGCVADLN NCP+ LQV D+G VVACKSACAQFNTPEYCCTGDH+T AT
Sbjct  143  RSSGGSGDCQYAGCVADLNANCPKELQVIDNGVVVACKSACAQFNTPEYCCTGDHSTPAT  202

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            CSPT YSRIFK+ACP AYSYAYDD SST TCAG+DYLITFCP
Sbjct  203  CSPTDYSRIFKSACPSAYSYAYDDASSTCTCAGADYLITFCP  244



>ref|XP_009365665.1| PREDICTED: pathogenesis-related protein 5-like [Pyrus x bretschneideri]
Length=246

 Score =   316 bits (809),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV  A  FTL N C+YTVWPGTLSGNG A LGEGGFAL+PG SV+  AP GWSGRFWART
Sbjct  18   NVVRATQFTLQNRCSYTVWPGTLSGNGAAILGEGGFALAPGTSVQFTAPPGWSGRFWART  77

Query  677  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            GC FD  GNG CVTGDCG LKC GGG PPVTLAEFTI +   DKDFYD+SLVDGYNV +G
Sbjct  78   GCTFDDLGNGKCVTGDCGSLKCAGGGTPPVTLAEFTIGSNPGDKDFYDISLVDGYNVGMG  137

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNT  324
            +  +GG+GDCQYAGCVADLN  CP  L+V D  SG+VVAC+SACA FNTPE+CCTG+H T
Sbjct  138  LWATGGTGDCQYAGCVADLNGRCPAELRVMDAGSGAVVACRSACAAFNTPEFCCTGEHAT  197

Query  323  HATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              TCSPTQYS +FK ACP AYSYAYDD SST TC+GSDYLITFCP
Sbjct  198  PQTCSPTQYSEMFKTACPTAYSYAYDDASSTCTCSGSDYLITFCP  242



>ref|XP_008377347.1| PREDICTED: LOW QUALITY PROTEIN: pathogenesis-related protein 
5-like [Malus domestica]
Length=246

 Score =   315 bits (808),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV  A   TL N CTYTVWPGTLSGNG A LG+GGFAL+PG SV+L AP GWSGRFW RT
Sbjct  18   NVVYATXVTLQNRCTYTVWPGTLSGNGAAILGDGGFALAPGTSVQLTAPPGWSGRFWGRT  77

Query  677  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            GC FD +GNGNCVTGDCG LKC GGG PPVTLAEFTI +   DKDFYDVSLVDGYNV +G
Sbjct  78   GCTFDDAGNGNCVTGDCGSLKCAGGGAPPVTLAEFTIGSNPGDKDFYDVSLVDGYNVGMG  137

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGS--VVACKSACAQFNTPEYCCTGDHNT  324
            +  +GG+GDCQYAGCV DLN +CP  L+V DSGS  VVAC+SACA FNTPE+CCTG+H T
Sbjct  138  LWATGGTGDCQYAGCVTDLNGSCPAELRVMDSGSGVVVACRSACAAFNTPEFCCTGEHAT  197

Query  323  HATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              TCSPTQYS +FK ACP AYSYAYDD SST TC+GSDYLITFCP
Sbjct  198  PQTCSPTQYSEMFKTACPSAYSYAYDDASSTCTCSGSDYLITFCP  242



>ref|XP_008357219.1| PREDICTED: pathogenesis-related protein 5-like, partial [Malus 
domestica]
Length=248

 Score =   315 bits (807),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 184/225 (82%), Gaps = 2/225 (1%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV  A   TL N CTYTVWPGTLSGNG A LG+GGFAL+PG SV+L AP GWSGRFW RT
Sbjct  20   NVVYATQVTLQNRCTYTVWPGTLSGNGAAILGDGGFALAPGTSVQLTAPPGWSGRFWGRT  79

Query  677  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            GC FD +GNGNCVTGDCG LKC GGG PPVTLAEFTI +   DKDFYDVSLVDGYNV +G
Sbjct  80   GCTFDDAGNGNCVTGDCGSLKCAGGGAPPVTLAEFTIGSNPGDKDFYDVSLVDGYNVGMG  139

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGS--VVACKSACAQFNTPEYCCTGDHNT  324
            +  +GG+GDCQYAGCV DLN +CP  L+V DSGS  VVAC+SACA FNTPE+CCTG+H T
Sbjct  140  LWATGGTGDCQYAGCVTDLNGSCPAELRVMDSGSGVVVACRSACAAFNTPEFCCTGEHAT  199

Query  323  HATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              TCSPTQYS +FK ACP AYSYAYDD SST TC+GSDYLITFCP
Sbjct  200  PQTCSPTQYSEMFKTACPSAYSYAYDDASSTCTCSGSDYLITFCP  244



>ref|XP_010254957.1| PREDICTED: pathogenesis-related protein 5 [Nelumbo nucifera]
Length=244

 Score =   315 bits (806),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/217 (77%), Positives = 182/217 (84%), Gaps = 1/217 (0%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C Y VWPGTLSGNGGA LGEGGF+L+PG SV+L AP GWSGRFWARTGCNF  S
Sbjct  25   FTLQNHCAYMVWPGTLSGNGGAVLGEGGFSLAPGASVQLTAPPGWSGRFWARTGCNFHDS  84

Query  656  GNGNCVTgdcgglkcgggGVPPVTLAEFTIA-NGNADKDFYDVSLVDGYNVDLGIRPSGG  480
            GNG C+TGDCGGLKC GGG PPVTLAEFT   +G  + DFYDVSLVDGYNV +G+R SGG
Sbjct  85   GNGKCITGDCGGLKCAGGGAPPVTLAEFTTGVSGTNNMDFYDVSLVDGYNVGMGVRASGG  144

Query  479  SGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPTQ  300
            +G CQYAGCVADLN +CP+ LQVTDSG+VVACKSACA FNTPE+CCTG H+T  TCSPT 
Sbjct  145  TGACQYAGCVADLNHSCPKELQVTDSGNVVACKSACAAFNTPEFCCTGGHSTPQTCSPTS  204

Query  299  YSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            YS +FK ACP AYSYAYDD SST TC GSDYLITFCP
Sbjct  205  YSEMFKRACPTAYSYAYDDASSTCTCTGSDYLITFCP  241



>ref|XP_010246990.1| PREDICTED: pathogenesis-related protein 5 [Nelumbo nucifera]
Length=248

 Score =   313 bits (801),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 166/219 (76%), Positives = 182/219 (83%), Gaps = 3/219 (1%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C YTVWPG LSGNG A LG+GGF+L PG S++L AP GWSGRFWARTGCNFD S
Sbjct  26   FTLQNFCGYTVWPGVLSGNGAAVLGDGGFSLPPGASLQLTAPPGWSGRFWARTGCNFDES  85

Query  656  GNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNAD--KDFYDVSLVDGYNVDLGIRPSG  483
            GNG C TGDCGGL C GGG PPVTL EFTI   + D  KDFYDVSLVDGYNV +G+RPSG
Sbjct  86   GNGKCATGDCGGLNCAGGGAPPVTLVEFTIGTNDNDNNKDFYDVSLVDGYNVGMGVRPSG  145

Query  482  GSGDCQYAGCVADLNTNCPEVLQVTDSG-SVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
            G+GDCQYAGC+ DLN +CP  LQVTD+G +VVACKSACA FNTPE+CCTGDH+T  TCSP
Sbjct  146  GTGDCQYAGCLTDLNGSCPAELQVTDTGNNVVACKSACAAFNTPEFCCTGDHSTPQTCSP  205

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TQYS +FK+ACP AYSYAYDD SST TC GSDYLITFCP
Sbjct  206  TQYSEMFKSACPTAYSYAYDDASSTCTCTGSDYLITFCP  244



>ref|XP_011031355.1| PREDICTED: pathogenesis-related protein 5 [Populus euphratica]
Length=247

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 178/224 (79%), Gaps = 1/224 (0%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV  A  FTL N C+YT+WPGTLSGNG A LG+GGF L+PG S++LQAP GWSGRFWART
Sbjct  20   NVGNATVFTLQNQCSYTLWPGTLSGNGAATLGDGGFTLAPGASIQLQAPPGWSGRFWART  79

Query  677  GCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  501
            GC FD SG+G CVTGDCGG+    GGG PPV+L EFTI     DKDFYDVSLVDGYNV L
Sbjct  80   GCVFDESGSGKCVTGDCGGILNCIGGGAPPVSLVEFTIGTNRNDKDFYDVSLVDGYNVGL  139

Query  500  GIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTH  321
            G++  GGSGDCQYAGCV DLN NCP  L+V DSGS VACKSACA FN PE+CCT DH T 
Sbjct  140  GVKALGGSGDCQYAGCVTDLNGNCPAELRVVDSGSTVACKSACAAFNAPEFCCTADHATP  199

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             TCSPTQYS +FK ACP AYSYAYDD SST TC GSDYLITFCP
Sbjct  200  QTCSPTQYSVMFKTACPTAYSYAYDDASSTCTCTGSDYLITFCP  243



>ref|XP_004238220.1| PREDICTED: pathogenesis-related protein 5 [Solanum lycopersicum]
Length=247

 Score =   312 bits (799),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 184/222 (83%), Gaps = 2/222 (1%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N C YTVWPGTLSGNG    G+ GFAL+PG +++L AP G+SGRFW RTGCN
Sbjct  23   SATQFTLQNNCGYTVWPGTLSGNGVPISGDSGFALTPGATIQLSAPGGFSGRFWGRTGCN  82

Query  668  FDASGNGNCVTgdcgglk--cgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            F+++G G C+TGDCG LK   G GG PPV+L EFTIA  NA+KDFYDVSLVDGYNV +G+
Sbjct  83   FNSTGAGKCITGDCGALKCPSGAGGAPPVSLVEFTIAKTNAEKDFYDVSLVDGYNVGIGV  142

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
            R SGGSGDCQYAGCVADLN  CP+ LQV D+G+VVACKSACAQFNT EYCCTG H+T AT
Sbjct  143  RSSGGSGDCQYAGCVADLNAICPKELQVMDNGAVVACKSACAQFNTAEYCCTGAHSTPAT  202

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            CSPT YSRIFK+ACP AYSYAYDD SST TCAG+DYLITFCP
Sbjct  203  CSPTNYSRIFKSACPSAYSYAYDDASSTCTCAGADYLITFCP  244



>ref|XP_008364957.1| PREDICTED: pathogenesis-related protein 5-like [Malus domestica]
Length=246

 Score =   311 bits (798),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 180/225 (80%), Gaps = 2/225 (1%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV  A  FTL N C YTVWPGTLSGNG A LGEGGFAL+PG SV   AP GWSGRFWART
Sbjct  18   NVVRATQFTLQNRCGYTVWPGTLSGNGAAILGEGGFALAPGTSVXFTAPPGWSGRFWART  77

Query  677  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            GC FD  G G CVTGDCG LKC GGG PPVTLAEFTI +   DKDFYDVSLVDGYNV +G
Sbjct  78   GCTFDDXGKGKCVTGDCGSLKCXGGGAPPVTLAEFTIGSXPGDKDFYDVSLVDGYNVGMG  137

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNT  324
            +  +GG+GDCQYAGCVADLN  CP  L+V D  SG+VVAC+SACA FNTPE+CCTG+H T
Sbjct  138  LWATGGTGDCQYAGCVADLNGRCPAELRVMDAGSGAVVACRSACAAFNTPEFCCTGEHAT  197

Query  323  HATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              TCSPTQYS +FK ACP AYSYAYDD +ST TC+GSDYLITFCP
Sbjct  198  PQTCSPTQYSEMFKTACPTAYSYAYDDATSTCTCSGSDYLITFCP  242



>ref|XP_006473452.1| PREDICTED: pathogenesis-related protein 5-like [Citrus sinensis]
 gb|KDO84436.1| hypothetical protein CISIN_1g026001mg [Citrus sinensis]
Length=245

 Score =   311 bits (797),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 177/217 (82%), Gaps = 1/217 (0%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C+YTVWPGTL GNG A LG+GGFAL  G SV+   PA WSGR W RTGCNFDAS
Sbjct  28   FTLENHCSYTVWPGTLCGNGVATLGDGGFALPTGASVQFPVPAAWSGRIWGRTGCNFDAS  87

Query  656  GNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSGG  480
            G G C TGDCGG+    GGG PPV+L EFTIAN   +KDFYDVSLVDGYN+ LG++  GG
Sbjct  88   GTGKCTTGDCGGVLKCTGGGAPPVSLVEFTIANNPNEKDFYDVSLVDGYNIGLGVKAVGG  147

Query  479  SGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPTQ  300
             GDCQYAGCVADLN NCP  LQVTDSGSVVACKSACA FNTPE+CCTGDH T  TCSPTQ
Sbjct  148  KGDCQYAGCVADLNGNCPAELQVTDSGSVVACKSACAAFNTPEFCCTGDHATPDTCSPTQ  207

Query  299  YSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            YS++FK+ACP AYSYAYDD SST TC+GSDYLITFCP
Sbjct  208  YSQLFKHACPTAYSYAYDDASSTCTCSGSDYLITFCP  244



>ref|XP_004501042.1| PREDICTED: pathogenesis-related protein 5-like [Cicer arietinum]
Length=250

 Score =   311 bits (797),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 183/225 (81%), Gaps = 2/225 (1%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV     FT+ N C  T+WPGTLSGNG A LG+GGF+L PG SV+L A +GWSGRFW RT
Sbjct  22   NVALGTVFTIENHCNNTIWPGTLSGNGAALLGDGGFSLPPGSSVQLTAASGWSGRFWGRT  81

Query  677  GCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  501
            GCNFD +GNGNC+TGDC G     GGG PPVTLAEFTI +GN DKDFYDVSLVDGYNV +
Sbjct  82   GCNFDGAGNGNCITGDCAGGMNCNGGGTPPVTLAEFTIGSGNEDKDFYDVSLVDGYNVGM  141

Query  500  GIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSG-SVVACKSACAQFNTPEYCCTGDHNT  324
            GIR +GG+GDCQYAGCVADLN NCP  LQVT+ G SVVACKSACA FNT E+CCTG+H++
Sbjct  142  GIRATGGTGDCQYAGCVADLNGNCPAELQVTEEGGSVVACKSACAAFNTAEFCCTGEHSS  201

Query  323  HATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              +CSPT+YS +FK+ACP AYSYAYDD SST TC+GSDY ITFCP
Sbjct  202  PQSCSPTKYSEMFKSACPSAYSYAYDDASSTCTCSGSDYHITFCP  246



>ref|XP_006434928.1| hypothetical protein CICLE_v10002288mg [Citrus clementina]
 gb|ESR48168.1| hypothetical protein CICLE_v10002288mg [Citrus clementina]
Length=245

 Score =   310 bits (795),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 177/217 (82%), Gaps = 1/217 (0%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C+YTVWPGTL GNG A LG+GGFAL  G SV+   PA WSGR W RTGCNFDAS
Sbjct  28   FTLENHCSYTVWPGTLCGNGVATLGDGGFALPTGASVQFPVPATWSGRIWGRTGCNFDAS  87

Query  656  GNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSGG  480
            G G C TGDCGG+    GGG PPV+L EFTIAN   +KDFYDVSLVDGYN+ LG++  GG
Sbjct  88   GTGKCTTGDCGGVLKCTGGGAPPVSLVEFTIANNPNEKDFYDVSLVDGYNIGLGVKAVGG  147

Query  479  SGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPTQ  300
             GDCQYAGCVADLN NCP  LQVTDSGSVVACKSACA FNTPE+CCTGDH T  TCSPTQ
Sbjct  148  KGDCQYAGCVADLNGNCPAELQVTDSGSVVACKSACAAFNTPEFCCTGDHATPDTCSPTQ  207

Query  299  YSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            YS++FK+ACP AYSYAYDD SST TC+GSDYLITFCP
Sbjct  208  YSQLFKHACPTAYSYAYDDASSTCTCSGSDYLITFCP  244



>gb|KDP38462.1| hypothetical protein JCGZ_04387 [Jatropha curcas]
Length=244

 Score =   310 bits (795),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 178/223 (80%), Gaps = 1/223 (0%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            N+  A  FT+ N C+YT+WPGTLSGNG A LG+GGFAL  G S++LQAP  WSGRFWART
Sbjct  18   NLANAAVFTIQNLCSYTIWPGTLSGNGAAILGDGGFALPSGTSIQLQAPPNWSGRFWART  77

Query  677  GCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  501
            GC FD SGNG CVTGDCGGL    GGG PPVTL EFTIA    DKDFYDVSLVDGYNV +
Sbjct  78   GCTFDESGNGKCVTGDCGGLLKCTGGGAPPVTLVEFTIAANANDKDFYDVSLVDGYNVGV  137

Query  500  GIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTH  321
            G+   GG+GDCQYAGCV DLN NCP  L+V DSGS VACKSACA FN PE+CCTGDH T 
Sbjct  138  GVEALGGTGDCQYAGCVVDLNGNCPAELRVMDSGSTVACKSACAAFNAPEFCCTGDHATP  197

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
             TC PTQYS +FKNACP+AYSYAYDD SST TC+GSDYLITFC
Sbjct  198  QTCPPTQYSELFKNACPRAYSYAYDDASSTCTCSGSDYLITFC  240



>ref|XP_007017454.1| Thaumatin-like protein 3 [Theobroma cacao]
 gb|EOY14679.1| Thaumatin-like protein 3 [Theobroma cacao]
Length=247

 Score =   310 bits (795),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 178/217 (82%), Gaps = 2/217 (1%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C++TVWPG+LSGN  A LG+GGFAL PG S + QAP GWSGRFW RTGC FD S
Sbjct  29   FTLQNHCSFTVWPGSLSGNSAA-LGDGGFALPPGSSAKYQAPPGWSGRFWGRTGCTFDNS  87

Query  656  GNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSGG  480
            G+G C+TGDC G+    GGG PPVTL EFTIA  ++DKDFYDVSLVDGYNV LG++  GG
Sbjct  88   GSGKCITGDCDGVLKCTGGGAPPVTLVEFTIAGDSSDKDFYDVSLVDGYNVALGVKAVGG  147

Query  479  SGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPTQ  300
            +GDCQYAGCV DLNTNCP  L+V DSGS+VACKSACA FN PE+CCTGDH T  TCSPTQ
Sbjct  148  TGDCQYAGCVTDLNTNCPTELRVMDSGSIVACKSACAAFNAPEFCCTGDHATPQTCSPTQ  207

Query  299  YSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            YS +FKNACP AYSYAYDD SST TC+GSDYLITFCP
Sbjct  208  YSEMFKNACPTAYSYAYDDASSTRTCSGSDYLITFCP  244



>ref|XP_010106041.1| hypothetical protein L484_021218 [Morus notabilis]
 gb|EXC07311.1| hypothetical protein L484_021218 [Morus notabilis]
Length=251

 Score =   310 bits (795),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 181/225 (80%), Gaps = 2/225 (1%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV  A  FTL N C YTVWPGTLSGNG  +LG+GGF L PGESV+  AP GWSGRFW RT
Sbjct  22   NVGDATVFTLQNRCGYTVWPGTLSGNGAGNLGDGGFVLPPGESVQFTAPPGWSGRFWGRT  81

Query  677  GCNFDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            GC FD SG G C TGDCG LKC GGG PPVTL EFT+ + +++KDFYDVSLVDGYNV +G
Sbjct  82   GCTFDKSGKGKCATGDCGPLKCTGGGAPPVTLVEFTVGSTSSEKDFYDVSLVDGYNVGMG  141

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNT  324
            ++  GG+GDCQYAGCVADLN NCP  L+VT  +SGSVVACKSAC  FN PE+CCTGDH T
Sbjct  142  VKAVGGTGDCQYAGCVADLNGNCPPELRVTGSNSGSVVACKSACEAFNAPEFCCTGDHAT  201

Query  323  HATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              TCSPTQYS +FKNACP AYSYAYDD +ST TC+GSDYLITFCP
Sbjct  202  PQTCSPTQYSAMFKNACPTAYSYAYDDATSTCTCSGSDYLITFCP  246



>ref|XP_011074598.1| PREDICTED: pathogenesis-related protein 5-like [Sesamum indicum]
Length=265

 Score =   311 bits (796),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 193/231 (84%), Gaps = 5/231 (2%)
 Frame = -1

Query  866  GITNVWAAGS-FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRF  690
            G+  + A+G+ FTL N+C+YTVWPGTLSGNG A LG GGFA++PG+++EL AP GWSGRF
Sbjct  33   GVFTINASGTVFTLQNSCSYTVWPGTLSGNGPAILGGGGFAMAPGDTIELPAPPGWSGRF  92

Query  689  WARTGCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNAD--KDFYDVSLVD  519
            WARTGC FD +G GNC TGDCGG+    GGGVPPV+L EFTIA+G A+  KDFYDVSLVD
Sbjct  93   WARTGCLFDDAGTGNCTTGDCGGILKCTGGGVPPVSLVEFTIASGGANLGKDFYDVSLVD  152

Query  518  GYNVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSG-SVVACKSACAQFNTPEYCC  342
            GYNV L +R SGGSGDCQ AGCVAD+N NCP+ LQV D G +VVACKSACA FNTPE+CC
Sbjct  153  GYNVGLSVRASGGSGDCQSAGCVADVNANCPKELQVVDDGGNVVACKSACAAFNTPEFCC  212

Query  341  TGDHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TG+H+T ATCSPT YS++FKNACP AYSYAYDD SST TCAG+DY ITFCP
Sbjct  213  TGEHSTSATCSPTPYSQMFKNACPAAYSYAYDDLSSTCTCAGADYFITFCP  263



>ref|XP_006375059.1| hypothetical protein POPTR_0014s04020g [Populus trichocarpa]
 gb|ERP52856.1| hypothetical protein POPTR_0014s04020g [Populus trichocarpa]
Length=247

 Score =   310 bits (794),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 177/224 (79%), Gaps = 1/224 (0%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV  A  FTL N C+YT+WPGTLSGNG A LG+GGF L+PG S++ QAP GWSGRFWART
Sbjct  20   NVGNATVFTLQNQCSYTLWPGTLSGNGAATLGDGGFTLAPGASIQFQAPPGWSGRFWART  79

Query  677  GCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  501
            GC FD SG+G CVTGDCGG     GGG PPV+L EFTI     DKDFYDVSLVDGYNV L
Sbjct  80   GCVFDESGSGKCVTGDCGGTLNCIGGGAPPVSLVEFTIGTNPNDKDFYDVSLVDGYNVGL  139

Query  500  GIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTH  321
            G++  GG GDCQYAGCV+DLN NCP  L+V DSGS VACKSACA FN PE+CCT DH T 
Sbjct  140  GVKALGGYGDCQYAGCVSDLNGNCPAELRVVDSGSTVACKSACAAFNAPEFCCTADHATP  199

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             TCSPTQYS +FKNACP AYSYAYDD SST TC GSDYLITFCP
Sbjct  200  QTCSPTQYSVMFKNACPTAYSYAYDDASSTCTCTGSDYLITFCP  243



>ref|XP_003549422.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=248

 Score =   310 bits (793),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 184/225 (82%), Gaps = 3/225 (1%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV  A  FTL N C+YTVWPGTLSGNG A LGEGGFAL+PG +V+L APAGWSGRFWART
Sbjct  22   NVAYATVFTLENHCSYTVWPGTLSGNGAALLGEGGFALAPGSAVQLTAPAGWSGRFWART  81

Query  677  GCNFDASGNGNCVTgd-cgglkcgggGVPPVTLAEFTIANG-NADKDFYDVSLVDGYNVD  504
            GC+FDASG+G CVTGD   GLKC GGGVPP TLAEFT+ +  N +KDFYDVSLVDGYNV 
Sbjct  82   GCSFDASGSGKCVTGDCGSGLKCSGGGVPPATLAEFTLGSASNGNKDFYDVSLVDGYNVG  141

Query  503  LGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTGDHN  327
            +G+R +GG+GDCQYAGCVAD+N  CP  LQV D SG+VVACKSAC   NT EYCCTGDHN
Sbjct  142  MGVRATGGTGDCQYAGCVADVNGVCPAELQVRDGSGAVVACKSACLALNTAEYCCTGDHN  201

Query  326  THATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            T  TC PT YS IFKNACP AYSYAYDD SST TC+GSDY ITFC
Sbjct  202  TPQTCPPTHYSEIFKNACPTAYSYAYDDASSTCTCSGSDYRITFC  246



>gb|KGN62571.1| hypothetical protein Csa_2G361370 [Cucumis sativus]
Length=243

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 184/224 (82%), Gaps = 1/224 (0%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            N+  A  FTL N C+YT+WPGTLSGNG A LG+GGF L+PG SV+L AP GWSGRFWART
Sbjct  18   NLAFATVFTLQNHCSYTLWPGTLSGNGAAVLGDGGFPLAPGASVQLPAPPGWSGRFWART  77

Query  677  GCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  501
            GC+FD SGNG C TGDCGG     GGG+PPVTLAEFTI + + + DFYD+SLVDGYNV +
Sbjct  78   GCDFDGSGNGKCQTGDCGGTLKCNGGGLPPVTLAEFTIGSSSGNMDFYDISLVDGYNVGM  137

Query  500  GIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTH  321
            G+R +GG+GDCQYAGCV+D+N  CP  LQVT+SGSVVACKSACA FNTPE+CCT DH+T 
Sbjct  138  GVRANGGTGDCQYAGCVSDVNGICPSELQVTNSGSVVACKSACAAFNTPEFCCTNDHSTP  197

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             TC PT+YS +FKNACP AYSYAYDD SST TC GSDYLI+FCP
Sbjct  198  QTCPPTKYSEMFKNACPSAYSYAYDDASSTCTCTGSDYLISFCP  241



>ref|XP_004152784.1| PREDICTED: pathogenesis-related protein 5-like [Cucumis sativus]
 ref|XP_004160053.1| PREDICTED: pathogenesis-related protein 5-like [Cucumis sativus]
Length=260

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 184/224 (82%), Gaps = 1/224 (0%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            N+  A  FTL N C+YT+WPGTLSGNG A LG+GGF L+PG SV+L AP GWSGRFWART
Sbjct  35   NLAFATVFTLQNHCSYTLWPGTLSGNGAAVLGDGGFPLAPGASVQLPAPPGWSGRFWART  94

Query  677  GCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  501
            GC+FD SGNG C TGDCGG     GGG+PPVTLAEFTI + + + DFYD+SLVDGYNV +
Sbjct  95   GCDFDGSGNGKCQTGDCGGTLKCNGGGLPPVTLAEFTIGSSSGNMDFYDISLVDGYNVGM  154

Query  500  GIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTH  321
            G+R +GG+GDCQYAGCV+D+N  CP  LQVT+SGSVVACKSACA FNTPE+CCT DH+T 
Sbjct  155  GVRANGGTGDCQYAGCVSDVNGICPSELQVTNSGSVVACKSACAAFNTPEFCCTNDHSTP  214

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             TC PT+YS +FKNACP AYSYAYDD SST TC GSDYLI+FCP
Sbjct  215  QTCPPTKYSEMFKNACPSAYSYAYDDASSTCTCTGSDYLISFCP  258



>ref|XP_008444682.1| PREDICTED: pathogenesis-related protein 5-like [Cucumis melo]
Length=243

 Score =   309 bits (791),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 185/224 (83%), Gaps = 1/224 (0%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            N+  A  FTL N C+YT+WPGTLSGNG A LG+GGF L+PG S++L AP GWSGRFWART
Sbjct  18   NLAFATVFTLQNHCSYTLWPGTLSGNGAAVLGDGGFPLAPGTSMQLTAPPGWSGRFWART  77

Query  677  GCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  501
            GC+FD+SGNG C TGDCGG     GGG+PPVTLAEFTI + + + DFYD+SLVDGYNV +
Sbjct  78   GCDFDSSGNGKCQTGDCGGTLKCTGGGMPPVTLAEFTIGSSSNNMDFYDISLVDGYNVGM  137

Query  500  GIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTH  321
            G+R +GG+GDCQYAGCV+D+N  CP  LQVT+SGSVVACKSACA FNTPE+CCT DH+T 
Sbjct  138  GVRANGGTGDCQYAGCVSDVNGICPSELQVTNSGSVVACKSACAAFNTPEFCCTNDHSTP  197

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             TC PT+YS +FKNACP AYSYAYDD SST TC GSDYLI+FCP
Sbjct  198  QTCPPTKYSEMFKNACPSAYSYAYDDASSTCTCTGSDYLISFCP  241



>ref|XP_002510340.1| Zeamatin precursor, putative [Ricinus communis]
 gb|EEF52527.1| Zeamatin precursor, putative [Ricinus communis]
Length=257

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/226 (73%), Positives = 181/226 (80%), Gaps = 3/226 (1%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            N   A  FTL N C+Y +WPGTLSGNG   LG+GGFAL PG S++LQAP  WSGRFWART
Sbjct  28   NFSNATVFTLQNHCSYMIWPGTLSGNGAGTLGDGGFALPPGSSIQLQAPPTWSGRFWART  87

Query  677  GCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  501
            GC FD  GNG C TGDCGG     GGG PPV+LAEFTIA  + +KDFYDVSLVDGYNV L
Sbjct  88   GCTFDDLGNGKCDTGDCGGALKCTGGGAPPVSLAEFTIAPSSNEKDFYDVSLVDGYNVGL  147

Query  500  GIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDS--GSVVACKSACAQFNTPEYCCTGDHN  327
            G++  GGSGDCQYAGCVADLN NCP  L+VTDS  GSVVACKSACA FN PE+CCTGDH+
Sbjct  148  GVKALGGSGDCQYAGCVADLNGNCPPELRVTDSVSGSVVACKSACAAFNAPEFCCTGDHS  207

Query  326  THATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            T  TCSPTQYS +FKNACP AYSYAYDD SST TC+GSDY+ITFCP
Sbjct  208  TPQTCSPTQYSALFKNACPSAYSYAYDDASSTCTCSGSDYMITFCP  253



>ref|XP_003545289.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=251

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 178/226 (79%), Gaps = 3/226 (1%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV  A  FTL N C+YTVWPGTLSGN  A LG GGFAL+PG +V L APAGWSGRFWART
Sbjct  22   NVANATVFTLENHCSYTVWPGTLSGNSAAILGGGGFALAPGSAVRLIAPAGWSGRFWART  81

Query  677  GCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANG-NADKDFYDVSLVDGYNVD  504
            GC FD SG G C TGDC G     G GVPPVTLAEFTI +  N +KDFYDVSLVDGYNV 
Sbjct  82   GCRFDGSGAGKCTTGDCAGGLRCTGSGVPPVTLAEFTIGSASNGNKDFYDVSLVDGYNVG  141

Query  503  LGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTGDHN  327
            +G+R +GG+GDCQYAGCVAD+N  CP  LQV D +GSVVACKSACA FNT E+CCTGDH+
Sbjct  142  MGVRAAGGTGDCQYAGCVADVNGVCPAELQVRDGAGSVVACKSACAAFNTAEFCCTGDHS  201

Query  326  THATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            T  TCSPT +S IFK ACP AYSYAYDD SST TC+GSDY ITFCP
Sbjct  202  TPQTCSPTHHSEIFKKACPTAYSYAYDDASSTCTCSGSDYRITFCP  247



>ref|XP_006390357.1| hypothetical protein EUTSA_v10019680mg [Eutrema salsugineum]
 gb|ESQ27643.1| hypothetical protein EUTSA_v10019680mg [Eutrema salsugineum]
Length=246

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 185/223 (83%), Gaps = 4/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YTVWPG LSGN    LG+GGF L+PG SV+L AP GWSGRFWARTGC+
Sbjct  22   SATVFTLQNSCPYTVWPGILSGNSNT-LGDGGFPLTPGASVQLTAPPGWSGRFWARTGCS  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FD+SG+GNCVTGDCGG+    GGGVPP TLAEFT+ +G++ KDFYDVSLVDGYNV++GI+
Sbjct  81   FDSSGHGNCVTGDCGGVLKCIGGGVPPTTLAEFTVGSGDSGKDFYDVSLVDGYNVEMGIK  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GGSGDC+YAGCVAD+NT CP  L++ D  +G + ACKSACA FN+PE+CCTG H T  
Sbjct  141  PQGGSGDCKYAGCVADVNTVCPSELRIMDPHTGIIAACKSACAAFNSPEFCCTGAHATPQ  200

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT YS +FKNACP AYSYAYDD +STFTC+GS+YLITFCP
Sbjct  201  TCSPTHYSAMFKNACPSAYSYAYDDATSTFTCSGSNYLITFCP  243



>ref|XP_003545287.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=246

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 181/227 (80%), Gaps = 4/227 (2%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            + NV  A  FTL N C+YTVWPGTLSGNG A +G+GGF ++PG SV+L AP+GWSGR W 
Sbjct  20   LGNVAYATVFTLENHCSYTVWPGTLSGNGAATIGDGGFPMAPGSSVQLTAPSGWSGRLWP  79

Query  683  RTGCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNV  507
            RTGCNFDASGNG C+TG C G     GGGVPP TLAEFTI +G   KDFYDVSLVDGYNV
Sbjct  80   RTGCNFDASGNGKCLTGYCAGGMRCTGGGVPPATLAEFTIGSGG--KDFYDVSLVDGYNV  137

Query  506  DLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSG-SVVACKSACAQFNTPEYCCTGDH  330
             +G+R +GG+GDC+YAGC  DLN  CP  LQV D G +VVACKSACA FNT E+CCTGDH
Sbjct  138  GVGVRATGGTGDCKYAGCSEDLNPACPAELQVKDGGGAVVACKSACAAFNTAEFCCTGDH  197

Query  329  NTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            ++  TCSPT+YS+IFKNACP AYSYAYDD SS  TC+GSDY+ITFCP
Sbjct  198  SSPQTCSPTRYSKIFKNACPAAYSYAYDDPSSICTCSGSDYVITFCP  244



>emb|CDY68760.1| BnaAnng28270D [Brassica napus]
Length=246

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 183/223 (82%), Gaps = 4/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YTVWPG LSGN    LG+GGF L+PG S +L AP GWSGRFWARTGC+
Sbjct  22   SATVFTLQNSCPYTVWPGILSGNSNT-LGDGGFPLTPGASKQLTAPQGWSGRFWARTGCS  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FD+SGNGNCVTGDCGG+    GGGVPP TLAEFT+  G + KDFYDVSLVDGYNV++GI+
Sbjct  81   FDSSGNGNCVTGDCGGVLKCIGGGVPPTTLAEFTVGTGVSGKDFYDVSLVDGYNVEMGIK  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GGSGDC+YAGCVAD+N  CP  L++ D  +G+V ACKSACA FN+PE+CCTG H T  
Sbjct  141  PQGGSGDCKYAGCVADVNAVCPNELRIVDPKTGTVAACKSACAAFNSPEFCCTGAHATPQ  200

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT+YS +FKNACP AYSYAYDD +STFTCAG++YLITFCP
Sbjct  201  TCSPTRYSAMFKNACPSAYSYAYDDATSTFTCAGANYLITFCP  243



>ref|XP_002887571.1| hypothetical protein ARALYDRAFT_895371 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63830.1| hypothetical protein ARALYDRAFT_895371 [Arabidopsis lyrata subsp. 
lyrata]
Length=239

 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 159/220 (72%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FT+ N C  TVW GTL+G G   LG+GGF L+PG S +L APAGWSGRFWARTGCN
Sbjct  22   SATDFTIKNNCPNTVWAGTLAGQG-PKLGDGGFELTPGASRQLTAPAGWSGRFWARTGCN  80

Query  668  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            FDASGNG CVTGDCGGL+C GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV LGIRP
Sbjct  81   FDASGNGRCVTGDCGGLRCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVKLGIRP  139

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGGSGDC+YAGCV+DLN  CP+VL+V D  +VVACKSAC +FNT +YCC G +N   TC 
Sbjct  140  SGGSGDCKYAGCVSDLNAACPDVLKVMDQNNVVACKSACERFNTDQYCCRGANNKPETCP  199

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            PT+YSRIFKNACP AYSYAYDD++STFTC G++Y +TFCP
Sbjct  200  PTEYSRIFKNACPDAYSYAYDDETSTFTCTGANYEVTFCP  239



>ref|XP_010248229.1| PREDICTED: pathogenesis-related protein 5-like [Nelumbo nucifera]
Length=244

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 181/221 (82%), Gaps = 2/221 (1%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FT  N C+YTVWPGTL+ NGG  LG+GGF L+PG + ++ AP GW GRFWARTGCN
Sbjct  25   SATVFTFKNQCSYTVWPGTLANNGGPVLGDGGFLLAPGATSQVTAPPGWEGRFWARTGCN  84

Query  668  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            FD SGNG C TGDCGGLKC G GVPPVTLAEF     N D ++YD+SLVDGYNV++GI+P
Sbjct  85   FDGSGNGRCTTGDCGGLKCRGAGVPPVTLAEFKTGTNN-DMEYYDISLVDGYNVNMGIKP  143

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDS-GSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            +GG+GDC+   CVAD+N +CP VLQ+ DS G+VVACKSAC  FNTPEYCCTG+HNT  TC
Sbjct  144  TGGTGDCKDIQCVADINGSCPAVLQLKDSAGNVVACKSACTAFNTPEYCCTGNHNTPQTC  203

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            SP+QYS++FK ACP AYSYAYDD +STFTCAGSDYLITFCP
Sbjct  204  SPSQYSQMFKRACPMAYSYAYDDPTSTFTCAGSDYLITFCP  244



>ref|XP_010539926.1| PREDICTED: pathogenesis-related protein 5-like [Tarenaya hassleriana]
Length=245

 Score =   300 bits (769),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 179/221 (81%), Gaps = 6/221 (3%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N+C YTVWPG LSGNG   LG+GGF L PG SV+L  P GWSGRFWARTGCNFD S
Sbjct  23   FTLENSCRYTVWPGVLSGNGDT-LGDGGFPLPPGSSVKLTGPPGWSGRFWARTGCNFDPS  81

Query  656  GNGNCVTgdcgglkc-gggGVPPVTLAEFTIANG--NADKDFYDVSLVDGYNVDLGIRPS  486
            G GNC+TGDCGG+    GGG PPVTLAEFT+A    +A KDFYDVSLVDGYNV++GIR  
Sbjct  82   GQGNCLTGDCGGVLKCIGGGAPPVTLAEFTVATAGDSASKDFYDVSLVDGYNVEMGIRAV  141

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            GGSGDCQYAGCV+D+N  CP  L+V +  +G V ACKSACA FNTPE+CCTGDH+T  TC
Sbjct  142  GGSGDCQYAGCVSDVNAICPSELRVMELATGQVAACKSACAAFNTPEFCCTGDHSTPETC  201

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            SPTQYS +FKNACP AYSYAYDD SST TC+GSDYLITFCP
Sbjct  202  SPTQYSAMFKNACPSAYSYAYDDASSTRTCSGSDYLITFCP  242



>gb|KHG17165.1| hypothetical protein F383_22419 [Gossypium arboreum]
Length=247

 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 177/218 (81%), Gaps = 3/218 (1%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FT+ N C++T+WP +LSGNG A LG GGF LS G S + QAP GWSGRFW RTGC FD S
Sbjct  28   FTVQNHCSFTIWPASLSGNG-APLGNGGFELSSGSSAQFQAPPGWSGRFWGRTGCEFDPS  86

Query  656  GNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNAD-KDFYDVSLVDGYNVDLGIRPSG  483
            G+G C+TGDCGG++    GGVPPVTL EFTIA G+ D KDFYDVSLVDGYNV LG++  G
Sbjct  87   GSGKCITGDCGGIQNCTFGGVPPVTLVEFTIAGGSTDNKDFYDVSLVDGYNVALGVKAIG  146

Query  482  GSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPT  303
            GSGDCQYAGCV DLN NCP  L+V DSGSVVACKSAC  FNTPE+CC GDH T  TCSPT
Sbjct  147  GSGDCQYAGCVTDLNANCPVELRVLDSGSVVACKSACTAFNTPEFCCIGDHATPQTCSPT  206

Query  302  QYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            QYS++FK+ACP AYSYAYDD SST TC+GSDY+ITFCP
Sbjct  207  QYSKMFKSACPTAYSYAYDDASSTRTCSGSDYVITFCP  244



>gb|EYU45112.1| hypothetical protein MIMGU_mgv1a012469mg [Erythranthe guttata]
Length=249

 Score =   300 bits (768),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 158/227 (70%), Positives = 178/227 (78%), Gaps = 2/227 (1%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            ++N  +A  FTL N+C YT+WPGT  GNG + LGEGGFALSPG + +  AP GWSGRFWA
Sbjct  21   LSNYVSATVFTLQNSCNYTIWPGTHCGNGASLLGEGGFALSPGATTQFPAPPGWSGRFWA  80

Query  683  RTGCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNV  507
            RTGCNFD++GNGNC TGDCGG     GGG PPV+LAEFTI  G++  DFYDVSLVDGYNV
Sbjct  81   RTGCNFDSAGNGNCTTGDCGGKLNCAGGGEPPVSLAEFTIGGGSSTMDFYDVSLVDGYNV  140

Query  506  DLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSG-SVVACKSACAQFNTPEYCCTGDH  330
             LG+RPSGGSG CQYAGCVAD+   CP+ LQV  +G  VVAC+SACA FNTPEYCC+ DH
Sbjct  141  GLGVRPSGGSGACQYAGCVADVIPECPKELQVVGAGGKVVACRSACAAFNTPEYCCSEDH  200

Query  329  NTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             T  TC PT YS +FK ACP AYSYAYDD SST TC GSDYLITFCP
Sbjct  201  ATPQTCGPTPYSEVFKKACPSAYSYAYDDLSSTCTCTGSDYLITFCP  247



>ref|NP_177641.1| pathogenesis-related protein 5 [Arabidopsis thaliana]
 sp|P28493.1|PR5_ARATH RecName: Full=Pathogenesis-related protein 5; Short=PR-5; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51923.1|AC013258_17 thaumatin-like protein; 25613-24636 [Arabidopsis thaliana]
 gb|AAA32865.1| thaumatin-like protein [Arabidopsis thaliana]
 gb|AAB68336.1| thaumatin-like protein [Arabidopsis thaliana]
 gb|AAK59672.1| putative thaumatin protein [Arabidopsis thaliana]
 gb|AAL15220.1| putative thaumatin protein [Arabidopsis thaliana]
 gb|AEE35665.1| pathogenesis-related protein 5 [Arabidopsis thaliana]
Length=239

 Score =   299 bits (766),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 180/219 (82%), Gaps = 2/219 (1%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A  FTL N C  TVW GTL+G G   LG+GGF L+PG S +L APAGWSGRFWARTGCNF
Sbjct  23   ATDFTLRNNCPTTVWAGTLAGQG-PKLGDGGFELTPGASRQLTAPAGWSGRFWARTGCNF  81

Query  665  DASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            DASGNG CVTGDCGGL+C GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV LGIRPS
Sbjct  82   DASGNGRCVTGDCGGLRCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVKLGIRPS  140

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
            GGSGDC+YAGCV+DLN  CP++L+V D  +VVACKSAC +FNT +YCC G ++   TC P
Sbjct  141  GGSGDCKYAGCVSDLNAACPDMLKVMDQNNVVACKSACERFNTDQYCCRGANDKPETCPP  200

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            T YSRIFKNACP AYSYAYDD++STFTC G++Y ITFCP
Sbjct  201  TDYSRIFKNACPDAYSYAYDDETSTFTCTGANYEITFCP  239



>emb|CDX73137.1| BnaC06g35850D [Brassica napus]
Length=246

 Score =   300 bits (767),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 182/223 (82%), Gaps = 4/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YT+WPG LSGN    LG+GGF L+PG S +L AP GWSGRFW RTGC+
Sbjct  22   SATVFTLQNSCPYTIWPGILSGNSNT-LGDGGFPLTPGASKQLTAPQGWSGRFWPRTGCS  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FD+SGNGNCVTGDCGG+    GGGVPP TLAEFT+  G + KDFYDVSLVDGYNV++GI+
Sbjct  81   FDSSGNGNCVTGDCGGVLKCIGGGVPPTTLAEFTVETGVSGKDFYDVSLVDGYNVEMGIK  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GGSGDC+YAGCVAD+N  CP  L++ D  +G+V ACKSACA FN+PE+CCTG H T  
Sbjct  141  PQGGSGDCKYAGCVADVNAVCPNELRIMDPKTGTVAACKSACAAFNSPEFCCTGAHATPQ  200

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT+YS +FKNACP AYSYAYDD +STFTCAG++YLITFCP
Sbjct  201  TCSPTRYSAMFKNACPSAYSYAYDDATSTFTCAGANYLITFCP  243



>ref|NP_177640.1| thaumatin-like protein 3 [Arabidopsis thaliana]
 gb|AAG51927.1|AC013258_21 thaumatin-like protein; 28949-28112 [Arabidopsis thaliana]
 dbj|BAD43106.1| thaumatin-like protein [Arabidopsis thaliana]
 gb|ABN04791.1| At1g75030 [Arabidopsis thaliana]
 gb|AEE35664.1| thaumatin-like protein 3 [Arabidopsis thaliana]
Length=246

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 180/223 (81%), Gaps = 4/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YTVWPGTLSGN    LG+GGF L+PG SV+L AP GWSGRFWARTGCN
Sbjct  22   SATVFTLQNSCAYTVWPGTLSGNS-ITLGDGGFPLTPGASVQLTAPTGWSGRFWARTGCN  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FDASG+G CVTGDCGG+    GGGVPP TLAEFT+ + NA  DFYDVSLVDGYNV +GI+
Sbjct  81   FDASGHGTCVTGDCGGVLKCTGGGVPPATLAEFTVGSSNAGMDFYDVSLVDGYNVKMGIK  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GG G+C+YAGCV+D+N  CP  L++ D  SGSV ACKSACA F++PE+CCTG H T  
Sbjct  141  PQGGFGNCKYAGCVSDINEICPSELRIMDPNSGSVAACKSACAAFSSPEFCCTGAHATPQ  200

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT YS +FKNACP AYSYAYDD SSTFTC GS+YLITFCP
Sbjct  201  TCSPTYYSSMFKNACPSAYSYAYDDASSTFTCTGSNYLITFCP  243



>ref|XP_002887570.1| hypothetical protein ARALYDRAFT_476641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63829.1| hypothetical protein ARALYDRAFT_476641 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 180/223 (81%), Gaps = 4/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YTVWPGTLSGN    LG+GGF L+PG SV+L AP GWSGRFWARTGCN
Sbjct  22   SATVFTLLNSCPYTVWPGTLSGNS-VTLGDGGFPLTPGASVQLTAPTGWSGRFWARTGCN  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FDASG+G CVTGDCGG+    GGGVPP TLAEFT+ + NA  DFYDVSLVDGYNV +GI+
Sbjct  81   FDASGHGTCVTGDCGGVLKCTGGGVPPATLAEFTVGSSNAGMDFYDVSLVDGYNVKMGIK  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GG G+C+YAGCV+D+N  CP  L++ D  SGS+ ACKSACA FN+PE+CCTG H T  
Sbjct  141  PQGGFGNCKYAGCVSDINEICPSELRIMDPNSGSIAACKSACAAFNSPEFCCTGAHATPQ  200

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT YS +FKNACP AYSYAYDD SSTFTC GS+YLITFCP
Sbjct  201  TCSPTYYSSMFKNACPSAYSYAYDDASSTFTCTGSNYLITFCP  243



>emb|CDY46016.1| BnaA02g17100D [Brassica napus]
Length=247

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 177/224 (79%), Gaps = 5/224 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YTVWPG LSGN    LGEGGF L+PG SVEL AP GWSGRFWARTGCN
Sbjct  22   SATVFTLENSCPYTVWPGILSGNANT-LGEGGFPLTPGASVELNAPPGWSGRFWARTGCN  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FD+SG+G CVTGDCGG     G GVPP TLAEFT+ + N+  DFYDVSLVDGYNV +GIR
Sbjct  81   FDSSGHGTCVTGDCGGALKCTGNGVPPATLAEFTVGSSNSGMDFYDVSLVDGYNVKMGIR  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD---SGSVVACKSACAQFNTPEYCCTGDHNTH  321
            P GGSGDC+YAGCV+D+N  CP  L++ D    G V ACKSACA FN+PE+CCTG H T 
Sbjct  141  PQGGSGDCRYAGCVSDINEICPSELRIMDPLNGGIVAACKSACAAFNSPEFCCTGAHATP  200

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             TCSPTQYS +FKNACP AYSYAYDD +STFTC G++Y+ITFCP
Sbjct  201  QTCSPTQYSAMFKNACPTAYSYAYDDATSTFTCNGANYVITFCP  244



>ref|XP_009106162.1| PREDICTED: pathogenesis-related protein 5 [Brassica rapa]
Length=246

 Score =   298 bits (762),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/219 (71%), Positives = 180/219 (82%), Gaps = 4/219 (2%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N+C YTVWPG LSGN    LG+GGF L+PG S +L AP GWSGRFWARTGC+FD+S
Sbjct  26   FTLQNSCPYTVWPGILSGNSNT-LGDGGFPLTPGASKQLTAPQGWSGRFWARTGCSFDSS  84

Query  656  GNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSGG  480
            GNGNCVTGDCGG+    GGGVPP TLAEFT+  G + KDFYDVSLVDGYNV++GI+P GG
Sbjct  85   GNGNCVTGDCGGVLKCIGGGVPPTTLAEFTVGTGVSGKDFYDVSLVDGYNVEMGIKPQGG  144

Query  479  SGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
            SGDC+YAGCVAD+N  CP  L++ D  +G+V ACKSACA FN+PE+CCTG   T  TCSP
Sbjct  145  SGDCKYAGCVADVNAVCPNELRIVDPKTGTVAACKSACAAFNSPEFCCTGAPATPQTCSP  204

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            T+YS +FKNACP AYSYAYDD +STFTCAG++YLITFCP
Sbjct  205  TRYSAMFKNACPSAYSYAYDDATSTFTCAGANYLITFCP  243



>gb|KEH40091.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=249

 Score =   298 bits (762),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 174/225 (77%), Gaps = 2/225 (1%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            N+ +A  FT+ N C+YT+WPGTLSGNG A LG+GGF L+PG SV L APAGWSGRFWART
Sbjct  21   NLASATVFTIQNQCSYTIWPGTLSGNGAAILGQGGFLLAPGASVSLTAPAGWSGRFWART  80

Query  677  GCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIAN-GNADKDFYDVSLVDGYNVD  504
            GC FD +GNG CVTGDC G     GGG PPVTLAEFTI + GN  KDFYDVSLVDGYN  
Sbjct  81   GCEFDGAGNGKCVTGDCPGGLNCIGGGTPPVTLAEFTIGSAGNGGKDFYDVSLVDGYNAG  140

Query  503  LGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNT  324
            +G+  +GG+GDCQYAGCVADLN  CP  L+V   GSVVACKSAC  FN  E+CCTG H T
Sbjct  141  MGVWATGGTGDCQYAGCVADLNGGCPAELRVNSGGSVVACKSACLAFNMEEFCCTGQHAT  200

Query  323  HATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              TCSPT YS IFK ACP AYSYAYDD SST TC+GSDY ITFCP
Sbjct  201  PQTCSPTHYSEIFKKACPTAYSYAYDDASSTCTCSGSDYHITFCP  245



>ref|XP_007160787.1| hypothetical protein PHAVU_001G016600g [Phaseolus vulgaris]
 gb|ESW32781.1| hypothetical protein PHAVU_001G016600g [Phaseolus vulgaris]
Length=244

 Score =   298 bits (762),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 176/228 (77%), Gaps = 3/228 (1%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            + NV +   FTL N C+YTVWPGTLSGNG A LG+GGF L PG  V+L AP+GWSGR WA
Sbjct  17   LGNVVSGAVFTLQNRCSYTVWPGTLSGNGVATLGDGGFPLEPGAEVQLTAPSGWSGRIWA  76

Query  683  RTGCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIA-NGNADKDFYDVSLVDGYN  510
            RTGC+FD SG G C TGDC G     GGGVPP TLAEFTI   GN DKDFYDVSLVDGYN
Sbjct  77   RTGCSFDGSGIGTCATGDCAGGLRCTGGGVPPATLAEFTIGFAGNGDKDFYDVSLVDGYN  136

Query  509  VDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVV-ACKSACAQFNTPEYCCTGD  333
            V +G+  +GG+GDC+YAGC ADLN  CPE LQV DSG VV ACKSACA FNTPE+CCTG+
Sbjct  137  VGIGVLATGGTGDCRYAGCAADLNAACPEELQVRDSGGVVVACKSACAAFNTPEFCCTGE  196

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            H T  TCS T YS IFKNACP AYSYAYDD SST TC+ +DY+I FCP
Sbjct  197  HGTPQTCSATHYSEIFKNACPTAYSYAYDDASSTRTCSTADYVIAFCP  244



>gb|KHG08802.1| hypothetical protein F383_35963 [Gossypium arboreum]
Length=236

 Score =   297 bits (761),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 181/223 (81%), Gaps = 3/223 (1%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A SFTL N C++TVWPG+L+ NG   LG+GGFAL+PG S  L  P GWSGRFW RTGCN
Sbjct  16   SATSFTLENRCSFTVWPGSLTANG-PPLGDGGFALAPGSSSRLHPPPGWSGRFWGRTGCN  74

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FD SG+G CVTGDCGG     GGG+PPV+L EFT+ NG+ +KDFYD+SLVDGYN+ + ++
Sbjct  75   FDNSGSGKCVTGDCGGALKCNGGGIPPVSLIEFTL-NGHDNKDFYDISLVDGYNMAVAVK  133

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
              GG+G CQYAGCV DLNTNCP  LQ+TDSGSVVACKSACA FNTPEYCCTG H T  TC
Sbjct  134  AVGGTGTCQYAGCVNDLNTNCPAELQMTDSGSVVACKSACAAFNTPEYCCTGAHGTPQTC  193

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            SPT+YS++FKNACP AYSYAYDD +ST TC G+DYLITFCP S
Sbjct  194  SPTKYSQLFKNACPTAYSYAYDDATSTMTCTGADYLITFCPTS  236



>ref|XP_006390358.1| hypothetical protein EUTSA_v10019046mg [Eutrema salsugineum]
 gb|ESQ27644.1| hypothetical protein EUTSA_v10019046mg [Eutrema salsugineum]
Length=247

 Score =   297 bits (761),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 180/224 (80%), Gaps = 5/224 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N C YTVWPG LSGN    LG+GGF L+PG SV+L +P  WSGRFWARTGCN
Sbjct  22   SATVFTLENLCPYTVWPGILSGNSNT-LGDGGFPLTPGASVQLTSPPRWSGRFWARTGCN  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FD+SG GNCVTGDCGG+    GGGVPP TLAEFT+ +G +  DFYDVSLVDGYNV +GI+
Sbjct  81   FDSSGRGNCVTGDCGGVLKCIGGGVPPATLAEFTVGSGESGMDFYDVSLVDGYNVQMGIK  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD---SGSVVACKSACAQFNTPEYCCTGDHNTH  321
            P GGSGDC+YAGCV+D+N  CP  L++ D   +GSV ACKSACA FN+PE+CCTG H+T 
Sbjct  141  PQGGSGDCKYAGCVSDINEICPSELRIMDPNNNGSVAACKSACAAFNSPEFCCTGAHSTP  200

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             TCSPTQYS +FKNACP AYSYAYDD +STFTC+G+ YLITFCP
Sbjct  201  MTCSPTQYSAMFKNACPSAYSYAYDDATSTFTCSGASYLITFCP  244



>gb|ABL86687.1| TLP1 [Gossypium barbadense]
Length=244

 Score =   297 bits (760),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 180/223 (81%), Gaps = 3/223 (1%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A SFTL N C++TVWPG+L+ NG   LG+GGFAL+PG S  L  P GWSGRFW RTGCN
Sbjct  24   SATSFTLENRCSFTVWPGSLTANG-PPLGDGGFALAPGSSSRLHPPPGWSGRFWGRTGCN  82

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FD SG+G CVTGDCGG     GGG+PPV+L EFT+ NG+ +KDFYD+SLVDGYN+ + ++
Sbjct  83   FDNSGSGKCVTGDCGGALKCNGGGIPPVSLIEFTL-NGHDNKDFYDISLVDGYNMAVAVK  141

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
              GG+G CQYAGCV DLNTNCP  LQ+TDSGSVVACKSACA FNTPEYCCTG H T  TC
Sbjct  142  AVGGTGTCQYAGCVNDLNTNCPAELQMTDSGSVVACKSACAAFNTPEYCCTGAHGTPQTC  201

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            SPT YS++FKNACP AYSYAYDD +ST TC G+DYLITFCP S
Sbjct  202  SPTMYSQLFKNACPTAYSYAYDDATSTMTCTGADYLITFCPTS  244



>ref|XP_003545288.2| PREDICTED: pathogenesis-related protein 5-like [Glycine max]
Length=250

 Score =   297 bits (760),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 178/229 (78%), Gaps = 4/229 (2%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            + N+  A  FTL N C+YTVWPGTLSGNG A LG+GGF ++PG S +L AP+GWSGR WA
Sbjct  20   LGNIAYATVFTLENHCSYTVWPGTLSGNGVATLGDGGFPMAPGSSAQLTAPSGWSGRLWA  79

Query  683  RTGCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTI--ANGNADKDFYDVSLVDGY  513
            RTGC+FDASGNG C+TGDC G     G GVPP TLAEFT+  A     KDFYDVSLVDGY
Sbjct  80   RTGCSFDASGNGKCLTGDCAGGMRCTGAGVPPATLAEFTVGSAGKGGGKDFYDVSLVDGY  139

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSG-SVVACKSACAQFNTPEYCCTG  336
            NV +G+R +GG+GDC+YAGC  DLN  CP  LQV D G  VVACKSACA FNT E+CCTG
Sbjct  140  NVGVGVRATGGTGDCKYAGCSEDLNAACPAELQVKDGGGEVVACKSACAAFNTAEFCCTG  199

Query  335  DHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            DH++  TCSPT YS+IFKNACP AYSYAYDD SS  TC+GSDY+ITFCP
Sbjct  200  DHSSPQTCSPTLYSKIFKNACPAAYSYAYDDPSSICTCSGSDYVITFCP  248



>ref|XP_009128072.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=247

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 176/224 (79%), Gaps = 5/224 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C Y VWPG LSGN    LGEGGF L+PG SVEL AP GWSGRFWARTGCN
Sbjct  22   SATVFTLENSCPYIVWPGILSGNANT-LGEGGFPLTPGASVELNAPPGWSGRFWARTGCN  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FD+SG+G CVTGDCGG     G GVPP TLAEFT+ + N+  DFYDVSLVDGYNV +GIR
Sbjct  81   FDSSGHGTCVTGDCGGALKCTGNGVPPATLAEFTVGSSNSGMDFYDVSLVDGYNVKMGIR  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD---SGSVVACKSACAQFNTPEYCCTGDHNTH  321
            P GGSGDC+YAGCV+D+N  CP  L++ D    G V ACKSACA FN+PE+CCTG H T 
Sbjct  141  PQGGSGDCRYAGCVSDINEICPSELRIMDPLNGGIVAACKSACAAFNSPEFCCTGAHATP  200

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             TCSPTQYS +FKNACP AYSYAYDD +STFTC G++Y+ITFCP
Sbjct  201  QTCSPTQYSAMFKNACPTAYSYAYDDATSTFTCNGANYVITFCP  244



>emb|CDY37263.1| BnaCnng08170D [Brassica napus]
Length=247

 Score =   295 bits (755),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 176/224 (79%), Gaps = 5/224 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YTVWPG LSGN    LGEGGF L+PG S++L AP GWSGRFWARTGC+
Sbjct  22   SATVFTLENSCPYTVWPGILSGNTNT-LGEGGFPLTPGASIQLNAPPGWSGRFWARTGCS  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FD+SG G CVTGDCGG     G GVPP TLAEFT+ + N+  DFYDVSLVDGYNV +GIR
Sbjct  81   FDSSGRGTCVTGDCGGALKCTGNGVPPATLAEFTVGSSNSGMDFYDVSLVDGYNVKMGIR  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD---SGSVVACKSACAQFNTPEYCCTGDHNTH  321
            P GGSGDC+YAGCV+D+N  CP  L++ D    G V ACKSACA FN+PE+CCTG H T 
Sbjct  141  PQGGSGDCRYAGCVSDINEICPSELRIMDPQNGGIVAACKSACAAFNSPEFCCTGAHATP  200

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             TCSPTQYS +FKNACP AYSYAYDD +S+FTC G++YLITFCP
Sbjct  201  QTCSPTQYSTMFKNACPSAYSYAYDDATSSFTCNGANYLITFCP  244



>emb|CDY59465.1| BnaCnng34970D [Brassica napus]
Length=247

 Score =   295 bits (755),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 184/230 (80%), Gaps = 6/230 (3%)
 Frame = -1

Query  863  ITNVWA--AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRF  690
            ITNV A  A  FTL N+C YTVWPG LSGN    LG+GGF L+ G SV+L AP GWSGRF
Sbjct  16   ITNVIAVSATVFTLQNSCPYTVWPGILSGNSNT-LGDGGFPLTSGASVQLTAPPGWSGRF  74

Query  689  WARTGCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
            WARTGC+FD+SG+GNCVTGDCGG+    GGGVPP TLAEFT+ +G   KDFYDVSLVDGY
Sbjct  75   WARTGCSFDSSGHGNCVTGDCGGVLKCIGGGVPPTTLAEFTVGSGAYGKDFYDVSLVDGY  134

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCT  339
            NV++GI+P GGSGDC  AGCVAD+N+ CP VLQ+ D  +G V ACKSACA FN PE+CCT
Sbjct  135  NVEMGIKPHGGSGDCTSAGCVADVNSVCPSVLQIMDPRTGIVAACKSACAAFNAPEFCCT  194

Query  338  GDHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            G H T  TCSPT +S +FKNACP AYSYAYDD +STFTC+G++Y+ITFCP
Sbjct  195  GAHATPQTCSPTHFSAVFKNACPSAYSYAYDDATSTFTCSGANYVITFCP  244



>gb|AAB71214.1| thaumatin-like protein [Arabidopsis thaliana]
Length=245

 Score =   295 bits (754),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 180/223 (81%), Gaps = 5/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YTVWPGTLSGN    LG+GGF L+PG SV+L AP GWSGRFWARTGCN
Sbjct  22   SATVFTLQNSCAYTVWPGTLSGNS-ITLGDGGFPLTPGASVQLTAPTGWSGRFWARTGCN  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FDASG+G CVTGDCGG+    GGGVPP TLAEFT+ + NA  DFYDVSLVDGYNV +GI+
Sbjct  81   FDASGHGTCVTGDCGGVLKCTGGGVPPATLAEFTVGSSNAGMDFYDVSLVDGYNVKMGIK  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GG G+C+YAGCV+D+N  CP  L++ D  SGSV ACKSACA F++PE+CCTG H T  
Sbjct  141  PQGGFGNCKYAGCVSDINEICPSELRIMDPNSGSVAACKSACA-FSSPEFCCTGAHATPQ  199

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT YS +FKNACP AYSYAYDD SSTFTC GS+YLITFCP
Sbjct  200  TCSPTYYSSMFKNACPSAYSYAYDDASSTFTCTGSNYLITFCP  242



>ref|XP_007160788.1| hypothetical protein PHAVU_001G016700g [Phaseolus vulgaris]
 gb|ESW32782.1| hypothetical protein PHAVU_001G016700g [Phaseolus vulgaris]
Length=248

 Score =   295 bits (754),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 176/225 (78%), Gaps = 3/225 (1%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV +   F L N C++TVWPGTLSGNG A LG GGFAL PG SV   AP+GWSGRFW RT
Sbjct  18   NVASDTVFYLENHCSHTVWPGTLSGNGAAVLGSGGFALPPGSSVHFSAPSGWSGRFWGRT  77

Query  677  GCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTI-ANGNADKDFYDVSLVDGYNVD  504
            GC FD SG G+C TGDC G     GGGVPPVTL EFT  ++GN +KDFYDVSLVDGYNV 
Sbjct  78   GCTFDESGVGSCATGDCAGGLKCNGGGVPPVTLVEFTTGSSGNGNKDFYDVSLVDGYNVG  137

Query  503  LGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSG-SVVACKSACAQFNTPEYCCTGDHN  327
            +G+R +GG+GDC+YAGCVADLN  CP  LQV D G +VVACKSACA FNT E+CCTGDH 
Sbjct  138  MGVRATGGTGDCRYAGCVADLNGACPTELQVRDGGGAVVACKSACAAFNTAEFCCTGDHG  197

Query  326  THATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            T  TCSPT YS IFK+ACP AYSYAYDD SSTFTC+ SDY+ITFC
Sbjct  198  TPQTCSPTHYSEIFKSACPTAYSYAYDDASSTFTCSNSDYVITFC  242



>ref|XP_010416369.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=246

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 182/223 (82%), Gaps = 5/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YTVWPG LSGN    LG+GGF L+PG SV+L APAGWSGRFWARTGCN
Sbjct  23   SATVFTLQNSCPYTVWPGILSGNDNT-LGDGGFPLTPGASVQLTAPAGWSGRFWARTGCN  81

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FDASG+GNCVTGDCGG+    GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV++GI+
Sbjct  82   FDASGHGNCVTGDCGGVLKCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMGIK  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GGSGDC YAGCVAD+N  CP  L++ D  +G + ACKSACA FN+ E+CCTG H T  
Sbjct  141  PQGGSGDCHYAGCVADVNAVCPNELRIMDPHTGIIAACKSACAAFNSEEFCCTGAHATPQ  200

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT YS +FK+ACP AYSYAYDD +STFTC+GS+YLI+FCP
Sbjct  201  TCSPTHYSAMFKSACPGAYSYAYDDATSTFTCSGSNYLISFCP  243



>ref|XP_010428505.1| PREDICTED: pathogenesis-related protein 5 isoform X1 [Camelina 
sativa]
Length=245

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 182/223 (82%), Gaps = 5/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YTVWPG LSGN    LG+GGF L+PG SV+L APAGWSGRFWARTGCN
Sbjct  22   SATVFTLQNSCPYTVWPGILSGNDNT-LGDGGFPLTPGASVQLTAPAGWSGRFWARTGCN  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FDASG+GNCVTGDCGG+    GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV++GI+
Sbjct  81   FDASGHGNCVTGDCGGVLKCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMGIK  139

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GGSGDC YAGCVAD+N  CP  L++ D  +G + ACKSACA FN+ E+CCTG H T  
Sbjct  140  PQGGSGDCHYAGCVADVNAVCPNELRIMDPHTGIIAACKSACAAFNSEEFCCTGAHATPQ  199

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT YS +FK+ACP AYSYAYDD +STFTC+GS+YLI+FCP
Sbjct  200  TCSPTHYSAMFKSACPGAYSYAYDDATSTFTCSGSNYLISFCP  242



>gb|KEH36134.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=250

 Score =   293 bits (751),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 179/225 (80%), Gaps = 2/225 (1%)
 Frame = -1

Query  857  NVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWART  678
            NV +   FT+ N C  T+WPGTLSGNG   LG+GGF+L PG S ++ AP GWSGRFW RT
Sbjct  22   NVASGTMFTIENRCNNTIWPGTLSGNGAELLGDGGFSLPPGSSFDVTAPPGWSGRFWGRT  81

Query  677  GCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  501
            GCNFD +GNGNC+TGDC G     GGG PPVTLAEFTI + + DKDFYDVSLVDGYNV +
Sbjct  82   GCNFDGAGNGNCITGDCTGGLKCNGGGAPPVTLAEFTIGSVSGDKDFYDVSLVDGYNVGI  141

Query  500  GIRPSGGSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTGDHNT  324
            GI+ + G+GDCQYAGCVADLN++CP  LQVT+  GSVVACKSACA FNT E+CCTG+H++
Sbjct  142  GIQATRGTGDCQYAGCVADLNSHCPAELQVTEVGGSVVACKSACAAFNTEEFCCTGEHSS  201

Query  323  HATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              +CS TQYS +FK+ACP AYSYAYDD SST TC+ SDY ITFCP
Sbjct  202  PQSCSSTQYSEMFKSACPSAYSYAYDDASSTCTCSESDYHITFCP  246



>ref|XP_002887572.1| hypothetical protein ARALYDRAFT_316436 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63831.1| hypothetical protein ARALYDRAFT_316436 [Arabidopsis lyrata subsp. 
lyrata]
Length=245

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 181/223 (81%), Gaps = 5/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YTVWPG LSGN    LG+GGF L+PG SV+L APAGWSGRFWARTGCN
Sbjct  22   SATVFTLQNSCPYTVWPGILSGNDNT-LGDGGFPLTPGASVQLTAPAGWSGRFWARTGCN  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FDASG+GNCVTGDCGG+    GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV++GI+
Sbjct  81   FDASGHGNCVTGDCGGVLKCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMGIK  139

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GGSGDC YAGCVAD+N  CP  L++ D  +G + ACKSACA FN+ E+CCTG H T  
Sbjct  140  PQGGSGDCHYAGCVADVNAVCPNELRIMDPHTGIIAACKSACAAFNSEEFCCTGAHATPQ  199

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT YS +FK+ACP AYSYAYDD +STFTC GS+YLI+FCP
Sbjct  200  TCSPTHYSAMFKSACPGAYSYAYDDATSTFTCTGSNYLISFCP  242



>ref|XP_010428506.1| PREDICTED: pathogenesis-related protein 5 isoform X2 [Camelina 
sativa]
Length=246

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 182/223 (82%), Gaps = 5/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YTVWPG LSGN    LG+GGF L+PG SV+L APAGWSGRFWARTGCN
Sbjct  23   SATVFTLQNSCPYTVWPGILSGNDNT-LGDGGFPLTPGASVQLTAPAGWSGRFWARTGCN  81

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FDASG+GNCVTGDCGG+    GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV++GI+
Sbjct  82   FDASGHGNCVTGDCGGVLKCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMGIK  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GGSGDC YAGCVAD+N  CP  L++ D  +G + ACKSACA FN+ E+CCTG H T  
Sbjct  141  PQGGSGDCHYAGCVADVNAVCPNELRIMDPHTGIIAACKSACAAFNSEEFCCTGAHATPQ  200

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT YS +FK+ACP AYSYAYDD +STFTC+GS+YLI+FCP
Sbjct  201  TCSPTHYSAMFKSACPGAYSYAYDDATSTFTCSGSNYLISFCP  243



>ref|XP_010428504.1| PREDICTED: pathogenesis-related protein 5 [Camelina sativa]
Length=246

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 177/223 (79%), Gaps = 4/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YTVWPGTLSGN    LG+GGF L+PG SV+L AP GWSGRFWART CN
Sbjct  22   SATVFTLQNSCPYTVWPGTLSGNS-ITLGDGGFQLTPGASVQLTAPVGWSGRFWARTSCN  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FDASG G CVTGDCGG+    GGG PP TLAEFT+ + NA  DFYDVSLVDGYNV +GI 
Sbjct  81   FDASGRGTCVTGDCGGVLKCIGGGEPPATLAEFTVGSSNAGMDFYDVSLVDGYNVKMGIT  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GG G+C+YAGCV+D+N  CP  L++ D  SGS+ ACKSACA F++PE+CCTG H+T  
Sbjct  141  PQGGFGNCKYAGCVSDINEICPNELRIMDPGSGSIAACKSACAAFSSPEFCCTGAHSTPQ  200

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT YS +FKNACP AYSYAYDD SSTFTC GS+YLITFCP
Sbjct  201  TCSPTYYSTMFKNACPSAYSYAYDDASSTFTCTGSNYLITFCP  243



>ref|XP_010471602.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=246

 Score =   292 bits (748),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 177/223 (79%), Gaps = 4/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FT+ N+C YTVWPGTLSGN    LG+GGF L+PG SV+L AP GWSGRFW RTGCN
Sbjct  22   SATVFTIQNSCPYTVWPGTLSGNS-ITLGDGGFQLTPGASVQLTAPVGWSGRFWGRTGCN  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FDASG G CVTGDCGG+    GGG PP TLAEFT+ + NA  DFYDVSLVDGYNV +GI 
Sbjct  81   FDASGRGTCVTGDCGGVLKCIGGGEPPATLAEFTVGSSNAGMDFYDVSLVDGYNVKMGIA  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GG G+C+YAGCV+D+N  CP  L++ D  SGS+ ACKSACA F++PE+CCTG H+T  
Sbjct  141  PQGGFGNCKYAGCVSDINEICPNELRIMDPGSGSIAACKSACAAFSSPEFCCTGAHSTPQ  200

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT YS +FKNACP AYSYAYDD SSTFTC GS+YLITFCP
Sbjct  201  TCSPTYYSTMFKNACPSAYSYAYDDASSTFTCTGSNYLITFCP  243



>ref|XP_010416362.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=246

 Score =   292 bits (748),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 177/223 (79%), Gaps = 4/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FT+ N+C YTVWPGTLSGN    LG+GGF L+PG SV+L AP GWSGRFW RTGCN
Sbjct  22   SATVFTIQNSCPYTVWPGTLSGNS-ITLGDGGFQLTPGASVQLTAPVGWSGRFWGRTGCN  80

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FDASG G CVTGDCGG+    GGG PP TLAEFT+ + NA  DFYDVSLVDGYNV +GI 
Sbjct  81   FDASGRGTCVTGDCGGVLKCIGGGEPPATLAEFTVGSSNAGMDFYDVSLVDGYNVKMGIA  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GG G+C+YAGCV+D+N  CP  L++ D  SGS+ ACKSACA F++PE+CCTG H+T  
Sbjct  141  PQGGFGNCKYAGCVSDINEICPNELRIMDPGSGSIAACKSACAAFSSPEFCCTGAHSTPQ  200

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT YS +FKNACP AYSYAYDD SSTFTC GS+YLITFCP
Sbjct  201  TCSPTYYSTMFKNACPSAYSYAYDDASSTFTCTGSNYLITFCP  243



>ref|XP_009106158.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=243

 Score =   292 bits (747),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 171/219 (78%), Gaps = 7/219 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
             FTL N C YTVWPGTL+GNGG  LG+GG+ L+PG SV+L+AP GW+GRFWARTGCNFD+
Sbjct  25   EFTLQNNCPYTVWPGTLTGNGGNILGDGGYQLNPGASVQLRAPPGWTGRFWARTGCNFDS  84

Query  659  SGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            SGNG CVTG         G GGVPPVTLAEFT+     +KD+YDVSLVDGYNV +GI+P 
Sbjct  85   SGNGKCVTGDCGGVLKCAGAGGVPPVTLAEFTV----GEKDYYDVSLVDGYNVKMGIKPQ  140

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            GG GDC+YAGCV+DLN  CP  L+V D   +V ACKSACA FN  EYCCTG H+T  TCS
Sbjct  141  GGFGDCKYAGCVSDLNMICPNELRVMDPQNNVAACKSACAAFNKEEYCCTGAHSTPQTCS  200

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            PT YS  FK ACP AYSYAYDD++STFTCAG++YLITFC
Sbjct  201  PTTYSMTFKKACPDAYSYAYDDETSTFTCAGANYLITFC  239



>emb|CDX73133.1| BnaC06g35810D [Brassica napus]
Length=243

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 171/219 (78%), Gaps = 7/219 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
             FTL N C YTVWPGTL+GNGG  LG+GG+ L+PG SV+L+AP GW+GRFWARTGCNFD+
Sbjct  25   EFTLQNNCPYTVWPGTLTGNGGNILGDGGYQLNPGASVQLRAPPGWTGRFWARTGCNFDS  84

Query  659  SGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            SGNG CVTGD        G GGVPPVTLAEFT+     +KD+YDVSLVDGYNV +GI+P 
Sbjct  85   SGNGKCVTGDCGGVLKCAGAGGVPPVTLAEFTV----GEKDYYDVSLVDGYNVKMGIKPQ  140

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            GG GDC YAGCV+DLN  CP  L+V D   +V ACKSACA FN  EYCCTG H+T  TCS
Sbjct  141  GGFGDCDYAGCVSDLNMVCPNELRVMDPQNNVAACKSACAAFNKEEYCCTGAHSTPQTCS  200

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            PT YS  FK ACP AYSYAYDD++STFTCAG++YLITFC
Sbjct  201  PTTYSMTFKKACPDAYSYAYDDETSTFTCAGANYLITFC  239



>ref|NP_177642.2| pathogenesis-related thaumatin-like protein protein [Arabidopsis 
thaliana]
 gb|ABE65774.1| thaumatin-like protein/pathogenesis-like protein [Arabidopsis 
thaliana]
 gb|AEE35666.1| pathogenesis-related thaumatin-like protein protein [Arabidopsis 
thaliana]
Length=246

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 181/225 (80%), Gaps = 5/225 (2%)
 Frame = -1

Query  854  VWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTG  675
            V AA  FTL N+C YTVWPG LSGN    LG+GGF L+PG SV+L APAGWSGRFWARTG
Sbjct  21   VSAATVFTLQNSCPYTVWPGILSGNDNT-LGDGGFPLTPGASVQLTAPAGWSGRFWARTG  79

Query  674  CNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            CNFDASG+GNC TGDCGG+    GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV++G
Sbjct  80   CNFDASGHGNCGTGDCGGVLKCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMG  138

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNT  324
            I+P GGSGDC YAGCVAD+N  CP  L++ D  +G + ACKSACA FN+ E+CCTG H T
Sbjct  139  IKPQGGSGDCHYAGCVADVNAVCPNELRLMDPHTGIIAACKSACAAFNSEEFCCTGAHAT  198

Query  323  HATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              TCSPT YS +FK+ACP AYSYAYDD +STFTC GS+YLI+FCP
Sbjct  199  PQTCSPTHYSAMFKSACPGAYSYAYDDATSTFTCTGSNYLISFCP  243



>ref|XP_010678327.1| PREDICTED: pathogenesis-related protein 5-like [Beta vulgaris 
subsp. vulgaris]
Length=249

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 176/218 (81%), Gaps = 4/218 (2%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C YTVWPGTLSGNG    GEG + LSPG S++L  P GWSGRFWARTGCNFD +
Sbjct  29   FTLLNNCPYTVWPGTLSGNGPTLAGEGNYILSPGTSMQLNPPVGWSGRFWARTGCNFDTN  88

Query  656  GNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSG--  483
            G G C TGDCGGL+C GGGVPPV+L EFT+ NG   +DFYDVSLVDGYNV +G++P+G  
Sbjct  89   GAGTCSTGDCGGLQCTGGGVPPVSLVEFTL-NGAGGQDFYDVSLVDGYNVGIGVKPTGDG  147

Query  482  GSGDCQYAGCVADLNTNCPEVLQVTDS-GSVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
             SG+CQYAGCV DLN +CP  LQV DS GSVVACKSACA FN+PEYCCTGDH +  TCSP
Sbjct  148  ASGNCQYAGCVNDLNASCPPELQVRDSNGSVVACKSACAAFNSPEYCCTGDHGSPQTCSP  207

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            TQYS +FKNACP AYSYAYDD SST TC GSDY+ITFC
Sbjct  208  TQYSEMFKNACPTAYSYAYDDASSTCTCTGSDYIITFC  245



>gb|AAG51919.1|AC013258_13 thaumatin-like protein; 23251-22305 [Arabidopsis thaliana]
Length=257

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 181/225 (80%), Gaps = 5/225 (2%)
 Frame = -1

Query  854  VWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTG  675
            V AA  FTL N+C YTVWPG LSGN    LG+GGF L+PG SV+L APAGWSGRFWARTG
Sbjct  32   VSAATVFTLQNSCPYTVWPGILSGNDNT-LGDGGFPLTPGASVQLTAPAGWSGRFWARTG  90

Query  674  CNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            CNFDASG+GNC TGDCGG+    GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV++G
Sbjct  91   CNFDASGHGNCGTGDCGGVLKCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMG  149

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNT  324
            I+P GGSGDC YAGCVAD+N  CP  L++ D  +G + ACKSACA FN+ E+CCTG H T
Sbjct  150  IKPQGGSGDCHYAGCVADVNAVCPNELRLMDPHTGIIAACKSACAAFNSEEFCCTGAHAT  209

Query  323  HATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              TCSPT YS +FK+ACP AYSYAYDD +STFTC GS+YLI+FCP
Sbjct  210  PQTCSPTHYSAMFKSACPGAYSYAYDDATSTFTCTGSNYLISFCP  254



>gb|KFK33653.1| hypothetical protein AALP_AA5G041900 [Arabis alpina]
Length=249

 Score =   291 bits (745),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/228 (68%), Positives = 181/228 (79%), Gaps = 7/228 (3%)
 Frame = -1

Query  854  VWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTG  675
            V +A  FTL N C YTVWPG LSGN   +LG+GGF L+PG SV+L +P GWSGRFWARTG
Sbjct  20   VVSATVFTLQNNCPYTVWPGILSGNSN-NLGDGGFPLTPGASVQLTSPPGWSGRFWARTG  78

Query  674  CNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            CNFD++G G+CVTGDCGG+    G GVPP TLAEFT+ +  +DKDFYDVSLVDGYNV++G
Sbjct  79   CNFDSTGRGSCVTGDCGGILKCTGSGVPPATLAEFTVGSSISDKDFYDVSLVDGYNVEMG  138

Query  497  IRPSGG--SGDCQYAGCVADLNTNCPEVLQVTD---SGSVVACKSACAQFNTPEYCCTGD  333
            I P GG  SGDC YAGCVAD+N  CP  L++ D   +G+V ACKSACA FN+PE+CCTG 
Sbjct  139  ITPQGGDGSGDCHYAGCVADINEICPNELRIMDPYNNGNVAACKSACAAFNSPEFCCTGA  198

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            H T  TCSPTQYS +FKNACP AYSYAYDD +S FTC+GS+YLITFCP
Sbjct  199  HATPDTCSPTQYSTMFKNACPSAYSYAYDDATSIFTCSGSNYLITFCP  246



>ref|XP_010471604.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=240

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 178/221 (81%), Gaps = 3/221 (1%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FT+ N C  TVW GTL+G G   LGEGGF L+PG S +L APAGWSGRFWARTGC 
Sbjct  22   SATVFTIKNNCPSTVWAGTLAGRG-PKLGEGGFELTPGASRQLNAPAGWSGRFWARTGCR  80

Query  668  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            FD +GNG CVTGDCGGL+C GGGVPPV+LAEFT+  G+  KDFYDVSLVDGYNV LGIRP
Sbjct  81   FDGAGNGRCVTGDCGGLRCIGGGVPPVSLAEFTLV-GDGGKDFYDVSLVDGYNVKLGIRP  139

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            SGGSGDC+YAGCVADLN  CP  L+V     +VVACKSACAQFNT +YCC G +NT  TC
Sbjct  140  SGGSGDCKYAGCVADLNARCPNELKVLGPQNNVVACKSACAQFNTDQYCCRGAYNTPQTC  199

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT YSRIFK+ACP AYSYAYDD++STFTC G++Y +TFCP
Sbjct  200  PPTNYSRIFKSACPDAYSYAYDDETSTFTCTGANYEVTFCP  240



>ref|XP_006301180.1| hypothetical protein CARUB_v10021579mg [Capsella rubella]
 gb|EOA34078.1| hypothetical protein CARUB_v10021579mg [Capsella rubella]
Length=247

 Score =   291 bits (744),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 181/223 (81%), Gaps = 5/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YTVWPG LSGN    LG+GGF L+PG SV+L APAGWSGRFWARTGCN
Sbjct  24   SATVFTLQNSCPYTVWPGILSGNDNT-LGDGGFPLTPGASVQLTAPAGWSGRFWARTGCN  82

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FDASG+GNCVTGDCGG+    GGGVPPVTLAEFT+  G+  KDFYDVSLVDGYNV++GI+
Sbjct  83   FDASGHGNCVTGDCGGVLKCNGGGVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMGIK  141

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GGSGDC YAGCVAD+N  CP  L++ D  +G + ACKSACA FN+ E+CCTG H T  
Sbjct  142  PQGGSGDCHYAGCVADVNAVCPNELRIMDPHTGIIAACKSACAAFNSEEFCCTGAHATPQ  201

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT YS +FK+ACP AYSYAYDD +STFTC+ S+YLI+FCP
Sbjct  202  TCSPTHYSAMFKSACPGAYSYAYDDATSTFTCSRSNYLISFCP  244



>gb|KFK41942.1| hypothetical protein AALP_AA2G192200 [Arabis alpina]
Length=240

 Score =   290 bits (742),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 178/222 (80%), Gaps = 7/222 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YT+WPG L+GNGG  +GEG   L+ G+SV+L+AP GWSGRFWARTGC 
Sbjct  23   SATEFTLQNSCPYTIWPGILTGNGGNPIGEGT-PLNTGDSVQLRAPPGWSGRFWARTGCT  81

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FDASG+GNCVTGDCGG++   G G PPVTLAEFT+     DKDFYDVSLVDGYNV LGI+
Sbjct  82   FDASGHGNCVTGDCGGVQKCTGTGAPPVTLAEFTVG----DKDFYDVSLVDGYNVKLGIK  137

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
            P GG GDC+YAGCVADLNTNCP  L+V D   +V ACKSACA FN  EYCC+G H T  T
Sbjct  138  PQGGFGDCKYAGCVADLNTNCPNELRVMDPHNNVAACKSACAAFNKEEYCCSGAHATPQT  197

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            CSPT YS IFK ACP AYSYAYDD++STFTCAG++YLITFCP
Sbjct  198  CSPTNYSVIFKKACPDAYSYAYDDETSTFTCAGANYLITFCP  239



>ref|XP_010471608.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=247

 Score =   290 bits (741),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 180/223 (81%), Gaps = 5/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N+C YTVWPG LSGN    LG+GGF L+PG SV+L APAGWSGRFWARTGCN
Sbjct  24   SATVFTLQNSCPYTVWPGILSGNDNT-LGDGGFPLTPGASVQLTAPAGWSGRFWARTGCN  82

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FDASG+GNC TGDCGG+    GGG PPVTLAEFT+  G+  KDFYDVSLVDGYNV++GI+
Sbjct  83   FDASGHGNCETGDCGGVLKCNGGGFPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVEMGIK  141

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P GGSGDC YAGCVAD+N  CP  L++ D  +G + ACKSACA FN+ E+CCTG H T  
Sbjct  142  PQGGSGDCHYAGCVADVNAVCPNELRIMDPHTGIIAACKSACAAFNSEEFCCTGAHATPQ  201

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT YS +FK+ACP AYSYAYDD +STFTC+GS+YLI+FCP
Sbjct  202  TCSPTHYSAMFKSACPGAYSYAYDDATSTFTCSGSNYLISFCP  244



>ref|XP_009117552.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Brassica 
rapa]
 emb|CDY21672.1| BnaA09g44230D [Brassica napus]
Length=246

 Score =   289 bits (740),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 168/228 (74%), Gaps = 3/228 (1%)
 Frame = -1

Query  866  GITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFW  687
            G  +V +   FT+ N+C++ VWPG L+GNGGA L +GGF L+PG SV + APAGWSGR W
Sbjct  19   GAVSVVSGTVFTIQNSCSFPVWPGILTGNGGAQLNDGGFTLNPGASVAVTAPAGWSGRIW  78

Query  686  ARTGCNFDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
             RTGCNFD SG G C+TG         G GGVPPVTLAEFTI NG A KDFYDVSLVDGY
Sbjct  79   GRTGCNFDGSGAGRCLTGDCGNKLKCAGAGGVPPVTLAEFTIGNGGA-KDFYDVSLVDGY  137

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            NV +G+   GGSGDCQ  GCVADLN  CP  L+V +  +VVACKSAC  F  PEYCCTG 
Sbjct  138  NVQMGVTTRGGSGDCQNIGCVADLNGRCPNELRVMNGANVVACKSACEAFGKPEYCCTGA  197

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             +T ATC PT YSRIFK ACPKAYSYAYDD SSTFTCA ++Y I FCP
Sbjct  198  FSTSATCPPTNYSRIFKGACPKAYSYAYDDASSTFTCANANYSIVFCP  245



>gb|KFK41944.1| hypothetical protein AALP_AA2G192400 [Arabis alpina]
Length=246

 Score =   289 bits (740),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 179/220 (81%), Gaps = 6/220 (3%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N+C YTVWPG LSGN    LG+GGF L+ G SV+L AP GWSGRFWARTGCNFD++
Sbjct  26   FTLQNSCPYTVWPGILSGNSNT-LGDGGFPLTQGASVQLTAPQGWSGRFWARTGCNFDST  84

Query  656  GNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSGG  480
            G+GNCVTGDCGG+    GGGVPP TLAEFT+  G++ KDFYDVSLVDGYNV++GI+P GG
Sbjct  85   GHGNCVTGDCGGVLNCIGGGVPPTTLAEFTV-QGDSGKDFYDVSLVDGYNVEMGIKPQGG  143

Query  479  SGDCQYAGCVADLNTNCPEVLQVTD---SGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGDC+YAGCVAD+N  CP  L++ D   +G V ACKSAC  FN+PE+CCT DH T  TCS
Sbjct  144  SGDCRYAGCVADVNAVCPNELRIMDPNNNGVVAACKSACLAFNSPEFCCTEDHATPQTCS  203

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            PT YS +FK+ACP AYSYAYDD +STFTC+GS+YLITFCP
Sbjct  204  PTHYSAMFKSACPSAYSYAYDDATSTFTCSGSNYLITFCP  243



>ref|XP_009117553.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Brassica 
rapa]
Length=244

 Score =   289 bits (739),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 164/218 (75%), Gaps = 3/218 (1%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FT+ N+C++ VWPG L+GNGGA L +GGF L+PG SV + APAGWSGR W RTGCNFD S
Sbjct  27   FTIQNSCSFPVWPGILTGNGGAQLNDGGFTLNPGASVAVTAPAGWSGRIWGRTGCNFDGS  86

Query  656  GNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSG  483
            G G C+TG         G GGVPPVTLAEFTI NG A KDFYDVSLVDGYNV +G+   G
Sbjct  87   GAGRCLTGDCGNKLKCAGAGGVPPVTLAEFTIGNGGA-KDFYDVSLVDGYNVQMGVTTRG  145

Query  482  GSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPT  303
            GSGDCQ  GCVADLN  CP  L+V +  +VVACKSAC  F  PEYCCTG  +T ATC PT
Sbjct  146  GSGDCQNIGCVADLNGRCPNELRVMNGANVVACKSACEAFGKPEYCCTGAFSTSATCPPT  205

Query  302  QYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             YSRIFK ACPKAYSYAYDD SSTFTCA ++Y I FCP
Sbjct  206  NYSRIFKGACPKAYSYAYDDASSTFTCANANYSIVFCP  243



>ref|XP_010416364.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=240

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 178/221 (81%), Gaps = 3/221 (1%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FT+ N C  TVW G+L+G G   LGEGGF L+PG S +L APAGWSGRFWARTGC 
Sbjct  22   SATVFTIRNNCPSTVWAGSLAGRG-PKLGEGGFELTPGASRQLNAPAGWSGRFWARTGCR  80

Query  668  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            FD +GNG CVTGDCGGL+C GGGVPPV+LAEFT+  G+  KDFYDVSLVDGYNV LGIRP
Sbjct  81   FDGAGNGRCVTGDCGGLRCNGGGVPPVSLAEFTLV-GDGGKDFYDVSLVDGYNVKLGIRP  139

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            SGGSG+C+YAGCVADLN  CP  L+V     +VVACKSACAQFNT +YCC G +NT  TC
Sbjct  140  SGGSGNCKYAGCVADLNARCPNELKVLGPQNNVVACKSACAQFNTDQYCCRGAYNTPQTC  199

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT YSRIFK+ACP AYSYAYDD++STFTC G++Y +TFCP
Sbjct  200  PPTNYSRIFKSACPDAYSYAYDDETSTFTCTGANYEVTFCP  240



>ref|XP_006302689.1| hypothetical protein CARUB_v10020799mg [Capsella rubella]
 gb|EOA35587.1| hypothetical protein CARUB_v10020799mg [Capsella rubella]
Length=267

 Score =   289 bits (739),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 178/221 (81%), Gaps = 3/221 (1%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FT+ N C  TVW GTL+G G   LG+GGF L+PG S +L APAGWSGRFWARTGC+
Sbjct  49   SATVFTIKNNCPTTVWAGTLAGRG-PKLGDGGFQLTPGASRQLTAPAGWSGRFWARTGCS  107

Query  668  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            FD +GNG CVTGDCGGL+C GGGVPPV+LAEFT+  G+  KDFYDVSLVDGYNV +GIRP
Sbjct  108  FDGAGNGRCVTGDCGGLRCSGGGVPPVSLAEFTLV-GDGGKDFYDVSLVDGYNVKIGIRP  166

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            SGGSGDC+YAGCVADLN NCP  L+V     +VVACKSACA+FNT +YCC G  NT  TC
Sbjct  167  SGGSGDCRYAGCVADLNANCPNDLKVMGPQNNVVACKSACARFNTDQYCCRGAFNTPKTC  226

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT YSRIFKNACP AYSYAYDD++STFTC G++Y + FCP
Sbjct  227  PPTDYSRIFKNACPDAYSYAYDDETSTFTCTGANYEVAFCP  267



>ref|XP_010428509.1| PREDICTED: pathogenesis-related protein 5 [Camelina sativa]
Length=240

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 155/221 (70%), Positives = 180/221 (81%), Gaps = 3/221 (1%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FT+ N C  TVW GTL+G G   LG+GGF L+PG S +L APAGWSGRFWARTGC+
Sbjct  22   SATVFTIKNNCPTTVWAGTLAGKG-PKLGDGGFELTPGASRQLTAPAGWSGRFWARTGCS  80

Query  668  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            FD +GNG CVTGDCGGL+C GGGVPPV+LAEFT+  G+  KDFYDVSLVDGYNV LGIRP
Sbjct  81   FDGAGNGRCVTGDCGGLRCNGGGVPPVSLAEFTLV-GDGGKDFYDVSLVDGYNVKLGIRP  139

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGS-VVACKSACAQFNTPEYCCTGDHNTHATC  312
            SGGSGDC+YAGCVADLN NCP  L+V   G+ VVACKSACA FNT +YCC G ++T  TC
Sbjct  140  SGGSGDCKYAGCVADLNANCPNELKVMGPGNNVVACKSACAHFNTDQYCCRGAYSTPQTC  199

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT +SRIFK ACP AYSYAYDD++STFTC+G++Y +TFCP
Sbjct  200  PPTDFSRIFKRACPDAYSYAYDDETSTFTCSGANYEVTFCP  240



>ref|XP_010529666.1| PREDICTED: pathogenesis-related protein 5-like [Tarenaya hassleriana]
Length=242

 Score =   287 bits (734),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 179/223 (80%), Gaps = 5/223 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FT+ N+C +TVWPG LSGNG A LG+GGF L PG SV+L A  GWSGRFWARTGCN
Sbjct  19   SATVFTIENSCRFTVWPGVLSGNG-ATLGDGGFPLPPGSSVKLTAHPGWSGRFWARTGCN  77

Query  668  FDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            FD+ G+GNC+TGDCGG+    GGG PPVTLAEFT+  G + KDFYDVSLVDGYNV++GIR
Sbjct  78   FDSYGHGNCLTGDCGGVLNCIGGGAPPVTLAEFTLV-GASGKDFYDVSLVDGYNVEMGIR  136

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHA  318
              GGSGDCQYAGCV+D+N  CP  L+V D  +G V ACKSAC  FN+PE+CCTGDH T  
Sbjct  137  ALGGSGDCQYAGCVSDVNAICPSELRVVDPGTGDVAACKSACLAFNSPEFCCTGDHATPE  196

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TCSPT++S +FKNACP AYSYAYDD SST TC GSDYLITFCP
Sbjct  197  TCSPTKFSGMFKNACPSAYSYAYDDASSTCTCTGSDYLITFCP  239



>ref|XP_010530276.1| PREDICTED: pathogenesis-related protein 5-like [Tarenaya hassleriana]
Length=246

 Score =   287 bits (734),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 174/220 (79%), Gaps = 5/220 (2%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C+YT+WPG LSGNG A  G+GGFAL P  SV+  AP GWSGRFWARTGCNFD S
Sbjct  25   FTLENRCSYTIWPGILSGNGAA-FGDGGFALPPAASVQFPAPPGWSGRFWARTGCNFDGS  83

Query  656  -GNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSG  483
             G G C+TGDCGG     GGG+PPV+LAEFTIA+   +KDFYDVSLVDGYNV +GIRP  
Sbjct  84   TGTGRCLTGDCGGTLKCSGGGIPPVSLAEFTIASSPGEKDFYDVSLVDGYNVGIGIRPIS  143

Query  482  GSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            G GDC+++GCVADLN NCP  L+V D  +G VVACKSAC+   +PE+CCTGDH T  TC 
Sbjct  144  GVGDCRFSGCVADLNGNCPAELRVVDPSTGLVVACKSACSAXESPEFCCTGDHATPETCP  203

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            PTQ+S IFK ACP AYSYAYDD +STFTC+GSDYLI+FCP
Sbjct  204  PTQFSAIFKAACPGAYSYAYDDATSTFTCSGSDYLISFCP  243



>dbj|BAD90814.1| thaumatin-like protein [Cryptomeria japonica]
Length=240

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 171/220 (78%), Gaps = 6/220 (3%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C+YTVWPGTLSG+G + LGEGGF L+PG+SV L A + WSGRFW RT C+FDAS
Sbjct  25   FTLVNKCSYTVWPGTLSGSGSSVLGEGGFTLAPGQSVPLTASSRWSGRFWGRTDCSFDAS  84

Query  656  GNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSG  483
            G G+C+TGD          GG PPV+LAEFT+     DKDFYDVSLVDGYNV L I   G
Sbjct  85   GKGSCITGDCGNVLNCAQAGGTPPVSLAEFTLG----DKDFYDVSLVDGYNVPLSIAAVG  140

Query  482  GSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPT  303
            G+GDC+ AGCV+DL T+CP  L VT +G V+ACKSACA F+TPEYCCTGDH +  TCSP+
Sbjct  141  GTGDCRTAGCVSDLRTSCPAELSVTSNGQVIACKSACAAFSTPEYCCTGDHGSPQTCSPS  200

Query  302  QYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            +YS++FK+ACP AYSYAYDD +STFTC+ +DY ITFCP S
Sbjct  201  KYSQVFKSACPTAYSYAYDDATSTFTCSNADYTITFCPSS  240



>ref|XP_004499121.1| PREDICTED: pathogenesis-related protein 5-like [Cicer arietinum]
Length=251

 Score =   283 bits (723),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 171/220 (78%), Gaps = 4/220 (2%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FT+ N C+YT+WPGTLSGNG A LG+GGF L PG S+ L APAGWSGRFWARTGC FD +
Sbjct  28   FTIQNQCSYTIWPGTLSGNGAAVLGQGGFVLPPGASINLNAPAGWSGRFWARTGCKFDDA  87

Query  656  GNGNCVTgd-cgglkcgggGVPPVTLAEFTIANG-NADKDFYDVSLVDGYNVDLGIRPSG  483
            G G C+TGD  GGL C GGG PPVTLAEFTI +  N  KDFYDVSLVDGYNV +G+  +G
Sbjct  88   GTGKCLTGDCPGGLNCNGGGTPPVTLAEFTIGSADNGGKDFYDVSLVDGYNVGMGVWATG  147

Query  482  GSGDCQYAGCVADLNTNCPEVLQVTD--SGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            G+GDCQYAGC+ADLN  CP  L++ D  SG+VVACKSAC  FNT  +CCTG H+T   CS
Sbjct  148  GTGDCQYAGCIADLNRVCPTELRINDGGSGAVVACKSACLAFNTEVFCCTGKHSTPDRCS  207

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             T YS IFK ACP AYSYAYDD SST TC+GSDY ITFCP
Sbjct  208  ATHYSEIFKKACPTAYSYAYDDASSTCTCSGSDYRITFCP  247



>ref|XP_006390359.1| hypothetical protein EUTSA_v10019053mg [Eutrema salsugineum]
 gb|ESQ27645.1| hypothetical protein EUTSA_v10019053mg [Eutrema salsugineum]
Length=243

 Score =   282 bits (722),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 167/223 (75%), Gaps = 7/223 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FTL N C YTVWPG L+GNGG  LG+GG  L+   SV+L AP GW+GRFWARTGC 
Sbjct  22   SATVFTLENLCPYTVWPGILTGNGGKALGDGGLELATDASVQLTAPPGWTGRFWARTGCK  81

Query  668  FDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FD++G+G CVTG         G GGVPPVTLAEFT+      KDFYDVSLVDGYNV +GI
Sbjct  82   FDSTGHGICVTGDCGGVLKCAGAGGVPPVTLAEFTVGG----KDFYDVSLVDGYNVKMGI  137

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDS-GSVVACKSACAQFNTPEYCCTGDHNTHA  318
            +P GGSGDC+YAGCVADLN  CPE L+V D   +V ACKSACA FN  EYCC+G H+T  
Sbjct  138  KPQGGSGDCRYAGCVADLNAICPEELRVKDQQNNVAACKSACAAFNKEEYCCSGAHSTPE  197

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TC+PT YS  FK ACP AYSYAYDD +STFTC+G+ YLITFCP
Sbjct  198  TCAPTNYSMTFKKACPSAYSYAYDDATSTFTCSGASYLITFCP  240



>ref|XP_010471607.1| PREDICTED: pathogenesis-related protein 5 [Camelina sativa]
Length=240

 Score =   281 bits (720),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 176/221 (80%), Gaps = 3/221 (1%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FT+ N C  TVW GTL+G G   LG+GGF L+PG S +L APAGWSGRFWARTGC+
Sbjct  22   SATVFTIKNNCPTTVWAGTLAGQG-PKLGDGGFELTPGASRQLTAPAGWSGRFWARTGCS  80

Query  668  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            FD +GNG CVTGDCGGL+C GGGVPPV+LAEFT+  G+  KDFYDVSLVDGYNV LGIRP
Sbjct  81   FDGAGNGRCVTGDCGGLRCIGGGVPPVSLAEFTLV-GDGGKDFYDVSLVDGYNVKLGIRP  139

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            SGGSGDC+YAGCVADLN NCP  L+V     +VVACKSAC  F T +YCC G ++T  TC
Sbjct  140  SGGSGDCKYAGCVADLNANCPNELKVMGPDNNVVACKSACEAFKTDQYCCRGAYSTPQTC  199

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT +SRIFK ACP AYSYAYDD++STFTC G++Y +TFCP
Sbjct  200  PPTDFSRIFKRACPDAYSYAYDDETSTFTCTGANYEVTFCP  240



>gb|KFK44066.1| hypothetical protein AALP_AA1G211800 [Arabis alpina]
Length=244

 Score =   281 bits (719),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 168/228 (74%), Gaps = 4/228 (2%)
 Frame = -1

Query  866  GITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFW  687
            G  +V +   FT+ N+C++TVWPG L+GNG A L +GGF L+PG SV +  PAGWSGR W
Sbjct  19   GTISVVSGAVFTIRNSCSFTVWPGILTGNG-AQLSDGGFTLAPGASVTVTPPAGWSGRIW  77

Query  686  ARTGCNFDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
             RTGCNFD SG G+C TG         G GG PP TLAEFTI NG A+ DFYDVSLVDGY
Sbjct  78   GRTGCNFDGSGAGSCQTGDCGNKLKCNGAGGAPPATLAEFTIGNGGAN-DFYDVSLVDGY  136

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            NV +GI  SGGSG+CQ  GC +DLN NCP  L+V+ SG+VVACKSAC  F  PEYCCTG 
Sbjct  137  NVKMGITTSGGSGNCQNVGCTSDLNANCPNDLRVSASGNVVACKSACEAFGKPEYCCTGA  196

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             NT  TC PT YSRIFK+ACPKAYSYAYDD SSTFTCA ++Y I FCP
Sbjct  197  FNTPQTCPPTDYSRIFKSACPKAYSYAYDDASSTFTCANANYAIVFCP  244



>emb|CDY41037.1| BnaC05g14950D [Brassica napus]
Length=246

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/230 (64%), Positives = 168/230 (73%), Gaps = 4/230 (2%)
 Frame = -1

Query  866  GITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFW  687
            G  +V +   FT+ N+C++ VWPG L+GNG A L +GGF L+PG SV+L APAGWSGR W
Sbjct  19   GTLSVVSGTVFTIVNSCSFNVWPGVLTGNG-AQLNDGGFLLTPGASVDLTAPAGWSGRIW  77

Query  686  ARTGCNFDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
             RTGCNFD SG G C+TG         G GGVPPVTLAEFTI NG   +DFYDVSLVDGY
Sbjct  78   GRTGCNFDGSGAGRCLTGDCGNKLKCAGAGGVPPVTLAEFTIGNGGG-QDFYDVSLVDGY  136

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            NV +GI    GSGDCQ  GCV+DLN +CP  L+V D G+VVACKSACA FN PEYCCTG 
Sbjct  137  NVQMGITTRDGSGDCQNVGCVSDLNGSCPNELRVMDGGNVVACKSACAAFNKPEYCCTGA  196

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
             +   TC PT YSRIFK ACPKAYSYAYDD SSTFTC  ++Y + FCP S
Sbjct  197  FDKPETCPPTDYSRIFKAACPKAYSYAYDDASSTFTCTNANYSVVFCPKS  246



>ref|XP_010416366.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=240

 Score =   280 bits (715),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 176/221 (80%), Gaps = 3/221 (1%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A  FT+ N C  TVW GTL+G G   LG+GGF L+PG S +L APAGWSGRFWARTGC+
Sbjct  22   SATVFTIKNNCPTTVWAGTLAGQG-PKLGDGGFELTPGASRQLTAPAGWSGRFWARTGCS  80

Query  668  FDASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            FD +GNG CVTGDCGGL+C GGGVPPV+LAEFT+  G+  KDFYDVSLVDGYNV LGIRP
Sbjct  81   FDGAGNGRCVTGDCGGLRCNGGGVPPVSLAEFTLV-GDGGKDFYDVSLVDGYNVKLGIRP  139

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            SGGSGDC+YAGCVADLN NCP  L+V     +VVACK+AC  F T +YCC G ++T  TC
Sbjct  140  SGGSGDCKYAGCVADLNANCPNELKVMGPQNNVVACKNACEAFKTDQYCCRGAYSTPQTC  199

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT +SRIFK ACP AYSYAYDD++STFTC G++Y +TFCP
Sbjct  200  LPTDFSRIFKRACPDAYSYAYDDETSTFTCTGANYEVTFCP  240



>ref|XP_006416518.1| hypothetical protein EUTSA_v10008604mg [Eutrema salsugineum]
 gb|ESQ34871.1| hypothetical protein EUTSA_v10008604mg [Eutrema salsugineum]
Length=245

 Score =   280 bits (715),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 169/228 (74%), Gaps = 4/228 (2%)
 Frame = -1

Query  866  GITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFW  687
            G  +V +   FT+ N+C++TVWPG L+GNG A L +GGFAL+PG SV++ APAGWSGRFW
Sbjct  19   GTISVVSGTVFTIVNSCSFTVWPGILTGNG-AQLMDGGFALNPGASVDVTAPAGWSGRFW  77

Query  686  ARTGCNFDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
             RTGCNFD+SG G+C+TG         G GG PP TLAEFTI   N   DFYDVSLVDGY
Sbjct  78   GRTGCNFDSSGAGSCITGDCGNKLKCGGAGGAPPATLAEFTIGT-NGGNDFYDVSLVDGY  136

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            NV + I   GGSGDCQ  GCV+DLN NCP  L+V+D+G+VVACKSAC  FN PE+CCTG 
Sbjct  137  NVQMEITTGGGSGDCQNVGCVSDLNANCPNDLRVSDAGNVVACKSACEAFNKPEFCCTGS  196

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
                 TC PT YSRIFK ACPKAYSYAYDD SSTFTCA ++Y I FCP
Sbjct  197  FGKPETCPPTDYSRIFKGACPKAYSYAYDDASSTFTCANANYSIIFCP  244



>ref|XP_009149407.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=246

 Score =   280 bits (715),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 147/230 (64%), Positives = 168/230 (73%), Gaps = 4/230 (2%)
 Frame = -1

Query  866  GITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFW  687
            G  +V +   FT+ N+C++ VWPG L+GNG A L +GGF L+PG SV+L APAGWSGR W
Sbjct  19   GTLSVVSGTVFTIVNSCSFNVWPGVLTGNG-AQLNDGGFLLTPGASVDLTAPAGWSGRIW  77

Query  686  ARTGCNFDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
             RTGCNFD SG G C+TG         G GGVPPVTLAEFTI NG   +DFYDVSLVDGY
Sbjct  78   GRTGCNFDGSGAGRCLTGDCGNKLKCAGAGGVPPVTLAEFTIGNGGG-QDFYDVSLVDGY  136

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            NV +GI    GSGDCQ  GCV+DLN +CP  L+V D G+VVACKSACA FN PEYCCTG 
Sbjct  137  NVQMGITTRDGSGDCQNVGCVSDLNGSCPNELRVMDGGNVVACKSACAAFNKPEYCCTGA  196

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
             +   TC PT YSRIFK ACPKAYSYAYDD SSTFTC  ++Y + FCP S
Sbjct  197  FDKPETCPPTDYSRIFKAACPKAYSYAYDDASSTFTCTNANYSVVFCPRS  246



>ref|XP_009104727.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=242

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 170/226 (75%), Gaps = 8/226 (4%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQA--PAGWSGRFWARTG  675
            +A  FTL N+C YTVWP T +G G + LGEGGF L PG SV+L      GWSGRFW RTG
Sbjct  19   SATVFTLKNSCPYTVWPATFAGKG-STLGEGGFQLDPGASVQLTLTNEPGWSGRFWGRTG  77

Query  674  CNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            CNFD+SG+GNC TGDCG        G  P TLAEFTI  G++  DFYD+SLVDGYNV +G
Sbjct  78   CNFDSSGHGNCATGDCGNSLKCTVTGATPSTLAEFTI-QGDSGNDFYDLSLVDGYNVKMG  136

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTD---SGSVVACKSACAQFNTPEYCCTGDHN  327
            I+P GGSG+C+Y GCVADLN +CPE L+V D    G+VV CKSACA FNT E+CC G HN
Sbjct  137  IKPEGGSGECKYTGCVADLNADCPEQLRVMDPNNGGNVVGCKSACAAFNTDEFCCKGAHN  196

Query  326  THATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            T  TCSPT YSR FKNACP AYSYAYDD SSTFTCAG++Y+ITFCP
Sbjct  197  TSQTCSPTDYSRKFKNACPTAYSYAYDDASSTFTCAGANYVITFCP  242



>emb|CDX68151.1| BnaA07g21910D [Brassica napus]
Length=242

 Score =   274 bits (701),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 170/226 (75%), Gaps = 8/226 (4%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQA--PAGWSGRFWARTG  675
            +A  FTL N+C YTVWP T +G G + LGEGGF L PG SV+L      GWSGRFW RTG
Sbjct  19   SATVFTLKNSCPYTVWPATFAGKG-STLGEGGFQLDPGASVQLTLTNEPGWSGRFWGRTG  77

Query  674  CNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            CNFD+SG+GNC TGDCG        G  P TLAEFTI  G++  DFYD+SLVDGYNV +G
Sbjct  78   CNFDSSGHGNCATGDCGNSLKCTVTGATPSTLAEFTI-QGHSGNDFYDLSLVDGYNVKMG  136

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTD---SGSVVACKSACAQFNTPEYCCTGDHN  327
            I+P GGSG+C+  GCVADLN +CPE L+V D   SG+VV CKSACA FNT E+CC G H+
Sbjct  137  IKPEGGSGECKNTGCVADLNADCPEQLRVMDPNNSGNVVGCKSACAAFNTDEFCCKGAHS  196

Query  326  THATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            T  TCSPT YSR FKNACP AYSYAYDD SSTFTCAG++Y+ITFCP
Sbjct  197  TSQTCSPTDYSRKFKNACPTAYSYAYDDASSTFTCAGANYVITFCP  242



>gb|KFK41943.1| hypothetical protein AALP_AA2G192300 [Arabis alpina]
Length=240

 Score =   273 bits (699),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 172/223 (77%), Gaps = 7/223 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQ--APAGWSGRFWARTG  675
            +A  FTL N+C YTVWPGT S    ++  EGG  L+ G SV+L   +P GW+GRFWARTG
Sbjct  22   SATVFTLQNSCPYTVWPGTFSD---SNKLEGGLELTSGASVQLTLTSPPGWTGRFWARTG  78

Query  674  CNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            CNFD+SGNGNCVTG+CGG     G GVPPVTLAEFTI  G+  KDFYDVSLVDG+NV LG
Sbjct  79   CNFDSSGNGNCVTGNCGGGLKCTGTGVPPVTLAEFTI-QGDGGKDFYDVSLVDGFNVKLG  137

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            I+P GGSG+C+ A CVAD+N  CP+ L+V D+G+VVACKSAC  FNT EYCCTG H    
Sbjct  138  IKPQGGSGECKDAACVADVNAVCPDQLKVNDNGNVVACKSACVAFNTEEYCCTGAHERRG  197

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TC P+ +S +FKNACP AYSYA+DD SSTFTC G++YLITFCP
Sbjct  198  TCFPSNFSMVFKNACPNAYSYAHDDPSSTFTCTGANYLITFCP  240



>ref|XP_010026231.1| PREDICTED: pathogenesis-related protein 5 [Eucalyptus grandis]
 gb|KCW88067.1| hypothetical protein EUGRSUZ_A00487 [Eucalyptus grandis]
Length=248

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 173/228 (76%), Gaps = 5/228 (2%)
 Frame = -1

Query  863  ITNVWAAGS-FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFW  687
            I NV A+ +  TL N C YTVWPGTLSGNG    G G F+L PG SV+LQAPAGWSGRFW
Sbjct  18   IGNVLASATVITLQNQCGYTVWPGTLSGNGPTLGGGG-FSLPPGGSVQLQAPAGWSGRFW  76

Query  686  ARTGCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNAD-KDFYDVSLVDGY  513
             RTGC+FD SG G CVTGDC G     GGG PP TL EFT+A  NA   DFYDVSLVDGY
Sbjct  77   GRTGCSFDGSGAGTCVTGDCPGGLKCTGGGAPPATLVEFTVAAPNAGGMDFYDVSLVDGY  136

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTG  336
            NV + +R +GG+G+CQYAGC+ D+N NCP  L+V D SG VVACKSAC QF TPEYCCTG
Sbjct  137  NVGMAVRATGGTGNCQYAGCLLDVNANCPAELRVVDGSGRVVACKSACEQFKTPEYCCTG  196

Query  335  DHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            DH T  TC P+ YS+IFK+ACP AYSYAYDD +ST TC G+DYLITFC
Sbjct  197  DHGTPQTCGPSSYSKIFKSACPTAYSYAYDDATSTCTCTGADYLITFC  244



>emb|CDX83773.1| BnaC08g18720D [Brassica napus]
Length=247

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 162/228 (71%), Gaps = 3/228 (1%)
 Frame = -1

Query  866  GITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFW  687
            G  +V +   FT+ N C++ VWPG L+G+ G  L  GGFAL  G SV++ APAGWSGR W
Sbjct  19   GAISVVSGTVFTIVNRCSFPVWPGILTGDNGVQLNGGGFALKTGASVDVAAPAGWSGRIW  78

Query  686  ARTGCNFDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
             RTGCNFDA G G+C+TG         G GGVPP TLAEFTI +G A  DFYDVSLVDGY
Sbjct  79   GRTGCNFDAFGTGSCLTGDCGNKLQCSGAGGVPPATLAEFTIGHGGA-MDFYDVSLVDGY  137

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            NV + I+  GGSGDCQ  GCV+DLN  CP  L V + GSVVACKSAC  F +P+YCCTG 
Sbjct  138  NVQMEIKTRGGSGDCQNVGCVSDLNKICPNELSVLNGGSVVACKSACEAFGSPQYCCTGA  197

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             N   TC PT YSRIFK ACPKAYSYAYDD +STFTCA ++Y I FCP
Sbjct  198  FNKAETCPPTDYSRIFKAACPKAYSYAYDDATSTFTCANANYSIIFCP  245



>ref|XP_009106161.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=245

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 162/220 (74%), Gaps = 4/220 (2%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            F L N+C YTVWPG LSGN    LG+GG  L+PG SV+L AP GWSGRFWARTGC+FD S
Sbjct  23   FVLENSCPYTVWPGILSGNSTTTLGDGGVPLTPGASVQLTAPPGWSGRFWARTGCSFDPS  82

Query  656  GNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSGG  480
              G+CVTGDCGG+     G  PP  LAEFT+ +GN+D D Y VSLVDGYNV +GI P GG
Sbjct  83   SRGSCVTGDCGGILNCNRGRFPPAILAEFTVGSGNSDTDIYGVSLVDGYNVKMGIEPLGG  142

Query  479  SGDCQYAGCVADLNTNCPEVLQVTD---SGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GDC YAGC+AD+N  CP  L++ D    G V AC SACA F+ PE+CCTG H T  TC 
Sbjct  143  TGDCHYAGCLADVNEICPGDLRIMDPNVDGVVAACMSACAAFDLPEFCCTGAHATLQTCD  202

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            P++YS +FKNACP AYSYAY D +S FTC+ S+YLITFCP
Sbjct  203  PSRYSMVFKNACPSAYSYAYGDATSIFTCSRSNYLITFCP  242



>ref|XP_008790236.1| PREDICTED: pathogenesis-related protein 5 [Phoenix dactylifera]
Length=243

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 166/222 (75%), Gaps = 6/222 (3%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C YTVWPGTLSGNG A LG GGF L P  +V L AP GWSGRFWART C F  S
Sbjct  18   FTLQNKCPYTVWPGTLSGNGAAVLGGGGFELPPNAAVSLTAPPGWSGRFWARTACVFPPS  77

Query  656  G-NGNCVTgdcgglkc-gggGVPPVTLAEFTIANGN--ADKDFYDVSLVDGYNVDLGIRP  489
            G +G+C TGDCGG     GGG PPVTLAEFT+A G   A KDFYDVSLVDGYNV +G+RP
Sbjct  78   GVSGSCATGDCGGALRCSGGGAPPVTLAEFTLAGGGNGATKDFYDVSLVDGYNVGMGLRP  137

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDS-GSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            +  S  CQYAGCVADLN  CP  L+V  + G  VAC+SAC  F  PEYCCTGDH + +TC
Sbjct  138  TPASSSCQYAGCVADLNGRCPAELRVAGAAGETVACRSACEAFGGPEYCCTGDHGSPSTC  197

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSD-YLITFCP  189
             PT+YS++FK ACP AYSYAYDD +STFTC+ +D YLITFCP
Sbjct  198  GPTRYSQLFKAACPAAYSYAYDDATSTFTCSAADGYLITFCP  239



>emb|CDX83771.1| BnaC08g18740D [Brassica napus]
Length=247

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 160/218 (73%), Gaps = 3/218 (1%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FT+ N C++ VWPG L+G+ G  L  GGFAL+PG SV++ APAGWSGR W RTGCNFDA 
Sbjct  29   FTIVNRCSFPVWPGILTGDNGVQLNGGGFALTPGASVDVAAPAGWSGRIWGRTGCNFDAF  88

Query  656  GNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSG  483
            G+G+C+TG         G GGV P TLAEFTI +G A  DFYDVSLVDGYNV + I+  G
Sbjct  89   GSGSCLTGDCGNKLQCSGAGGVSPATLAEFTIGHGGA-MDFYDVSLVDGYNVQMEIKTRG  147

Query  482  GSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPT  303
            GSGDCQ  GCV+DLN  CP  L V + GSVVACKSAC  F TP+YCCTG  +   TC PT
Sbjct  148  GSGDCQNVGCVSDLNRICPNELSVPNGGSVVACKSACEAFGTPQYCCTGAFDKPETCPPT  207

Query  302  QYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             YSRIFK ACPKAYSYAYDD +STFTCA ++Y I FCP
Sbjct  208  DYSRIFKAACPKAYSYAYDDATSTFTCANANYSIIFCP  245



>ref|XP_009110282.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=247

 Score =   266 bits (681),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 162/228 (71%), Gaps = 3/228 (1%)
 Frame = -1

Query  866  GITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFW  687
            G  +V +   FT+ N C + VWPG L+G+ G  L  GGFAL+ G SV++ APAGWSGR W
Sbjct  19   GALSVVSGTVFTIVNRCNFPVWPGILTGDNGVQLNGGGFALNTGASVDVAAPAGWSGRIW  78

Query  686  ARTGCNFDASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
             RTGCNFDA G G+C+TG+        G GG PP TLAEFTI +G A  DFYDVSLVDGY
Sbjct  79   GRTGCNFDAFGTGSCLTGNCGNKVQCSGAGGAPPATLAEFTIGHGGA-MDFYDVSLVDGY  137

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            NV + I+  GGSGDCQ  GC++DLN  CP  L V + GSVVACKSAC  F +P+YCCTG 
Sbjct  138  NVQMEIKTQGGSGDCQNVGCISDLNKICPNELSVHNGGSVVACKSACEAFGSPQYCCTGA  197

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             N   TC PT YSRIFK ACPKAYSYAYDD +STFTCA ++Y I FCP
Sbjct  198  FNKPETCPPTDYSRIFKTACPKAYSYAYDDATSTFTCANANYSIIFCP  245



>ref|XP_009110283.1| PREDICTED: pathogenesis-related protein 5-like [Brassica rapa]
Length=247

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 161/228 (71%), Gaps = 3/228 (1%)
 Frame = -1

Query  866  GITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFW  687
            G  +V +   FT+ N C + VWPG L+G+ G  L  GGFAL+ G SV++ APAGWSGR W
Sbjct  19   GALSVVSGTVFTIVNRCNFPVWPGILTGDNGVQLNGGGFALNTGASVDVAAPAGWSGRIW  78

Query  686  ARTGCNFDASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
             RTGCNFDA G G+C+TG+        G GG PP TLAEFTI +G A  DFYDVSLVDGY
Sbjct  79   GRTGCNFDAFGTGSCLTGNCGNKVQCSGAGGAPPATLAEFTIGHGGA-MDFYDVSLVDGY  137

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            NV + I+  GGSGDCQ  GCV+DLN  CP  L V   GSVVACKSAC  F +P+YCCTG 
Sbjct  138  NVQMEIKTQGGSGDCQNVGCVSDLNKICPTELSVLSGGSVVACKSACEAFGSPQYCCTGA  197

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             N   TC PT YSRIFK ACPKAYSYAYDD +STFTCA ++Y I FCP
Sbjct  198  FNKPETCPPTDYSRIFKAACPKAYSYAYDDATSTFTCANANYSIIFCP  245



>ref|XP_010936134.1| PREDICTED: pathogenesis-related protein 5 [Elaeis guineensis]
Length=259

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 166/222 (75%), Gaps = 6/222 (3%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C+YTVWPGTLSGNG A LG GGF LSP  +V L AP GWSGRFWART C F  S
Sbjct  34   FTLQNKCSYTVWPGTLSGNGAAVLGGGGFELSPNAAVSLTAPPGWSGRFWARTACVFPPS  93

Query  656  G-NGNCVTgd-cgglkcgggGVPPVTLAEFTIANG--NADKDFYDVSLVDGYNVDLGIRP  489
            G +G+C TGD  G ++C  GG PPVTLAEFT+A G   A KDFYDVSLVDGYNV +G+RP
Sbjct  94   GVSGSCTTGDCGGAIRCSFGGTPPVTLAEFTLAGGGNGAAKDFYDVSLVDGYNVGMGVRP  153

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            +  S  C+YAGCVADLN  CP  L+V   +G  VAC+SAC  F  PEYCCTG H +  TC
Sbjct  154  APASSGCKYAGCVADLNGRCPAELRVAGMTGETVACRSACEAFGGPEYCCTGAHGSPGTC  213

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTC-AGSDYLITFCP  189
             PT+YS++FK ACP AYSYAYDD +STFTC A S+YLITFCP
Sbjct  214  GPTRYSQLFKAACPTAYSYAYDDATSTFTCSAASEYLITFCP  255



>ref|XP_002890328.1| hypothetical protein ARALYDRAFT_472154 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66587.1| hypothetical protein ARALYDRAFT_472154 [Arabidopsis lyrata subsp. 
lyrata]
Length=244

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 160/218 (73%), Gaps = 6/218 (3%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C+ T+WPG L+ NG   +G+GGFAL+ G SV L   AGWSGRFW RTGCNFDAS
Sbjct  28   FTLTNHCSSTIWPGILTANG-TPIGDGGFALAAGSSVTLTVSAGWSGRFWGRTGCNFDAS  86

Query  656  GNGNCVTg--dcgglkcgggGVPPVTLAEFTIANG---NADKDFYDVSLVDGYNVDLGIR  492
            G+G C TG         G GG PP TLAEFTI +    NA +DFYDVSLVDGYNV + I 
Sbjct  87   GSGKCTTGDCGGKLKCAGAGGAPPATLAEFTIGSSGKKNAVQDFYDVSLVDGYNVQMKIT  146

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            P GGSG+CQ AGCV+D+N  CP  L+VTD+  VVACKSAC  FN PEYCCTG ++T ATC
Sbjct  147  PQGGSGNCQTAGCVSDVNAICPNELRVTDAAGVVACKSACEAFNKPEYCCTGAYSTPATC  206

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLIT  198
             PT YS+IFK ACP AYSYAYDD SSTFTC  ++Y+I+
Sbjct  207  PPTNYSKIFKQACPSAYSYAYDDASSTFTCTNANYVIS  244



>ref|NP_173365.2| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
 gb|AAF79420.1|AC025808_2 F18O14.4 [Arabidopsis thaliana]
 gb|AAT41867.1| At1g19320 [Arabidopsis thaliana]
 gb|AEE29829.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
Length=247

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 158/221 (71%), Gaps = 6/221 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FTL N C  T+WPG L+ NG A LG+GGFAL+ G SV      GWSGRFWART CNFDA
Sbjct  27   TFTLTNHCGSTIWPGILTANG-AQLGDGGFALASGSSVTFTVSPGWSGRFWARTYCNFDA  85

Query  659  SGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANG---NADKDFYDVSLVDGYNVDLGI  495
            SG+G C TG         G GG PP TLAEFTI +    NA +DFYDVSLVDGYNV + I
Sbjct  86   SGSGKCGTGDCGSKLKCAGAGGAPPATLAEFTIGSSGKKNAVQDFYDVSLVDGYNVQMKI  145

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
             P GGSGDC+ AGCV+D+N  CP+ LQVT    V ACKSAC  FN PEYCCTG ++T AT
Sbjct  146  TPQGGSGDCKTAGCVSDVNAICPKELQVTGPSGVAACKSACEAFNKPEYCCTGAYSTPAT  205

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            C PT YS+IFK ACP AYSYAYDD SSTFTC  ++Y I+FC
Sbjct  206  CPPTNYSKIFKQACPSAYSYAYDDASSTFTCTNANYEISFC  246



>ref|XP_006307402.1| hypothetical protein CARUB_v10009026mg [Capsella rubella]
 gb|EOA40300.1| hypothetical protein CARUB_v10009026mg [Capsella rubella]
Length=475

 Score =   266 bits (681),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 168/217 (77%), Gaps = 3/217 (1%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C++TVW  TL+G G    G G F L+ G S +LQAPAGWSGRFWARTGC FDAS
Sbjct  261  FTLKNKCSHTVWAATLAGRGPRLGGGG-FKLTSGASQKLQAPAGWSGRFWARTGCKFDAS  319

Query  656  GNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSGGS  477
            GNG C+TGDCGGL+C GG VPPVTLAEFT+  G+  KDFYDVSLVDGYNV LGIRP GG 
Sbjct  320  GNGRCITGDCGGLRCNGGAVPPVTLAEFTLV-GDGGKDFYDVSLVDGYNVKLGIRPYGGY  378

Query  476  GDCQYAGCVADLNTNCPEVLQVT-DSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPTQ  300
            GDC+YAGC+ DLN NCP  L+V     +VVACKSACA FNT +YCC G  NT  TC PT 
Sbjct  379  GDCRYAGCITDLNANCPNELKVMGPQNNVVACKSACAVFNTDQYCCRGAFNTPETCPPTN  438

Query  299  YSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            YSRIFK ACP AYSYAYDD ++TFTC+ ++Y ITFCP
Sbjct  439  YSRIFKEACPIAYSYAYDDQTNTFTCSRANYEITFCP  475



>ref|XP_010416363.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=239

 Score =   259 bits (661),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 159/218 (73%), Gaps = 7/218 (3%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C YTVWPGTL+  G   LG+GGF L+ G S +L AP GWSGRFWARTGCNFD S
Sbjct  27   FTLQNNCPYTVWPGTLASKG-ITLGDGGFELTQGASKQLTAPDGWSGRFWARTGCNFDGS  85

Query  656  GNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSGG  480
            GNG C TGDC G     G G PPVTLAEFT+  G+A +DFYDVSLVDGYNV LGI+PS  
Sbjct  86   GNGKCDTGDCTGGLKCTGTGFPPVTLAEFTLV-GDAGQDFYDVSLVDGYNVKLGIKPST-  143

Query  479  SGDCQYAGCVADLNTNCPEVLQVT-DSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPT  303
              DC+YA C +DLN +CP+ L+VT    +VVACKSAC  F   EYCCTG H+   TC PT
Sbjct  144  --DCKYAACASDLNADCPDELKVTGQQNNVVACKSACTAFTKEEYCCTGAHDKAETCPPT  201

Query  302  QYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             YS IFK ACP AYSYAYDD +S FTC G+DY ITFCP
Sbjct  202  NYSMIFKKACPDAYSYAYDDVTSLFTCTGADYTITFCP  239



>gb|AAO64168.1| putative pathogenesis-related protein 5 precursor [Arabidopsis 
thaliana]
 dbj|BAF00496.1| putative pathogenesis-related protein 5 precursor [Arabidopsis 
thaliana]
Length=247

 Score =   259 bits (661),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 157/221 (71%), Gaps = 6/221 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FTL N C  T+WPG L+ NG A LG+GGFAL+ G SV      GWSGRFWART CNFDA
Sbjct  27   TFTLTNHCGSTIWPGILTANG-AQLGDGGFALASGSSVTFTVSPGWSGRFWARTYCNFDA  85

Query  659  SGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANG---NADKDFYDVSLVDGYNVDLGI  495
            S +G C TG         G GG PP TLAEFTI +    NA +DFYDVSLVDGYNV + I
Sbjct  86   SSSGKCGTGDCGSKLKCAGAGGAPPATLAEFTIGSSGKKNAVQDFYDVSLVDGYNVQMKI  145

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
             P GGSGDC+ AGCV+D+N  CP+ LQVT    V ACKSAC  FN PEYCCTG ++T AT
Sbjct  146  TPQGGSGDCKTAGCVSDVNAICPKELQVTGPSGVAACKSACEAFNKPEYCCTGAYSTPAT  205

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            C PT YS++FK ACP AYSYAYDD SSTFTC  ++Y I+FC
Sbjct  206  CPPTNYSKMFKQACPSAYSYAYDDASSTFTCTNANYEISFC  246



>ref|XP_006482914.1| PREDICTED: pathogenesis-related protein 5-like [Citrus sinensis]
Length=236

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 158/220 (72%), Gaps = 5/220 (2%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A  FTL N C  T+WPG L+G+G   L  GG  L+ GE+++++AP GWSGRFW RTGC F
Sbjct  20   AAIFTLENKCKETIWPGILAGSGKPVLMNGGVRLNAGENIKIEAPKGWSGRFWPRTGCTF  79

Query  665  DASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            D SGNG CVTGD        G GG PPV+LAEFT+   ++ +DFYDVSLVDGYNV + I 
Sbjct  80   DQSGNGKCVTGDCGAKLNCNGAGGEPPVSLAEFTL---DSPEDFYDVSLVDGYNVPMSII  136

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            PSGG+G C+   CV+DLNT CPE LQ  D+G VVACKSAC  FNTPEYCCTG      TC
Sbjct  137  PSGGTGGCKSVNCVSDLNTKCPEDLQQKDTGRVVACKSACMAFNTPEYCCTGAFGGPNTC  196

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
             PT YS+IFK +CP AYSYAYDD +STFTC  ++Y I+FC
Sbjct  197  KPTNYSKIFKESCPDAYSYAYDDLTSTFTCKDANYTISFC  236



>emb|CDX73136.1| BnaC06g35840D [Brassica napus]
Length=245

 Score =   257 bits (657),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 167/232 (72%), Gaps = 8/232 (3%)
 Frame = -1

Query  863  ITNVWAAGS---FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGR  693
            IT+   AG+   F L N+C YTVWPG LSGN    LG GG  L+PG SV+L AP GWSGR
Sbjct  12   ITSSGIAGTATIFVLENSCPYTVWPGILSGNSTTTLGNGGVPLTPGASVQLTAPPGWSGR  71

Query  692  FWARTGCNFDASGNGNCVTgd-cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDG  516
            F ARTGC+FDASG G+CV G   G L C  GG PP  LAEFT+ +G+++ DFY VSLVDG
Sbjct  72   FCARTGCSFDASGRGSCVPGVCGGVLNCNRGGFPPAILAEFTVGSGDSEMDFYGVSLVDG  131

Query  515  YNVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDS---GSVVACKSACAQFNTPEYC  345
            +NV +GI P GG+GDC YAGC+AD+N  CP  L++ D    G V AC SACA F++PE+C
Sbjct  132  FNVKMGIEPLGGTGDCHYAGCLADVNEICPGDLRIMDQNVVGVVAACMSACAAFDSPEFC  191

Query  344  CTGDHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            CTG H T  TC P++YS +FKNACP AYSYA  D +S FTC+ S+YLITFCP
Sbjct  192  CTGAHATPQTCGPSRYSTVFKNACPSAYSYA-GDATSIFTCSRSNYLITFCP  242



>gb|ABL86688.1| TLP2 [Gossypium barbadense]
Length=187

 Score =   254 bits (650),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  743  SPGESVELQAPAGWSGRFWARTGCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTI  567
            +PG S  LQ P GWSGRFW RTGCNFD SG+G CVTGDCGG     GGG+PPV+L EFT+
Sbjct  1    APGSSSRLQPPPGWSGRFWGRTGCNFDNSGSGKCVTGDCGGALKCNGGGIPPVSLIEFTL  60

Query  566  ANGNADKDFYDVSLVDGYNVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVA  387
             NG+ +KDFYD+SLVDGYN+ + ++  GG+G CQYAGCV DLNTNCP  LQ+ DSGSVVA
Sbjct  61   -NGHDNKDFYDISLVDGYNMAVAVKAVGGTGTCQYAGCVNDLNTNCPAELQMMDSGSVVA  119

Query  386  CKSACAQFNTPEYCCTGDHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDY  207
            CKSACA FN PEYCCTG H T  TCSPT+YS++FKNACP AYSYAYDD +ST TC G+DY
Sbjct  120  CKSACAAFNMPEYCCTGAHGTPQTCSPTKYSQLFKNACPTAYSYAYDDATSTMTCTGADY  179

Query  206  LITFCPGS  183
            LITFCP S
Sbjct  180  LITFCPTS  187



>ref|XP_010459595.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=249

 Score =   256 bits (655),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 154/221 (70%), Gaps = 7/221 (3%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C+ TVWPG L+  G   LG+GG AL+ G SV L A  GWSGRFW RTGCNFDAS
Sbjct  29   FTLTNHCSSTVWPGILTSKG-TQLGDGGLALASGSSVTLTASPGWSGRFWGRTGCNFDAS  87

Query  656  GNGNCVTg--dcgglkcgggGVPPVTLAEFTIA----NGNADKDFYDVSLVDGYNVDLGI  495
            G G CVTG         G GG PP TLAEFTI       N+ +DFYDVSLVDGYNV + I
Sbjct  88   GVGKCVTGDCGGKLKCAGAGGAPPATLAEFTIGTPGPRSNSVQDFYDVSLVDGYNVQMKI  147

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
             P GGSG+C  AGCV+D+N  CP  L+VT +  VVACKSAC  FN PEYCCTG  +   T
Sbjct  148  TPQGGSGNCITAGCVSDVNAICPNELRVTGAAGVVACKSACEAFNKPEYCCTGAFSKPET  207

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            C PT YS+IFK ACP AYSYAYDD SSTFTC  ++YLI+FC
Sbjct  208  CPPTSYSKIFKGACPTAYSYAYDDASSTFTCTNANYLISFC  248



>gb|ABR17407.1| unknown [Picea sitchensis]
Length=246

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 157/219 (72%), Gaps = 5/219 (2%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C+ T+WPG L+GNGG  L  GGFALS G+SV + AP GWSGRFW RTGC F AS
Sbjct  26   FTLVNRCSETIWPG-LAGNGGTSLAGGGFALSTGQSVPVNAPTGWSGRFWGRTGCAFSAS  84

Query  656  GNGNCVTgdcgglkcgggGV--PPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSG  483
            G G+C TG+C       G    PP TLAEFTI  G+A KDFYDVSLVDGYNV L IR +G
Sbjct  85   GVGSCATGNCVHGLKCAGSTGEPPATLAEFTI-GGDAGKDFYDVSLVDGYNVPLSIRAAG  143

Query  482  GSGDCQYAGCVADLNTNCPEVLQVTDS-GSVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
            G+GDC+ AGC +DL ++CP  L V  S G V+AC+SAC  F + EYCCTGDH    TCSP
Sbjct  144  GTGDCRTAGCSSDLRSSCPAELSVKGSDGRVIACRSACNAFGSAEYCCTGDHGNPQTCSP  203

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             +YS+IFK ACP AYSYAYDD SS  TC  +DY ITFCP
Sbjct  204  NKYSQIFKAACPTAYSYAYDDASSLVTCTHADYTITFCP  242



>ref|XP_009389442.1| PREDICTED: pathogenesis-related protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=259

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 160/223 (72%), Gaps = 7/223 (3%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            F L N C YTVWPG LSGNG   LG G F L P  +     P GWSGRFWART C FD+S
Sbjct  34   FILENNCPYTVWPGALSGNGAVLLGNGSFELPPNATSSFSGPPGWSGRFWARTSCLFDSS  93

Query  656  -GNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSG  483
              NG+C TGDCGG      GG PPV+LAEFT+  G+  KDFYDVSLVDGYNV +G+RPSG
Sbjct  94   SANGSCATGDCGGALRCSIGGAPPVSLAEFTLGGGDGAKDFYDVSLVDGYNVGIGVRPSG  153

Query  482  GS--GDCQYAGCVADLNTNCPEVLQV-TDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
             +  G C+YAGCVAD+N  CP  L+V ++SG  +AC+SAC  F +PEYCCTG H +  TC
Sbjct  154  AAVGGSCRYAGCVADVNARCPAELRVASESGETMACRSACEAFGSPEYCCTGAHGSPTTC  213

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCA--GSDYLITFCP  189
             PT+YS++FK ACP AYSYAYDD +STFTCA   +DY ITFCP
Sbjct  214  GPTRYSQLFKAACPAAYSYAYDDATSTFTCASGAADYTITFCP  256



>dbj|BAA95017.1| thaumatin-like protein [Cestrum elegans]
Length=177

 Score =   248 bits (633),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 144/174 (83%), Gaps = 2/174 (1%)
 Frame = -1

Query  704  WSGRFWARTGCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNAD-KDFYDV  531
            WSGRFWARTGCNFD +GNG C TG+CGG     GGG PPV+L EFTIANGN   KDFYDV
Sbjct  1    WSGRFWARTGCNFDEAGNGQCKTGNCGGALKCTGGGEPPVSLVEFTIANGNDQTKDFYDV  60

Query  530  SLVDGYNVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPE  351
            SLVDGYNV +G+R +GGSGDCQYAGCV DLN NCP  L+V D+G VVACKSACA FNT E
Sbjct  61   SLVDGYNVGIGVRATGGSGDCQYAGCVTDLNVNCPTDLRVVDNGVVVACKSACAAFNTSE  120

Query  350  YCCTGDHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            YCCTGDH T  TC PTQYS++FK+ACP AYSYAYDD SST TC+GSDYLITFCP
Sbjct  121  YCCTGDHATPTTCPPTQYSKLFKDACPSAYSYAYDDASSTCTCSGSDYLITFCP  174



>ref|XP_002264550.2| PREDICTED: pathogenesis-related protein 5-like [Vitis vinifera]
Length=235

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 156/220 (71%), Gaps = 5/220 (2%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A  FTL N C  ++WPG   G+G   L +GGF L PGESV++ AP GWSGRFW R  C+F
Sbjct  19   AAVFTLKNGCGESIWPGIQPGSGTPQLMDGGFELRPGESVDITAPEGWSGRFWGRRRCSF  78

Query  665  DASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            D SG G+CVTGD        G GG PP TLAEFT+   ++  DFYDVSLVDGYN+ + I 
Sbjct  79   DDSGKGSCVTGDCGGVLKCAGAGGAPPATLAEFTL---DSPVDFYDVSLVDGYNMPVSIL  135

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            PSGGSG+C+   CV+DLN +CP+ LQV   G VVAC SAC  FN PEYCC+G  +T  TC
Sbjct  136  PSGGSGECKTVRCVSDLNQHCPKDLQVLRDGRVVACNSACMAFNKPEYCCSGAFSTPDTC  195

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
             PT+YS++FK +CP +YSYAYDD +STFTC G++YLI FC
Sbjct  196  KPTEYSKVFKASCPTSYSYAYDDPTSTFTCKGANYLIRFC  235



>gb|EYU27084.1| hypothetical protein MIMGU_mgv1a012534mg [Erythranthe guttata]
Length=247

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 159/218 (73%), Gaps = 5/218 (2%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FT  N C +T+WP + SG G A + +GGF L PG +    AP GWSGRFWARTGC FD +
Sbjct  29   FTFTNHCNFTIWPASNSGTG-AVVADGGFVLPPGSTAAFPAPPGWSGRFWARTGCVFDNA  87

Query  656  GNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSGG  480
            GNG C TGDCGG      GG PPV+LAEFT+  G   +DFYDVSLVDG+NV +G+RPSGG
Sbjct  88   GNGRCTTGDCGGRLRCANGGEPPVSLAEFTVGGGG--QDFYDVSLVDGFNVGVGVRPSGG  145

Query  479  SGDCQYAGCVADLNTNCPEVLQVTDS-GSVVACKSACAQFNTPEYCCTGDHNTHATCSPT  303
            SGDC+   C AD+  +CP  LQV  + G+VVACKSAC +F TPE+CC+GDH T ATC PT
Sbjct  146  SGDCRVTACGADVLGDCPPELQVIGAAGAVVACKSACLRFGTPEFCCSGDHATPATCGPT  205

Query  302  QYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             YSR FK  CP AY+YAYDD +STFTC+G+DY + FCP
Sbjct  206  PYSRRFKKLCPTAYTYAYDDKTSTFTCSGADYTVGFCP  243



>ref|XP_010257784.1| PREDICTED: thaumatin-like protein [Nelumbo nucifera]
Length=235

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 150/217 (69%), Gaps = 5/217 (2%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL+N C  T+WPG     G   L  GGF L PGE+V + APA WSGRFW R  C+FD S
Sbjct  22   FTLNNNCRKTIWPGIQPSAGKPDLEAGGFPLKPGETVSISAPAAWSGRFWGRRSCSFDPS  81

Query  656  GNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSG  483
            G G+C+TGD        G GG PPVTLAEFT+   N+  D+YD+SLVDGYN+ + I PSG
Sbjct  82   GKGSCITGDCGGLLACSGMGGAPPVTLAEFTL---NSPDDYYDISLVDGYNMAVSITPSG  138

Query  482  GSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPT  303
            GSG+C+ A CV+DLN  CP  LQV     VVAC+SAC  FN PEYCCTGD+++   C PT
Sbjct  139  GSGECKPARCVSDLNQICPTNLQVKRKKRVVACESACMAFNRPEYCCTGDYSSPDKCKPT  198

Query  302  QYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
             YSR+FK ACP AYSYAYDD SS  TC G++YLI FC
Sbjct  199  NYSRVFKAACPSAYSYAYDDQSSLRTCNGANYLIKFC  235



>ref|XP_010477142.1| PREDICTED: pathogenesis-related protein 5-like [Camelina sativa]
Length=249

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 150/221 (68%), Gaps = 7/221 (3%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C+  VWPG L+  G   LG+GGFAL+ G SV L A  GWSGRFWART C+FD S
Sbjct  29   FTLTNHCSSPVWPGILTSKG-TQLGDGGFALASGSSVTLTASPGWSGRFWARTACDFDES  87

Query  656  GNGNCVTg--dcgglkcgggGVPPVTLAEFTIA----NGNADKDFYDVSLVDGYNVDLGI  495
            G G C TG         G GG PP TLAEFTI        + +DFYDVSLVDGYNV + I
Sbjct  88   GTGKCATGDCGGKLKCAGVGGAPPATLAEFTIGTPGHKSKSVQDFYDVSLVDGYNVQMKI  147

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
             P GGSG+C+ AGCV+D+N  CP  L V     VVACKSAC  FN PEYCCTG  +   T
Sbjct  148  TPQGGSGNCKIAGCVSDVNAICPNELSVVGPPGVVACKSACEAFNKPEYCCTGAFSKPET  207

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            C PT+YS+IFK ACP AYSYAYDD SSTFTC  ++YLI+FC
Sbjct  208  CPPTRYSKIFKRACPTAYSYAYDDASSTFTCTNANYLISFC  248



>ref|XP_007160531.1| hypothetical protein PHAVU_002G329400g [Phaseolus vulgaris]
 gb|ESW32525.1| hypothetical protein PHAVU_002G329400g [Phaseolus vulgaris]
Length=248

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 152/224 (68%), Gaps = 7/224 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            AA SF  +N C + VWPG     G   L  GGF L+P  +  LQ PA WSGRFW R GC 
Sbjct  25   AASSFVFYNKCPHPVWPGIQPSAGKPILARGGFKLAPNRAYSLQLPALWSGRFWGRHGCA  84

Query  668  FDASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FDASG G C TGD        G GG PP TLAEFT+ N   ++DFYDVSLVDGYN+ + I
Sbjct  85   FDASGRGRCATGDCGGSLYCNGIGGTPPATLAEFTLGN---EQDFYDVSLVDGYNLPISI  141

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTH  321
             P  GSG C YAGCV+DLNT CP  LQV   D+  VVACKSAC+ FN+P+YCCTG + + 
Sbjct  142  TPFKGSGKCSYAGCVSDLNTMCPVGLQVRSRDNKRVVACKSACSAFNSPKYCCTGSYGSP  201

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              C PT YS+IFK+ACPKAYSYAYDD +S  TC  ++YLITFCP
Sbjct  202  QACKPTVYSKIFKSACPKAYSYAYDDPTSIATCTKANYLITFCP  245



>ref|XP_009149412.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Brassica 
rapa]
Length=248

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 159/229 (69%), Gaps = 4/229 (2%)
 Frame = -1

Query  866  GITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFW  687
            G   V +   FT+ N+C++ VWPG L+G+ G  L +GGF L+PG SV++ APAGWSGR W
Sbjct  19   GTVTVVSGTVFTVVNSCSFPVWPGILTGDNGVQLNDGGFELAPGASVDVTAPAGWSGRIW  78

Query  686  ARTGCNFDASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
             RTGCNFD SG G+C+TGD        G GGVPPVTLAEFTI  G   +D YDVSLVDGY
Sbjct  79   GRTGCNFDGSGAGSCLTGDCGNKLKCAGAGGVPPVTLAEFTIGTGGG-QDNYDVSLVDGY  137

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            N+ + +    GSGDCQ  GC +DLN +CP   +V D  +VVAC+SAC  F  PEYCCTG 
Sbjct  138  NIQMALTTRDGSGDCQNGGCDSDLNGSCPNDQRVMDGANVVACRSACEAFKKPEYCCTGA  197

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDD-DSSTFTCAGSDYLITFCP  189
             +   TC PT+ S+IFK ACP+AYSYAYDD ++S FTC  ++Y I FCP
Sbjct  198  FDKPETCPPTELSKIFKAACPRAYSYAYDDRNTSLFTCTNANYSIVFCP  246



>ref|XP_006856120.1| hypothetical protein AMTR_s00059p00148770 [Amborella trichopoda]
 gb|ERN17587.1| hypothetical protein AMTR_s00059p00148770 [Amborella trichopoda]
Length=234

 Score =   246 bits (627),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 152/223 (68%), Gaps = 8/223 (4%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A +F + N C Y VWP TLSG  G     GGF L+ G S  L AP GWSGR W RT C+
Sbjct  17   SAANFNIVNKCGYGVWPATLSG-AGTITPAGGFYLASGASTSLSAPTGWSGRIWGRTDCS  75

Query  668  FDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FDASG G C TG           GG PPVTLAEFTI N     DFYDVSLVDGYN+ +G+
Sbjct  76   FDASGAGKCDTGDCGSLQCNPNAGGQPPVTLAEFTIGN----MDFYDVSLVDGYNLPMGV  131

Query  494  RPSGGSGDCQYAGCVADLNTNCP-EVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
                G+G+CQYAGC ADL T CP E++    SG  VACKSAC  FNTPEYCCTG + +  
Sbjct  132  NAVHGTGNCQYAGCTADLRTTCPTELVLKGQSGQTVACKSACMAFNTPEYCCTGAYGSPT  191

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TC PT+YS+IFK ACP AYSYAYDD+SST TC GSDY++TFCP
Sbjct  192  TCKPTKYSQIFKTACPDAYSYAYDDESSTRTCTGSDYVVTFCP  234



>ref|XP_009149413.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Brassica 
rapa]
Length=246

 Score =   246 bits (628),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 156/219 (71%), Gaps = 4/219 (2%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FT+ N+C++ VWPG L+G+ G  L +GGF L+PG SV++ APAGWSGR W RTGCNFD S
Sbjct  27   FTVVNSCSFPVWPGILTGDNGVQLNDGGFELAPGASVDVTAPAGWSGRIWGRTGCNFDGS  86

Query  656  GNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSG  483
            G G+C+TGD        G GGVPPVTLAEFTI  G   +D YDVSLVDGYN+ + +    
Sbjct  87   GAGSCLTGDCGNKLKCAGAGGVPPVTLAEFTIGTGGG-QDNYDVSLVDGYNIQMALTTRD  145

Query  482  GSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPT  303
            GSGDCQ  GC +DLN +CP   +V D  +VVAC+SAC  F  PEYCCTG  +   TC PT
Sbjct  146  GSGDCQNGGCDSDLNGSCPNDQRVMDGANVVACRSACEAFKKPEYCCTGAFDKPETCPPT  205

Query  302  QYSRIFKNACPKAYSYAYDD-DSSTFTCAGSDYLITFCP  189
            + S+IFK ACP+AYSYAYDD ++S FTC  ++Y I FCP
Sbjct  206  ELSKIFKAACPRAYSYAYDDRNTSLFTCTNANYSIVFCP  244



>ref|XP_010266794.1| PREDICTED: thaumatin-like protein 1b [Nelumbo nucifera]
Length=330

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 149/222 (67%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C YT+WPG L+  G   L   GF L+ G S   QAP GWSGRFW RTGCNFD 
Sbjct  27   TFTFVNKCDYTIWPGILANAGSPRLDSTGFELTQGSSRSFQAPTGWSGRFWGRTGCNFDG  86

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG G+C TG          G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ + +  
Sbjct  87   SGQGSCATGDCGSGQIECKGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGYNLPMIVEG  144

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GG G C   GCV DLN  CP  L+V   G   ACKSAC  F TPEYCC+G+ NT ATC 
Sbjct  145  TGGQGTCASTGCVTDLNQRCPTELRV---GEGEACKSACEAFGTPEYCCSGEFNTPATCR  201

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK+ACPK+YSYAYDD +STFTC G+DY ITFCP S
Sbjct  202  PSVYSEMFKSACPKSYSYAYDDATSTFTCTGADYTITFCPSS  243



>emb|CDY64470.1| BnaAnng19340D [Brassica napus]
Length=249

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 158/222 (71%), Gaps = 13/222 (6%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A  F L N+C     PGTLS N    LG+    L+PG SV+L AP GWSGRFWARTGC+F
Sbjct  35   ATVFVLENSC-----PGTLSINS-TTLGDSWVPLTPGASVQLIAPPGWSGRFWARTGCSF  88

Query  665  DASGNGNCVTgdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            DASG  +C     G L C  GG PP TLAEFT+ +G +D DFY VSLVDG+NV +GI P 
Sbjct  89   DASGRSSC----GGVLNCNRGGFPPATLAEFTVGSGVSDMDFYGVSLVDGFNVKMGIDPL  144

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVTD---SGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
            GG+GDC YAGC+AD+N  CP  L++ D    G VVAC SACA F++PE+CCTG H T  T
Sbjct  145  GGTGDCHYAGCLADVNEICPGDLRIMDPNIDGVVVACMSACAAFDSPEFCCTGAHATPQT  204

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            C P++YS +FKNACP AYSYAYDD +S FTC+ S+YLITFCP
Sbjct  205  CDPSRYSTVFKNACPSAYSYAYDDTTSIFTCSRSNYLITFCP  246



>ref|XP_008463807.1| PREDICTED: thaumatin-like protein [Cucumis melo]
Length=250

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 151/229 (66%), Gaps = 7/229 (3%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            I+ + +A + TL+N C++ VWPG     G   L  GGF L P ++  LQ PA WSGRFW 
Sbjct  22   ISVLVSATTITLYNKCSHPVWPGIQPSAGKPLLARGGFKLPPNKAYTLQLPALWSGRFWG  81

Query  683  RTGCNFDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYN  510
            R GC FDASG G C TG         G GG PP TLAE T+ N   D+DFYDVSLVDGYN
Sbjct  82   RHGCAFDASGRGKCATGDCGGALFCNGIGGTPPATLAEITLGN---DQDFYDVSLVDGYN  138

Query  509  VDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTG  336
            + + I PS GSG C YAGCV+DLN  CP  LQV   D+  VVACKSAC  FN+P YCCTG
Sbjct  139  LAISITPSKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRRVVACKSACFAFNSPRYCCTG  198

Query  335  DHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
                  +C PT YS+IFK ACPKAYSYAYDD +S  TC G +YL+TFCP
Sbjct  199  RFGNPQSCKPTAYSKIFKTACPKAYSYAYDDPTSIATCTGGNYLVTFCP  247



>gb|EYU24132.1| hypothetical protein MIMGU_mgv1a012513mg [Erythranthe guttata]
Length=248

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 150/226 (66%), Gaps = 7/226 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            A  + TL+N C++ VWPG   G+G   L +GGF L P +S  LQ P GWSGR W R GC+
Sbjct  26   AGTTMTLYNKCSHPVWPGIQPGSGKPVLAKGGFKLLPNKSYALQLPEGWSGRLWGRHGCS  85

Query  668  FDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FDA+G+G C TG         G GG PP TLAE T+ N   ++DFYDVSLVDGYN+ + I
Sbjct  86   FDAAGHGRCATGDCGGALFCNGMGGTPPATLAEITLGN---EQDFYDVSLVDGYNLAISI  142

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTH  321
             P  GSG C YAGCV+DLN  CP  LQV   D   VVACKSAC  FN+P YCCTG     
Sbjct  143  TPFRGSGKCSYAGCVSDLNMMCPVGLQVRSHDKKKVVACKSACFAFNSPRYCCTGSFGNP  202

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
             TC PT YS+IFK ACPKAYSYAYDD +S  TC GS YL+TFCP S
Sbjct  203  QTCKPTAYSKIFKTACPKAYSYAYDDPTSISTCTGSSYLLTFCPHS  248



>ref|XP_010245598.1| PREDICTED: thaumatin-like protein 1b [Nelumbo nucifera]
Length=324

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 148/222 (67%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C YTVWPG L+  G   L   GF L+ G S   QAP GWSGRFW RTGCNFD 
Sbjct  27   TFTFVNKCDYTVWPGILANAGSPKLDSTGFELAKGSSRSFQAPTGWSGRFWGRTGCNFDG  86

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG G+C TG          G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ + +  
Sbjct  87   SGRGSCSTGDCGSGQIECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGYNLPMIVEG  144

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGG G C   GCV DLN  CP  L+V   G   ACKSAC  F TPEYCC+G  NT ATC 
Sbjct  145  SGGQGTCTSTGCVTDLNQRCPTELKV---GEGDACKSACEAFGTPEYCCSGSFNTPATCR  201

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS++FK+ACPK+YSYAYDD +STFTC G+DY I FCP S
Sbjct  202  PSVYSQMFKSACPKSYSYAYDDATSTFTCTGADYTIAFCPSS  243



>ref|XP_004516152.1| PREDICTED: thaumatin-like protein-like, partial [Cicer arietinum]
Length=223

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 151/217 (70%), Gaps = 4/217 (2%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C  T+WPG L+G G   L +GGF L PG+++ + AP GWSGRFW R GC F+  
Sbjct  9    FTLQNKCRNTMWPGILTGAGKPPLTDGGFRLRPGQAINITAPKGWSGRFWGRRGCTFNGF  68

Query  656  GNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSG  483
            G+G C+TGD        G GG+PP +LAEFT+ +   + DFYDVSLVDGYN+ + I PS 
Sbjct  69   GHGKCITGDCGGKLRCAGAGGIPPASLAEFTLDS--PEGDFYDVSLVDGYNMPVSIIPSR  126

Query  482  GSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPT  303
            GSG C+   C +DLN NCP  L++ +   VV CKSAC  FN PEYCCTGD N+   C P+
Sbjct  127  GSGQCKTVKCRSDLNRNCPTGLELRNKDRVVGCKSACMAFNKPEYCCTGDFNSPNKCQPS  186

Query  302  QYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
             YS++FK +CP+AYSYAYDD +STFTC G+DY+I FC
Sbjct  187  SYSKVFKASCPQAYSYAYDDATSTFTCHGADYIIRFC  223



>emb|CAN80000.1| hypothetical protein VITISV_043971 [Vitis vinifera]
Length=634

 Score =   255 bits (652),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 156/220 (71%), Gaps = 5/220 (2%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A  FTL N C  ++WPG   G+G   L +GGF L PGESV++ AP GWSGRFW R  C+F
Sbjct  418  AAVFTLKNGCGESIWPGIQPGSGTPQLMDGGFELRPGESVDITAPEGWSGRFWGRRRCSF  477

Query  665  DASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            D SG G+CVTGD        G GG PP TLAEFT+   ++  DFYDVSLVDGYN+ + I 
Sbjct  478  DDSGKGSCVTGDCGGVLKCAGAGGAPPATLAEFTL---DSPVDFYDVSLVDGYNMPVSIL  534

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            PSGGSG+C+   CV+DLN +CP+ LQV   G VVAC SAC  FN PEYCC+G  +T  TC
Sbjct  535  PSGGSGECKTVRCVSDLNQHCPKDLQVLRDGRVVACNSACMAFNKPEYCCSGAFSTPDTC  594

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
             PT+YS++FK +CP +YSYAYDD +STFTC G++YLI FC
Sbjct  595  KPTEYSKVFKASCPTSYSYAYDDPTSTFTCKGANYLIRFC  634



>ref|XP_004137499.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 ref|XP_004163817.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 gb|KGN64169.1| Protein P21 [Cucumis sativus]
Length=250

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 150/229 (66%), Gaps = 7/229 (3%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            I+ + +A + T +N C++ VWPG     G   L  GGF L P +S  LQ PA WSGRFW 
Sbjct  22   ISVLVSATTITFYNKCSHPVWPGIQPSAGKPLLARGGFKLPPNKSYNLQLPALWSGRFWG  81

Query  683  RTGCNFDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYN  510
            R GC FDASG G C TG         G GG PP TLAE T+ N   D+DFYDVSLVDGYN
Sbjct  82   RHGCAFDASGRGKCATGDCGGSLFCNGIGGTPPATLAEITLGN---DQDFYDVSLVDGYN  138

Query  509  VDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTG  336
            + + I PS GSG C YAGCV+DLN  CP  LQV   D+  VVACKSAC  FN+P YCCTG
Sbjct  139  LAISITPSKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRRVVACKSACFAFNSPRYCCTG  198

Query  335  DHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
                  +C PT YS+IFK ACPKAYSYAYDD +S  TC G +YL+TFCP
Sbjct  199  RFGNPQSCKPTAYSKIFKTACPKAYSYAYDDPTSIATCTGGNYLVTFCP  247



>ref|XP_003530957.2| PREDICTED: thaumatin-like protein-like [Glycine max]
Length=253

 Score =   243 bits (621),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 150/229 (66%), Gaps = 7/229 (3%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            +  V A+ S   +N C + VWPG     G   L  GGF L+P  +  LQ PA WSGRFW 
Sbjct  25   VLKVSASSSVIFYNKCQHPVWPGIQPSAGKPVLARGGFKLAPNRAYSLQLPALWSGRFWG  84

Query  683  RTGCNFDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYN  510
            R GC+FDA G G C TG         G GG PP TLAEFT+ N   ++DFYDVSLVDGYN
Sbjct  85   RHGCSFDAGGRGRCATGDCGGSLFCNGIGGSPPATLAEFTLGN---EQDFYDVSLVDGYN  141

Query  509  VDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTG  336
            + + I P  GSG C YAGCV+DLNT CP  LQV   D+  VVACKSAC+ FN+P YCCTG
Sbjct  142  LPISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSRDNKRVVACKSACSAFNSPRYCCTG  201

Query  335  DHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             + +   C PT YS+IFK ACPKAYSYAYDD +S  TC  ++YL+TFCP
Sbjct  202  SYGSPQACKPTVYSKIFKTACPKAYSYAYDDPTSIATCTKANYLVTFCP  250



>ref|XP_010539098.1| PREDICTED: thaumatin-like protein 1b [Tarenaya hassleriana]
Length=307

 Score =   245 bits (626),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 153/224 (68%), Gaps = 8/224 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFD-  663
            + T+ N C YTVWPG LS  G   LG  GF LS  +S   QAP  WSGRFWARTGCNFD 
Sbjct  27   TITVINRCDYTVWPGILSNAGSDGLGTTGFELSSDDSRSFQAPPNWSGRFWARTGCNFDP  86

Query  662  ASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADK-DFYDVSLVDGYNVDLGI  495
             +G G C+TG          G G  PP TLAEFTI +G+  + DFYDVSLVDGYNV + +
Sbjct  87   GTGQGACLTGDCGSNRLECNGAGASPPATLAEFTIGSGDPTRQDFYDVSLVDGYNVPMIV  146

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
             PS GSG C   GCV DLN  CP  L+V   GS VACKSAC  F +PEYCC+G++ +  T
Sbjct  147  EPSAGSGTCLSTGCVTDLNRKCPSELRV---GSGVACKSACEAFGSPEYCCSGEYGSPET  203

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            C PT YS IFK+ACP++YSYAYDD +STFTC+G+DY ITFCP S
Sbjct  204  CKPTMYSEIFKSACPRSYSYAYDDATSTFTCSGADYTITFCPSS  247



>gb|KEH19055.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=237

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 148/218 (68%), Gaps = 5/218 (2%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C   +WPG L+G G   L +GGF L PG ++ + AP GW GRFW R GC FD S
Sbjct  22   FTLQNKCRNAIWPGILTGAGKPQLLDGGFQLKPGHAINITAPKGWFGRFWGRIGCTFDIS  81

Query  656  GNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSG  483
            G G C+TGD        G GG PP +LAEFT+ +   + DFYDVSLVDGYN+ + I P G
Sbjct  82   GKGKCITGDCGGKLKCVGAGGEPPASLAEFTLDS--PEGDFYDVSLVDGYNLPVSIVPFG  139

Query  482  GSGDCQYAGCVADLNTNCPEVLQVTD-SGSVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
            GSG C    C +DLN NCP  L++ +  G VV CKSAC  FN PEYCCTGD N+   C P
Sbjct  140  GSGQCTAVKCRSDLNRNCPAGLELRNIKGRVVGCKSACMAFNRPEYCCTGDFNSPKKCEP  199

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            + YS++FK++CP AYSYAYDD++STF C G+DYLI+FC
Sbjct  200  SSYSKVFKDSCPMAYSYAYDDETSTFACKGADYLISFC  237



>ref|XP_009785059.1| PREDICTED: thaumatin-like protein isoform X2 [Nicotiana sylvestris]
Length=247

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 148/223 (66%), Gaps = 7/223 (3%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A + T++N C++ VWPG     G   L  GGF L P ++ +L  PAGWSGR W R GC+F
Sbjct  26   ATTMTMYNRCSHPVWPGIQPSAGKPILARGGFKLLPNKAYKLSLPAGWSGRVWGRHGCSF  85

Query  665  DASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            DASG+G C TG         G GG PP TLAE T+ +   D+DFYDVSLVDGYN+ + I 
Sbjct  86   DASGHGRCATGDCGGALFCNGIGGTPPATLAEITLGS---DQDFYDVSLVDGYNLAISIT  142

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P  G G C YAGCV+DLNT CP  LQV   D   VVACKSACA FN+P YCCTG      
Sbjct  143  PFRGKGKCSYAGCVSDLNTMCPVGLQVKSHDKRQVVACKSACAAFNSPRYCCTGTFGNPQ  202

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            +C PT YSRIFK ACPKAYSYAYDD +S  TC GS YL+TFCP
Sbjct  203  SCKPTAYSRIFKTACPKAYSYAYDDPTSIATCTGSSYLLTFCP  245



>ref|XP_009785058.1| PREDICTED: thaumatin-like protein isoform X1 [Nicotiana sylvestris]
Length=248

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 148/223 (66%), Gaps = 7/223 (3%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A + T++N C++ VWPG     G   L  GGF L P ++ +L  PAGWSGR W R GC+F
Sbjct  27   ATTMTMYNRCSHPVWPGIQPSAGKPILARGGFKLLPNKAYKLSLPAGWSGRVWGRHGCSF  86

Query  665  DASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            DASG+G C TG         G GG PP TLAE T+ +   D+DFYDVSLVDGYN+ + I 
Sbjct  87   DASGHGRCATGDCGGALFCNGIGGTPPATLAEITLGS---DQDFYDVSLVDGYNLAISIT  143

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P  G G C YAGCV+DLNT CP  LQV   D   VVACKSACA FN+P YCCTG      
Sbjct  144  PFRGKGKCSYAGCVSDLNTMCPVGLQVKSHDKRQVVACKSACAAFNSPRYCCTGTFGNPQ  203

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            +C PT YSRIFK ACPKAYSYAYDD +S  TC GS YL+TFCP
Sbjct  204  SCKPTAYSRIFKTACPKAYSYAYDDPTSIATCTGSSYLLTFCP  246



>emb|CDX72995.1| BnaC06g34430D [Brassica napus]
Length=265

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 151/223 (68%), Gaps = 7/223 (3%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A +   +N CTYTVWPG  + +G   LG GGF LSP  +  LQ P+ WSGRFW R GC+F
Sbjct  42   ASTVIFYNKCTYTVWPGIQASSGQPLLGGGGFKLSPKRAYTLQLPSLWSGRFWGRHGCSF  101

Query  665  DASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            D SG G C TGD     L  G GGVPP TLAE T+ +   D+DFYDVSLVDGYN+ + I 
Sbjct  102  DRSGRGRCATGDCGGSLLCNGAGGVPPATLAEITLGH---DQDFYDVSLVDGYNLAMSIM  158

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P  G+G C YAGCV+DLN  CP  LQV   D   VVACKSAC+ FN+P YCCTG      
Sbjct  159  PVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGKQVVACKSACSAFNSPRYCCTGSFGNPQ  218

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TC PT YS+IFK ACPKAYSYAYDD +S  TC  ++Y++TFCP
Sbjct  219  TCRPTAYSKIFKVACPKAYSYAYDDPTSIATCTKANYVVTFCP  261



>gb|KDP26886.1| hypothetical protein JCGZ_18044 [Jatropha curcas]
Length=232

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 151/220 (69%), Gaps = 8/220 (4%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A  FT  N C  TVWPG LSG G   L  GGF L PG+SV L AP GWSGRFW RTGC+F
Sbjct  19   AAVFTFSNRCRTTVWPGILSGAGKPQLMGGGFELRPGQSVTLNAPQGWSGRFWGRTGCSF  78

Query  665  DASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            D SG G C+TG         G GGVPP +LAEFT+   N+  D+YDVSLVDG+N+ + I 
Sbjct  79   DRSGRGRCLTGDCGGVLKCAGAGGVPPASLAEFTL---NSPLDYYDVSLVDGFNLPISIL  135

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            P+G    C+   CVAD+N  CP  LQV  +  VVACKSAC  F +PE+CCTG + + ATC
Sbjct  136  PTGA---CKSVECVADMNRRCPGSLQVRWNRQVVACKSACLAFGSPEFCCTGPYGSPATC  192

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
             P+ YS++FK+ACP AYSYA+DD +STFTC G++YLI FC
Sbjct  193  KPSNYSKVFKDACPTAYSYAFDDSTSTFTCQGANYLIRFC  232



>ref|XP_007046679.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
 gb|EOX90836.1| Pathogenesis-related thaumatin superfamily protein [Theobroma 
cacao]
Length=317

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 151/222 (68%), Gaps = 8/222 (4%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A +FT  N C YTVWPG L+  G   L   GF L+ G S   QAP GW+GRFW RTGCNF
Sbjct  28   AATFTFINKCDYTVWPGILANPGSPKLESTGFELTKGSSRSFQAPTGWAGRFWGRTGCNF  87

Query  665  DASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            D SG+G+C TG          G G +PP TLAEFT+ +G+  +DFYDVSLVDGYN+ + +
Sbjct  88   DDSGHGSCATGDCGSGEVECNGAGAIPPATLAEFTLGSGS--QDFYDVSLVDGYNLPMIV  145

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
              SGGSG+C   GCV+DLN  CP  L++   G   ACKSAC  F  PEYCC+G  N+ A 
Sbjct  146  EGSGGSGECAITGCVSDLNKKCPSELRIDGGG---ACKSACDAFGNPEYCCSGAFNSPAA  202

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            C P+ YS +FK+ACPK+YSYA+DD +STFTC G+DY ITFCP
Sbjct  203  CKPSMYSEVFKSACPKSYSYAFDDATSTFTCTGADYSITFCP  244



>gb|EYU32807.1| hypothetical protein MIMGU_mgv1a020484mg, partial [Erythranthe 
guttata]
Length=195

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 149/193 (77%), Gaps = 5/193 (3%)
 Frame = -1

Query  752  FALSPGESVELQAPAGWSGRFWARTGCNFDASGNGNCVTgdcgglkc-gggGVPPVTLAE  576
            F LSPG+++ L AP GWSGRFWARTGC FD +GNG+C TGDCGG+      G PP++LAE
Sbjct  1    FPLSPGDTIHLPAPQGWSGRFWARTGCVFDDAGNGHCETGDCGGVLQCTLSGAPPISLAE  60

Query  575  FTIANGN--ADKDFYDVSLVDGYNVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDS  402
            FTI +G   A  DFYD+SLVDGYNV L ++PSGGSGDCQ AGCVAD+N NCPE LQV   
Sbjct  61   FTIGSGGGVAAMDFYDISLVDGYNVGLSVQPSGGSGDCQSAGCVADVNANCPEELQVVVE  120

Query  401  GSVV--ACKSACAQFNTPEYCCTGDHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTF  228
                  ACKSACA F +PE+CCTG+H+T  TC+PT YS +FKNACP AYSYAYDD SST 
Sbjct  121  EGGGVVACKSACAAFGSPEFCCTGEHSTPDTCAPTPYSEMFKNACPTAYSYAYDDLSSTC  180

Query  227  TCAGSDYLITFCP  189
            TC GSDYLITFCP
Sbjct  181  TCTGSDYLITFCP  193



>ref|XP_009596997.1| PREDICTED: thaumatin-like protein [Nicotiana tomentosiformis]
Length=248

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 144/221 (65%), Gaps = 7/221 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            + T++N C++ VWPG     G   L  GGF L P ++  L  PAGWSGR W R GC+FDA
Sbjct  29   TMTMYNKCSHPVWPGIQPSAGKPILARGGFKLLPNKAYRLSLPAGWSGRVWGRHGCSFDA  88

Query  659  SGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            SG G C TG         G GG PP TLAE T+ N   D+DFYDVSLVDGYN+ + I P 
Sbjct  89   SGQGRCATGDCGGALFCNGIGGTPPATLAEITLGN---DQDFYDVSLVDGYNLAISITPF  145

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
             G G C YAGCV+DLNT CP  LQV   D   VVACKSACA FN+P YCCTG      +C
Sbjct  146  RGKGKCSYAGCVSDLNTMCPVGLQVKSHDKRQVVACKSACAAFNSPRYCCTGTFGNPQSC  205

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT YSRIFK ACPKAYSYAYDD +S  TC G  YL+TFCP
Sbjct  206  KPTAYSRIFKTACPKAYSYAYDDPTSIATCTGGSYLLTFCP  246



>ref|XP_009612390.1| PREDICTED: thaumatin-like protein [Nicotiana tomentosiformis]
 dbj|BAA74546.2| thaumatin-like protein SE39b [Nicotiana tabacum]
Length=238

 Score =   241 bits (615),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 147/221 (67%), Gaps = 6/221 (3%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A  FTL N C   +WPG LSG G   L  GG  L P E+ E++AP GWSGRFW R+ CNF
Sbjct  21   AAVFTLKNKCNMKIWPGILSGGGHPLLMNGGLQLQPNETAEIKAPTGWSGRFWPRSQCNF  80

Query  665  DASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            D SG G C T D        G GG PP +LAEFT+   ++  DFYDVS VDG+N+ + I 
Sbjct  81   DTSGKGTCATADCGGVLECNGAGGNPPASLAEFTL---DSPMDFYDVSFVDGFNIPISIY  137

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQV-TDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
            P GGSG+C    CV+DLN  CP  LQV T++ +V+ACKSAC  FN PEYCCT + N    
Sbjct  138  PLGGSGNCSNVQCVSDLNLQCPPELQVKTNNDTVIACKSACLAFNKPEYCCTEEFNDPNI  197

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            C PT+YS IFK ACP AYSY YDD +STFTC G+DYLI+FC
Sbjct  198  CKPTKYSEIFKKACPDAYSYPYDDATSTFTCKGADYLISFC  238



>gb|KHG07208.1| hypothetical protein F383_34305 [Gossypium arboreum]
Length=313

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 154/222 (69%), Gaps = 8/222 (4%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A +FT  N C YTVWPG L+  G   L   GF L+ G S   QAP GW+GRFW RTGCNF
Sbjct  28   AATFTFINKCDYTVWPGILANPGSPKLESTGFELTKGSSRSFQAPTGWAGRFWGRTGCNF  87

Query  665  DASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            D SG+G+C TG          G G +PP TLAEFT+ +G+  +DFYDVSLVDGYN+ + +
Sbjct  88   DDSGHGSCATGDCGSGEMECNGAGAIPPATLAEFTLGSGS--QDFYDVSLVDGYNLPMIV  145

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
              SGGSG+C   GC+ DLN  CP  L++ D G+  ACKSAC  F  PEYCC+G +N+   
Sbjct  146  EGSGGSGECATTGCLTDLNKKCPSELKI-DGGA--ACKSACDAFGKPEYCCSGAYNSPTA  202

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            C P+ YS++FK+ACPK+YSYA+DD +STFTC+G+DY ITFCP
Sbjct  203  CKPSMYSQVFKSACPKSYSYAFDDATSTFTCSGADYAITFCP  244



>ref|XP_011008805.1| PREDICTED: thaumatin-like protein [Populus euphratica]
Length=247

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 144/220 (65%), Gaps = 6/220 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            + TLHN CT+ VWPG     G   L  GGF L P ++  L  P  WSGRFW R GC+FDA
Sbjct  28   TITLHNKCTHPVWPGVQPSAGRPLLARGGFKLPPNKAYTLNLPPLWSGRFWGRHGCSFDA  87

Query  659  SGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            SG G C TGD        G GG PP TLAE T+ N   D+DFYDVSLVDGYN+ + I P 
Sbjct  88   SGRGRCATGDCGGSLFCNGIGGTPPATLAEITLGN---DQDFYDVSLVDGYNLAISITPF  144

Query  485  GGSGDCQYAGCVADLNTNCPEVLQV-TDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
             GSG C YAGCV DLN  CP  LQV T +  VVACKSAC+ FN+P YCCTG   T   C 
Sbjct  145  KGSGKCSYAGCVRDLNMMCPVGLQVRTKNNRVVACKSACSAFNSPRYCCTGSFGTPQACK  204

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            PT YSRIFK ACPKAYSYAYDD +S  TC   +YL+TFCP
Sbjct  205  PTAYSRIFKAACPKAYSYAYDDPTSIATCTRGNYLVTFCP  244



>ref|XP_004235810.1| PREDICTED: thaumatin-like protein [Solanum lycopersicum]
Length=245

 Score =   241 bits (614),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 147/224 (66%), Gaps = 7/224 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A + TL+N C++ VWPG     G   L  GGF L P ++  L  PAGWSGR W R GC 
Sbjct  23   SATTMTLYNKCSHPVWPGIQPSAGKPILARGGFKLPPNKAYRLNMPAGWSGRVWGRHGCA  82

Query  668  FDASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FDA+G G C TGD        G GG PP TLAE T+ N   ++DFYDVSLVDGYN+ + +
Sbjct  83   FDAAGRGRCATGDCGGSLFCNGIGGTPPATLAEITLGN---EQDFYDVSLVDGYNLAISV  139

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTH  321
             P  G G C YAGCV+DLNT CP  LQV   D   VVACKSAC+ FN+P YCCTG     
Sbjct  140  TPVRGKGKCSYAGCVSDLNTMCPAGLQVRSHDKSQVVACKSACSAFNSPRYCCTGTFGNP  199

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             TC PT YSRIFK ACPKAYSYAYDD +S  TC GS Y++TFCP
Sbjct  200  QTCKPTAYSRIFKTACPKAYSYAYDDPTSIATCTGSSYVLTFCP  243



>gb|AHC69780.1| thuamatin-like protein [Quercus suber]
Length=249

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 146/224 (65%), Gaps = 7/224 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A + TL+N CT+ VWPG   G G   L  GGF L P ++  L  PA WSGR W R GC 
Sbjct  26   SATTITLYNKCTHPVWPGIQPGAGKPILARGGFKLQPNKAYSLHLPALWSGRLWGRHGCT  85

Query  668  FDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FDASG G C TG         G GG PP TLAE T+ N   ++DFYDVSLVDGYN+ + I
Sbjct  86   FDASGRGLCATGDCGGSLFCNGLGGAPPATLAEITLGN---EQDFYDVSLVDGYNLAISI  142

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTH  321
             P  GSG C YAGCV+DLN  CP  LQV   D+  VVACKSAC  FN+P YCCTG   + 
Sbjct  143  TPIKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRRVVACKSACFAFNSPRYCCTGSFGSP  202

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              C PT YSRIFK ACPKAYSYAYDD +S  TC G +YL+TFCP
Sbjct  203  QACKPTAYSRIFKAACPKAYSYAYDDPTSISTCTGGNYLVTFCP  246



>gb|KDP46766.1| hypothetical protein JCGZ_06554 [Jatropha curcas]
Length=314

 Score =   243 bits (620),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 148/222 (67%), Gaps = 11/222 (5%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            + +FTL N C YTVWPG L   G   L   GF L  G S   QAP GWSGRFWARTGCNF
Sbjct  25   SATFTLVNKCDYTVWPGIL---GSPKLETTGFELPKGSSRSFQAPTGWSGRFWARTGCNF  81

Query  665  DASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            D+SG+G+C T           G    PP TLAEFT+ +G   +DFYDVSLVDGYN+ + +
Sbjct  82   DSSGHGSCSTADCGSSQLECNGNTATPPATLAEFTLGSGT--QDFYDVSLVDGYNLPMVV  139

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
              +GGSG C+  GCV DLN  CP  L+V       ACKSAC  F  PEYCC+G +N+ +T
Sbjct  140  VVNGGSGQCESTGCVTDLNRKCPSELRVEGG---AACKSACEAFGNPEYCCSGAYNSPST  196

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            C P+ YS +FK+ACPK+YSYA+DD SSTFTC G+DY ITFCP
Sbjct  197  CKPSTYSEMFKSACPKSYSYAFDDASSTFTCTGADYTITFCP  238



>ref|XP_006383093.1| hypothetical protein POPTR_0005s11480g [Populus trichocarpa]
 gb|ERP60890.1| hypothetical protein POPTR_0005s11480g [Populus trichocarpa]
Length=325

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 152/219 (69%), Gaps = 11/219 (5%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FT  N C ++VWPG L   G   L   GF L  G S   QAP GWSGRFW RTGCNFD+S
Sbjct  32   FTFVNKCDFSVWPGIL---GSPELDSTGFELRKGSSRSFQAPTGWSGRFWGRTGCNFDSS  88

Query  656  GNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            G+G+CVT           G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ + +  S
Sbjct  89   GHGSCVTADCGSGQVECNGAGATPPATLAEFTLGSGS--QDFYDVSLVDGYNLPMIVEVS  146

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
            GGSG+C   GCV DLN  CP  L+ T+ GS  AC+SAC  F  PEYCC+G++N+ A+C P
Sbjct  147  GGSGECASTGCVTDLNRKCPTELR-TEGGS--ACRSACEAFGKPEYCCSGEYNSPASCKP  203

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            + YS++FK+ACPK+YSYAYDD +STFTC G+DY ITFCP
Sbjct  204  SMYSQVFKSACPKSYSYAYDDATSTFTCTGADYTITFCP  242



>ref|XP_004503284.1| PREDICTED: thaumatin-like protein-like [Cicer arietinum]
Length=251

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 147/224 (66%), Gaps = 7/224 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A +  L+N C + VWPG     G   L  GGF L P ++  LQ P  WSGRFW R GC 
Sbjct  28   SAAAIILYNKCPHPVWPGIQPSAGKPILARGGFNLPPNKAYSLQVPPLWSGRFWGRHGCT  87

Query  668  FDASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FD++G+G C TGD        G GG PP TLAEFT+ N   D+DFYDVSLVDGYN+ + I
Sbjct  88   FDSTGHGRCATGDCGGSLFCNGIGGTPPATLAEFTLGN---DQDFYDVSLVDGYNLPISI  144

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTH  321
             P  GSG C YAGCV+DLN  CP  LQV   D   VVACKSAC+ FN+P YCCTG+  + 
Sbjct  145  TPFKGSGKCSYAGCVSDLNLMCPVGLQVRSRDKKRVVACKSACSAFNSPRYCCTGNFGSP  204

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
              C PT YSRIFK ACPKAYSYAYDD +S  TC  + YLITFCP
Sbjct  205  QACKPTAYSRIFKTACPKAYSYAYDDPTSISTCTNASYLITFCP  248



>ref|XP_008461434.1| PREDICTED: thaumatin-like protein, partial [Cucumis melo]
Length=224

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 148/220 (67%), Gaps = 5/220 (2%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A  FTL N C   +WPG   G G   L  GGF L PGE+V + AP GWSGRFW R GC+F
Sbjct  8    AAVFTLENKCNDIIWPGIQPGAGRPQLMNGGFQLKPGETVTINAPTGWSGRFWGRRGCSF  67

Query  665  DASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            D SG G C TGD        G GGVPP TLAEFT+   ++  DFYDVSLVDGYN+ + I 
Sbjct  68   DVSGKGTCETGDCGGVLECVGAGGVPPATLAEFTL---DSPLDFYDVSLVDGYNIPISIA  124

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            PSGGS  CQ   C+ DLN +CP+ L++  + +V+ACKSAC  F+ PEYCCTG ++T  TC
Sbjct  125  PSGGSSTCQTVKCLTDLNQHCPDGLEMKKNDTVIACKSACLAFDKPEYCCTGAYSTPKTC  184

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
             PT YS+ FK ACP AYSYAYDD SSTFTC  ++Y I FC
Sbjct  185  KPTVYSKAFKLACPMAYSYAYDDASSTFTCQKANYSIGFC  224



>ref|XP_009415311.1| PREDICTED: pathogenesis-related protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=261

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 165/225 (73%), Gaps = 7/225 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            A  +FTL N C YT+WPGTLSGNG A LG GGF LS  ++    AP GWSGRFWART C 
Sbjct  29   AGATFTLKNNCPYTIWPGTLSGNGAALLGGGGFELSLNDTASFSAPPGWSGRFWARTRCL  88

Query  668  F-DASGNGNCVTgdcgglkc-gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
               +S NG C TGDCGG+     GG PP +LAEFT+ +G+  +DFYDVSLVDGYNV +G+
Sbjct  89   LGSSSSNGTCATGDCGGVLRCVVGGAPPASLAEFTLGSGDGTQDFYDVSLVDGYNVGIGV  148

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQV-TDSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            RPS GS  C+YAGCVAD+N  CP  L+V  +SG  VAC+SAC  F  PEYCCTG H + A
Sbjct  149  RPSRGS--CRYAGCVADVNARCPAELRVPAESGETVACRSACEAFGAPEYCCTGAHGSPA  206

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAG--SDYLITFCP  189
            TC PT+YS++FK ACP AYSYAYDD +STFTCA   +DYLITFCP
Sbjct  207  TCGPTRYSQLFKAACPAAYSYAYDDATSTFTCAAGTADYLITFCP  251



>ref|XP_009106020.1| PREDICTED: thaumatin-like protein isoform X2 [Brassica rapa]
Length=264

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 150/224 (67%), Gaps = 7/224 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A +   +N CTYTVWPG  + +G   L  GGF LSP  +  LQ P+ WSGRFW R GC+
Sbjct  40   SASTVIFYNKCTYTVWPGIQASSGQPLLAGGGFKLSPKRAYTLQLPSLWSGRFWGRHGCS  99

Query  668  FDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FD SG G C TG      L  G GGVPP TLAE T+ +   ++DFYDVSLVDGYN+ + I
Sbjct  100  FDRSGRGRCATGDCGGSLLCNGAGGVPPATLAEITLGH---EQDFYDVSLVDGYNLAMSI  156

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTH  321
             P  G+G C YAGCV+DLN  CP  LQV   D   VVACKSAC+ FN+P YCCTG     
Sbjct  157  MPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGKQVVACKSACSAFNSPRYCCTGSFGNP  216

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             TC PT YS+IFK ACPKAYSYAYDD +S  TC  ++Y++TFCP
Sbjct  217  QTCRPTAYSKIFKVACPKAYSYAYDDPTSIATCTKANYVVTFCP  260



>ref|XP_004297839.1| PREDICTED: thaumatin-like protein 1-like [Fragaria vesca subsp. 
vesca]
Length=252

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 146/222 (66%), Gaps = 6/222 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C +TVWPGTL+G GGA L   GF L+ G S  L  PA WSGRFW RT C+ DA
Sbjct  24   TFTFTNNCPFTVWPGTLTGGGGAQLSSTGFELASGASSTLDVPAPWSGRFWGRTQCSTDA  83

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG   C T           G G +PP +L E T+A GN  +DFYD+SLVDG+NV + + P
Sbjct  84   SGKFTCATADCGSGQVACHGAGAIPPASLVELTLA-GNGGQDFYDISLVDGFNVPVLLSP  142

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDS-GSVVACKSACAQFNTPEYCCTGDHNTHATC  312
             GGSG C    C  ++N  CP  L V  S G V+ACKSAC  FN P+YCCTGDH T  TC
Sbjct  143  QGGSGGCSATTCAGNVNAVCPAELAVKGSDGGVIACKSACLVFNQPQYCCTGDHGTPETC  202

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTC-AGSDYLITFCP  189
             PT YSR+FKN CP+AYSYAYDD SSTFTC  G +YL+TFCP
Sbjct  203  PPTDYSRVFKNQCPQAYSYAYDDKSSTFTCNGGPNYLVTFCP  244



>gb|KHG18980.1| hypothetical protein F383_08602 [Gossypium arboreum]
Length=240

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 148/222 (67%), Gaps = 5/222 (2%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A + TL+N C++ VWPG     G   L  GGF L P ++  +  P  WSGRFW R GC+
Sbjct  19   SATTITLYNKCSHPVWPGIQPSAGKPILARGGFKLPPNKAYSMNLPPLWSGRFWGRHGCS  78

Query  668  FDASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FDASG+G C TGD        G GG PP TLAE T+A     +DFYDVSLVDGYN+ + I
Sbjct  79   FDASGHGRCATGDCGGSLFCNGLGGTPPATLAEITLAQ---QQDFYDVSLVDGYNIAMSI  135

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
             P  G+G C YAGCV+DLN  CP  LQV D+  VVACKSAC  FN+P YCCTG   +  +
Sbjct  136  TPFKGAGKCSYAGCVSDLNLMCPVALQVRDNKQVVACKSACFAFNSPRYCCTGSFGSPQS  195

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            C PT YS+IFK ACPKAYSYAYDD +S  TC+  +YL+TFCP
Sbjct  196  CKPTAYSKIFKTACPKAYSYAYDDPTSIATCSRGNYLVTFCP  237



>ref|XP_004135916.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 ref|XP_004167983.1| PREDICTED: thaumatin-like protein-like [Cucumis sativus]
 gb|KGN45153.1| hypothetical protein Csa_7G428900 [Cucumis sativus]
Length=234

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 147/220 (67%), Gaps = 5/220 (2%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A  FTL N C   +WPG   G G   L  GGF L PGE+V + AP GWSGRFW R GC+F
Sbjct  18   AAVFTLENKCNDIIWPGIQPGAGRPQLMNGGFQLKPGETVTINAPTGWSGRFWGRRGCSF  77

Query  665  DASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            D SG G C TGD        G GGVPP TLAEFT+   ++  DFYDVSLVDGYN+ + I 
Sbjct  78   DVSGKGTCQTGDCGGVLECAGAGGVPPATLAEFTL---DSPLDFYDVSLVDGYNIPISIA  134

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            PSGGS  CQ   C+ DLN +CP+ L++  + +V+ CKSAC  FN PEYCCTG ++T  TC
Sbjct  135  PSGGSSTCQTVKCLTDLNQHCPDGLEMKKNDTVIGCKSACLAFNKPEYCCTGVYSTPKTC  194

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
             PT YS+ FK ACP AYSYAYDD SSTFTC  ++Y I FC
Sbjct  195  KPTVYSKAFKLACPLAYSYAYDDGSSTFTCQKANYSIGFC  234



>ref|XP_002513184.1| Zeamatin precursor, putative [Ricinus communis]
 gb|EEF49175.1| Zeamatin precursor, putative [Ricinus communis]
Length=234

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 154/220 (70%), Gaps = 7/220 (3%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A  FTL N C  T+WPGTLSG G   L  GG  L PG ++ +  P  WSGRFWARTGC F
Sbjct  20   AAIFTLQNNCRSTIWPGTLSGKG-PLLINGGTRLKPGRTMRINVPHKWSGRFWARTGCKF  78

Query  665  DASGNGNCVTgdcgglkc--gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            D +G G C TGDCGGLK   G G VPPVTLAEFT+     D +FYDVSLVDGYN+ + I 
Sbjct  79   DQTGKGKCATGDCGGLKHCGGAGSVPPVTLAEFTLD----DLNFYDVSLVDGYNIPISIY  134

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            P GGSGDC+   C ++LN  CP+ LQV ++G +VACKSAC  +NTP+YCC+G + +  TC
Sbjct  135  PYGGSGDCKKVECFSNLNPRCPKDLQVINNGKIVACKSACTAYNTPKYCCSGAYGSPQTC  194

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
             PT +SRIFK ACP  YSYAYDD +STFTC  ++Y I FC
Sbjct  195  KPTGFSRIFKAACPTYYSYAYDDATSTFTCKDANYRIKFC  234



>ref|XP_007202291.1| hypothetical protein PRUPE_ppa009119mg [Prunus persica]
 gb|EMJ03490.1| hypothetical protein PRUPE_ppa009119mg [Prunus persica]
Length=306

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 148/219 (68%), Gaps = 8/219 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C +TVWPG L+  G   L   GF L+ G +   QAP GWSGRFW RTGCNFD 
Sbjct  24   TFTFTNKCDFTVWPGILASAGTPKLDSTGFELAKGSTRSFQAPTGWSGRFWGRTGCNFDG  83

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G+C TG          G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ + +  
Sbjct  84   SGHGSCSTGDCGSGQLECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGYNLPMIVEG  141

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGGSG C   GC  DLN  CP  L+V   G   ACKSAC  F +PEYCC GD+ + +TC 
Sbjct  142  SGGSGTCASTGCATDLNRRCPAELKVDGGG---ACKSACDAFGSPEYCCNGDYGSPSTCK  198

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            P+ YS++FK+ACPK+YSYAYDD SSTFTC G+DY ITFC
Sbjct  199  PSMYSQLFKSACPKSYSYAYDDASSTFTCTGADYTITFC  237



>ref|XP_003538880.1| PREDICTED: thaumatin-like protein 1-like [Glycine max]
Length=304

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 150/222 (68%), Gaps = 6/222 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT+ N C+YTVWPG L+G G + L   GF L PGES  +  PA WSGR W RT C  DA
Sbjct  27   TFTIVNKCSYTVWPGILTGAGTSPLSTTGFVLQPGESNVITVPAAWSGRLWGRTVCTQDA  86

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            +G  +CVTG          G G  PP TLAEFT+ NG    DF+DVSLVDGYN+ + + P
Sbjct  87   TGKFSCVTGDCGSSAVECNGAGAAPPATLAEFTL-NGAGGLDFFDVSLVDGYNLPMIVEP  145

Query  488  SGGSG--DCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
             GGSG  +C   GCV DLNT CP  L+V  SG  VACKSAC  F+ P+YCC+G + T  T
Sbjct  146  QGGSGAGNCSATGCVVDLNTPCPTELKVMSSGDGVACKSACEAFDDPQYCCSGAYATPDT  205

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            C P+ YS+ FK+ACP+AYSYAYDD SSTFTCA +DY ITFCP
Sbjct  206  CKPSSYSQFFKSACPRAYSYAYDDGSSTFTCASADYTITFCP  247



>ref|XP_006425448.1| hypothetical protein CICLE_v10026139mg [Citrus clementina]
 gb|ESR38688.1| hypothetical protein CICLE_v10026139mg [Citrus clementina]
Length=309

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 149/230 (65%), Gaps = 13/230 (6%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            I+    AG+FT  N C YTVWPG L   G   L   GF L  G S   QAP GWSGRFW 
Sbjct  17   ISKGVTAGTFTFVNKCDYTVWPGLL---GSPKLDSTGFELQKGGSRSFQAPTGWSGRFWG  73

Query  683  RTGCNFDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
            RTGCNFD+SG+G+C T           G G  PP TLAEFT+ +G+  +DFYDVSLVDGY
Sbjct  74   RTGCNFDSSGHGSCATADCGSNQVECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGY  131

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            N+ + +  SGGSG C   GCV DLN +CP  L+V        C+SAC  F  PEYCC+G 
Sbjct  132  NIPIVVEGSGGSGACAPTGCVTDLNRSCPNELRVQG-----GCRSACEAFGNPEYCCSGS  186

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
             N+ ATC P+ YS IFKNACPK+YSYAYDD +STFTC  +DY ITFCP S
Sbjct  187  FNSPATCKPSMYSSIFKNACPKSYSYAYDDATSTFTCTAADYTITFCPSS  236



>emb|CDO98353.1| unnamed protein product [Coffea canephora]
Length=249

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 147/224 (66%), Gaps = 7/224 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A + T +N C++ VWPG     G   L  GGF L P  S  L+ PAGWSGRFW R GC+
Sbjct  26   SATTMTFYNKCSHPVWPGIQPSAGKPILARGGFKLPPNRSYSLRLPAGWSGRFWGRHGCS  85

Query  668  FDASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FDASG G C TGD        G GG PP TLAE T+ N   ++DFYDVSLVDGYN+ + I
Sbjct  86   FDASGRGRCATGDCGGSLFCNGLGGTPPATLAEITLGN---EQDFYDVSLVDGYNLAISI  142

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTH  321
             P  GSG C YAGCV+DLN  CP  LQV   D   VVACKSAC  FN+P YCCTG     
Sbjct  143  TPFRGSGKCSYAGCVSDLNMMCPVGLQVRSHDKRRVVACKSACFAFNSPRYCCTGSFGNP  202

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             +C PT YS+IFK ACP+AYSYAYDD +S  TC G +YL+TFCP
Sbjct  203  QSCKPTAYSKIFKAACPRAYSYAYDDPTSIATCTGGNYLVTFCP  246



>ref|NP_001288837.1| thaumatin-like protein precursor [Brassica rapa]
 gb|ABV89611.1| thaumatin-like protein [Brassica rapa]
Length=245

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 149/223 (67%), Gaps = 7/223 (3%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A +   +N CTYTVWPG  + +G   L  GGF LSP  +  LQ P+ WSGRFW R GC+F
Sbjct  22   ASTVIFYNKCTYTVWPGIQASSGQPLLAGGGFKLSPKRAYTLQLPSLWSGRFWGRHGCSF  81

Query  665  DASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            D SG G C TG      L  G GGVPP TLAE T+ +   ++DFYDVSLVDGYN+ + I 
Sbjct  82   DRSGRGRCATGDCGGSLLCNGAGGVPPATLAEITLGH---EQDFYDVSLVDGYNLAMSIM  138

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P  G+G C YAGCV+DLN  CP  LQV   D   VVACKSAC+ FN+P YCCTG      
Sbjct  139  PVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGKQVVACKSACSAFNSPRYCCTGSFGNPQ  198

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TC PT YS+IFK ACPKAYSYAYDD +S  TC  ++Y++TFCP
Sbjct  199  TCRPTAYSKIFKVACPKAYSYAYDDPTSIATCTKANYVVTFCP  241



>ref|XP_010436965.1| PREDICTED: thaumatin-like protein 1 [Camelina sativa]
Length=349

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 147/222 (66%), Gaps = 7/222 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C YTVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC FD 
Sbjct  30   TFTFANRCGYTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCKFDG  89

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C TG          G G  PPVTLAEFT+     D DFYDVSLVDGYN+ + +  
Sbjct  90   SGSGTCTTGDCGSNQVECVGLGAAPPVTLAEFTLGTTGGD-DFYDVSLVDGYNIPMIVEV  148

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GGSG C   GC +D+NT CP  L+  D     ACKSAC  F +PEYCC+G + T +TC 
Sbjct  149  AGGSGQCASTGCTSDINTQCPAELRFGDGD---ACKSACEAFRSPEYCCSGAYATPSTCR  205

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS++FK ACP++YSYAYDD +STFTCAG DY +TFCP S
Sbjct  206  PSVYSQMFKAACPRSYSYAYDDATSTFTCAGGDYTVTFCPSS  247



>ref|XP_002868852.1| hypothetical protein ARALYDRAFT_912315 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45111.1| hypothetical protein ARALYDRAFT_912315 [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 146/222 (66%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C +TVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC FD 
Sbjct  30   TFTFANRCGFTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCKFDG  89

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C TG          G G  PPVTLAEFT+  G    DFYDVSLVDGYN+ + +  
Sbjct  90   SGSGTCTTGDCGSNTVECAGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNIPMIVEV  147

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GGSG C   GC +DLNT CP  L+  D     ACKSAC  F +PEYCC+G + T +TC 
Sbjct  148  AGGSGQCASTGCTSDLNTQCPAELRFGDGD---ACKSACEAFRSPEYCCSGAYATPSTCR  204

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTCAG DY +TFCP S
Sbjct  205  PSVYSEMFKAACPRSYSYAYDDATSTFTCAGGDYTVTFCPSS  246



>ref|XP_008440826.1| PREDICTED: thaumatin-like protein 1 [Cucumis melo]
Length=325

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 150/222 (68%), Gaps = 8/222 (4%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +  +FT  N C YTVWPG L+ +G   L   GF L  G S  LQA  GWSGRFW RT CN
Sbjct  27   SGATFTFVNKCDYTVWPGILASSGSPKLETTGFELQAGNSRSLQASTGWSGRFWGRTKCN  86

Query  668  FDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            FD SG G+C TG          G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ + 
Sbjct  87   FDDSGRGSCNTGDCGSGEIECNGAGATPPATLAEFTLGSGS--QDFYDVSLVDGYNLPMI  144

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            +  +GGSG C   GC+ DLN  CP  L+  D G   ACKSAC  F TPEYCC+G++N+ A
Sbjct  145  VEGTGGSGTCASTGCITDLNQLCPAELKAEDGG---ACKSACEAFETPEYCCSGEYNSPA  201

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            TC P+ YS++FK+ACPK+YSYAYDD +STFTC G+DY ITFC
Sbjct  202  TCRPSMYSQMFKSACPKSYSYAYDDATSTFTCNGADYTITFC  243



>gb|ABK25809.1| unknown [Picea sitchensis]
Length=243

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 150/222 (68%), Gaps = 7/222 (3%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A +FTL N C ++VWPG     G   L  GGF L P +++ +  PAGWSGR W R GC+F
Sbjct  25   ATTFTLFNKCKHSVWPGIQPSAGRPVLANGGFRLMPLQAMSIVPPAGWSGRIWGRHGCSF  84

Query  665  DASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            D+ G G C TG         G GG PP TLAE T+      +DFYDVSLVDGYN+ + I 
Sbjct  85   DSDGKGLCATGDCGGQLHCNGAGGAPPATLAEITLGT----QDFYDVSLVDGYNLPIAIA  140

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVT-DSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
            P  GSG C YAGC++DLN +CP  LQV  + G V+ACKSAC  F+TP+YCCTG +    T
Sbjct  141  PRRGSGKCTYAGCISDLNLSCPPSLQVKNEQGCVMACKSACFAFSTPQYCCTGSYGNPQT  200

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            C PT +SR+FKNACP+AYSYAYDD +S  TC+G+DYLITFCP
Sbjct  201  CRPTSFSRLFKNACPRAYSYAYDDPNSLVTCSGADYLITFCP  242



>ref|XP_006366508.1| PREDICTED: pathogenesis-related protein 5-like [Solanum tuberosum]
Length=238

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 149/218 (68%), Gaps = 6/218 (3%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FTL N C  T+WPG+LSG G   L  GG  L P E+ E+ AP GWSGRFWART C FD S
Sbjct  24   FTLKNNCNVTIWPGSLSGAGHPFLINGGLELQPYETTEINAPTGWSGRFWARTHCQFDTS  83

Query  656  GNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSG  483
            G G C T D        G GG PP +LAEFT+   ++  DFYDVS VDG+N+ + + PSG
Sbjct  84   GKGTCATADCGGVLQCNGAGGTPPASLAEFTL---DSPMDFYDVSFVDGFNIPISVYPSG  140

Query  482  GSGDCQYAGCVADLNTNCPEVLQV-TDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
            GSG+C    C +D+N  CP+ LQV T  G+ VACKSAC  FN PEYCCTG+ N  +TC P
Sbjct  141  GSGNCSNIQCSSDINLQCPQELQVKTYDGTTVACKSACFAFNKPEYCCTGEFNNPSTCKP  200

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            T+YS+ FKN+C  AYSYAYDD +S FTC G++YLI+FC
Sbjct  201  TEYSQYFKNSCRDAYSYAYDDATSIFTCKGANYLISFC  238



>ref|XP_006341532.1| PREDICTED: thaumatin-like protein-like [Solanum tuberosum]
Length=247

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 144/224 (64%), Gaps = 7/224 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A + TL N C++ VWPG     G   L  GGF L P ++  L  P GWSGR W R GC 
Sbjct  25   SATTMTLFNKCSHPVWPGIQPSAGKPILARGGFKLPPNKAYRLSMPVGWSGRVWGRHGCA  84

Query  668  FDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FDA+G G C TG         G GG PP TLAE T+ N   ++DFYDVSLVDGYN+ + +
Sbjct  85   FDATGRGRCATGDCGGSLFCNGIGGTPPATLAEITLGN---EQDFYDVSLVDGYNLAISV  141

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTH  321
             P  G G C YAGCV+DLNT CP  LQV   D   VVACKSAC+ FN+P YCCTG     
Sbjct  142  TPVRGKGKCSYAGCVSDLNTMCPAGLQVRSHDKSQVVACKSACSAFNSPRYCCTGTFGNP  201

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             TC PT YSRIFK ACPKAYSYAYDD +S  TC GS Y++TFCP
Sbjct  202  QTCKPTAYSRIFKTACPKAYSYAYDDPTSISTCTGSSYVLTFCP  245



>ref|XP_006466958.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Citrus 
sinensis]
Length=238

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 148/230 (64%), Gaps = 13/230 (6%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            I+    A +FT  N C YTVWPG L   G   L   GF L  G S   QAP GWSGRFW 
Sbjct  17   ISKGVTAATFTFVNKCDYTVWPGIL---GSPKLDSTGFELQKGGSRSFQAPTGWSGRFWG  73

Query  683  RTGCNFDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
            RTGCNFD+SG+G+C T           G G  PP TLAEFT+ +G+  +DFYDVSLVDGY
Sbjct  74   RTGCNFDSSGHGSCATADCGSNQVECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGY  131

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            N+ + +  SGGSG C   GCV DLN +CP  L+V        C+SAC  F  PEYCC+G 
Sbjct  132  NIPIVVEGSGGSGACAPTGCVTDLNRSCPNELRVQG-----GCRSACEAFGNPEYCCSGS  186

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
             N+ ATC P+ YS IFKNACPK+YSYAYDD +STFTC  +DY ITFCP S
Sbjct  187  FNSPATCKPSMYSSIFKNACPKSYSYAYDDATSTFTCTAADYTITFCPSS  236



>emb|CDX96487.1| BnaA07g30980D [Brassica napus]
Length=245

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 149/223 (67%), Gaps = 7/223 (3%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A +   +N CTYTVWPG  + +G   L  GGF LSP  +  LQ P+ WSGRFW R GC+F
Sbjct  22   ASTVIFYNKCTYTVWPGIQASSGQPLLAGGGFKLSPKRAYTLQLPSLWSGRFWGRHGCSF  81

Query  665  DASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            D SG G C TG      L  G GGVPP TLAE T+ +   ++DFYDVSLVDGYN+ + I 
Sbjct  82   DRSGRGRCATGDCGGSLLCNGAGGVPPATLAEITLGH---EQDFYDVSLVDGYNLAMSIM  138

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            P  G+G C YAGC++DLN  CP  LQV   D   VVACKSAC+ FN+P YCCTG      
Sbjct  139  PVKGTGKCTYAGCISDLNRMCPVGLQVRSRDGKQVVACKSACSAFNSPRYCCTGSFGNPQ  198

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            TC PT YS+IFK ACPKAYSYAYDD +S  TC  ++Y++TFCP
Sbjct  199  TCRPTAYSKIFKVACPKAYSYAYDDPTSIATCTKANYVVTFCP  241



>ref|XP_010097569.1| hypothetical protein L484_017379 [Morus notabilis]
 gb|EXB69101.1| hypothetical protein L484_017379 [Morus notabilis]
Length=249

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 145/226 (64%), Gaps = 7/226 (3%)
 Frame = -1

Query  854  VWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTG  675
            V A+ + TL+N C + VWPG     G   L  GGF L P ++  L+ P  WSGR W R G
Sbjct  24   VSASTTITLYNKCKHPVWPGIQPSAGQPILARGGFKLPPNKAYALRLPPLWSGRLWGRHG  83

Query  674  CNFDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDL  501
            C FDA G G C TG         G GG PP TLAE T+ N   D+DFYDVSLVDGYN+ +
Sbjct  84   CAFDAHGRGRCATGDCGGSLFCAGAGGAPPATLAEITLGN---DQDFYDVSLVDGYNLAI  140

Query  500  GIRPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHN  327
             I PS GSG C YAGCV+DLN  CP  LQV   D   VVACKSAC+ FN+P YCCTG   
Sbjct  141  SITPSKGSGKCSYAGCVSDLNVMCPASLQVRSGDGRRVVACKSACSAFNSPRYCCTGSFG  200

Query  326  THATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            +  +C PT YSRIFK ACPKAYSYAYDD +S  TC   +YL+TFCP
Sbjct  201  SPQSCKPTAYSRIFKAACPKAYSYAYDDPTSIATCTKGNYLVTFCP  246



>ref|XP_008448548.1| PREDICTED: thaumatin-like protein 1 [Cucumis melo]
 gb|ADN33946.1| zeamatin precursor [Cucumis melo subsp. melo]
Length=323

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 148/221 (67%), Gaps = 7/221 (3%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FT  N C +TVWPG LSG G       GF L  G S   QAPAGWSGRFW RT CNFD S
Sbjct  31   FTFVNKCDFTVWPGVLSGAGSLKFDTTGFELRKGSSRSFQAPAGWSGRFWGRTDCNFDGS  90

Query  656  GNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            G G C TG          G G  PP TLAEFT+ +GN+  DFYDVSLVDGYN+ + +  +
Sbjct  91   GRGVCNTGDCGSGEIECNGAGAAPPATLAEFTLGSGNS-PDFYDVSLVDGYNLAMIVEGT  149

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
            GG+G C   GCV DLN  CP  L+    G   AC+SAC +F TPEYCC+G + + ATC P
Sbjct  150  GGTGACGSTGCVTDLNRQCPLELRAEKGG---ACRSACEKFGTPEYCCSGAYGSPATCKP  206

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            ++YS IFK+ACP++YSYAYDD +STFTC+G+DY +TFCP S
Sbjct  207  SKYSEIFKSACPRSYSYAYDDATSTFTCSGADYTVTFCPSS  247



>ref|XP_010446375.1| PREDICTED: thaumatin-like protein 1 [Camelina sativa]
Length=341

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 146/222 (66%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C YTVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC FD 
Sbjct  30   TFTFANRCGYTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCQFDG  89

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C TG          G G  PPVTLAEFT+  G    DFYDVSLVDGYN+ + +  
Sbjct  90   SGSGTCTTGDCGSNQVECVGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNIPMIVEV  147

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GGSG C   GC +D+NT CP  L+  D     ACKSAC  F +PEYCC+G + T +TC 
Sbjct  148  AGGSGQCASTGCTSDINTQCPAELRFGDGD---ACKSACEAFRSPEYCCSGAYATPSTCR  204

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTCAG DY +TFCP S
Sbjct  205  PSVYSEMFKAACPRSYSYAYDDATSTFTCAGGDYTVTFCPSS  246



>gb|KCW56621.1| hypothetical protein EUGRSUZ_I02339 [Eucalyptus grandis]
Length=306

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 151/225 (67%), Gaps = 7/225 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            ++ +FT  N C + VWPG LSG G   L   GF L+ GES  LQ PAGWSGRFW R+GC+
Sbjct  9    SSATFTFVNKCNFPVWPGILSGAGSPPLETTGFELAKGESHSLQVPAGWSGRFWGRSGCS  68

Query  668  FDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            FD+SG G+C T           GG   PP TLAEFT+  G+  +DFYDVSLVDGYN+ + 
Sbjct  69   FDSSGRGSCATADCGSGEVECKGGNAAPPATLAEFTLG-GSGSQDFYDVSLVDGYNLPMV  127

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            I   GGSG C   GC  DLN  CP  L+ +     +ACKSAC  F +PEYCC+G +N+ +
Sbjct  128  IDGIGGSGKCVSTGCTTDLNRQCPAELRASGG---MACKSACEAFGSPEYCCSGAYNSPS  184

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
             C P+ YS+IFKNACP++YSYA+DD +STFTC G+DY ITFCP S
Sbjct  185  ACKPSLYSQIFKNACPRSYSYAFDDATSTFTCTGADYTITFCPNS  229



>ref|XP_004292943.1| PREDICTED: pathogenesis-related protein 5-like [Fragaria vesca 
subsp. vesca]
Length=341

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 149/221 (67%), Gaps = 8/221 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFD-  663
            +FT  N C Y V+PGTLSG+    L   GF L PGES  LQAP  WSGRFW RTGCNFD 
Sbjct  29   TFTFINRCDYAVYPGTLSGSSSPPLETTGFQLQPGESRSLQAPPSWSGRFWGRTGCNFDP  88

Query  662  ASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
             +G G+C +           G G +PP TLAEFTI +G+  KDFYDVSLVDG+N+ + + 
Sbjct  89   TTGQGSCTSADCGSNQLQCNGAGAIPPATLAEFTIGSGDT-KDFYDVSLVDGFNLPMLVE  147

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            PSGGSGDC   GC  +LN  CP  LQ    G    C+SAC  F TPEYCC+G + + +TC
Sbjct  148  PSGGSGDCSITGCSVNLNKGCPSELQF---GGGAGCRSACEAFQTPEYCCSGAYGSPSTC  204

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             P+ YS++FK ACP AYSYAYDD +STFTC+G+DY ITFCP
Sbjct  205  KPSVYSQMFKAACPTAYSYAYDDGTSTFTCSGADYAITFCP  245



>ref|XP_009356044.1| PREDICTED: thaumatin-like protein [Pyrus x bretschneideri]
Length=250

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 150/229 (66%), Gaps = 7/229 (3%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            + +V +A + T++N CT+ VWPG     G   L  GGF L P ++  L  P  WSGRFW 
Sbjct  22   LVSVSSATTLTMYNKCTHPVWPGIQPSAGQPLLARGGFTLPPNKAHTLHLPRLWSGRFWG  81

Query  683  RTGCNFDASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYN  510
            R GC FDASG G C TGD        G GG PP TLAE T+ N   D+DFYDVSLVDGYN
Sbjct  82   RHGCAFDASGRGRCATGDCGGNLFCSGLGGTPPATLAEITLGN---DQDFYDVSLVDGYN  138

Query  509  VDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTG  336
            + + I P  GSG C YAGCV+DLN  CP  LQV   D+  VVACKSAC+ FN+P YCCTG
Sbjct  139  LAISITPFKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRRVVACKSACSAFNSPRYCCTG  198

Query  335  DHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
               +  +C PT YS+IFK ACPKAYSYAYDD +S  TC   +YL+TFCP
Sbjct  199  SFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYLVTFCP  247



>ref|XP_011046459.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Populus 
euphratica]
Length=340

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 152/222 (68%), Gaps = 8/222 (4%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A +FT  N C YTVWPG L+  G   L   GF L    S    AP GWSGRFWARTGCNF
Sbjct  29   AATFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDSSRSFIAPTGWSGRFWARTGCNF  88

Query  665  DASGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            D SG G+C TGDCG  +    G+   PP TLAEFT+ +G   +DFYDVSLVDGYN+ + +
Sbjct  89   DESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLGSGG--QDFYDVSLVDGYNLPMVV  146

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
              SGGSG C   GCV+DLN  CP+ L+   SG   ACKSAC  F +PEYCC+G  NT AT
Sbjct  147  EGSGGSGMCASTGCVSDLNRQCPQELR---SGEGDACKSACEAFGSPEYCCSGAFNTPAT  203

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            C P+ YS +FK ACPK+YSYAYDD +STFTC+G+DY +TFCP
Sbjct  204  CKPSVYSEMFKAACPKSYSYAYDDATSTFTCSGADYTVTFCP  245



>ref|XP_011046468.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Populus 
euphratica]
Length=339

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 152/222 (68%), Gaps = 8/222 (4%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A +FT  N C YTVWPG L+  G   L   GF L    S    AP GWSGRFWARTGCNF
Sbjct  29   AATFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDSSRSFIAPTGWSGRFWARTGCNF  88

Query  665  DASGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            D SG G+C TGDCG  +    G+   PP TLAEFT+ +G   +DFYDVSLVDGYN+ + +
Sbjct  89   DESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLGSGG--QDFYDVSLVDGYNLPMVV  146

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
              SGGSG C   GCV+DLN  CP+ L+   SG   ACKSAC  F +PEYCC+G  NT AT
Sbjct  147  EGSGGSGMCASTGCVSDLNRQCPQELR---SGEGDACKSACEAFGSPEYCCSGAFNTPAT  203

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            C P+ YS +FK ACPK+YSYAYDD +STFTC+G+DY +TFCP
Sbjct  204  CKPSVYSEMFKAACPKSYSYAYDDATSTFTCSGADYTVTFCP  245



>gb|ABK92515.1| unknown [Populus trichocarpa]
 gb|AFZ78665.1| thaumatin [Populus tomentosa]
Length=344

 Score =   241 bits (616),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 152/222 (68%), Gaps = 8/222 (4%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A +FT  N C YTVWPG L+  G   L   GF L    S    AP GWSGRFWARTGCNF
Sbjct  29   AATFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDSSRSFIAPTGWSGRFWARTGCNF  88

Query  665  DASGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            D SG G+C TGDCG  +    G+   PP TLAEFT+ +G   +DFYDVSLVDGYN+ + +
Sbjct  89   DESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLGSGG--QDFYDVSLVDGYNLPMVV  146

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
              SGGSG C   GCV+DLN  CP+ L+   SG   ACKSAC  F +PEYCC+G  NT AT
Sbjct  147  EGSGGSGMCASTGCVSDLNRQCPQELR---SGEGDACKSACEAFGSPEYCCSGAFNTPAT  203

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            C P+ YS +FK ACPK+YSYAYDD +STFTC+G+DY +TFCP
Sbjct  204  CKPSVYSEMFKAACPKSYSYAYDDATSTFTCSGADYTVTFCP  245



>ref|XP_008801393.1| PREDICTED: pathogenesis-related protein 5-like isoform X2 [Phoenix 
dactylifera]
Length=279

 Score =   239 bits (610),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 144/219 (66%), Gaps = 3/219 (1%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT++N C + +WPGTL+G G   L   GF L PG S  + AP GWSGRFWARTGC FDA
Sbjct  25   TFTIYNNCPHAIWPGTLAGAGTPQLPTTGFRLEPGRSERIAAPPGWSGRFWARTGCKFDA  84

Query  659  SGNGNCVTgdcgglkc--gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
             G G C TGDC G     G G +PP TL E T+  G  D+DFYDVSLVDGYN+ +   P 
Sbjct  85   EGAGTCQTGDCAGRMECGGAGALPPATLFEITLGKGK-DRDFYDVSLVDGYNLPIAAAPR  143

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
               G C   GCVADLN+ CP+ LQV   G VVACKSAC  F   +YCC+G+     TC P
Sbjct  144  VPRGRCNITGCVADLNSACPKELQVDGDGGVVACKSACEAFGLDKYCCSGEFGNPTTCKP  203

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            + YS IFK ACP+AYSYAYDD +STFTC   DY I FCP
Sbjct  204  SYYSSIFKTACPRAYSYAYDDGTSTFTCKAYDYTIVFCP  242



>ref|XP_004287804.1| PREDICTED: thaumatin-like protein 1-like [Fragaria vesca subsp. 
vesca]
Length=310

 Score =   240 bits (613),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 151/228 (66%), Gaps = 7/228 (3%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            IT   +  +FT  N C +TVWPG L+  G  +L   GF L+ G S   QAPAGWSGRFWA
Sbjct  18   ITKGVSGATFTFVNKCEFTVWPGILASAGSPNLDSTGFELAKGASRTFQAPAGWSGRFWA  77

Query  683  RTGCNFDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNA-DKDFYDVSLVDG  516
            RT C+FDASG G+C T           G G  PP TLAEFT+ +G+   +DFYDVSLVDG
Sbjct  78   RTRCSFDASGLGSCATADCGSGQLECNGAGAAPPATLAEFTLGSGSGGTQDFYDVSLVDG  137

Query  515  YNVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTG  336
            YN+ + +  SGGSG C   GC  DLN +CP  L+V D     ACKSAC  F TPEYCC G
Sbjct  138  YNLPMIVEGSGGSGTCATTGCATDLNRSCPNELKVEDGD---ACKSACDAFGTPEYCCNG  194

Query  335  DHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
             + +  TC P+ YS++FK+ACPK+YSYAYDD SSTFTC G+DY ITFC
Sbjct  195  AYGSPDTCKPSIYSQLFKSACPKSYSYAYDDASSTFTCTGADYTITFC  242



>ref|XP_010029672.1| PREDICTED: thaumatin-like protein 1 [Eucalyptus grandis]
Length=325

 Score =   241 bits (614),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 151/225 (67%), Gaps = 7/225 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            ++ +FT  N C + VWPG LSG G   L   GF L+ GES  LQ PAGWSGRFW R+GC+
Sbjct  28   SSATFTFVNKCNFPVWPGILSGAGSPPLETTGFELAKGESHSLQVPAGWSGRFWGRSGCS  87

Query  668  FDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            FD+SG G+C T           GG   PP TLAEFT+  G+  +DFYDVSLVDGYN+ + 
Sbjct  88   FDSSGRGSCATADCGSGEVECKGGNAAPPATLAEFTLG-GSGSQDFYDVSLVDGYNLPMV  146

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            I   GGSG C   GC  DLN  CP  L+ +     +ACKSAC  F +PEYCC+G +N+ +
Sbjct  147  IDGIGGSGKCVSTGCTTDLNRQCPAELRASGG---MACKSACEAFGSPEYCCSGAYNSPS  203

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
             C P+ YS+IFKNACP++YSYA+DD +STFTC G+DY ITFCP S
Sbjct  204  ACKPSLYSQIFKNACPRSYSYAFDDATSTFTCTGADYTITFCPNS  248



>ref|XP_002313721.2| hypothetical protein POPTR_0009s13510g [Populus trichocarpa]
 gb|EEE87676.2| hypothetical protein POPTR_0009s13510g [Populus trichocarpa]
Length=344

 Score =   241 bits (616),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 152/222 (68%), Gaps = 8/222 (4%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A +FT  N C YTVWPG L+  G   L   GF L    S    AP GWSGRFWARTGCNF
Sbjct  29   AATFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDSSRSFIAPTGWSGRFWARTGCNF  88

Query  665  DASGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            D SG G+C TGDCG  +    G+   PP TLAEFT+ +G   +DFYDVSLVDGYN+ + +
Sbjct  89   DESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLGSGG--QDFYDVSLVDGYNLPMVV  146

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
              SGGSG C   GCV+DLN  CP+ L+   SG   ACKSAC  F +PEYCC+G  NT AT
Sbjct  147  EGSGGSGMCASTGCVSDLNRQCPQELR---SGEGDACKSACEAFGSPEYCCSGAFNTPAT  203

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            C P+ YS +FK ACPK+YSYAYDD +STFTC+G+DY +TFCP
Sbjct  204  CKPSVYSEMFKAACPKSYSYAYDDATSTFTCSGADYTVTFCP  245



>ref|XP_006451631.1| hypothetical protein CICLE_v10009291mg [Citrus clementina]
 ref|XP_006490768.1| PREDICTED: thaumatin-like protein-like [Citrus sinensis]
 gb|ESR64871.1| hypothetical protein CICLE_v10009291mg [Citrus clementina]
 gb|KDO63812.1| hypothetical protein CISIN_1g025749mg [Citrus sinensis]
Length=248

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 142/221 (64%), Gaps = 5/221 (2%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A + TL N C + VWPG  +  G   L  GGF L P ++  ++ P  WSGRFW R GC F
Sbjct  27   ATTITLFNKCEHPVWPGIQASAGKPLLARGGFKLPPNKAYTIRLPPLWSGRFWGRHGCRF  86

Query  665  DASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            DASG G C TG         G GG PP TLAE T+      +DFYDVSLVDGYN+ + I 
Sbjct  87   DASGRGRCATGDCGGSLFCNGIGGSPPATLAEITLGQ---QQDFYDVSLVDGYNIAMSIL  143

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            P  GSG C YAGCV+DLN  CP  LQV  +  VVACKSAC  FN+P YCCTG      +C
Sbjct  144  PIRGSGKCSYAGCVSDLNLMCPAGLQVRSNSRVVACKSACFAFNSPRYCCTGSFGNPQSC  203

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT YSRIFK ACP+AYSYAYDD +S  TC GS+YL+TFCP
Sbjct  204  KPTAYSRIFKAACPRAYSYAYDDPTSIATCTGSNYLLTFCP  244



>ref|XP_002322099.1| hypothetical protein POPTR_0015s04510g [Populus trichocarpa]
 gb|EEF06226.1| hypothetical protein POPTR_0015s04510g [Populus trichocarpa]
Length=248

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 143/221 (65%), Gaps = 7/221 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            + TLHN CT+ VWPG     G   L  GGF L P ++  L  P  WSGR W R GC+FDA
Sbjct  28   TITLHNKCTHPVWPGVQPSAGRPVLARGGFKLPPNKAYTLNLPPLWSGRLWGRHGCSFDA  87

Query  659  SGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            SG G C TGD        G GG PP TLAE T+ N   D+DFYDVSLVDGYN+ + I P 
Sbjct  88   SGRGGCATGDCGGSLYCNGIGGTPPATLAEITLGN---DQDFYDVSLVDGYNLAISITPF  144

Query  485  GGSGDCQYAGCVADLNTNCPEVLQV--TDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
             GSG C YAGCV DLN  CP  LQV   D+  VVACKSAC+ FN+P YCCTG   T   C
Sbjct  145  KGSGKCSYAGCVRDLNMMCPVGLQVRSKDNNRVVACKSACSAFNSPRYCCTGSFGTPQAC  204

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT YSRIFK ACPKAYSYAYDD +S  TC   +YL+TFCP
Sbjct  205  KPTAYSRIFKAACPKAYSYAYDDPTSIATCTRGNYLVTFCP  245



>gb|AAM64698.1| putative thaumatin-like protein [Arabidopsis thaliana]
Length=345

 Score =   241 bits (616),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 145/222 (65%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C YTVWPG LS  G   L   GF L  G S  LQAP GWSGRFWARTGC FD+
Sbjct  31   TFTFANRCGYTVWPGILSNAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCKFDS  90

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C TG          G G  PPVTLAEFT+  G    DFYDVSLVDGYN+ + +  
Sbjct  91   SGSGTCKTGDCGSNSVECAGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNIPMIVEV  148

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GGSG C   GC  DLN  CP  L+  D     ACKSAC  F +PEYCC+G + T ++C 
Sbjct  149  AGGSGQCASTGCTTDLNIQCPAELRFGDGD---ACKSACLAFRSPEYCCSGAYATPSSCR  205

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTCAG DY +TFCP S
Sbjct  206  PSVYSEMFKAACPRSYSYAYDDATSTFTCAGGDYTVTFCPSS  247



>ref|XP_011084258.1| PREDICTED: thaumatin-like protein [Sesamum indicum]
Length=248

 Score =   238 bits (607),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 143/221 (65%), Gaps = 7/221 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            + TL+N C++ VWPG     G   L  GGF L P +S  +Q PAGWSGR W R GC+F+A
Sbjct  29   TMTLYNKCSHPVWPGIQPSAGKPVLARGGFKLPPNKSYTVQLPAGWSGRVWGRHGCSFNA  88

Query  659  SGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
             G G C TG         G GG PP TLAE T+ N   D+DFYDVSLVDGYN+ + I P 
Sbjct  89   EGRGRCATGDCGGALFCNGIGGPPPATLAEITLGN---DQDFYDVSLVDGYNLAISITPF  145

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
             G G C YAGCV+DLN  CP  LQV   D  SVVACKSAC  FN+P YCCTG      +C
Sbjct  146  RGKGKCSYAGCVSDLNMMCPVGLQVRSHDKKSVVACKSACFAFNSPRYCCTGSFGNPQSC  205

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT YSRIFK ACPKAYSYAYDD +S  TC G  YL+TFCP
Sbjct  206  KPTAYSRIFKAACPKAYSYAYDDPTSIATCTGGSYLLTFCP  246



>ref|XP_006379282.1| hypothetical protein POPTR_0009s13510g [Populus trichocarpa]
 gb|ERP57079.1| hypothetical protein POPTR_0009s13510g [Populus trichocarpa]
Length=343

 Score =   241 bits (615),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 152/222 (68%), Gaps = 8/222 (4%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A +FT  N C YTVWPG L+  G   L   GF L    S    AP GWSGRFWARTGCNF
Sbjct  29   AATFTFVNKCEYTVWPGILANAGSPRLDSTGFELLKDSSRSFIAPTGWSGRFWARTGCNF  88

Query  665  DASGNGNCVTgdcgglkcgggGV---PPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            D SG G+C TGDCG  +    G+   PP TLAEFT+ +G   +DFYDVSLVDGYN+ + +
Sbjct  89   DESGTGSCSTGDCGSGQVECNGLGASPPATLAEFTLGSGG--QDFYDVSLVDGYNLPMVV  146

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
              SGGSG C   GCV+DLN  CP+ L+   SG   ACKSAC  F +PEYCC+G  NT AT
Sbjct  147  EGSGGSGMCASTGCVSDLNRQCPQELR---SGEGDACKSACEAFGSPEYCCSGAFNTPAT  203

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            C P+ YS +FK ACPK+YSYAYDD +STFTC+G+DY +TFCP
Sbjct  204  CKPSVYSEMFKAACPKSYSYAYDDATSTFTCSGADYTVTFCP  245



>ref|XP_008444818.1| PREDICTED: thaumatin-like protein 1b [Cucumis melo]
Length=250

 Score =   238 bits (607),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 148/222 (67%), Gaps = 10/222 (5%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFD-A  660
            FT  N C +TVWPG L   G   L   GF LSPG +   QAP GWSGRFW RTGC+FD A
Sbjct  33   FTFVNRCDFTVWPGIL---GNPQLESTGFELSPGATRSFQAPPGWSGRFWGRTGCSFDPA  89

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            +G GNC T           G G  PP TLAEFTI  G   +DFYDVSLVDGYN+ + +  
Sbjct  90   TGQGNCQTADCGSNQIECNGAGATPPATLAEFTIGGGAGGQDFYDVSLVDGYNIPMVVDA  149

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GGSG+CQ  GC A+LN  CP  L+   +G   AC+SAC  F  PEYCC+G +N+ A C 
Sbjct  150  TGGSGECQSTGCAAELNRRCPAELR---AGEGKACRSACEAFGNPEYCCSGAYNSPAACK  206

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK+ACPK+YSYA+DD +STFTC+G+DY ITFCP S
Sbjct  207  PSIYSEMFKSACPKSYSYAFDDATSTFTCSGADYTITFCPSS  248



>ref|XP_011087313.1| PREDICTED: pathogenesis-related protein 5-like [Sesamum indicum]
Length=242

 Score =   238 bits (606),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 148/227 (65%), Gaps = 12/227 (5%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A  FTL N C  TVWPG LSG+G   L  GG  L P +  ++ AP GWSGRFW RTGCNF
Sbjct  19   AAVFTLQNRCKETVWPGILSGSGKPLLMSGGLELKPDQKTDVPAPTGWSGRFWPRTGCNF  78

Query  665  DASGN-GNCVT---gdcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            D SG  GNC T   G       G GG PPV+LAEFT+   ++  DFYDVSLVDG+NV + 
Sbjct  79   DQSGKQGNCTTGDCGGGLLECGGTGGAPPVSLAEFTL---DSPLDFYDVSLVDGFNVPVS  135

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQV-----TDSGSVVACKSACAQFNTPEYCCTGD  333
            I PSGGSG+C    C ++LN  CPE LQV     ++  + VACKSAC  FN P+YCC G+
Sbjct  136  IIPSGGSGNCSAVNCTSNLNLECPEKLQVRGYDKSNGETTVACKSACLAFNEPQYCCAGE  195

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
             N    C P+ YS IFK ACP +YSY YDD +STFTC G++YLI FC
Sbjct  196  FNNPEVCKPSNYSEIFKKACPTSYSYPYDDATSTFTCKGANYLIIFC  242



>ref|XP_002529658.1| Zeamatin precursor, putative [Ricinus communis]
 gb|EEF32745.1| Zeamatin precursor, putative [Ricinus communis]
Length=316

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 148/220 (67%), Gaps = 11/220 (5%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FTL N C YTVWPG L   G   L   GF L  G S   QAP GWSGRFW RTGC FD 
Sbjct  22   TFTLINKCDYTVWPGIL---GNPKLDSTGFELPKGSSRSFQAPTGWSGRFWGRTGCTFDT  78

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G+C T           G    PP TLAEFT+ +G+  +DFYDVSLVDGYN+ + +  
Sbjct  79   SGHGSCSTADCGSSQLECNGNSAAPPATLAEFTLGSGS--QDFYDVSLVDGYNLPMLVEV  136

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GGSG+C   GCVADLN  CP  L+V   G   AC+SAC  F  PEYCC+G +++ +TC 
Sbjct  137  NGGSGECASTGCVADLNRKCPTELRVEGGG---ACRSACEAFGNPEYCCSGAYSSPSTCK  193

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            P+ YS++FK+ACPK+YSYA+DD SSTFTC G+DY ITFCP
Sbjct  194  PSTYSQVFKSACPKSYSYAFDDASSTFTCTGADYTITFCP  233



>ref|XP_008337996.1| PREDICTED: thaumatin-like protein 1 [Malus domestica]
Length=253

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 150/227 (66%), Gaps = 8/227 (4%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            IT   +A +FT  N C +TVWPG L+ +G   L   GF L  G S   QAP GWSGRFW 
Sbjct  26   ITRGVSAATFTFTNKCDFTVWPGILASSGSEKLDSTGFELPKGSSRVFQAPTGWSGRFWG  85

Query  683  RTGCNFDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
            RTGC+FD SG G+C TG          G G  PP TLAEFT+ +G+  +DFYDVSLVDGY
Sbjct  86   RTGCSFDGSGRGSCSTGDCGSGELECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGY  143

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            N+ + ++ SGGSG C   GCV DLN  CP  L+    G   ACKSAC  F +PEYCC G 
Sbjct  144  NLPMIVQGSGGSGACASTGCVTDLNRRCPAELKAEGGG---ACKSACDAFGSPEYCCNGA  200

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            + + +TC P+ YS++FK+ACPK+YSYAYDD SSTFTC G+DY I FC
Sbjct  201  YGSPSTCKPSMYSQLFKSACPKSYSYAYDDASSTFTCTGADYTIIFC  247



>ref|NP_568046.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
 gb|AAL49903.1| putative thaumatin protein [Arabidopsis thaliana]
 gb|AAM20232.1| putative thaumatin [Arabidopsis thaliana]
 dbj|BAF00500.1| thaumatin-like protein [Arabidopsis thaliana]
 gb|AEE86959.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
Length=345

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 145/222 (65%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C YTVWPG LS  G   L   GF L  G S  LQAP GWSGRFWARTGC FD+
Sbjct  31   TFTFANRCGYTVWPGILSNAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCKFDS  90

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C TG          G G  PPVTLAEFT+  G    DFYDVSLVDGYN+ + +  
Sbjct  91   SGSGTCKTGDCGSNAVECAGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNIPMIVEV  148

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GGSG C   GC  DLN  CP  L+  D     ACKSAC  F +PEYCC+G + T ++C 
Sbjct  149  AGGSGQCASTGCTTDLNIQCPAELRFGDGD---ACKSACLAFRSPEYCCSGAYATPSSCR  205

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTCAG DY +TFCP S
Sbjct  206  PSVYSEMFKAACPRSYSYAYDDATSTFTCAGGDYTVTFCPSS  247



>ref|XP_011016697.1| PREDICTED: thaumatin-like protein 1b [Populus euphratica]
Length=325

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 152/220 (69%), Gaps = 11/220 (5%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C ++VWPG L   G   L   GF L  G S   QAP GWSGRFW R+GCNFD+
Sbjct  31   TFTFVNKCDFSVWPGIL---GSPELDSTGFELRKGSSRSFQAPTGWSGRFWGRSGCNFDS  87

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G+C T           G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ + +  
Sbjct  88   SGHGSCATADCGSGQVECNGAGATPPATLAEFTLGSGS--QDFYDVSLVDGYNLPMIVEV  145

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGGSG+C   GCV DLN  CP  L+ T+ GS  AC+SAC  F  PEYCC+G++N+ A+C 
Sbjct  146  SGGSGECASTGCVTDLNRKCPTELR-TEGGS--ACRSACEAFGKPEYCCSGEYNSPASCK  202

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            P+ YS++FK+ACPK+YSYAYDD +STFTC G+DY ITFCP
Sbjct  203  PSMYSQVFKSACPKSYSYAYDDATSTFTCTGADYTITFCP  242



>ref|XP_006466957.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Citrus 
sinensis]
Length=309

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 148/230 (64%), Gaps = 13/230 (6%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            I+    A +FT  N C YTVWPG L   G   L   GF L  G S   QAP GWSGRFW 
Sbjct  17   ISKGVTAATFTFVNKCDYTVWPGIL---GSPKLDSTGFELQKGGSRSFQAPTGWSGRFWG  73

Query  683  RTGCNFDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
            RTGCNFD+SG+G+C T           G G  PP TLAEFT+ +G+  +DFYDVSLVDGY
Sbjct  74   RTGCNFDSSGHGSCATADCGSNQVECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGY  131

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            N+ + +  SGGSG C   GCV DLN +CP  L+V        C+SAC  F  PEYCC+G 
Sbjct  132  NIPIVVEGSGGSGACAPTGCVTDLNRSCPNELRVQG-----GCRSACEAFGNPEYCCSGS  186

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
             N+ ATC P+ YS IFKNACPK+YSYAYDD +STFTC  +DY ITFCP S
Sbjct  187  FNSPATCKPSMYSSIFKNACPKSYSYAYDDATSTFTCTAADYTITFCPSS  236



>gb|KFK41805.1| hypothetical protein AALP_AA2G174200 [Arabis alpina]
Length=244

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 150/221 (68%), Gaps = 7/221 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +   +N CTYTVWPG  + +G   L  GGF LSP  +  LQ P  WSGRFW R GC+FD 
Sbjct  23   TVIFYNKCTYTVWPGIQASSGQPLLAGGGFKLSPNRAYTLQLPPLWSGRFWGRHGCSFDR  82

Query  659  SGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            SG+G C TG      L  G GGVPP TLAE T+ +   D+DFYDVSLVDGYN+ + I P 
Sbjct  83   SGHGRCATGDCGGSLLCNGAGGVPPATLAEITLGH---DQDFYDVSLVDGYNLAMSIMPV  139

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
             G G C YAGCV+DLN  CP  LQV   D   VVACKSAC+ FN+P+YCCTG   +  +C
Sbjct  140  KGKGKCSYAGCVSDLNRMCPVGLQVRSRDGRRVVACKSACSAFNSPQYCCTGSFGSPQSC  199

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT YS+IFK ACPKAYSYAYDD +S  TC+ ++Y+++FCP
Sbjct  200  RPTAYSKIFKVACPKAYSYAYDDPTSISTCSKANYIVSFCP  240



>ref|XP_006573555.1| PREDICTED: thaumatin-like protein 1-like [Glycine max]
Length=304

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 150/222 (68%), Gaps = 6/222 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT+ N C+YTVWPG LSG G + L   GF L PGES  +  PA WSGR W RT C  DA
Sbjct  27   TFTIVNKCSYTVWPGILSGAGTSPLPTTGFVLQPGESNVIAVPAAWSGRLWGRTFCTQDA  86

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            +G  +CVTG          GGG  PP TLAEFT+ NG    DF+DVSLVDGYN+ + + P
Sbjct  87   TGKFSCVTGDCGSSAVECNGGGAAPPATLAEFTL-NGAGGLDFFDVSLVDGYNLPMIVEP  145

Query  488  SGGSG--DCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
             GG+G  +C   GCV DLNT CP  L V  SG  VACKSAC  F+ P+YCC+G + T  T
Sbjct  146  QGGTGAGNCTATGCVVDLNTPCPAELMVMSSGEGVACKSACEAFDDPQYCCSGAYATPDT  205

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            C P+ YS+ FK+ACP+AYSYAYDD SSTFTCA +DY ITFCP
Sbjct  206  CKPSSYSQFFKSACPRAYSYAYDDGSSTFTCATADYTITFCP  247



>ref|XP_009379396.1| PREDICTED: thaumatin-like protein 1 [Pyrus x bretschneideri]
Length=305

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 148/227 (65%), Gaps = 8/227 (4%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            +T      +FT  N C +TVWPG L+  G   L   GF L  G S   QAP GWSGRFW 
Sbjct  16   VTEGVLGATFTFTNKCDFTVWPGILASAGSNKLDSTGFELPKGSSRVFQAPTGWSGRFWG  75

Query  683  RTGCNFDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
            RTGC FD SG G+C TG          G G VPP TLAEFT+ +G+  +DFYDVSLVDGY
Sbjct  76   RTGCTFDGSGQGSCSTGDCGSGELECNGAGAVPPATLAEFTLGSGS--QDFYDVSLVDGY  133

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            N+ + +  SGGSG C   GCV DLN  CP  L+V   G   ACKSAC  F +PEYCC G 
Sbjct  134  NLPMTVEGSGGSGACASTGCVTDLNRRCPAELKVKGGG---ACKSACDAFGSPEYCCNGA  190

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            + + +TC P+ YS++FK+ACPK+YSYAYDD SSTFTC G+DY ITFC
Sbjct  191  YGSPSTCKPSMYSQLFKSACPKSYSYAYDDASSTFTCIGADYTITFC  237



>ref|XP_008393422.1| PREDICTED: thaumatin-like protein [Malus domestica]
Length=250

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 151/229 (66%), Gaps = 7/229 (3%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            + +V +A + T++N CT+ VWPG     G   L  GGF L P ++  L  PA WSGRFW 
Sbjct  22   LVSVSSATTITMYNKCTHPVWPGIQPSAGQPILARGGFTLPPNKAHTLHLPALWSGRFWG  81

Query  683  RTGCNFDASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYN  510
            R GC FDASG G C TGD        G GG PP TLAE T+ N   ++DFYDVSLVDGYN
Sbjct  82   RHGCTFDASGRGRCATGDCGGNLFCSGLGGTPPATLAEITLGN---EQDFYDVSLVDGYN  138

Query  509  VDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTG  336
            + + I P  GSG C YAGCV+DLN  CP  LQV   D+  VVACKSAC+ FN+P YCCTG
Sbjct  139  LAISITPFKGSGKCSYAGCVSDLNMMCPVGLQVRSHDNRQVVACKSACSAFNSPRYCCTG  198

Query  335  DHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
               +  +C PT YS+IFK ACPKAYSYAYDD +S  TC   ++L+TFCP
Sbjct  199  SFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNFLVTFCP  247



>ref|NP_001031809.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
 emb|CAB37522.1| putative thaumatin-like protein [Arabidopsis thaliana]
 emb|CAB80530.1| putative thaumatin-like protein [Arabidopsis thaliana]
 gb|AEE86960.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
Length=323

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 145/222 (65%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C YTVWPG LS  G   L   GF L  G S  LQAP GWSGRFWARTGC FD+
Sbjct  9    TFTFANRCGYTVWPGILSNAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCKFDS  68

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C TG          G G  PPVTLAEFT+  G    DFYDVSLVDGYN+ + +  
Sbjct  69   SGSGTCKTGDCGSNAVECAGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNIPMIVEV  126

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GGSG C   GC  DLN  CP  L+  D     ACKSAC  F +PEYCC+G + T ++C 
Sbjct  127  AGGSGQCASTGCTTDLNIQCPAELRFGDGD---ACKSACLAFRSPEYCCSGAYATPSSCR  183

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTCAG DY +TFCP S
Sbjct  184  PSVYSEMFKAACPRSYSYAYDDATSTFTCAGGDYTVTFCPSS  225



>ref|XP_010933320.1| PREDICTED: thaumatin-like protein 1b [Elaeis guineensis]
Length=313

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 153/222 (69%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C YTVWPG LSG+G   L   GF L+ G+S  L AP GWSGRFWART C+FD 
Sbjct  32   TFTFLNKCGYTVWPGILSGSGSPELETTGFELATGDSRSLLAPTGWSGRFWARTECSFDG  91

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            +G G+C TG     G    G G  PP TLAEFT+A   + KD+YDVSLVDGYN+ + +  
Sbjct  92   AGKGSCNTGDCGSGGVECKGSGAAPPATLAEFTLAGPASAKDYYDVSLVDGYNLPMMVDT  151

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
             GG+G C   GCVADL+  CP  L+V D     AC+SAC  F  PE+CC+G + + ATC 
Sbjct  152  RGGAGGCASTGCVADLSRRCPAELRVGD-----ACRSACEAFGKPEFCCSGAYASPATCR  206

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS++FK+ACPK+YSYA+DD +STFTC+G+DY ITFCP S
Sbjct  207  PSVYSQMFKSACPKSYSYAFDDPTSTFTCSGADYTITFCPES  248



>ref|XP_008801392.1| PREDICTED: pathogenesis-related protein 5-like isoform X1 [Phoenix 
dactylifera]
Length=292

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/219 (57%), Positives = 144/219 (66%), Gaps = 3/219 (1%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT++N C + +WPGTL+G G   L   GF L PG S  + AP GWSGRFWARTGC FDA
Sbjct  25   TFTIYNNCPHAIWPGTLAGAGTPQLPTTGFRLEPGRSERIAAPPGWSGRFWARTGCKFDA  84

Query  659  SGNGNCVTgdcgglkc--gggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
             G G C TGDC G     G G +PP TL E T+  G  D+DFYDVSLVDGYN+ +   P 
Sbjct  85   EGAGTCQTGDCAGRMECGGAGALPPATLFEITLGKGK-DRDFYDVSLVDGYNLPIAAAPR  143

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
               G C   GCVADLN+ CP+ LQV   G VVACKSAC  F   +YCC+G+     TC P
Sbjct  144  VPRGRCNITGCVADLNSACPKELQVDGDGGVVACKSACEAFGLDKYCCSGEFGNPTTCKP  203

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            + YS IFK ACP+AYSYAYDD +STFTC   DY I FCP
Sbjct  204  SYYSSIFKTACPRAYSYAYDDGTSTFTCKAYDYTIVFCP  242



>ref|XP_002277548.1| PREDICTED: thaumatin-like protein 1b [Vitis vinifera]
 emb|CBI37894.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 147/222 (66%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C YTVWPG L+  G A L   GF L    S    AP GWSGRFW RTGCNFD 
Sbjct  28   TFTFVNRCEYTVWPGILANAGSARLDSTGFELPKDTSRSFLAPTGWSGRFWGRTGCNFDG  87

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG G+CVTG          G G  PP TLAEFT+  G   +DFYDVSLVDGYN+ + +  
Sbjct  88   SGLGSCVTGDCGSGTIECNGAGAAPPATLAEFTLGTGG--QDFYDVSLVDGYNLPMIVEG  145

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGGSG C   GC  DLN  CP  L+V D     AC+SAC  F +PEYCC+G ++T ATC 
Sbjct  146  SGGSGMCASTGCTVDLNQGCPAELKVGDGS---ACRSACEAFGSPEYCCSGAYSTPATCR  202

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK+ACP++YSYAYDD +STFTCAG+DY +TFCP S
Sbjct  203  PSVYSEMFKSACPRSYSYAYDDATSTFTCAGADYTVTFCPSS  244



>ref|XP_007041885.1| Pathogenesis-related thaumatin superfamily protein isoform 5 
[Theobroma cacao]
 gb|EOX97716.1| Pathogenesis-related thaumatin superfamily protein isoform 5 
[Theobroma cacao]
Length=376

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 145/222 (65%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            SFT  N C YTVWPG L+  G   L   GF L    S   QAP GWSGRFW RTGC FD 
Sbjct  44   SFTFVNRCAYTVWPGILANAGSPRLDSTGFELPKDSSRSFQAPTGWSGRFWGRTGCTFDG  103

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C+TG          G G  PPVTLAEFT+  G   +DFYDVSLVDGYN+ + +  
Sbjct  104  SGSGACLTGDCGAGQMECNGLGAAPPVTLAEFTLGTGG--QDFYDVSLVDGYNLPMIVEG  161

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGGSG C   GC  DLN  CP  L+V D     ACKSAC  F +PEYCC+G ++T ATC 
Sbjct  162  SGGSGLCASTGCTTDLNRQCPSELRVGDGD---ACKSACEAFGSPEYCCSGAYSTPATCK  218

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTC G+DY +TFCP S
Sbjct  219  PSVYSEMFKAACPRSYSYAYDDATSTFTCTGADYTVTFCPSS  260



>ref|XP_007041883.1| Pathogenesis-related thaumatin superfamily protein isoform 2 
[Theobroma cacao]
 gb|EOX97714.1| Pathogenesis-related thaumatin superfamily protein isoform 2 
[Theobroma cacao]
Length=372

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 145/222 (65%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            SFT  N C YTVWPG L+  G   L   GF L    S   QAP GWSGRFW RTGC FD 
Sbjct  44   SFTFVNRCAYTVWPGILANAGSPRLDSTGFELPKDSSRSFQAPTGWSGRFWGRTGCTFDG  103

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C+TG          G G  PPVTLAEFT+  G   +DFYDVSLVDGYN+ + +  
Sbjct  104  SGSGACLTGDCGAGQMECNGLGAAPPVTLAEFTLGTGG--QDFYDVSLVDGYNLPMIVEG  161

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGGSG C   GC  DLN  CP  L+V D     ACKSAC  F +PEYCC+G ++T ATC 
Sbjct  162  SGGSGLCASTGCTTDLNRQCPSELRVGDGD---ACKSACEAFGSPEYCCSGAYSTPATCK  218

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTC G+DY +TFCP S
Sbjct  219  PSVYSEMFKAACPRSYSYAYDDATSTFTCTGADYTVTFCPSS  260



>ref|XP_004159719.1| PREDICTED: thaumatin-like protein 1-like [Cucumis sativus]
Length=308

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 148/221 (67%), Gaps = 7/221 (3%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FT  N C +TVWPG LSG G       GF L  G S   QAPAGWSGRFW RT C+FD S
Sbjct  24   FTFVNKCDFTVWPGVLSGAGSLKFDTTGFELRKGSSRSFQAPAGWSGRFWGRTDCSFDGS  83

Query  656  GNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            G G C TG          G G  PP TLAEFT+ +G++  DFYDVSLVDGYN+ + +  +
Sbjct  84   GRGVCNTGDCGSGEIECKGAGAAPPATLAEFTLGSGSS-PDFYDVSLVDGYNLGMIVEGT  142

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
            GG+G C   GCV DLN  CP  L+    G   AC+SAC +F TPEYCC+G + + ATC P
Sbjct  143  GGTGACGSTGCVTDLNRQCPLELRTEKGG---ACRSACEKFGTPEYCCSGAYGSPATCKP  199

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            ++YS IFK+ACP++YSYAYDD +STFTC+G+DY +TFCP S
Sbjct  200  SKYSEIFKSACPRSYSYAYDDATSTFTCSGADYTVTFCPSS  240



>ref|NP_177503.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
 gb|AAG52086.1|AC012679_24 thaumatin-like protein; 9376-10898 [Arabidopsis thaliana]
 gb|AEE35486.1| pathogenesis-related thaumatin-like protein [Arabidopsis thaliana]
Length=264

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 150/224 (67%), Gaps = 7/224 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A +   +N CTYTVWPG    +G + L  GGF LSP  +  LQ P  WSGRFW R GC+
Sbjct  40   SASTVIFYNKCTYTVWPGIQPSSGQSLLAGGGFKLSPNRAYTLQLPPLWSGRFWGRHGCS  99

Query  668  FDASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FD SG G C TGD     L  G GGVPP TLAE T+ +   D DFYDVSLVDGYN+ + I
Sbjct  100  FDRSGRGRCATGDCGGSFLCNGAGGVPPATLAEITLGH---DMDFYDVSLVDGYNLAMSI  156

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTH  321
             P  G+G C YAGCV+DLN  CP  LQV   D   VVACKSAC+ FN+P YCCTG     
Sbjct  157  MPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGTQVVACKSACSAFNSPRYCCTGLFGNP  216

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             +C PT YS+IFK ACPKAYSYAYDD +S  TC+ ++Y++TFCP
Sbjct  217  QSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYVVTFCP  260



>ref|XP_010679923.1| PREDICTED: thaumatin-like protein 1b [Beta vulgaris subsp. vulgaris]
Length=332

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 146/222 (66%), Gaps = 7/222 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C YTVWPG L+G     L   GF L  G +   QAPAGWSGRFW R+GC FD+
Sbjct  28   TFTFVNRCDYTVWPGLLAGASSPKLDSTGFELQHGGTRTFQAPAGWSGRFWGRSGCTFDS  87

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            +G G+C TG          G G  PP TLAEFT+ NG+  +DFYDVSLVDGYN+ + +  
Sbjct  88   TGQGSCSTGDCGSGTIECNGSGATPPATLAEFTL-NGSGGQDFYDVSLVDGYNLPMIVES  146

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GGSG CQ  GCV DLN  CP  L+    G   AC+SAC  F +PEYCC+G   T   C 
Sbjct  147  TGGSGGCQSTGCVVDLNLRCPNELKAEGGG---ACRSACEAFGSPEYCCSGQFATPDKCK  203

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS+ FKNACP+AYSYAYDD SSTFTC+G DY ITFCP S
Sbjct  204  PSMYSQTFKNACPRAYSYAYDDASSTFTCSGGDYTITFCPSS  245



>gb|AIU34434.1| thaumatin-like protein 5, partial [Medicago truncatula var. truncatula]
Length=223

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 142/221 (64%), Gaps = 7/221 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            S   +N C + VWP    G G   L  GGF L P ++  LQ P  WSGRFW R GC FDA
Sbjct  2    SVVFYNKCPHPVWPAIQPGAGKPILARGGFNLPPNKAYSLQVPPQWSGRFWGRHGCTFDA  61

Query  659  SGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            SG+G+C TGD        G GG PP TLAEFT      D DFYDVSLVDGYN+ + I P 
Sbjct  62   SGHGHCATGDCGGSLFCNGIGGTPPATLAEFTFGK---DLDFYDVSLVDGYNLPISITPF  118

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
             GSG C YAGCV+DLN  CP  LQV   D   VV C+SACA FN+P YCCTG+  T  TC
Sbjct  119  KGSGKCSYAGCVSDLNLMCPVGLQVRSRDKKHVVGCRSACAAFNSPRYCCTGNFGTPQTC  178

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT YSRIFK ACPKAYSYAYDD +S  TC  + Y+ITFCP
Sbjct  179  KPTAYSRIFKTACPKAYSYAYDDPTSIATCTNASYMITFCP  219



>gb|AAM62907.1| thaumatin-like protein [Arabidopsis thaliana]
 dbj|BAC42848.1| putative thaumatin [Arabidopsis thaliana]
Length=244

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/224 (56%), Positives = 149/224 (67%), Gaps = 7/224 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A +   +N CTYTVWPG    +G + L  GGF LSP  +  LQ P  WSGRFW R GC+
Sbjct  20   SASTVIFYNKCTYTVWPGIQPSSGQSLLAGGGFKLSPNRAYTLQLPPLWSGRFWGRHGCS  79

Query  668  FDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FD SG G C TG      L  G GGVPP TLAE T+ +   D DFYDVSLVDGYN+ + I
Sbjct  80   FDRSGRGRCATGDCGGSFLCNGAGGVPPATLAEITLGH---DMDFYDVSLVDGYNLAMSI  136

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTH  321
             P  G+G C YAGCV+DLN  CP  LQV   D   VVACKSAC+ FN+P YCCTG     
Sbjct  137  MPVKGTGKCTYAGCVSDLNRMCPVGLQVRSRDGTQVVACKSACSAFNSPRYCCTGLFGNP  196

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             +C PT YS+IFK ACPKAYSYAYDD +S  TC+ ++Y++TFCP
Sbjct  197  QSCKPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYVVTFCP  240



>ref|XP_007041884.1| Pathogenesis-related thaumatin superfamily protein isoform 4, 
partial [Theobroma cacao]
 gb|EOX97715.1| Pathogenesis-related thaumatin superfamily protein isoform 4, 
partial [Theobroma cacao]
Length=305

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 145/222 (65%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            SFT  N C YTVWPG L+  G   L   GF L    S   QAP GWSGRFW RTGC FD 
Sbjct  13   SFTFVNRCAYTVWPGILANAGSPRLDSTGFELPKDSSRSFQAPTGWSGRFWGRTGCTFDG  72

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C+TG          G G  PPVTLAEFT+  G   +DFYDVSLVDGYN+ + +  
Sbjct  73   SGSGACLTGDCGAGQMECNGLGAAPPVTLAEFTLGTGG--QDFYDVSLVDGYNLPMIVEG  130

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGGSG C   GC  DLN  CP  L+V D     ACKSAC  F +PEYCC+G ++T ATC 
Sbjct  131  SGGSGLCASTGCTTDLNRQCPSELRVGDGD---ACKSACEAFGSPEYCCSGAYSTPATCK  187

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTC G+DY +TFCP S
Sbjct  188  PSVYSEMFKAACPRSYSYAYDDATSTFTCTGADYTVTFCPSS  229



>ref|XP_004172986.1| PREDICTED: thaumatin-like protein-like, partial [Cucumis sativus]
Length=304

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 149/222 (67%), Gaps = 8/222 (4%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            ++ +FT  N C YTVWPG L+ +G   L   GF L  G S  LQA  GWSGRFW RT C 
Sbjct  5    SSATFTFVNKCDYTVWPGILASSGSPKLETTGFELKAGNSRSLQASTGWSGRFWGRTNCK  64

Query  668  FDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            FD SG GNC TG          G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ + 
Sbjct  65   FDDSGRGNCNTGDCGSGEIECNGAGATPPATLAEFTLGSGS--QDFYDVSLVDGYNLPMI  122

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            +  +GGSG C   GC+ DLN  CP  L+    G   ACKSAC  F TPEYCC+G++N+ A
Sbjct  123  VEGTGGSGTCASTGCITDLNQLCPAELKAEAGG---ACKSACEAFETPEYCCSGEYNSPA  179

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            TC P+ YS++FK+ACPK+YSYAYDD +STFTC G+DY ITFC
Sbjct  180  TCKPSMYSQMFKSACPKSYSYAYDDATSTFTCNGADYTITFC  221



>ref|XP_003634206.1| PREDICTED: thaumatin-like protein [Vitis vinifera]
 emb|CBI15563.3| unnamed protein product [Vitis vinifera]
Length=244

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 150/229 (66%), Gaps = 7/229 (3%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            I    +A + +L+N C++ VWPG   G G   L  GGF L P ++  L  PA WSGR W 
Sbjct  17   IAGEVSATTISLYNKCSHPVWPGIQPGAGKPILARGGFKLPPNKAYSLHIPAAWSGRIWG  76

Query  683  RTGCNFDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYN  510
            R GC+FDA G G C TG         G GG PP TLAE T+    +++DFYDVSLVDGYN
Sbjct  77   RHGCSFDAHGRGRCATGDCGGSLFCNGMGGTPPATLAEITLG---SEQDFYDVSLVDGYN  133

Query  509  VDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTG  336
            + + I P  GSG C YAGCV+DLNT CP  LQV   D+  VVACKSAC+ FN+P YCCTG
Sbjct  134  LAISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSHDNRRVVACKSACSAFNSPRYCCTG  193

Query  335  DHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
               +  +C PT YS+IFK ACP+AYSYAYDD +S  TC G +YL+TFCP
Sbjct  194  SFGSPQSCKPTAYSKIFKAACPRAYSYAYDDPTSIATCTGGNYLVTFCP  242



>ref|XP_003525190.1| PREDICTED: thaumatin-like protein-like [Glycine max]
Length=245

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/229 (55%), Positives = 148/229 (65%), Gaps = 7/229 (3%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            +  V A+ S   +N C + VWPG     G   L  GGF L+P  +  LQ PA WSGRFW 
Sbjct  17   VLKVSASSSVIFYNKCPHPVWPGIQPSAGKPVLARGGFKLAPNRAYSLQLPALWSGRFWG  76

Query  683  RTGCNFDASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYN  510
            R GC FD  G G C TGD        G GG PP TLAE T+ N   ++DFYDVSLVDGYN
Sbjct  77   RHGCAFDVGGRGRCATGDCGGSLFCNGIGGSPPATLAELTLGN---EQDFYDVSLVDGYN  133

Query  509  VDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTG  336
            + + I P  GSG C YAGCV+DLNT CP  LQV   D+  VVACKSAC+ FN+P+YCCTG
Sbjct  134  LPISITPFKGSGKCSYAGCVSDLNTMCPVGLQVRSRDNKRVVACKSACSAFNSPKYCCTG  193

Query  335  DHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             + +   C PT YS+IFK ACPKAYSYAYDD +S  TC  ++Y +TFCP
Sbjct  194  SYGSPQACKPTVYSKIFKTACPKAYSYAYDDPTSIATCTKANYFLTFCP  242



>gb|KDP23919.1| hypothetical protein JCGZ_27079 [Jatropha curcas]
Length=249

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 144/221 (65%), Gaps = 7/221 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            + TL+N CT+ VWPG     G   L  GGF L P ++  L  P  WSGRFW R GC+FDA
Sbjct  29   TITLYNKCTHPVWPGIQPSAGKPLLVRGGFKLLPNKAYSLNLPPLWSGRFWGRHGCSFDA  88

Query  659  SGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            SG G C TGD        G GG PP TLAE T+ N   D+DFYDVSLVDGYN+ + I P 
Sbjct  89   SGRGRCATGDCGGSLYCNGLGGTPPATLAEITLGN---DQDFYDVSLVDGYNLGISITPF  145

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
             GSG C YAGC++DLN  CP  LQV   D+  VVACKSAC  FN+P YCCTG      TC
Sbjct  146  KGSGKCSYAGCISDLNLMCPVGLQVRSRDNRRVVACKSACFAFNSPRYCCTGSFGNPQTC  205

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT YSRIFK ACPKAYSYAYDD +S  TC   +YL+TFCP
Sbjct  206  KPTAYSRIFKAACPKAYSYAYDDPTSIATCTRGNYLVTFCP  246



>ref|XP_010664831.1| PREDICTED: thaumatin-like protein 1b [Vitis vinifera]
 emb|CBI19884.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 148/220 (67%), Gaps = 7/220 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +F + N C +TVWPG LS  G + L   GF LS G S  L+ P GWSGRFW R+GC FDA
Sbjct  28   TFAITNRCDFTVWPGILSNAGSSRLETTGFELSSGGSRSLEVPVGWSGRFWGRSGCTFDA  87

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            +G+GNC TG          G G +PP TLAEFTI +G + +DFYDVSLVDGYN+ + +  
Sbjct  88   TGHGNCTTGDCGSGQVECNGAGAIPPATLAEFTIGSG-SQQDFYDVSLVDGYNLPMIVEA  146

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGG+G C   GCV DLN  CP  L+  +     AC SAC  F  PEYCC+G + +  TC 
Sbjct  147  SGGTGSCASTGCVNDLNQQCPAELKANEG---QACNSACGAFAKPEYCCSGAYGSPTTCK  203

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            P+ YS IFK ACPK+YSYAYDD +STFTC+G++Y+ITFCP
Sbjct  204  PSVYSEIFKTACPKSYSYAYDDATSTFTCSGANYMITFCP  243



>emb|CDY72463.1| BnaAnng41250D, partial [Brassica napus]
Length=247

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 147/222 (66%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C +TVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC+FD 
Sbjct  30   TFTFANRCGFTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCSFDG  89

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C TG          G G  PPVTLAEFT+  G    DFYDVSLVDGYN+ + +  
Sbjct  90   SGSGTCKTGDCGSNQVECVGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNLPMIVEV  147

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GGSG C   GC +DLN  CP  L+   SG   ACKSAC  F +PEYCC+G + T +TC 
Sbjct  148  AGGSGQCASTGCTSDLNLQCPAELR---SGDGDACKSACEAFRSPEYCCSGAYATPSTCR  204

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTCAG DY +TFCP S
Sbjct  205  PSVYSEMFKAACPRSYSYAYDDATSTFTCAGGDYTVTFCPSS  246



>gb|KHG05671.1| Thaumatin-like protein 1 [Gossypium arboreum]
Length=290

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 151/220 (69%), Gaps = 4/220 (2%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +F++ N C+YTVWPG LSG G   +   GFAL PG+S  +  P  WSGR W RT C  D+
Sbjct  25   TFSIVNKCSYTVWPGVLSGAGTPQISPTGFALQPGQSTSIPVPTSWSGRIWGRTLCTEDS  84

Query  659  SGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            SG  +C+TG      L+C GG +PP TLAEFT+ NG    DF+DVSLVDGYN+ + I P 
Sbjct  85   SGKFSCLTGDCGSSTLECSGGAIPPATLAEFTL-NGAGGMDFFDVSLVDGYNLPMMISPQ  143

Query  485  GGSG-DCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            GG+G +C  AGC ADLN +CP  L+V D    VACKSAC  F  P+YCC+G + T  TC 
Sbjct  144  GGTGVNCTSAGCAADLNGDCPMELKVVDGSEGVACKSACDAFGDPQYCCSGAYATPNTCK  203

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            P+ YS+ FK ACP AYSYAYDD +STFTC G+DY+ITFCP
Sbjct  204  PSTYSQFFKTACPTAYSYAYDDGTSTFTCTGADYVITFCP  243



>ref|XP_006283927.1| hypothetical protein CARUB_v10005048mg, partial [Capsella rubella]
 gb|EOA16825.1| hypothetical protein CARUB_v10005048mg, partial [Capsella rubella]
Length=378

 Score =   240 bits (613),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 146/222 (66%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C YTVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC FD 
Sbjct  63   TFTFANRCGYTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCKFDV  122

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C TG          G G  PPVTLAEFT+  G    DFYDVSLVDGYN+ + +  
Sbjct  123  SGSGTCTTGDCGSNQVECVGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNIPMIVEV  180

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GGSG C   GC +D+NT CP  L+    G   ACKSAC  F +PEYCC+G + T +TC 
Sbjct  181  AGGSGQCASTGCTSDINTQCPAELRF---GEGDACKSACEAFRSPEYCCSGAYATPSTCR  237

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTCAG DY +TFCP S
Sbjct  238  PSVYSEMFKAACPRSYSYAYDDATSTFTCAGGDYTLTFCPSS  279



>gb|KGN55655.1| hypothetical protein Csa_3G002750 [Cucumis sativus]
Length=308

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 148/221 (67%), Gaps = 7/221 (3%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FT  N C +TVWPG LSG G       GF L  G S   QAPAGWSGRFW RT C+FD S
Sbjct  24   FTFVNKCDFTVWPGVLSGAGSLKFDTTGFELRKGSSRSFQAPAGWSGRFWGRTDCSFDGS  83

Query  656  GNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            G G C TG          G G  PP TLAEFT+ +G++  DFYDVSLVDGYN+ + +  +
Sbjct  84   GRGVCNTGDCGSGEIECKGAGAAPPATLAEFTLGSGSS-PDFYDVSLVDGYNLGMIVEGT  142

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
            GG+G C   GCV DLN  CP  L+    G   AC+SAC +F TPEYCC+G + + ATC P
Sbjct  143  GGTGACGSTGCVTDLNRQCPLELRTEKGG---ACRSACEKFGTPEYCCSGAYGSPATCKP  199

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            ++YS IFK+ACP++YSYAYDD +STFTC+G+DY +TFCP S
Sbjct  200  SKYSEIFKSACPRSYSYAYDDATSTFTCSGADYTVTFCPSS  240



>gb|KEH30510.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=344

 Score =   239 bits (611),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 147/219 (67%), Gaps = 8/219 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C YTVWPG L+  G   LG  GF L    +   QAPAGWSGRFWARTGCNFD 
Sbjct  26   TFTFVNKCDYTVWPGILANAGSPTLGSTGFELPQETTRTFQAPAGWSGRFWARTGCNFDG  85

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG G+C+TG          G G  PP TLAEFT+  G   +DFYDVSLVDGYN+ + +  
Sbjct  86   SGTGSCLTGDCGSNMVECNGAGAAPPATLAEFTL--GTIGQDFYDVSLVDGYNLPMIVEG  143

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGGSG C+  GC +DLN  CP  L+ +D     ACKSAC  F +PEYCC+G + + ATC 
Sbjct  144  SGGSGMCESTGCTSDLNQQCPAELRASDGS---ACKSACEAFGSPEYCCSGAYGSPATCR  200

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            P+ YS +FKNACP++YSYAYDD SSTFTC  +DY +TFC
Sbjct  201  PSIYSEMFKNACPRSYSYAYDDASSTFTCTAADYTVTFC  239



>emb|CAN59843.1| hypothetical protein VITISV_030359 [Vitis vinifera]
Length=243

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 149/224 (67%), Gaps = 7/224 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A + +L+N C++ VWPG   G G   L  GGF L P ++  L  PA WSGR W R GC+
Sbjct  21   SATTISLYNKCSHPVWPGIQPGAGKPILARGGFKLPPNKAYSLHIPAAWSGRIWGRHGCS  80

Query  668  FDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FDA G G C TG         G GG PP TLAE T+ +   ++DFYDVSLVDGYN+ + I
Sbjct  81   FDAHGRGRCATGDCGGSLFCNGMGGTPPATLAEITLGS---EQDFYDVSLVDGYNLAISI  137

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTH  321
             P  GSG C YAGCV+DLNT CP  LQV   D+  VVACKSAC+ FN+P YCCTG   + 
Sbjct  138  TPFKGSGKCSYAGCVSDLNTMCPVGLQVRSHDNRRVVACKSACSAFNSPRYCCTGSFGSP  197

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             +C PT YS+IFK ACP+AYSYAYDD +S  TC G +YL+TFCP
Sbjct  198  QSCKPTAYSKIFKAACPRAYSYAYDDPTSIATCTGGNYLVTFCP  241



>ref|XP_008240157.1| PREDICTED: thaumatin-like protein [Prunus mume]
Length=250

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 149/229 (65%), Gaps = 7/229 (3%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            +  V +A + T+HN C++ VWPG     G   L  GGF L P ++  L  P  WSGR W 
Sbjct  22   LVEVSSATTITMHNKCSHPVWPGIQPSAGQPILARGGFTLPPNKAYTLHLPPLWSGRLWG  81

Query  683  RTGCNFDASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYN  510
            R GC FDASG G C TGD        G GG PP TLAE T+ N   D+DFYDVSLVDGYN
Sbjct  82   RHGCAFDASGRGRCATGDCGGNLFCSGPGGPPPATLAEITLGN---DQDFYDVSLVDGYN  138

Query  509  VDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTG  336
            + + I+P  GSG C YAGC++DLN  CP  LQV   D+  VVACKSAC+ FN+P YCCTG
Sbjct  139  LAISIQPFKGSGKCSYAGCISDLNMMCPVGLQVRSHDNRRVVACKSACSAFNSPRYCCTG  198

Query  335  DHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
               +  +C PT YS+IFK ACPKAYSYAYDD +S  TC   +Y++TFCP
Sbjct  199  SFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYVVTFCP  247



>ref|XP_010929479.1| PREDICTED: pathogenesis-related protein 5-like [Elaeis guineensis]
Length=310

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 141/219 (64%), Gaps = 3/219 (1%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT++N C +T+WPGTL+G G   L   GF L PG SV + AP GWSGR WARTGC FDA
Sbjct  25   TFTIYNNCPHTIWPGTLAGAGTPQLSTTGFQLEPGRSVRMAAPPGWSGRMWARTGCEFDA  84

Query  659  SGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
             G G C TG         G G +PP TL E T+  G  D D+YDVSLVDGYN+ +   P 
Sbjct  85   QGAGTCQTGDCGGRMECGGAGALPPATLFEITLGKGK-DPDYYDVSLVDGYNLPVAAAPR  143

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
               G C   GC ADLN  CP+ LQV   G VVACKSAC  F   EYCC+G+  +  TC P
Sbjct  144  VPRGRCNATGCAADLNRACPKELQVDGDGGVVACKSACEAFGLDEYCCSGEFGSPGTCKP  203

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            + YS IFKNACP+AYSYA+DD +STFTC   DY I FCP
Sbjct  204  SFYSSIFKNACPRAYSYAFDDGTSTFTCKAYDYTIIFCP  242



>ref|XP_008352435.1| PREDICTED: thaumatin-like protein 1 [Malus domestica]
Length=318

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 150/227 (66%), Gaps = 8/227 (4%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            IT   +A +FT  N C +TVWPG L+ +G   L   GF L  G S   QAP GWSGRFW 
Sbjct  26   ITRGVSAATFTFTNKCDFTVWPGILASSGSEKLDSTGFELPKGSSRVFQAPTGWSGRFWG  85

Query  683  RTGCNFDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGY  513
            RTGC+FD SG G+C TG          G G  PP TLAEFT+ +G+  +DFYDVSLVDGY
Sbjct  86   RTGCSFDGSGRGSCSTGDCGSGELECNGAGAAPPATLAEFTLGSGS--QDFYDVSLVDGY  143

Query  512  NVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGD  333
            N+ + ++ SGGSG C   GCV DLN  CP  L+    G   ACKSAC  F +PEYCC G 
Sbjct  144  NLPMIVQGSGGSGACASTGCVTDLNRRCPAELKAEGGG---ACKSACDAFGSPEYCCNGA  200

Query  332  HNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            + + +TC P+ YS++FK+ACPK+YSYAYDD SSTFTC  +DY ITFC
Sbjct  201  YGSPSTCKPSMYSQLFKSACPKSYSYAYDDASSTFTCTDADYTITFC  247



>ref|XP_003631101.1| Thaumatin-like protein [Medicago truncatula]
 gb|AET05577.1| pathogenesis-related thaumatin family protein [Medicago truncatula]
Length=249

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 141/218 (65%), Gaps = 7/218 (3%)
 Frame = -1

Query  830  LHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDASGN  651
             +N C + VWP    G G   L  GGF L P ++  LQ P  WSGRFW R GC FDASG+
Sbjct  31   FYNKCPHPVWPAIQPGAGKPILARGGFNLPPNKAYSLQVPPQWSGRFWGRHGCTFDASGH  90

Query  650  GNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSGGS  477
            G+C TGD        G GG PP TLAEFT      D DFYDVSLVDGYN+ + I P  GS
Sbjct  91   GHCATGDCGGSLFCNGIGGTPPATLAEFTFGK---DLDFYDVSLVDGYNLPISITPFKGS  147

Query  476  GDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPT  303
            G C YAGCV+DLN  CP  LQV   D   VV C+SACA FN+P YCCTG+  T  TC PT
Sbjct  148  GKCSYAGCVSDLNLMCPVGLQVRSRDKKHVVGCRSACAAFNSPRYCCTGNFGTPQTCKPT  207

Query  302  QYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             YSRIFK ACPKAYSYAYDD +S  TC  + Y+ITFCP
Sbjct  208  AYSRIFKTACPKAYSYAYDDPTSIATCTNASYMITFCP  245



>gb|KGN48924.1| hypothetical protein Csa_6G506010 [Cucumis sativus]
Length=326

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 149/222 (67%), Gaps = 8/222 (4%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            ++ +FT  N C YTVWPG L+ +G   L   GF L  G S  LQA  GWSGRFW RT C 
Sbjct  27   SSATFTFVNKCDYTVWPGILASSGSPKLETTGFELKAGNSRSLQASTGWSGRFWGRTNCK  86

Query  668  FDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            FD SG GNC TG          G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ + 
Sbjct  87   FDDSGRGNCNTGDCGSGEIECNGAGATPPATLAEFTLGSGS--QDFYDVSLVDGYNLPMI  144

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            +  +GGSG C   GC+ DLN  CP  L+    G   ACKSAC  F TPEYCC+G++N+ A
Sbjct  145  VEGTGGSGTCASTGCITDLNQLCPAELKAEAGG---ACKSACEAFETPEYCCSGEYNSPA  201

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            TC P+ YS++FK+ACPK+YSYAYDD +STFTC G+DY ITFC
Sbjct  202  TCKPSMYSQMFKSACPKSYSYAYDDATSTFTCNGADYTITFC  243



>ref|XP_004152647.1| PREDICTED: thaumatin-like protein 1a-like, partial [Cucumis sativus]
 ref|XP_004171184.1| PREDICTED: thaumatin-like protein 1a-like, partial [Cucumis sativus]
Length=226

 Score =   235 bits (600),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 146/222 (66%), Gaps = 10/222 (5%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFD-A  660
            FT  N C +T+WPG L   G   L   GF LSPG     QAP GWSGRFW RTGC+FD A
Sbjct  9    FTFVNRCDFTIWPGIL---GNPKLESTGFELSPGAVRSFQAPPGWSGRFWGRTGCSFDPA  65

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            +G GNC T           G G  PP TLAEFTI  G   +DFYDVSLVDGYN+ + +  
Sbjct  66   TGQGNCQTADCGSNQIECNGAGATPPATLAEFTIGGGAGGQDFYDVSLVDGYNIPMVVDA  125

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GGSG CQ  GC A+LN  CP  L+   +G   AC+SAC  F  PEYCC+G +N+ A C 
Sbjct  126  TGGSGACQSTGCAAELNRRCPSELR---AGEGKACRSACEAFGNPEYCCSGAYNSPAACK  182

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK+ACPK+YSYA+DD +STFTC+G+DY ITFCP S
Sbjct  183  PSIYSEMFKSACPKSYSYAFDDATSTFTCSGADYTITFCPSS  224



>emb|CDP07385.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 148/226 (65%), Gaps = 9/226 (4%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +  +FTL N C + VWPG L+  G A L   GF L PG S   QAP  WSGRFW RTGC 
Sbjct  23   SGATFTLVNRCNHMVWPGILANAGSAKLDSTGFELPPGGSRSFQAPPSWSGRFWGRTGCT  82

Query  668  FDAS-GNGNCVTg---dcgglkcgggGVPPVTLAEFTIANG--NADKDFYDVSLVDGYNV  507
            FD S G G+C TG          G G  PP TLAEFT+ +G  +  +DFYDVSLVDGYN+
Sbjct  83   FDPSTGQGSCATGDCGSNQLECNGAGATPPATLAEFTVGSGPDSGTQDFYDVSLVDGYNL  142

Query  506  DLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHN  327
             + + PSGGSG C   GC  DLN  CP  L+    G   ACKSAC  F +PEYCC+G++ 
Sbjct  143  PMMVEPSGGSGACGATGCATDLNRMCPNELR---GGEGQACKSACEAFGSPEYCCSGEYG  199

Query  326  THATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            + +TC P+ YS IFKNACP+AYSYAYDD +STFTC G+DY ITFCP
Sbjct  200  SPSTCRPSMYSEIFKNACPRAYSYAYDDATSTFTCKGADYTITFCP  245



>ref|XP_010692057.1| PREDICTED: thaumatin-like protein 1b [Beta vulgaris subsp. vulgaris]
Length=246

 Score =   236 bits (601),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 154/230 (67%), Gaps = 6/230 (3%)
 Frame = -1

Query  866  GITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFW  687
            G+T V +  +FTL N C YT+WPGTLSG+    L   GF L  G ++ L  P  WSGRFW
Sbjct  19   GLTGVESI-TFTLKNNCPYTIWPGTLSGSSSPMLSSTGFELGNGATLSLDVPTHWSGRFW  77

Query  686  ARTGCNFDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDG  516
            ART C+ D +GN  C+TG          G GG PP TLAEFT+A GN +KDFYD+SLVDG
Sbjct  78   ARTLCHSDPTGNFRCMTGDCGSGEISCNGKGGAPPATLAEFTLA-GNMNKDFYDISLVDG  136

Query  515  YNVDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTG  336
            +N+ L + P GG+ DC    C A+LNT CPE L V D GS + C SAC   N P+YCCTG
Sbjct  137  FNLPLSVVPQGGTTDCPSTSCTANLNTQCPETLAVKDQGSTIGCNSACVALNQPQYCCTG  196

Query  335  DHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTC-AGSDYLITFCP  189
            +HNT  TC PT  S+ FK+ CP+AYSYAYDD +STFTC  G +YLITFCP
Sbjct  197  EHNTPQTCPPTSQSQYFKSQCPQAYSYAYDDSTSTFTCPTGVNYLITFCP  246



>ref|XP_002534154.1| Zeamatin precursor, putative [Ricinus communis]
 gb|EEF28230.1| Zeamatin precursor, putative [Ricinus communis]
Length=338

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 148/222 (67%), Gaps = 8/222 (4%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A +FT  N C YTVWPG L+  G   L   GF L    S   QAP GWSGRFWARTGC F
Sbjct  23   AATFTFVNRCEYTVWPGILANAGSPRLDTTGFELPKDTSRSFQAPTGWSGRFWARTGCAF  82

Query  665  DASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            D SG+G+C+TG          G G  PP TLAEFT+ +G   +DFYDVSLVDGYN+ + +
Sbjct  83   DDSGSGSCLTGDCGSGLVECNGLGAAPPATLAEFTLGSGG--QDFYDVSLVDGYNLPMLV  140

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHAT  315
              SGGSG C   GC ADLN  CP  L+V   G   ACKSAC  F +PEYCC+G  NT AT
Sbjct  141  EGSGGSGMCASTGCSADLNRQCPAELKV---GGGDACKSACEAFGSPEYCCSGAFNTPAT  197

Query  314  CSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            C P+ YS +FK+ACP++YSYAYDD +STFTC G+DY +TFCP
Sbjct  198  CKPSVYSEMFKSACPRSYSYAYDDATSTFTCTGADYTVTFCP  239



>ref|XP_002532822.1| Protein P21, putative [Ricinus communis]
 gb|EEF29561.1| Protein P21, putative [Ricinus communis]
Length=248

 Score =   236 bits (601),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 145/221 (66%), Gaps = 7/221 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            + TL+N CT+ VWPG     G   L  GGF L P ++  L+ P  WSGRFW R GC+FD 
Sbjct  28   TITLYNKCTHPVWPGIQPSAGKPLLARGGFKLPPNKAYSLKLPPLWSGRFWGRHGCSFDG  87

Query  659  SGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            SG G C TGD        G GG PP TLAE T+ N   D+DFYDVSLVDGYN+ + I P 
Sbjct  88   SGRGRCATGDCGGALFCNGIGGTPPATLAEITLGN---DQDFYDVSLVDGYNLAMSITPF  144

Query  485  GGSGDCQYAGCVADLNTNCPEVLQV--TDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
             GSG C YAGCV+DLN  CP  LQV   D+  VVACKSAC+ FN+P YCCTG      +C
Sbjct  145  KGSGKCSYAGCVSDLNLMCPVGLQVRSKDNRRVVACKSACSAFNSPRYCCTGKFGNPQSC  204

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT YS+IFK ACPKAYSYAYDD +S  TC   +YL+TFCP
Sbjct  205  KPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYLVTFCP  245



>ref|XP_004135026.1| PREDICTED: thaumatin-like protein-like, partial [Cucumis sativus]
Length=318

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 149/222 (67%), Gaps = 8/222 (4%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            ++ +FT  N C YTVWPG L+ +G   L   GF L  G S  LQA  GWSGRFW RT C 
Sbjct  19   SSATFTFVNKCDYTVWPGILASSGSPKLETTGFELKAGNSRSLQASTGWSGRFWGRTNCK  78

Query  668  FDASGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLG  498
            FD SG GNC TG          G G  PP TLAEFT+ +G+  +DFYDVSLVDGYN+ + 
Sbjct  79   FDDSGRGNCNTGDCGSGEIECNGAGATPPATLAEFTLGSGS--QDFYDVSLVDGYNLPMI  136

Query  497  IRPSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHA  318
            +  +GGSG C   GC+ DLN  CP  L+    G   ACKSAC  F TPEYCC+G++N+ A
Sbjct  137  VEGTGGSGTCASTGCITDLNQLCPAELKAEAGG---ACKSACEAFETPEYCCSGEYNSPA  193

Query  317  TCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
            TC P+ YS++FK+ACPK+YSYAYDD +STFTC G+DY ITFC
Sbjct  194  TCKPSMYSQMFKSACPKSYSYAYDDATSTFTCNGADYTITFC  235



>gb|AFK48181.1| unknown [Medicago truncatula]
Length=249

 Score =   236 bits (601),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 140/218 (64%), Gaps = 7/218 (3%)
 Frame = -1

Query  830  LHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDASGN  651
             +N C + VWP    G G   L  GGF L P ++  LQ P  WSGRFW R GC FDASG+
Sbjct  31   FYNKCPHPVWPAIQPGAGKPILARGGFNLPPNKAYSLQVPPQWSGRFWGRHGCTFDASGH  90

Query  650  GNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPSGGS  477
            G+C TGD        G  G PP TLAEFT      D DFYDVSLVDGYN+ + I P  GS
Sbjct  91   GHCATGDCGGSLFCNGIDGTPPATLAEFTFGK---DLDFYDVSLVDGYNLPISITPFKGS  147

Query  476  GDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTHATCSPT  303
            G C YAGCV+DLN  CP  LQV   D   VV C+SACA FN+P YCCTG+  T  TC PT
Sbjct  148  GKCSYAGCVSDLNLMCPVGLQVRSRDKKHVVGCRSACAAFNSPRYCCTGNFGTPQTCKPT  207

Query  302  QYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             YSRIFK ACPKAYSYAYDD +S  TC  + Y+ITFCP
Sbjct  208  AYSRIFKTACPKAYSYAYDDPTSIATCTNASYMITFCP  245



>emb|CAN79402.1| hypothetical protein VITISV_028072 [Vitis vinifera]
Length=295

 Score =   237 bits (605),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 148/220 (67%), Gaps = 7/220 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +F + N C +TVWPG LS  G + L   GF LS G S  L+ P GWSGRFW R+GC FDA
Sbjct  28   TFAITNRCDFTVWPGILSNAGSSRLETTGFELSSGGSRSLEVPVGWSGRFWGRSGCTFDA  87

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            +G+GNC TG          G G +PP TLAEFTI +G + +DFYDVSLVDGYN+ + +  
Sbjct  88   TGHGNCTTGDCGSGQVECNGAGAIPPATLAEFTIGSG-SQQDFYDVSLVDGYNLPMIVEA  146

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGG+G C   GCV DLN  CP  L+  +     AC SAC  F  PEYCC+G + +  TC 
Sbjct  147  SGGTGSCASTGCVNDLNQQCPAELKANEG---QACNSACGAFAKPEYCCSGAYGSPTTCK  203

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
            P+ YS IFK ACPK+YSYAYDD +STFTC+G++Y+ITFCP
Sbjct  204  PSVYSEIFKTACPKSYSYAYDDATSTFTCSGANYMITFCP  243



>ref|XP_002887494.1| hypothetical protein ARALYDRAFT_476498 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63753.1| hypothetical protein ARALYDRAFT_476498 [Arabidopsis lyrata subsp. 
lyrata]
Length=244

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 147/221 (67%), Gaps = 7/221 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +   +N CTYTVWPG    +G + L  GGF LSP  +  LQ P  WSGRFW R GC+FD 
Sbjct  23   TVIFYNKCTYTVWPGIQPSSGQSVLAGGGFKLSPNRAYTLQLPPLWSGRFWGRHGCSFDR  82

Query  659  SGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            SG G C TG      L  G GGVPP TLAE T+ +   D DFYDVSLVDGYN+ + I P 
Sbjct  83   SGRGRCATGDCGGSFLCNGAGGVPPATLAEITLGH---DMDFYDVSLVDGYNLAMSIMPV  139

Query  485  GGSGDCQYAGCVADLNTNCPEVLQV--TDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
             G+G C YAGCV+DLN  CP  LQV   D   VVACKSAC+ FN+P YCCTG      +C
Sbjct  140  KGTGKCTYAGCVSDLNRMCPVGLQVLSRDGKQVVACKSACSAFNSPRYCCTGLFGNPQSC  199

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT YS+IFK ACPKAYSYAYDD +S  TC+ ++Y++TFCP
Sbjct  200  KPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYIVTFCP  240



>gb|KHG02944.1| hypothetical protein F383_23941 [Gossypium arboreum]
Length=354

 Score =   239 bits (610),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 145/222 (65%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            SFT  N C YTVWPG L+  G   L   GF L    S   QAP GWSGRFW RTGC FD 
Sbjct  30   SFTFVNRCGYTVWPGILANAGSPTLDSTGFELPKDSSRSFQAPTGWSGRFWGRTGCTFDG  89

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G CVTG          G G  PPVTLAEFT+  G   +DFYDVSLVDGYN+ + +  
Sbjct  90   SGSGTCVTGDCGSGQMECNGLGAAPPVTLAEFTLGTGG--QDFYDVSLVDGYNIPMIVEG  147

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGGSG C   GC  DLN  CP  L++ D     ACKSAC  F +PEYCC+G ++T ATC 
Sbjct  148  SGGSGLCASTGCTTDLNRQCPSELRIGDGD---ACKSACEAFGSPEYCCSGAYSTPATCK  204

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTC G+DY +TFCP S
Sbjct  205  PSVYSEMFKAACPRSYSYAYDDATSTFTCTGADYTVTFCPSS  246



>emb|CDY12096.1| BnaC03g60120D [Brassica napus]
Length=346

 Score =   239 bits (609),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 147/222 (66%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C +TVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC+FD 
Sbjct  30   TFTFANRCGFTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCSFDG  89

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C TG          G G  PPVTLAEFT+  G    DFYDVSLVDGYN+ + +  
Sbjct  90   SGSGTCKTGDCGSNQVECVGLGAAPPVTLAEFTLGTGG--DDFYDVSLVDGYNLPMIVEV  147

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GGSG C   GC +DLN  CP  L+   SG   ACKSAC  F +PEYCC+G + T +TC 
Sbjct  148  AGGSGQCASTGCTSDLNLQCPAELR---SGDGDACKSACEAFRSPEYCCSGAYATPSTCR  204

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTCAG DY +TFCP S
Sbjct  205  PSVYSEMFKAACPRSYSYAYDDATSTFTCAGGDYTVTFCPSS  246



>ref|XP_010431808.1| PREDICTED: thaumatin-like protein 1 [Camelina sativa]
Length=346

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 146/222 (66%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C +TVWPG L+  G   L   GF L  G S  LQAP GWSGRFWARTGC FD 
Sbjct  30   TFTFANRCGFTVWPGILANAGSPTLSTTGFELPKGTSRSLQAPTGWSGRFWARTGCKFDG  89

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C TG          G G  PPVTLAEFT+  G    DFYDVSLVDGYN+ + +  
Sbjct  90   SGSGACTTGDCGSNQVECVGLGAAPPVTLAEFTL--GTCGDDFYDVSLVDGYNIPMIVEV  147

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            +GGSG C   GC +D+NT CP  L+  D     ACKSAC  F +PEYCC+G + T +TC 
Sbjct  148  AGGSGQCASTGCTSDINTQCPAELRYGDGD---ACKSACEAFRSPEYCCSGAYATPSTCR  204

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTCAG DY +TFCP S
Sbjct  205  PSVYSEMFKAACPRSYSYAYDDATSTFTCAGGDYTVTFCPSS  246



>ref|XP_010519216.1| PREDICTED: thaumatin-like protein [Tarenaya hassleriana]
Length=243

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 148/224 (66%), Gaps = 7/224 (3%)
 Frame = -1

Query  848  AAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCN  669
            +A + T++N C + VWPG     G   +  GGF L P ++  LQ P+ WSGRFW R GC 
Sbjct  19   SATTVTMYNKCAHPVWPGIQPSAGQKLIAGGGFKLLPNKAFTLQLPSLWSGRFWGRHGCA  78

Query  668  FDASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGI  495
            FD SG G C TG      L  G GG PP TLAE T+ N   DKDFYDVSLVDGYN+ + I
Sbjct  79   FDRSGRGRCATGDCGGSLLCNGLGGAPPATLAEITLGN---DKDFYDVSLVDGYNLAMSI  135

Query  494  RPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTH  321
            +P  GSG C YAGCV+DLN  CP  LQV   +   VVACKSAC+ FN+P YCCTG     
Sbjct  136  QPVKGSGQCSYAGCVSDLNRMCPVGLQVRSRNGKQVVACKSACSAFNSPRYCCTGSFGNP  195

Query  320  ATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             +C PT YS+IFK ACPKAYSYAYDD +S  TC+ ++YL+TFCP
Sbjct  196  QSCRPTAYSKIFKAACPKAYSYAYDDPTSIATCSKANYLVTFCP  239



>ref|XP_006390535.1| hypothetical protein EUTSA_v10019050mg [Eutrema salsugineum]
 gb|ESQ27821.1| hypothetical protein EUTSA_v10019050mg [Eutrema salsugineum]
Length=244

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 147/221 (67%), Gaps = 7/221 (3%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +   +N CTYTVWPG    +G + L  GGF LSP  +  LQ P  WSGRFW R GC+F  
Sbjct  23   TVIFYNKCTYTVWPGIQPSSGQSLLAGGGFKLSPNRAYSLQLPPLWSGRFWGRHGCSFGK  82

Query  659  SGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            SG G C TG      L  G GGVPP TLAE T+ +   D+DFYDVSLVDGYN+ + I P 
Sbjct  83   SGRGRCATGDCGGSLLCNGAGGVPPATLAEITLGH---DQDFYDVSLVDGYNLAMSIMPV  139

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
             G+G C YAGCV+DLN  CP  LQV   D   VVACKSAC+ FN+P YCCTG      +C
Sbjct  140  KGTGKCSYAGCVSDLNRMCPVGLQVRSRDGKQVVACKSACSAFNSPRYCCTGPFGNPQSC  199

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
             PT YS+IFK ACPKAYSYAYDD +S  TC+ ++Y++TFCP
Sbjct  200  RPTAYSKIFKVACPKAYSYAYDDPTSIATCSKANYVVTFCP  240



>ref|XP_010935078.1| PREDICTED: thaumatin-like protein 1b [Elaeis guineensis]
Length=379

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 149/221 (67%), Gaps = 8/221 (4%)
 Frame = -1

Query  836  FTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDAS  657
            FT  N C YTVWPG L+ +G A+L   GF L+ G+S  L APAGWSGRFWARTGCNFD+S
Sbjct  105  FTFVNNCGYTVWPGVLANSGNANLDSTGFTLAAGDSRVLLAPAGWSGRFWARTGCNFDSS  164

Query  656  GNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRPS  486
            G G+C TG          G G  PP TLAEFT+     DKD+YDVSLVDGYN+ + +   
Sbjct  165  GRGSCATGDCGSGQVECNGAGAAPPATLAEFTLGKA-GDKDYYDVSLVDGYNLPVVVDAG  223

Query  485  GGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCSP  306
            GG   C   GCVADLN  CP  L+V D G   AC+SAC  F  PE+CC+GD  + ATC P
Sbjct  224  GG---CAATGCVADLNRRCPSELRVGD-GEAAACRSACEAFGKPEFCCSGDFGSPATCHP  279

Query  305  TQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            + YS +FK+ACP++YSYAYDD +STFTC   DY ITFCP S
Sbjct  280  SVYSEVFKSACPRSYSYAYDDATSTFTCTAGDYSITFCPRS  320



>ref|XP_010928530.1| PREDICTED: pathogenesis-related protein 5-like, partial [Elaeis 
guineensis]
Length=221

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 143/220 (65%), Gaps = 5/220 (2%)
 Frame = -1

Query  845  AGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNF  666
            A  FTL N C YTVW     G G   +G+GG  L PG S  + APAGWSGR W R  C+F
Sbjct  5    AAGFTLKNNCAYTVWAAIQPGAGKPMIGDGGLQLEPGRSAHVHAPAGWSGRMWPRRDCSF  64

Query  665  DASGNGNCVTg--dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIR  492
            D+SG G C+TG         G GG PPVTLAEFT+   ++  D+YDVSLVDGYN  + + 
Sbjct  65   DSSGRGFCLTGDCGGLLQCAGAGGSPPVTLAEFTL---DSPIDYYDVSLVDGYNAPVSVV  121

Query  491  PSGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATC  312
            P GG+G C+   C +DLN +CP  L+V   G VVACKSAC  F TP YCCTG+  +   C
Sbjct  122  PMGGAGSCRPVTCESDLNRSCPGPLRVERGGEVVACKSACMAFGTPAYCCTGEFASPEAC  181

Query  311  SPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFC  192
             PT YSR+FK ACP AYSYAYDD +S F C G+DYLITFC
Sbjct  182  RPTAYSRVFKKACPTAYSYAYDDPTSIFMCRGADYLITFC  221



>gb|KDP29626.1| hypothetical protein JCGZ_18788 [Jatropha curcas]
Length=346

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 146/222 (66%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C YTVWPG L+  G   L   GF L    S   QAP GWSGRFWARTGCNFD 
Sbjct  25   TFTFVNRCEYTVWPGILANAGSPRLDSTGFELPKDTSRSFQAPTGWSGRFWARTGCNFDD  84

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C+TG          G G  PP TLAEFT+  G   +DFYDVSLVDGYN+ + +  
Sbjct  85   SGSGFCLTGDCGSGQVECNGLGAAPPATLAEFTLGTGG--QDFYDVSLVDGYNLPMVVDG  142

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGGSG C   GC ADLN  CP  L+V D     ACKSAC  F +PEYCC+G  NT +TC 
Sbjct  143  SGGSGMCASTGCSADLNRQCPAELKVGDGD---ACKSACEAFGSPEYCCSGAFNTPSTCK  199

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTC G+DY +TFCP S
Sbjct  200  PSVYSEMFKAACPRSYSYAYDDATSTFTCTGADYTVTFCPSS  241



>ref|XP_007041882.1| Pathogenesis-related thaumatin superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOX97713.1| Pathogenesis-related thaumatin superfamily protein isoform 1 
[Theobroma cacao]
Length=416

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 145/222 (65%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            SFT  N C YTVWPG L+  G   L   GF L    S   QAP GWSGRFW RTGC FD 
Sbjct  44   SFTFVNRCAYTVWPGILANAGSPRLDSTGFELPKDSSRSFQAPTGWSGRFWGRTGCTFDG  103

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C+TG          G G  PPVTLAEFT+  G   +DFYDVSLVDGYN+ + +  
Sbjct  104  SGSGACLTGDCGAGQMECNGLGAAPPVTLAEFTLGTGG--QDFYDVSLVDGYNLPMIVEG  161

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGGSG C   GC  DLN  CP  L+V D     ACKSAC  F +PEYCC+G ++T ATC 
Sbjct  162  SGGSGLCASTGCTTDLNRQCPSELRVGDGD---ACKSACEAFGSPEYCCSGAYSTPATCK  218

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTC G+DY +TFCP S
Sbjct  219  PSVYSEMFKAACPRSYSYAYDDATSTFTCTGADYTVTFCPSS  260



>ref|XP_007209509.1| hypothetical protein PRUPE_ppa010418mg [Prunus persica]
 gb|EMJ10708.1| hypothetical protein PRUPE_ppa010418mg [Prunus persica]
Length=250

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 150/229 (66%), Gaps = 7/229 (3%)
 Frame = -1

Query  863  ITNVWAAGSFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWA  684
            +  V +A + T+HN C++ VWPG     G   L  GGF L P ++  L+ P  WSGR W 
Sbjct  22   LVEVSSATTITMHNKCSHPVWPGIQPSAGQPILARGGFTLPPNKAYTLRLPPLWSGRLWG  81

Query  683  RTGCNFDASGNGNCVTgd--cgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYN  510
            R GC FD+SG G C TGD        G GG PP TLAE T+ N   ++DFYDVSLVDGYN
Sbjct  82   RHGCAFDSSGRGRCATGDCGGNLFCSGLGGTPPATLAEITLGN---EQDFYDVSLVDGYN  138

Query  509  VDLGIRPSGGSGDCQYAGCVADLNTNCPEVLQVT--DSGSVVACKSACAQFNTPEYCCTG  336
            + + I+P  GSG C YAGC++DLN  CP  LQV   D+  VVACKSAC+ FN+P YCCTG
Sbjct  139  LAISIQPFKGSGKCSYAGCISDLNMMCPVGLQVRSHDNRRVVACKSACSAFNSPRYCCTG  198

Query  335  DHNTHATCSPTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCP  189
               +  +C PT YS+IFK ACPKAYSYAYDD +S  TC   +Y++TFCP
Sbjct  199  SFGSPQSCKPTAYSKIFKAACPKAYSYAYDDPTSIATCTRGNYVVTFCP  247



>ref|XP_010531542.1| PREDICTED: thaumatin-like protein 1b [Tarenaya hassleriana]
Length=333

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 145/222 (65%), Gaps = 8/222 (4%)
 Frame = -1

Query  839  SFTLHNACTYTVWPGTLSGNGGAHLGEGGFALSPGESVELQAPAGWSGRFWARTGCNFDA  660
            +FT  N C  TVWPG L+  G   L   GF L    S  LQA  GWSGRFWARTGCNFD 
Sbjct  29   TFTFINRCGLTVWPGILANAGSPALATTGFELPKDTSRTLQASTGWSGRFWARTGCNFDG  88

Query  659  SGNGNCVTg---dcgglkcgggGVPPVTLAEFTIANGNADKDFYDVSLVDGYNVDLGIRP  489
            SG+G C TG          G G VPPVTLAEFT+  G    DFYDVSLVDGYN+ + +  
Sbjct  89   SGSGACTTGDCGSGMVECNGLGAVPPVTLAEFTLGTGG--NDFYDVSLVDGYNLPMVVEV  146

Query  488  SGGSGDCQYAGCVADLNTNCPEVLQVTDSGSVVACKSACAQFNTPEYCCTGDHNTHATCS  309
            SGGSG C   GC +DLN  CP  L+V D     ACKSAC  F +PEYCC+G + T ATC 
Sbjct  147  SGGSGQCAATGCTSDLNRQCPAELRVGDGD---ACKSACEAFRSPEYCCSGAYATPATCR  203

Query  308  PTQYSRIFKNACPKAYSYAYDDDSSTFTCAGSDYLITFCPGS  183
            P+ YS +FK ACP++YSYAYDD +STFTC+G DY +TFCP S
Sbjct  204  PSVYSEMFKAACPRSYSYAYDDATSTFTCSGGDYTVTFCPSS  245



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2555722443024