BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23593_g2_i4 len=331 path=[15697:0-109 281:110-330]

Length=331
                                                                      Score     E

ref|XP_010663040.1|  PREDICTED: two-component response regulator ...  72.8    1e-12   
ref|XP_006341767.1|  PREDICTED: two-component response regulator ...  73.2    2e-12   
ref|XP_010682390.1|  PREDICTED: two-component response regulator ...  72.8    2e-12   
ref|XP_002515016.1|  two-component sensor histidine kinase bacter...  72.4    3e-12   Ricinus communis
ref|XP_010663038.1|  PREDICTED: two-component response regulator ...  72.4    3e-12   
ref|XP_002274673.1|  PREDICTED: two-component response regulator ...  72.4    3e-12   Vitis vinifera
emb|CBI14873.3|  unnamed protein product                              72.4    3e-12   
ref|XP_009606770.1|  PREDICTED: uncharacterized protein LOC104101066  72.4    3e-12   
ref|XP_004239497.1|  PREDICTED: putative two-component response r...  72.0    4e-12   
ref|XP_009414676.1|  PREDICTED: uncharacterized protein LOC103995...  70.9    8e-12   
ref|XP_010251342.1|  PREDICTED: two-component response regulator ...  70.9    8e-12   
ref|XP_011042332.1|  PREDICTED: two-component response regulator ...  70.9    1e-11   
ref|XP_010248810.1|  PREDICTED: uncharacterized protein LOC104591...  70.5    1e-11   
ref|XP_009414674.1|  PREDICTED: uncharacterized protein LOC103995...  70.9    1e-11   
ref|XP_009793670.1|  PREDICTED: two-component response regulator ...  70.5    1e-11   
ref|XP_009414675.1|  PREDICTED: two-component response regulator ...  70.5    1e-11   
ref|XP_010025368.1|  PREDICTED: two-component response regulator ...  70.5    1e-11   
gb|EYU22557.1|  hypothetical protein MIMGU_mgv1a006021mg              70.1    1e-11   
gb|EYU22556.1|  hypothetical protein MIMGU_mgv1a006021mg              70.1    1e-11   
ref|XP_002315642.2|  hypothetical protein POPTR_0010s06290g           69.7    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_008351064.1|  PREDICTED: two-component response regulator ...  67.0    1e-11   
ref|XP_010248808.1|  PREDICTED: uncharacterized protein LOC104591...  70.1    2e-11   
emb|CBM42563.1|  putative B-type response regulator 21                70.1    2e-11   
ref|XP_010100306.1|  Two-component response regulator                 70.1    2e-11   
ref|XP_008390110.1|  PREDICTED: two-component response regulator ...  68.2    2e-11   
ref|XP_008221977.1|  PREDICTED: two-component response regulator ...  70.1    2e-11   
ref|XP_007226956.1|  hypothetical protein PRUPE_ppa002679mg           70.1    2e-11   
ref|XP_009359281.1|  PREDICTED: two-component response regulator ...  69.3    3e-11   
gb|KHF99908.1|  Two-component response regulator ARR11 -like protein  69.3    4e-11   
ref|XP_002312648.1|  hypothetical protein POPTR_0008s18130g           69.3    4e-11   Populus trichocarpa [western balsam poplar]
ref|XP_009392350.1|  PREDICTED: uncharacterized protein LOC103978...  69.3    4e-11   
ref|XP_007158728.1|  hypothetical protein PHAVU_002G177100g           69.3    4e-11   
ref|XP_008444405.1|  PREDICTED: two-component response regulator ...  69.3    4e-11   
ref|XP_009392349.1|  PREDICTED: uncharacterized protein LOC103978...  69.3    4e-11   
ref|XP_011029606.1|  PREDICTED: two-component response regulator ...  68.9    4e-11   
ref|XP_011029607.1|  PREDICTED: two-component response regulator ...  68.9    4e-11   
ref|XP_011029605.1|  PREDICTED: two-component response regulator ...  68.9    4e-11   
ref|XP_004142954.1|  PREDICTED: two-component response regulator ...  68.9    4e-11   
ref|XP_002267616.1|  PREDICTED: two-component response regulator ...  68.9    4e-11   Vitis vinifera
ref|XP_004310018.1|  PREDICTED: two-component response regulator ...  68.9    5e-11   
ref|XP_007044949.1|  Two-component sensor histidine kinase bacter...  68.9    5e-11   
emb|CBM42565.1|  putative B-type response regulator 14                68.9    5e-11   
ref|XP_007044950.1|  Two-component sensor histidine kinase bacter...  68.2    5e-11   
gb|AFK40300.1|  unknown                                               68.6    5e-11   
ref|XP_004310019.1|  PREDICTED: two-component response regulator ...  68.6    5e-11   
ref|XP_007044951.1|  Two-component sensor histidine kinase bacter...  68.6    6e-11   
ref|XP_011071178.1|  PREDICTED: two-component response regulator ...  68.6    6e-11   
ref|XP_010932292.1|  PREDICTED: two-component response regulator ...  67.4    1e-10   
ref|XP_008797265.1|  PREDICTED: two-component response regulator ...  67.4    1e-10   
gb|EPS59389.1|  hypothetical protein M569_15420                       65.5    1e-10   
ref|XP_006580107.1|  PREDICTED: two-component response regulator ...  67.4    2e-10   
ref|XP_010907773.1|  PREDICTED: two-component response regulator ...  67.4    2e-10   
ref|XP_003524159.1|  PREDICTED: two-component response regulator ...  67.4    2e-10   
ref|XP_008353034.1|  PREDICTED: two-component response regulator ...  67.4    2e-10   
ref|XP_008353033.1|  PREDICTED: two-component response regulator ...  67.0    2e-10   
ref|XP_008799983.1|  PREDICTED: two-component response regulator ...  67.0    2e-10   
ref|XP_007163714.1|  hypothetical protein PHAVU_001G258000g           66.2    3e-10   
gb|KHN44399.1|  Two-component response regulator ARR11                66.2    4e-10   
ref|XP_003537547.1|  PREDICTED: two-component response regulator ...  66.2    4e-10   
gb|KHN24104.1|  Two-component response regulator ARR11                66.2    4e-10   
gb|KDP26732.1|  hypothetical protein JCGZ_17890                       66.2    4e-10   
ref|XP_006591475.1|  PREDICTED: two-component response regulator ...  66.2    4e-10   
ref|XP_003601849.1|  Response regulator                               65.9    5e-10   
ref|XP_010025369.1|  PREDICTED: two-component response regulator ...  64.3    1e-09   
gb|KCW62015.1|  hypothetical protein EUGRSUZ_H04694                   64.3    1e-09   
ref|XP_004502338.1|  PREDICTED: two-component response regulator ...  63.9    3e-09   
gb|KDO82063.1|  hypothetical protein CISIN_1g007940mg                 63.5    3e-09   
ref|XP_006438147.1|  hypothetical protein CICLE_v10031052mg           63.5    3e-09   
ref|XP_006484016.1|  PREDICTED: two-component response regulator ...  63.5    3e-09   
ref|XP_002458941.1|  hypothetical protein SORBIDRAFT_03g043080        63.2    4e-09   Sorghum bicolor [broomcorn]
gb|AFW84265.1|  putative two-component response regulator family ...  63.2    4e-09   
emb|CDM84858.1|  unnamed protein product                              63.2    4e-09   
ref|NP_001152300.1|  two-component response regulator ARR11           63.2    4e-09   Zea mays [maize]
tpg|DAA56280.1|  TPA: putative two-component response regulator f...  63.2    4e-09   
ref|XP_008656969.1|  PREDICTED: uncharacterized protein LOC103636390  63.2    4e-09   
gb|EMT02832.1|  Two-component response regulator ARR11                63.2    5e-09   
ref|XP_010232707.1|  PREDICTED: two-component response regulator ...  62.8    5e-09   
ref|XP_003564868.1|  PREDICTED: two-component response regulator ...  62.8    5e-09   
ref|XP_004970962.1|  PREDICTED: two-component response regulator ...  62.8    6e-09   
gb|EEC71985.1|  hypothetical protein OsI_04831                        62.8    6e-09   Oryza sativa Indica Group [Indian rice]
tpd|FAA00259.1|  TPA: response regulator                              62.8    6e-09   
dbj|BAD82798.1|  putative response regulator 11                       62.4    7e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645188.1|  PREDICTED: two-component response regulator ...  62.4    7e-09   
ref|XP_002515018.1|  two-component sensor histidine kinase bacter...  61.6    9e-09   Ricinus communis
ref|XP_002515017.1|  Two-component response regulator ARR14, puta...  60.8    2e-08   Ricinus communis
ref|XP_011087104.1|  PREDICTED: two-component response regulator ...  60.8    2e-08   
ref|XP_004150083.1|  PREDICTED: two-component response regulator ...  60.5    3e-08   
ref|XP_006488885.1|  PREDICTED: two-component response regulator ...  57.8    4e-08   
gb|KHN12421.1|  Two-component response regulator ARR11                60.1    4e-08   
ref|XP_006419447.1|  hypothetical protein CICLE_v10005747mg           57.8    6e-08   
dbj|BAA94549.1|  response regulator 11                                59.3    6e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CAA06431.1|  receiver-like protein 3                              59.3    6e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550447.1|  PREDICTED: two-component response regulator ...  59.7    7e-08   
ref|XP_009105312.1|  PREDICTED: two-component response regulator ...  59.3    7e-08   
gb|KFK41176.1|  hypothetical protein AALP_AA2G095600                  59.3    7e-08   
ref|XP_010511720.1|  PREDICTED: two-component response regulator ...  59.3    7e-08   
ref|XP_006302128.1|  hypothetical protein CARUB_v10020133mg           59.3    7e-08   
ref|XP_002888617.1|  hypothetical protein ARALYDRAFT_894522           59.3    7e-08   
ref|XP_006391233.1|  hypothetical protein EUTSA_v10018396mg           59.3    7e-08   
ref|XP_010470687.1|  PREDICTED: two-component response regulator ...  59.3    7e-08   
emb|CDY28869.1|  BnaC06g26570D                                        59.3    7e-08   
ref|NP_176938.1|  two-component response regulator ARR11              59.3    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006419446.1|  hypothetical protein CICLE_v10005747mg           57.8    7e-08   
emb|CDY01838.1|  BnaC06g28780D                                        59.3    8e-08   
emb|CDX96070.1|  BnaA07g26610D                                        59.3    8e-08   
ref|XP_009105108.1|  PREDICTED: two-component response regulator ...  59.3    8e-08   
ref|XP_010415351.1|  PREDICTED: two-component response regulator ...  59.3    8e-08   
ref|XP_009105107.1|  PREDICTED: two-component response regulator ...  59.3    8e-08   
ref|XP_010051575.1|  PREDICTED: two-component response regulator ...  59.3    8e-08   
ref|XP_006852154.1|  hypothetical protein AMTR_s00049p00081480        59.3    1e-07   
ref|XP_006380213.1|  hypothetical protein POPTR_0008s22990g           58.9    1e-07   
emb|CBM42558.1|  putative B-type response regulator 12                58.9    1e-07   
gb|ABG35774.1|  SRR384                                                58.5    1e-07   Striga asiatica [witchweed]
gb|EYU43994.1|  hypothetical protein MIMGU_mgv1a002699mg              58.5    1e-07   
gb|AAQ10678.1|  type-B response regulator                             58.5    2e-07   Catharanthus roseus [chatas]
ref|XP_002978969.1|  type B response regulator                        58.5    2e-07   
ref|XP_004239797.1|  PREDICTED: two-component response regulator ...  58.5    2e-07   
ref|XP_011046396.1|  PREDICTED: two-component response regulator ...  58.5    2e-07   
ref|XP_011046395.1|  PREDICTED: two-component response regulator ...  58.5    2e-07   
ref|XP_011046394.1|  PREDICTED: two-component response regulator ...  58.5    2e-07   
ref|XP_011046392.1|  PREDICTED: two-component response regulator ...  58.5    2e-07   
ref|XP_011046391.1|  PREDICTED: two-component response regulator ...  58.5    2e-07   
ref|XP_011046390.1|  PREDICTED: two-component response regulator ...  58.5    2e-07   
ref|XP_011046389.1|  PREDICTED: two-component response regulator ...  58.5    2e-07   
ref|XP_011046388.1|  PREDICTED: two-component response regulator ...  58.5    2e-07   
ref|XP_011046387.1|  PREDICTED: two-component response regulator ...  58.5    2e-07   
ref|XP_011046386.1|  PREDICTED: two-component response regulator ...  58.5    2e-07   
ref|XP_008458388.1|  PREDICTED: two-component response regulator ...  57.8    3e-07   
emb|CBM42559.1|  putative B-type response regulator 13                57.8    3e-07   
ref|XP_002314325.1|  Two-component response regulator ARR2 family...  57.8    3e-07   Populus trichocarpa [western balsam poplar]
emb|CDO98804.1|  unnamed protein product                              57.8    3e-07   
ref|XP_011071400.1|  PREDICTED: two-component response regulator ...  57.8    3e-07   
ref|XP_011071399.1|  PREDICTED: two-component response regulator ...  57.8    3e-07   
ref|XP_006363579.1|  PREDICTED: two-component response regulator ...  57.4    4e-07   
ref|XP_006345976.1|  PREDICTED: two-component response regulator ...  57.0    5e-07   
ref|XP_011100814.1|  PREDICTED: two-component response regulator ...  57.0    5e-07   
ref|XP_011100813.1|  PREDICTED: two-component response regulator ...  57.0    5e-07   
ref|XP_011100812.1|  PREDICTED: two-component response regulator ...  57.0    5e-07   
ref|XP_004229281.1|  PREDICTED: two-component response regulator ...  57.0    6e-07   
gb|KHG01283.1|  Two-component response regulator ARR1 -like protein   56.6    7e-07   
gb|KHF98092.1|  Two-component response regulator ARR1 -like protein   56.6    7e-07   
ref|XP_009146503.1|  PREDICTED: two-component response regulator ...  56.6    7e-07   
ref|XP_009801563.1|  PREDICTED: two-component response regulator ...  56.6    8e-07   
ref|XP_004508173.1|  PREDICTED: two-component response regulator ...  56.6    8e-07   
ref|XP_004508172.1|  PREDICTED: two-component response regulator ...  56.6    8e-07   
ref|XP_004508171.1|  PREDICTED: two-component response regulator ...  56.6    8e-07   
ref|XP_009768392.1|  PREDICTED: two-component response regulator ...  56.2    9e-07   
ref|XP_002508755.1|  g2-like myb-transcription factor with a n-te...  55.8    1e-06   Micromonas commoda
ref|XP_009591694.1|  PREDICTED: two-component response regulator ...  56.2    1e-06   
ref|XP_010268091.1|  PREDICTED: two-component response regulator ...  56.2    1e-06   
ref|XP_010268090.1|  PREDICTED: two-component response regulator ...  56.2    1e-06   
ref|XP_008790854.1|  PREDICTED: two-component response regulator ...  56.2    1e-06   
ref|XP_010938331.1|  PREDICTED: two-component response regulator ...  56.2    1e-06   
ref|XP_010938330.1|  PREDICTED: two-component response regulator ...  56.2    1e-06   
ref|XP_008790853.1|  PREDICTED: two-component response regulator ...  56.2    1e-06   
ref|XP_008790852.1|  PREDICTED: two-component response regulator ...  56.2    1e-06   
ref|XP_010938329.1|  PREDICTED: two-component response regulator ...  56.2    1e-06   
ref|XP_010938328.1|  PREDICTED: two-component response regulator ...  56.2    1e-06   
gb|EYU45518.1|  hypothetical protein MIMGU_mgv1a003712mg              55.8    1e-06   
ref|XP_011000516.1|  PREDICTED: two-component response regulator ...  56.2    1e-06   
ref|XP_011000515.1|  PREDICTED: two-component response regulator ...  56.2    1e-06   
ref|XP_011000512.1|  PREDICTED: two-component response regulator ...  56.2    1e-06   
ref|XP_011000511.1|  PREDICTED: two-component response regulator ...  56.2    1e-06   
ref|XP_010101901.1|  Two-component response regulator                 55.8    1e-06   
ref|XP_008223287.1|  PREDICTED: two-component response regulator ...  55.8    1e-06   
ref|XP_007225155.1|  hypothetical protein PRUPE_ppa002408mg           55.8    1e-06   
ref|XP_008223286.1|  PREDICTED: two-component response regulator ...  55.8    1e-06   
ref|XP_003550512.1|  PREDICTED: two-component response regulator ...  55.8    1e-06   
gb|KHN02925.1|  Two-component response regulator ARR2                 55.8    1e-06   
ref|XP_007154337.1|  hypothetical protein PHAVU_003G110100g           55.8    1e-06   
ref|XP_003529546.1|  PREDICTED: two-component response regulator ...  55.8    1e-06   
gb|KEH32327.1|  two-component response regulator ARR2-like protein    55.8    1e-06   
gb|KEH32325.1|  two-component response regulator ARR2-like protein    55.8    1e-06   
ref|XP_010905671.1|  PREDICTED: two-component response regulator ...  55.8    1e-06   
ref|XP_006419449.1|  hypothetical protein CICLE_v10004989mg           55.5    1e-06   
ref|XP_006488883.1|  PREDICTED: two-component response regulator ...  55.5    2e-06   
ref|XP_010271366.1|  PREDICTED: two-component response regulator ...  55.5    2e-06   
ref|XP_010274996.1|  PREDICTED: two-component response regulator ...  55.5    2e-06   
ref|XP_002994006.1|  hypothetical protein SELMODRAFT_187683           55.1    2e-06   
ref|XP_010259415.1|  PREDICTED: two-component response regulator ...  55.1    2e-06   
ref|XP_010259414.1|  PREDICTED: two-component response regulator ...  55.1    2e-06   
ref|XP_010548968.1|  PREDICTED: two-component response regulator ...  55.1    2e-06   
emb|CDY09718.1|  BnaC07g33430D                                        55.1    2e-06   
ref|XP_010670915.1|  PREDICTED: two-component response regulator ...  55.1    2e-06   
ref|XP_010670914.1|  PREDICTED: two-component response regulator ...  55.1    2e-06   
ref|XP_006286049.1|  hypothetical protein CARUB_v10007581mg           55.1    2e-06   
ref|XP_007138963.1|  hypothetical protein PHAVU_009G253200g           55.1    3e-06   
ref|XP_009369971.1|  PREDICTED: two-component response regulator ...  55.1    3e-06   
ref|XP_008390564.1|  PREDICTED: two-component response regulator ...  55.1    3e-06   
ref|XP_009369970.1|  PREDICTED: two-component response regulator ...  55.1    3e-06   
ref|XP_006586907.1|  PREDICTED: two-component response regulator ...  55.1    3e-06   
emb|CDX90546.1|  BnaA03g42350D                                        55.1    3e-06   
ref|XP_009136741.1|  PREDICTED: two-component response regulator ...  55.1    3e-06   
ref|XP_009136740.1|  PREDICTED: two-component response regulator ...  55.1    3e-06   
ref|XP_003546340.1|  PREDICTED: two-component response regulator ...  55.1    3e-06   
gb|KHN12911.1|  Two-component response regulator ARR2                 55.1    3e-06   
ref|XP_003533222.1|  PREDICTED: two-component response regulator ...  55.1    3e-06   
gb|KHN14648.1|  Two-component response regulator ARR2                 55.1    3e-06   
ref|XP_009417757.1|  PREDICTED: two-component response regulator ...  55.1    3e-06   
gb|KDP27872.1|  hypothetical protein JCGZ_18952                       54.7    3e-06   
ref|XP_002958010.1|  ARR-B family transcription factor                53.5    3e-06   
ref|XP_003063042.1|  g2-like myb-transcription factor with a n-te...  54.7    3e-06   
ref|XP_004295112.1|  PREDICTED: two-component response regulator ...  54.7    3e-06   
emb|CBI22927.3|  unnamed protein product                              54.3    4e-06   
gb|KEH20538.1|  two-component response regulator ARR2-like protein    54.3    4e-06   
ref|XP_004134232.1|  PREDICTED: two-component response regulator ...  54.3    4e-06   
gb|EYU45516.1|  hypothetical protein MIMGU_mgv1a023212mg              54.3    4e-06   
ref|XP_006488891.1|  PREDICTED: two-component response regulator ...  52.8    4e-06   
ref|XP_010649546.1|  PREDICTED: two-component response regulator ...  54.3    4e-06   
ref|XP_007035713.1|  Sensor histidine kinase, putative isoform 1      54.3    4e-06   
ref|XP_002275142.2|  PREDICTED: two-component response regulator ...  54.3    4e-06   Vitis vinifera
ref|XP_002519174.1|  sensor histidine kinase, putative                54.3    4e-06   Ricinus communis
ref|XP_006488890.1|  PREDICTED: two-component response regulator ...  54.3    4e-06   
ref|XP_006419444.1|  hypothetical protein CICLE_v10004470mg           54.3    4e-06   
ref|XP_006488888.1|  PREDICTED: two-component response regulator ...  54.3    4e-06   
ref|XP_006419443.1|  hypothetical protein CICLE_v10004470mg           54.3    4e-06   
ref|XP_008438918.1|  PREDICTED: two-component response regulator ...  54.3    5e-06   
gb|AEM23772.1|  RRB2 type-b response regulator                        54.3    5e-06   
ref|XP_009615647.1|  PREDICTED: two-component response regulator ...  54.3    5e-06   
ref|XP_001700734.1|  hypothetical protein CHLREDRAFT_113139           52.4    5e-06   Chlamydomonas reinhardtii
ref|XP_010651334.1|  PREDICTED: two-component response regulator ...  53.9    5e-06   
gb|AFK34876.1|  unknown                                               53.9    5e-06   
ref|XP_003594816.1|  Two-component response regulator ARR2            53.9    5e-06   
emb|CBI26824.3|  unnamed protein product                              53.5    6e-06   
ref|XP_010651276.1|  PREDICTED: two-component response regulator ...  53.9    6e-06   
gb|KHG02654.1|  Two-component response regulator ARR1 -like protein   53.9    6e-06   
ref|XP_008340754.1|  PREDICTED: two-component response regulator ...  53.9    6e-06   
ref|XP_008340753.1|  PREDICTED: two-component response regulator ...  53.9    6e-06   
emb|CBL94183.1|  putative type-b response regulator (sensor histi...  53.9    6e-06   
emb|CDX75892.1|  BnaC03g39750D                                        53.5    6e-06   
emb|CDX95898.1|  BnaC05g36490D                                        53.5    6e-06   
ref|XP_002533196.1|  two-component sensor histidine kinase bacter...  53.5    7e-06   Ricinus communis
emb|CDX82389.1|  BnaA03g34320D                                        53.5    7e-06   
gb|AES92580.2|  two-component response regulator ARR12-like protein   53.5    7e-06   
ref|XP_003610383.1|  Two-component response regulator EHD1            53.5    7e-06   
ref|XP_009135499.1|  PREDICTED: two-component response regulator ...  53.5    7e-06   
ref|XP_010440207.1|  PREDICTED: two-component response regulator ...  53.5    7e-06   
ref|XP_010449851.1|  PREDICTED: two-component response regulator ...  53.5    7e-06   
ref|XP_010434886.1|  PREDICTED: two-component response regulator ...  53.5    7e-06   
ref|XP_009146053.1|  PREDICTED: two-component response regulator ...  53.5    7e-06   
dbj|BAJ34504.1|  unnamed protein product                              53.5    7e-06   
ref|NP_850600.2|  response regulator 1                                53.5    7e-06   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA74528.1|  ARR1 protein                                         53.5    7e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39028.1|  hypothetical protein AALP_AA3G191300                  53.5    7e-06   
ref|XP_010548971.1|  PREDICTED: two-component response regulator ...  51.6    7e-06   
ref|XP_009146052.1|  PREDICTED: two-component response regulator ...  53.5    7e-06   
ref|XP_009146051.1|  PREDICTED: two-component response regulator ...  53.5    7e-06   
ref|XP_002883031.1|  hypothetical protein ARALYDRAFT_479152           53.5    8e-06   
gb|AAL06987.1|  AT3g16857/MUH15_1                                     53.5    8e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566561.2|  response regulator 1                                53.5    8e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010465710.1|  PREDICTED: two-component response regulator ...  53.5    8e-06   
ref|XP_006297106.1|  hypothetical protein CARUB_v10013107mg           53.5    8e-06   
ref|XP_009346208.1|  PREDICTED: two-component response regulator ...  51.6    8e-06   
emb|CDX92102.1|  BnaA05g23050D                                        53.5    8e-06   
gb|KHG03362.1|  Two-component response regulator ARR2 -like protein   53.5    8e-06   
gb|KDP38123.1|  hypothetical protein JCGZ_04766                       53.5    8e-06   
ref|XP_006849799.1|  hypothetical protein AMTR_s00176p00045260        53.1    9e-06   
ref|XP_002311532.2|  hypothetical protein POPTR_0008s13490g           53.1    9e-06   Populus trichocarpa [western balsam poplar]
ref|XP_004964668.1|  PREDICTED: two-component response regulator ...  53.1    1e-05   
ref|XP_006855353.1|  hypothetical protein AMTR_s00057p00108840        52.8    1e-05   
ref|XP_010553618.1|  PREDICTED: two-component response regulator ...  52.4    2e-05   
ref|XP_009351555.1|  PREDICTED: two-component response regulator ...  52.4    2e-05   
emb|CDX82391.1|  BnaA03g34300D                                        49.7    2e-05   
ref|XP_010553611.1|  PREDICTED: two-component response regulator ...  52.4    2e-05   
emb|CDY54630.1|  BnaCnng27490D                                        49.7    2e-05   
ref|XP_010487556.1|  PREDICTED: two-component response regulator ...  52.4    2e-05   
ref|XP_010504728.1|  PREDICTED: two-component response regulator ...  52.4    2e-05   
tpg|DAA40099.1|  TPA: hypothetical protein ZEAMMB73_417245            52.4    2e-05   
ref|XP_010917519.1|  PREDICTED: two-component response regulator ...  52.4    2e-05   
ref|XP_011024263.1|  PREDICTED: two-component response regulator ...  52.0    2e-05   
ref|XP_006406799.1|  hypothetical protein EUTSA_v100202130mg          51.2    2e-05   
emb|CDY54632.1|  BnaCnng27500D                                        49.3    3e-05   
ref|XP_009776286.1|  PREDICTED: uncharacterized protein LOC104226...  52.0    3e-05   
gb|AEM23771.1|  RRB1 type-b response regulator                        52.0    3e-05   
ref|XP_004487801.1|  PREDICTED: two-component response regulator ...  52.0    3e-05   
ref|XP_009776287.1|  PREDICTED: uncharacterized protein LOC104226...  52.0    3e-05   
ref|XP_004487800.1|  PREDICTED: two-component response regulator ...  52.0    3e-05   
ref|XP_005652114.1|  CheY-like protein                                51.2    3e-05   
ref|XP_009776289.1|  PREDICTED: two-component response regulator ...  52.0    3e-05   
ref|XP_011084015.1|  PREDICTED: two-component response regulator ...  52.0    3e-05   
ref|XP_006845607.1|  hypothetical protein AMTR_s00019p00208460        51.6    3e-05   
ref|XP_004297431.1|  PREDICTED: uncharacterized protein LOC101293581  51.6    3e-05   
ref|XP_008812975.1|  PREDICTED: two-component response regulator ...  51.6    3e-05   
ref|XP_008812974.1|  PREDICTED: two-component response regulator ...  51.6    3e-05   
gb|AFW76301.1|  hypothetical protein ZEAMMB73_695347                  48.5    3e-05   
ref|XP_004954220.1|  PREDICTED: two-component response regulator ...  51.6    3e-05   
tpg|DAA40100.1|  TPA: hypothetical protein ZEAMMB73_417245            51.2    4e-05   
ref|XP_007153221.1|  hypothetical protein PHAVU_003G0170000g          47.8    4e-05   
gb|KDO60780.1|  hypothetical protein CISIN_1g005938mg                 51.2    4e-05   
gb|KDO60776.1|  hypothetical protein CISIN_1g005938mg                 51.2    4e-05   
gb|KDO60775.1|  hypothetical protein CISIN_1g005938mg                 51.2    4e-05   
gb|KDO60773.1|  hypothetical protein CISIN_1g005938mg                 51.2    4e-05   
ref|XP_006469262.1|  PREDICTED: two-component response regulator ...  51.2    4e-05   
ref|XP_006469261.1|  PREDICTED: two-component response regulator ...  51.2    4e-05   
ref|XP_008381754.1|  PREDICTED: two-component response regulator ...  51.2    4e-05   
gb|KDO60774.1|  hypothetical protein CISIN_1g005938mg                 51.2    4e-05   
ref|XP_006469260.1|  PREDICTED: two-component response regulator ...  51.2    4e-05   
ref|XP_006448147.1|  hypothetical protein CICLE_v10014527mg           51.2    4e-05   
gb|KDO60779.1|  hypothetical protein CISIN_1g005938mg                 51.2    4e-05   
gb|KDO60772.1|  hypothetical protein CISIN_1g005938mg                 51.2    4e-05   
ref|XP_006469257.1|  PREDICTED: two-component response regulator ...  51.2    4e-05   
emb|CAB10390.1|  hypothetical protein                                 51.2    4e-05   
ref|XP_002436607.1|  hypothetical protein SORBIDRAFT_10g005580        51.2    4e-05   
ref|XP_011021760.1|  PREDICTED: two-component response regulator ...  51.2    4e-05   
ref|NP_193346.4|  transcription factor response regulator 2           51.2    4e-05   
gb|ABF19058.1|  ARR2                                                  51.2    4e-05   
ref|XP_008813715.1|  PREDICTED: two-component response regulator ...  51.2    4e-05   
ref|XP_002870182.1|  hypothetical protein ARALYDRAFT_915160           51.2    4e-05   
ref|XP_009135500.1|  PREDICTED: two-component response regulator ...  51.2    4e-05   
ref|XP_004507712.1|  PREDICTED: two-component response regulator ...  51.2    4e-05   
ref|XP_004507711.1|  PREDICTED: two-component response regulator ...  51.2    4e-05   
ref|XP_002453411.1|  hypothetical protein SORBIDRAFT_04g005580        51.2    5e-05   
ref|XP_009382514.1|  PREDICTED: two-component response regulator ...  51.2    5e-05   
ref|XP_007045291.1|  Two-component response regulator ARR14 isofo...  51.2    5e-05   
ref|XP_002523141.1|  two-component sensor histidine kinase bacter...  50.8    5e-05   
gb|KHF98090.1|  Two-component response regulator ARR2 -like protein   48.5    5e-05   
ref|XP_002315852.1|  hypothetical protein POPTR_0010s11600g           50.8    5e-05   
emb|CBM42561.1|  putative B-type response regulator 16                50.8    6e-05   
ref|XP_006414393.1|  hypothetical protein EUTSA_v10024686mg           50.8    6e-05   
ref|XP_011078598.1|  PREDICTED: two-component response regulator ...  50.8    6e-05   
ref|XP_007153225.1|  hypothetical protein PHAVU_003G017300g           47.4    6e-05   
ref|XP_010474342.1|  PREDICTED: two-component response regulator ...  48.5    7e-05   
ref|XP_003564200.1|  PREDICTED: two-component response regulator ...  50.8    7e-05   
ref|XP_006655852.1|  PREDICTED: two-component response regulator ...  50.8    7e-05   
gb|EEC80137.1|  hypothetical protein OsI_21925                        50.8    7e-05   
ref|NP_001056986.1|  Os06g0183100                                     50.8    7e-05   
ref|XP_008220912.1|  PREDICTED: two-component response regulator ...  50.4    7e-05   
ref|XP_007225140.1|  hypothetical protein PRUPE_ppa002493mg           50.4    7e-05   
ref|XP_001753799.1|  predicted protein                                50.1    7e-05   
ref|XP_008657992.1|  PREDICTED: uncharacterized protein LOC100191...  50.4    8e-05   
ref|XP_002523510.1|  two-component system sensor histidine kinase...  50.4    8e-05   
gb|EMS51534.1|  Two-component response regulator ARR12                50.4    8e-05   
ref|XP_008457369.1|  PREDICTED: two-component response regulator ...  50.4    8e-05   
ref|XP_004139402.1|  PREDICTED: two-component response regulator ...  50.4    8e-05   
ref|XP_003570300.1|  PREDICTED: two-component response regulator ...  50.4    8e-05   
dbj|BAJ94963.1|  predicted protein                                    50.4    8e-05   
gb|EMT09822.1|  Two-component response regulator ARR12                50.4    8e-05   
gb|EMS59489.1|  Two-component response regulator ARR12                50.4    8e-05   
ref|XP_002443012.1|  hypothetical protein SORBIDRAFT_08g006300        50.1    9e-05   
emb|CBM42560.1|  putative B-type response regulator 15                50.4    9e-05   
ref|XP_009590426.1|  PREDICTED: two-component response regulator ...  50.1    9e-05   
ref|XP_009590425.1|  PREDICTED: two-component response regulator ...  50.1    9e-05   
ref|XP_009767632.1|  PREDICTED: two-component response regulator ...  50.1    9e-05   
ref|XP_009590424.1|  PREDICTED: two-component response regulator ...  50.1    1e-04   
gb|KEH39871.1|  response regulator                                    50.1    1e-04   
ref|XP_009767630.1|  PREDICTED: two-component response regulator ...  50.1    1e-04   
ref|XP_002450354.1|  hypothetical protein SORBIDRAFT_05g004150        50.1    1e-04   
ref|XP_009599319.1|  PREDICTED: uncharacterized protein LOC104095...  50.1    1e-04   
ref|XP_008443880.1|  PREDICTED: two-component response regulator ...  50.1    1e-04   
ref|XP_010239130.1|  PREDICTED: two-component response regulator ...  50.1    1e-04   
ref|XP_008443879.1|  PREDICTED: two-component response regulator ...  50.1    1e-04   
ref|XP_004146697.1|  PREDICTED: two-component response regulator ...  50.1    1e-04   
ref|XP_009599320.1|  PREDICTED: uncharacterized protein LOC104095...  50.1    1e-04   
ref|XP_002454708.1|  hypothetical protein SORBIDRAFT_04g035980        50.1    1e-04   
ref|XP_010103375.1|  Two-component response regulator                 50.1    1e-04   
gb|EYU31784.1|  hypothetical protein MIMGU_mgv1a003291mg              50.1    1e-04   
gb|AFW70448.1|  putative two-component response regulator family ...  49.7    1e-04   
ref|NP_001104863.1|  response regulator 9                             49.7    1e-04   
gb|ADX60172.1|  ARR-B transcription factor                            49.7    1e-04   
gb|ADX60157.1|  ARR-B transcription factor                            49.7    1e-04   
gb|EMT11380.1|  Two-component response regulator ARR12                50.1    1e-04   
gb|EYU30138.1|  hypothetical protein MIMGU_mgv1a003601mg              49.7    1e-04   
gb|KCW78951.1|  hypothetical protein EUGRSUZ_C00380                   50.1    1e-04   
ref|XP_010047141.1|  PREDICTED: two-component response regulator ...  50.1    1e-04   
ref|XP_008681518.1|  PREDICTED: uncharacterized protein LOC100274...  49.7    1e-04   
gb|EMS46078.1|  Two-component response regulator ARR12                49.7    1e-04   
gb|EMT32656.1|  Two-component response regulator ARR12                49.7    1e-04   
ref|XP_010026242.1|  PREDICTED: putative two-component response r...  49.7    1e-04   
ref|XP_010416355.1|  PREDICTED: two-component response regulator ...  47.0    1e-04   
gb|EMS59871.1|  Two-component response regulator ARR12                49.7    1e-04   
gb|KEH40636.1|  B-type response regulator                             49.7    1e-04   
ref|XP_008649062.1|  PREDICTED: two-component response regulator ...  49.7    1e-04   
ref|XP_001755122.1|  predicted protein                                49.3    1e-04   
ref|XP_007138266.1|  hypothetical protein PHAVU_009G194200g           49.7    1e-04   
ref|XP_008794327.1|  PREDICTED: two-component response regulator ...  49.7    1e-04   
ref|XP_008389164.1|  PREDICTED: two-component response regulator ...  49.7    1e-04   
ref|XP_008389163.1|  PREDICTED: two-component response regulator ...  49.7    1e-04   
ref|XP_008389161.1|  PREDICTED: two-component response regulator ...  49.7    1e-04   
ref|XP_008794326.1|  PREDICTED: two-component response regulator ...  49.7    1e-04   
ref|XP_002973731.1|  type B response regulator                        49.7    2e-04   
ref|XP_004287108.1|  PREDICTED: two-component response regulator ...  49.7    2e-04   
ref|XP_004287107.1|  PREDICTED: two-component response regulator ...  49.7    2e-04   
ref|XP_011070559.1|  PREDICTED: two-component response regulator ...  49.7    2e-04   
ref|XP_006646983.1|  PREDICTED: two-component response regulator ...  49.3    2e-04   
ref|NP_001046097.1|  Os02g0182100                                     49.3    2e-04   
gb|EAY84742.1|  hypothetical protein OsI_06112                        49.3    2e-04   
ref|XP_011017981.1|  PREDICTED: two-component response regulator ...  49.3    2e-04   
gb|KHG26339.1|  Two-component response regulator ARR12 -like protein  49.3    2e-04   
emb|CBM42562.1|  putative B-type response regulator 19                49.3    2e-04   
ref|XP_011017979.1|  PREDICTED: two-component response regulator ...  49.3    2e-04   
ref|XP_002325148.2|  hypothetical protein POPTR_0018s11960g           49.3    2e-04   
ref|XP_006587150.1|  PREDICTED: two-component response regulator ...  49.3    2e-04   
gb|KHN15214.1|  Two-component response regulator ARR12                49.3    2e-04   
ref|XP_003546612.1|  PREDICTED: two-component response regulator ...  49.3    2e-04   
ref|XP_003533888.2|  PREDICTED: two-component response regulator ...  49.3    2e-04   
ref|XP_011082624.1|  PREDICTED: two-component response regulator ...  49.3    2e-04   
ref|XP_008389975.1|  PREDICTED: two-component response regulator ...  49.3    2e-04   
gb|ABG35773.1|  SRR391                                                49.3    2e-04   
ref|XP_010064661.1|  PREDICTED: two-component response regulator ...  49.3    2e-04   
gb|ACU18532.1|  unknown                                               48.1    2e-04   
ref|XP_010088184.1|  Two-component response regulator                 49.3    2e-04   
ref|XP_004951672.1|  PREDICTED: two-component response regulator ...  49.3    2e-04   
ref|XP_010929130.1|  PREDICTED: two-component response regulator ...  49.3    2e-04   
ref|XP_002968894.1|  type B response regulator                        49.3    2e-04   
ref|XP_002974077.1|  hypothetical protein SELMODRAFT_173793           49.3    2e-04   
emb|CDP10195.1|  unnamed protein product                              49.3    2e-04   
gb|KHN07036.1|  Two-component response regulator ARR12                49.3    2e-04   
ref|XP_003526216.1|  PREDICTED: two-component response regulator ...  49.3    2e-04   
ref|XP_010472520.1|  PREDICTED: two-component response regulator ...  48.9    2e-04   
ref|XP_010417281.1|  PREDICTED: two-component response regulator ...  48.9    2e-04   
gb|KEH39870.1|  response regulator                                    48.9    2e-04   
ref|XP_011033470.1|  PREDICTED: two-component response regulator ...  48.9    3e-04   
ref|XP_002308388.2|  hypothetical protein POPTR_0006s20220g           48.9    3e-04   
emb|CDI06884.1|  response regulator                                   48.9    3e-04   
ref|XP_010066564.1|  PREDICTED: two-component response regulator ...  48.9    3e-04   
ref|XP_009392157.1|  PREDICTED: two-component response regulator ...  48.9    3e-04   
emb|CDP16250.1|  unnamed protein product                              48.9    3e-04   
gb|KFK27554.1|  hypothetical protein AALP_AA8G398600                  48.9    3e-04   
gb|KDP38648.1|  hypothetical protein JCGZ_04001                       48.9    3e-04   
ref|XP_010255669.1|  PREDICTED: two-component response regulator ...  48.5    3e-04   
dbj|BAK07044.1|  predicted protein                                    48.5    3e-04   
ref|XP_007011983.1|  Type-b response regulator, putative              48.5    3e-04   
ref|XP_003570765.1|  PREDICTED: two-component response regulator ...  48.5    3e-04   
gb|EMS58073.1|  Two-component response regulator ARR12                48.5    3e-04   
gb|EMT07857.1|  Two-component response regulator ARR12                48.5    3e-04   
ref|XP_003603312.1|  Two-component response regulator ARR1            48.5    3e-04   
ref|XP_006841189.1|  hypothetical protein AMTR_s00086p00182350        48.5    3e-04   
gb|KHG21281.1|  Two-component response regulator ARR12 -like protein  48.5    4e-04   
ref|XP_004501369.1|  PREDICTED: two-component response regulator ...  48.5    4e-04   
ref|XP_010916232.1|  PREDICTED: two-component response regulator ...  48.5    4e-04   
ref|XP_007136967.1|  hypothetical protein PHAVU_009G0889000g          48.1    4e-04   
gb|EEC74174.1|  hypothetical protein OsI_09283                        48.5    4e-04   
ref|NP_001048389.1|  Os02g0796500                                     48.5    4e-04   
dbj|BAD43141.1|  hypothetical protein                                 48.5    4e-04   
ref|XP_004157093.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...  48.5    4e-04   
ref|XP_004145510.1|  PREDICTED: two-component response regulator ...  48.5    4e-04   
ref|XP_008452870.1|  PREDICTED: two-component response regulator ...  48.5    4e-04   
emb|CDP16251.1|  unnamed protein product                              47.8    4e-04   
ref|XP_010916233.1|  PREDICTED: two-component response regulator ...  48.1    4e-04   
gb|KDO59440.1|  hypothetical protein CISIN_1g0057191mg                48.1    4e-04   
ref|XP_006473989.1|  PREDICTED: two-component response regulator ...  48.1    4e-04   
ref|XP_006453634.1|  hypothetical protein CICLE_v10007648mg           48.1    4e-04   
ref|XP_010916229.1|  PREDICTED: two-component response regulator ...  48.1    4e-04   
gb|EYU31786.1|  hypothetical protein MIMGU_mgv1a011483mg              47.4    5e-04   
ref|XP_006436079.1|  hypothetical protein CICLE_v10033605mg           47.8    5e-04   
ref|XP_008659836.1|  PREDICTED: two-component response regulator ...  48.1    5e-04   
ref|XP_008659835.1|  PREDICTED: two-component response regulator ...  48.1    5e-04   
gb|KDO67752.1|  hypothetical protein CISIN_1g009670mg                 47.8    5e-04   
ref|XP_008659834.1|  PREDICTED: two-component response regulator ...  48.1    5e-04   
ref|XP_008659833.1|  PREDICTED: two-component response regulator ...  48.1    5e-04   
gb|KDO67753.1|  hypothetical protein CISIN_1g009670mg                 47.8    5e-04   
ref|XP_007154913.1|  hypothetical protein PHAVU_003G158200g           47.8    5e-04   
ref|XP_009757804.1|  PREDICTED: two-component response regulator ...  47.8    6e-04   
ref|XP_006486037.1|  PREDICTED: two-component response regulator ...  47.8    6e-04   
ref|XP_006486036.1|  PREDICTED: two-component response regulator ...  47.8    6e-04   
ref|XP_009363896.1|  PREDICTED: two-component response regulator ...  47.8    6e-04   
ref|XP_008378770.1|  PREDICTED: two-component response regulator ...  47.8    6e-04   
ref|XP_009350850.1|  PREDICTED: two-component response regulator ...  47.8    6e-04   
ref|XP_008377662.1|  PREDICTED: two-component response regulator ...  47.8    6e-04   
ref|XP_009363889.1|  PREDICTED: two-component response regulator ...  47.8    6e-04   
ref|XP_008378763.1|  PREDICTED: two-component response regulator ...  47.8    6e-04   
ref|XP_004967181.1|  PREDICTED: two-component response regulator ...  47.8    6e-04   
ref|XP_004498786.1|  PREDICTED: two-component response regulator ...  47.4    6e-04   
ref|XP_010233232.1|  PREDICTED: two-component response regulator ...  45.4    7e-04   
gb|KHG29528.1|  Two-component response regulator ARR12 -like protein  47.8    7e-04   
ref|XP_004498241.1|  PREDICTED: two-component response regulator ...  47.8    7e-04   
ref|XP_004498785.1|  PREDICTED: two-component response regulator ...  47.4    7e-04   
ref|XP_008775607.1|  PREDICTED: LOW QUALITY PROTEIN: two-componen...  47.4    8e-04   
gb|KEH24689.1|  response regulator                                    47.4    8e-04   
ref|XP_009387543.1|  PREDICTED: two-component response regulator ...  47.4    8e-04   
ref|XP_001783363.1|  predicted protein                                46.6    8e-04   
ref|XP_004251765.1|  PREDICTED: two-component response regulator ...  47.4    8e-04   
ref|XP_009420377.1|  PREDICTED: two-component response regulator ...  47.4    8e-04   
ref|XP_009420376.1|  PREDICTED: two-component response regulator ...  47.4    8e-04   
ref|XP_010429508.1|  PREDICTED: two-component response regulator ...  47.4    9e-04   
gb|EMT18523.1|  Two-component response regulator ARR12                47.0    0.001   



>ref|XP_010663040.1| PREDICTED: two-component response regulator ARR11 isoform X3 
[Vitis vinifera]
Length=474

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PR+ E FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MESGFCSPRT-EAFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>ref|XP_006341767.1| PREDICTED: two-component response regulator ARR11-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341768.1| PREDICTED: two-component response regulator ARR11-like isoform 
X2 [Solanum tuberosum]
Length=581

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  189  LMESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +ME+      F    ++TFPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MMENSKTSAGFSSPRTDTFPAGLRVLVVDDDPTWLKILEKMLKKCSY  47



>ref|XP_010682390.1| PREDICTED: two-component response regulator ARR11 [Beta vulgaris 
subsp. vulgaris]
Length=628

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = +3

Query  201  VMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +M  G   PRS E FPAGLRVLVVDDDPTWLKILEKMLKKC+Y
Sbjct  2    IMENGFSSPRS-EPFPAGLRVLVVDDDPTWLKILEKMLKKCNY  43



>ref|XP_002515016.1| two-component sensor histidine kinase bacteria, putative [Ricinus 
communis]
 gb|EEF47570.1| two-component sensor histidine kinase bacteria, putative [Ricinus 
communis]
Length=584

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PRS + FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MENGFSSPRS-DAFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>ref|XP_010663038.1| PREDICTED: two-component response regulator ARR11 isoform X2 
[Vitis vinifera]
Length=569

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PR+ E FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MESGFCSPRT-EAFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>ref|XP_002274673.1| PREDICTED: two-component response regulator ARR11 isoform X1 
[Vitis vinifera]
Length=570

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PR+ E FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MESGFCSPRT-EAFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>emb|CBI14873.3| unnamed protein product [Vitis vinifera]
Length=592

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/42 (81%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PR+ E FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MESGFCSPRT-EAFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>ref|XP_009606770.1| PREDICTED: uncharacterized protein LOC104101066 [Nicotiana tomentosiformis]
Length=548

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  189  LMESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +ME+  +   F    S+ FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MMENSKSSAGFSSPRSDNFPAGLRVLVVDDDPTWLKILEKMLKKCSY  47



>ref|XP_004239497.1| PREDICTED: putative two-component response regulator-like APRR6 
[Solanum lycopersicum]
Length=582

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = +3

Query  189  LME-SVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +ME S  + G   PR+ +TFPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MMENSKTSVGFSSPRT-DTFPAGLRVLVVDDDPTWLKILEKMLKKCSY  47



>ref|XP_009414676.1| PREDICTED: uncharacterized protein LOC103995725 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=520

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  228  RSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            R++E FPAGLRVL+VDDDPTWLKILEKML+KCSY
Sbjct  9    RAAEAFPAGLRVLIVDDDPTWLKILEKMLRKCSY  42



>ref|XP_010251342.1| PREDICTED: two-component response regulator ARR11-like [Nelumbo 
nucifera]
Length=597

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PR+ + FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MESGFASPRA-DAFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>ref|XP_011042332.1| PREDICTED: two-component response regulator ARR11 [Populus euphratica]
Length=581

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +3

Query  201  VMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +M  G   PR+ ++FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MMENGFSSPRN-DSFPAGLRVLVVDDDPTWLKILEKMLKKCSY  42



>ref|XP_010248810.1| PREDICTED: uncharacterized protein LOC104591604 isoform X2 [Nelumbo 
nucifera]
Length=542

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PR  + FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MENGFASPRG-DAFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>ref|XP_009414674.1| PREDICTED: uncharacterized protein LOC103995725 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=571

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  228  RSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            R++E FPAGLRVL+VDDDPTWLKILEKML+KCSY
Sbjct  9    RAAEAFPAGLRVLIVDDDPTWLKILEKMLRKCSY  42



>ref|XP_009793670.1| PREDICTED: two-component response regulator ARR11 [Nicotiana 
sylvestris]
Length=545

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  189  LMESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +ME+      F    S+ FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MMENSKTTAGFSSPRSDNFPAGLRVLVVDDDPTWLKILEKMLKKCSY  47



>ref|XP_009414675.1| PREDICTED: two-component response regulator ARR11-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=540

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  228  RSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            R++E FPAGLRVL+VDDDPTWLKILEKML+KCSY
Sbjct  9    RAAEAFPAGLRVLIVDDDPTWLKILEKMLRKCSY  42



>ref|XP_010025368.1| PREDICTED: two-component response regulator ARR11-like [Eucalyptus 
grandis]
 gb|KCW62013.1| hypothetical protein EUGRSUZ_H04693 [Eucalyptus grandis]
Length=572

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 3/47 (6%)
 Frame = +3

Query  189  LMESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +MES  + G   PRS+  FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MMES--SKGFSSPRSN-GFPAGLRVLVVDDDPTWLKILEKMLKKCSY  44



>gb|EYU22557.1| hypothetical protein MIMGU_mgv1a006021mg [Erythranthe guttata]
Length=459

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 4/47 (9%)
 Frame = +3

Query  189  LMESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +MES    G   PR+ E FPAGLRVLVVDDDPTWLKILEKMLKKC+Y
Sbjct  1    MMES---SGFSSPRT-ECFPAGLRVLVVDDDPTWLKILEKMLKKCNY  43



>gb|EYU22556.1| hypothetical protein MIMGU_mgv1a006021mg [Erythranthe guttata]
Length=461

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 4/47 (9%)
 Frame = +3

Query  189  LMESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +MES    G   PR+ E FPAGLRVLVVDDDPTWLKILEKMLKKC+Y
Sbjct  1    MMES---SGFSSPRT-ECFPAGLRVLVVDDDPTWLKILEKMLKKCNY  43



>ref|XP_002315642.2| hypothetical protein POPTR_0010s06290g, partial [Populus trichocarpa]
 gb|EEF01813.2| hypothetical protein POPTR_0010s06290g, partial [Populus trichocarpa]
Length=373

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PR+ ++FPAGLRVLVVDDDPTWLKILEKMLK+CSY
Sbjct  1    MENGFSSPRN-DSFPAGLRVLVVDDDPTWLKILEKMLKRCSY  41



>ref|XP_008351064.1| PREDICTED: two-component response regulator ARR11-like [Malus 
domestica]
Length=138

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M      PR+ +TFPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MESSFSSPRN-DTFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>ref|XP_010248808.1| PREDICTED: uncharacterized protein LOC104591604 isoform X1 [Nelumbo 
nucifera]
Length=593

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PR  + FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MENGFASPRG-DAFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>emb|CBM42563.1| putative B-type response regulator 21 [Populus x canadensis]
Length=563

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PR+ ++FPAGLRVLVVDDDPTWLKILEKMLK+CSY
Sbjct  1    MENGFSSPRN-DSFPAGLRVLVVDDDPTWLKILEKMLKRCSY  41



>ref|XP_010100306.1| Two-component response regulator [Morus notabilis]
 gb|EXB82440.1| Two-component response regulator [Morus notabilis]
Length=576

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PRS + FPAGLRVLVVDDDPTWL+ILEKMLKKCSY
Sbjct  1    MENGFSSPRS-DAFPAGLRVLVVDDDPTWLRILEKMLKKCSY  41



>ref|XP_008390110.1| PREDICTED: two-component response regulator ARR11 [Malus domestica]
Length=289

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M      PR+ +TFPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MESSFSSPRN-DTFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>ref|XP_008221977.1| PREDICTED: two-component response regulator ARR11 [Prunus mume]
Length=616

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 1/35 (3%)
 Frame = +3

Query  225  PRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            PR+ ++FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  8    PRN-DSFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>ref|XP_007226956.1| hypothetical protein PRUPE_ppa002679mg [Prunus persica]
 gb|EMJ28155.1| hypothetical protein PRUPE_ppa002679mg [Prunus persica]
Length=645

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 1/35 (3%)
 Frame = +3

Query  225  PRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            PR+ ++FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  8    PRN-DSFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>ref|XP_009359281.1| PREDICTED: two-component response regulator ARR11 isoform X1 
[Pyrus x bretschneideri]
Length=637

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 1/35 (3%)
 Frame = +3

Query  225  PRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            PR+ ++FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  8    PRN-DSFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>gb|KHF99908.1| Two-component response regulator ARR11 -like protein [Gossypium 
arboreum]
Length=573

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +3

Query  201  VMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            V+A   F    ++ FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  2    VLAESGFSSPRNDAFPAGLRVLVVDDDPTWLKILEKMLKKCSY  44



>ref|XP_002312648.1| hypothetical protein POPTR_0008s18130g [Populus trichocarpa]
 gb|EEE90015.1| hypothetical protein POPTR_0008s18130g [Populus trichocarpa]
Length=642

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 1/39 (3%)
 Frame = +3

Query  213  GIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            G   PR+ ++FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  5    GFSSPRN-DSFPAGLRVLVVDDDPTWLKILEKMLKKCSY  42



>ref|XP_009392350.1| PREDICTED: uncharacterized protein LOC103978316 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=592

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  219  FLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
             L   +E FPAGLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  5    LLSARAEAFPAGLRVLVVDDDPTWLKILEKMLRKCSY  41



>ref|XP_007158728.1| hypothetical protein PHAVU_002G177100g [Phaseolus vulgaris]
 gb|ESW30722.1| hypothetical protein PHAVU_002G177100g [Phaseolus vulgaris]
Length=579

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  189  LMESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            L+ + M  G F     E FPAGLRVLVVDDDPTWL+ILEKMLKKC Y
Sbjct  3    LLSNNMDNGCFSSPRHEAFPAGLRVLVVDDDPTWLRILEKMLKKCLY  49



>ref|XP_008444405.1| PREDICTED: two-component response regulator ARR11 [Cucumis melo]
Length=584

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PRS + FP GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MENGFSSPRS-DAFPIGLRVLVVDDDPTWLKILEKMLKKCSY  41



>ref|XP_009392349.1| PREDICTED: uncharacterized protein LOC103978316 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=593

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  219  FLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
             L   +E FPAGLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  5    LLSARAEAFPAGLRVLVVDDDPTWLKILEKMLRKCSY  41



>ref|XP_011029606.1| PREDICTED: two-component response regulator ARR11-like isoform 
X2 [Populus euphratica]
Length=580

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 1/39 (3%)
 Frame = +3

Query  213  GIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            G   PR+ ++FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  6    GFSSPRN-DSFPAGLRVLVVDDDPTWLKILEKMLKKCSY  43



>ref|XP_011029607.1| PREDICTED: two-component response regulator ARR11-like isoform 
X3 [Populus euphratica]
Length=574

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 1/39 (3%)
 Frame = +3

Query  213  GIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            G   PR+ ++FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  6    GFSSPRN-DSFPAGLRVLVVDDDPTWLKILEKMLKKCSY  43



>ref|XP_011029605.1| PREDICTED: two-component response regulator ARR11-like isoform 
X1 [Populus euphratica]
Length=592

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 1/39 (3%)
 Frame = +3

Query  213  GIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            G   PR+ ++FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  6    GFSSPRN-DSFPAGLRVLVVDDDPTWLKILEKMLKKCSY  43



>ref|XP_004142954.1| PREDICTED: two-component response regulator ARR11-like [Cucumis 
sativus]
 ref|XP_004159561.1| PREDICTED: two-component response regulator ARR11-like [Cucumis 
sativus]
 gb|KGN62346.1| hypothetical protein Csa_2G350290 [Cucumis sativus]
Length=583

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/42 (79%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PRS + FP GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MENGFSSPRS-DVFPIGLRVLVVDDDPTWLKILEKMLKKCSY  41



>ref|XP_002267616.1| PREDICTED: two-component response regulator ARR11 [Vitis vinifera]
 emb|CBI27525.3| unnamed protein product [Vitis vinifera]
Length=594

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +3

Query  219  FLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            F P  ++ FPAGLRVLVVDDDPTWLKILEKMLKKC Y
Sbjct  5    FCPPRTDVFPAGLRVLVVDDDPTWLKILEKMLKKCLY  41



>ref|XP_004310018.1| PREDICTED: two-component response regulator ARR11-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=602

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 1/35 (3%)
 Frame = +3

Query  225  PRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            PR+ ++FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  8    PRN-DSFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>ref|XP_007044949.1| Two-component sensor histidine kinase bacteria, putative isoform 
1 [Theobroma cacao]
 gb|EOY00781.1| Two-component sensor histidine kinase bacteria, putative isoform 
1 [Theobroma cacao]
Length=581

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  201  VMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            ++  G   PR  + FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MVESGFSSPRH-DAFPAGLRVLVVDDDPTWLKILEKMLKKCSY  42



>emb|CBM42565.1| putative B-type response regulator 14 [Populus x canadensis]
Length=594

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 1/39 (3%)
 Frame = +3

Query  213  GIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            G   PR+ ++FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  5    GFSSPRN-DSFPAGLRVLVVDDDPTWLKILEKMLKKCSY  42



>ref|XP_007044950.1| Two-component sensor histidine kinase bacteria, putative isoform 
2 [Theobroma cacao]
 gb|EOY00782.1| Two-component sensor histidine kinase bacteria, putative isoform 
2 [Theobroma cacao]
Length=440

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  201  VMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            ++  G   PR  + FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MVESGFSSPRH-DAFPAGLRVLVVDDDPTWLKILEKMLKKCSY  42



>gb|AFK40300.1| unknown [Medicago truncatula]
Length=570

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G F P     FPAGLRVLVVDDDPTWLKILEKMLKKC+Y
Sbjct  1    MDNGCF-PSPRRDFPAGLRVLVVDDDPTWLKILEKMLKKCNY  41



>ref|XP_004310019.1| PREDICTED: two-component response regulator ARR11-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=577

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 1/35 (3%)
 Frame = +3

Query  225  PRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            PR+ ++FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  8    PRN-DSFPAGLRVLVVDDDPTWLKILEKMLKKCSY  41



>ref|XP_007044951.1| Two-component sensor histidine kinase bacteria, putative isoform 
3 [Theobroma cacao]
 gb|EOY00783.1| Two-component sensor histidine kinase bacteria, putative isoform 
3 [Theobroma cacao]
Length=517

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  201  VMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            ++  G   PR  + FPAGLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  1    MVESGFSSPRH-DAFPAGLRVLVVDDDPTWLKILEKMLKKCSY  42



>ref|XP_011071178.1| PREDICTED: two-component response regulator ARR11-like [Sesamum 
indicum]
Length=587

 Score = 68.6 bits (166),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 1/41 (2%)
 Frame = +3

Query  207  AGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + G   PR+ + FPAGLRVLVVDDDPTWLKILEKMLKKC+Y
Sbjct  3    SSGFSSPRT-DCFPAGLRVLVVDDDPTWLKILEKMLKKCNY  42



>ref|XP_010932292.1| PREDICTED: two-component response regulator ARR1 [Elaeis guineensis]
Length=603

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +E FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  10   TEAFPVGLRVLVVDDDPTWLKILEKMLRKCSY  41



>ref|XP_008797265.1| PREDICTED: two-component response regulator ARR11-like [Phoenix 
dactylifera]
Length=594

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +E FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  10   TEAFPVGLRVLVVDDDPTWLKILEKMLRKCSY  41



>gb|EPS59389.1| hypothetical protein M569_15420 [Genlisea aurea]
Length=282

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+++FPAGLRVLVVDDDPTWLKILEKMLKKC Y
Sbjct  7    SADSFPAGLRVLVVDDDPTWLKILEKMLKKCDY  39



>ref|XP_006580107.1| PREDICTED: two-component response regulator ARR11-like isoform 
X3 [Glycine max]
Length=583

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G F     + FPAGLRVLVVDDDPTWL+ILEKMLKKC Y
Sbjct  1    MDNGCFSSPRHDAFPAGLRVLVVDDDPTWLRILEKMLKKCLY  42



>ref|XP_010907773.1| PREDICTED: two-component response regulator ARR11-like [Elaeis 
guineensis]
Length=592

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +E FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  10   TEAFPVGLRVLVVDDDPTWLKILEKMLRKCSY  41



>ref|XP_003524159.1| PREDICTED: two-component response regulator ARR11-like isoform 
X1 [Glycine max]
 ref|XP_006580106.1| PREDICTED: two-component response regulator ARR11-like isoform 
X2 [Glycine max]
 gb|KHN46040.1| Two-component response regulator ARR11 [Glycine soja]
Length=584

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G F     + FPAGLRVLVVDDDPTWL+ILEKMLKKC Y
Sbjct  1    MDNGCFSSPRHDAFPAGLRVLVVDDDPTWLRILEKMLKKCLY  42



>ref|XP_008353034.1| PREDICTED: two-component response regulator ARR11-like isoform 
X2 [Malus domestica]
Length=636

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 1/35 (3%)
 Frame = +3

Query  225  PRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            PR+ ++FPAGLRVLVVDDDPTWL ILEKMLKKCSY
Sbjct  8    PRN-DSFPAGLRVLVVDDDPTWLXILEKMLKKCSY  41



>ref|XP_008353033.1| PREDICTED: two-component response regulator ARR11-like isoform 
X1 [Malus domestica]
Length=637

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 1/35 (3%)
 Frame = +3

Query  225  PRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            PR+ ++FPAGLRVLVVDDDPTWL ILEKMLKKCSY
Sbjct  8    PRN-DSFPAGLRVLVVDDDPTWLXILEKMLKKCSY  41



>ref|XP_008799983.1| PREDICTED: two-component response regulator ARR11-like [Phoenix 
dactylifera]
Length=596

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/32 (88%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +E FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  12   TEAFPVGLRVLVVDDDPTWLKILEKMLRKCSY  43



>ref|XP_007163714.1| hypothetical protein PHAVU_001G258000g [Phaseolus vulgaris]
 gb|ESW35708.1| hypothetical protein PHAVU_001G258000g [Phaseolus vulgaris]
Length=555

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 3/43 (7%)
 Frame = +3

Query  204  MAGGIFL-PRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G F  PR    FPAGLRVLVVDDDPTWLKILEKMLKKC+Y
Sbjct  1    MDNGCFSSPRRD--FPAGLRVLVVDDDPTWLKILEKMLKKCNY  41



>gb|KHN44399.1| Two-component response regulator ARR11 [Glycine soja]
Length=585

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 3/43 (7%)
 Frame = +3

Query  204  MAGGIFL-PRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G F  PR    FPAGLRVLVVDDDPTWLKILEKMLKKC+Y
Sbjct  1    MDNGCFSSPRRD--FPAGLRVLVVDDDPTWLKILEKMLKKCNY  41



>ref|XP_003537547.1| PREDICTED: two-component response regulator ARR11-like isoform 
X1 [Glycine max]
Length=585

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 3/43 (7%)
 Frame = +3

Query  204  MAGGIFL-PRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G F  PR    FPAGLRVLVVDDDPTWLKILEKMLKKC+Y
Sbjct  1    MDNGCFSSPRRD--FPAGLRVLVVDDDPTWLKILEKMLKKCNY  41



>gb|KHN24104.1| Two-component response regulator ARR11 [Glycine soja]
Length=579

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/29 (97%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLRVLVVDDDPTWLKILEKMLKKC+Y
Sbjct  13   FPAGLRVLVVDDDPTWLKILEKMLKKCNY  41



>gb|KDP26732.1| hypothetical protein JCGZ_17890 [Jatropha curcas]
Length=582

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PR+ + FPAGLRVLVVDDDPTWLKIL KML KCSY
Sbjct  1    MENGSSSPRN-DAFPAGLRVLVVDDDPTWLKILSKMLNKCSY  41



>ref|XP_006591475.1| PREDICTED: two-component response regulator ARR11-like isoform 
X2 [Glycine max]
Length=604

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 3/43 (7%)
 Frame = +3

Query  204  MAGGIFL-PRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G F  PR    FPAGLRVLVVDDDPTWLKILEKMLKKC+Y
Sbjct  1    MDNGCFSSPRRD--FPAGLRVLVVDDDPTWLKILEKMLKKCNY  41



>ref|XP_003601849.1| Response regulator [Medicago truncatula]
 gb|AES72100.1| two-component response regulator ARR2-like protein [Medicago 
truncatula]
Length=570

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/29 (97%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLRVLVVDDDPTWLKILEKMLKKC+Y
Sbjct  13   FPAGLRVLVVDDDPTWLKILEKMLKKCNY  41



>ref|XP_010025369.1| PREDICTED: two-component response regulator ARR11-like [Eucalyptus 
grandis]
 gb|KCW62014.1| hypothetical protein EUGRSUZ_H04694 [Eucalyptus grandis]
Length=454

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 3/47 (6%)
 Frame = +3

Query  189  LMESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +MES  + G   PRS+  FP GLRVL VDDD TWLKILEKMLKKCSY
Sbjct  1    MMES--SKGFSSPRSN-GFPTGLRVLAVDDDSTWLKILEKMLKKCSY  44



>gb|KCW62015.1| hypothetical protein EUGRSUZ_H04694 [Eucalyptus grandis]
Length=496

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 3/47 (6%)
 Frame = +3

Query  189  LMESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +MES  + G   PRS+  FP GLRVL VDDD TWLKILEKMLKKCSY
Sbjct  1    MMES--SKGFSSPRSN-GFPTGLRVLAVDDDSTWLKILEKMLKKCSY  44



>ref|XP_004502338.1| PREDICTED: two-component response regulator ARR11-like [Cicer 
arietinum]
Length=590

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 33/43 (77%), Gaps = 3/43 (7%)
 Frame = +3

Query  204  MAGGIFL-PRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G F  PR    FP GLRVLVVDDDPTWLKILEKMLKKC+Y
Sbjct  1    MDNGCFTSPRRD--FPNGLRVLVVDDDPTWLKILEKMLKKCNY  41



>gb|KDO82063.1| hypothetical protein CISIN_1g007940mg [Citrus sinensis]
Length=584

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PR+    PAGLRVLVVDDD  WLKILEKMLKKCSY
Sbjct  1    MENGFSSPRNDTFNPAGLRVLVVDDDLAWLKILEKMLKKCSY  42



>ref|XP_006438147.1| hypothetical protein CICLE_v10031052mg [Citrus clementina]
 gb|ESR51387.1| hypothetical protein CICLE_v10031052mg [Citrus clementina]
Length=584

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PR+    PAGLRVLVVDDD  WLKILEKMLKKCSY
Sbjct  1    MENGFSSPRNDTFNPAGLRVLVVDDDLAWLKILEKMLKKCSY  42



>ref|XP_006484016.1| PREDICTED: two-component response regulator ARR11-like isoform 
X1 [Citrus sinensis]
 ref|XP_006484017.1| PREDICTED: two-component response regulator ARR11-like isoform 
X2 [Citrus sinensis]
Length=584

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  204  MAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  G   PR+    PAGLRVLVVDDD  WLKILEKMLKKCSY
Sbjct  1    MENGFSSPRNDTFNPAGLRVLVVDDDLAWLKILEKMLKKCSY  42



>ref|XP_002458941.1| hypothetical protein SORBIDRAFT_03g043080 [Sorghum bicolor]
 gb|EES04061.1| hypothetical protein SORBIDRAFT_03g043080 [Sorghum bicolor]
Length=579

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +  FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  6    ATAFPYGLRVLVVDDDPTWLKILEKMLRKCSY  37



>gb|AFW84265.1| putative two-component response regulator family protein [Zea 
mays]
Length=598

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +  FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  6    ATAFPYGLRVLVVDDDPTWLKILEKMLRKCSY  37



>emb|CDM84858.1| unnamed protein product [Triticum aestivum]
 emb|CDM85271.1| unnamed protein product [Triticum aestivum]
Length=584

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +  FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  4    ASAFPYGLRVLVVDDDPTWLKILEKMLRKCSY  35



>ref|NP_001152300.1| two-component response regulator ARR11 [Zea mays]
 gb|ACG46892.1| two-component response regulator ARR11 [Zea mays]
Length=584

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +  FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  6    ATAFPYGLRVLVVDDDPTWLKILEKMLRKCSY  37



>tpg|DAA56280.1| TPA: putative two-component response regulator family protein 
[Zea mays]
Length=584

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +  FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  6    ATAFPYGLRVLVVDDDPTWLKILEKMLRKCSY  37



>ref|XP_008656969.1| PREDICTED: uncharacterized protein LOC103636390 [Zea mays]
Length=585

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +  FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  6    ATAFPYGLRVLVVDDDPTWLKILEKMLRKCSY  37



>gb|EMT02832.1| Two-component response regulator ARR11 [Aegilops tauschii]
Length=595

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +  FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  4    ASAFPYGLRVLVVDDDPTWLKILEKMLRKCSY  35



>ref|XP_010232707.1| PREDICTED: two-component response regulator ARR11-like isoform 
X2 [Brachypodium distachyon]
Length=576

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +  FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  5    ATVFPYGLRVLVVDDDPTWLKILEKMLRKCSY  36



>ref|XP_003564868.1| PREDICTED: two-component response regulator ARR11-like isoform 
X1 [Brachypodium distachyon]
Length=577

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +  FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  5    ATVFPYGLRVLVVDDDPTWLKILEKMLRKCSY  36



>ref|XP_004970962.1| PREDICTED: two-component response regulator ARR11-like [Setaria 
italica]
Length=578

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +  FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  6    ATAFPYGLRVLVVDDDPTWLKILEKMLRKCSY  37



>gb|EEC71985.1| hypothetical protein OsI_04831 [Oryza sativa Indica Group]
Length=582

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +  FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  3    ATAFPYGLRVLVVDDDPTWLKILEKMLRKCSY  34



>tpd|FAA00259.1| TPA: response regulator [Oryza sativa Japonica Group]
 gb|EEE55842.1| hypothetical protein OsJ_04457 [Oryza sativa Japonica Group]
Length=582

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +  FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  3    ATAFPYGLRVLVVDDDPTWLKILEKMLRKCSY  34



>dbj|BAD82798.1| putative response regulator 11 [Oryza sativa Japonica Group]
Length=586

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +  FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  3    ATAFPYGLRVLVVDDDPTWLKILEKMLRKCSY  34



>ref|XP_006645188.1| PREDICTED: two-component response regulator ARR11-like [Oryza 
brachyantha]
Length=577

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/32 (84%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +  FP GLRVLVVDDDPTWLKILEKML+KCSY
Sbjct  3    ATAFPYGLRVLVVDDDPTWLKILEKMLRKCSY  34



>ref|XP_002515018.1| two-component sensor histidine kinase bacteria, putative [Ricinus 
communis]
 gb|EEF47572.1| two-component sensor histidine kinase bacteria, putative [Ricinus 
communis]
Length=419

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +3

Query  201  VMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +M  G   P +++ FPAGLRVLVVD+DPTW +ILEKMLKKCSY
Sbjct  1    MMIHGFSSPLNND-FPAGLRVLVVDNDPTWSRILEKMLKKCSY  42



>ref|XP_002515017.1| Two-component response regulator ARR14, putative [Ricinus communis]
 gb|EEF47571.1| Two-component response regulator ARR14, putative [Ricinus communis]
Length=338

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCS  326
            ++ FPAGLRV+VVDDDPTWL ILE+MLK+CS
Sbjct  10   TDAFPAGLRVVVVDDDPTWLSILERMLKRCS  40



>ref|XP_011087104.1| PREDICTED: two-component response regulator ARR11 [Sesamum indicum]
Length=543

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +3

Query  207  AGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + G   PRS  +FPAGLRVLVV+DDPT LKI+EKMLKKC+Y
Sbjct  3    SSGFSSPRSG-SFPAGLRVLVVEDDPTCLKIVEKMLKKCNY  42



>ref|XP_004150083.1| PREDICTED: two-component response regulator ARR2-like [Cucumis 
sativus]
 ref|XP_004161384.1| PREDICTED: two-component response regulator ARR2-like [Cucumis 
sativus]
 gb|KGN47404.1| hypothetical protein Csa_6G312560 [Cucumis sativus]
Length=673

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            SS+ FPAGLRVLVVDDDPT LKILEKML+ C Y
Sbjct  29   SSDQFPAGLRVLVVDDDPTCLKILEKMLQNCCY  61



>ref|XP_006488885.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006488886.1| PREDICTED: two-component response regulator ARR2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006488887.1| PREDICTED: two-component response regulator ARR2-like isoform 
X3 [Citrus sinensis]
 gb|KDO38127.1| hypothetical protein CISIN_1g029986mg [Citrus sinensis]
Length=184

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDP WL+ILEKML+KC Y
Sbjct  12   DQFPAGLRVLVVDDDPIWLRILEKMLRKCLY  42



>gb|KHN12421.1| Two-component response regulator ARR11 [Glycine soja]
Length=583

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +3

Query  225  PRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            PR  + FPAGLRVLVVDDD TWL+ILEKMLKKC Y
Sbjct  10   PRH-DAFPAGLRVLVVDDDLTWLRILEKMLKKCLY  43



>ref|XP_006419447.1| hypothetical protein CICLE_v10005747mg [Citrus clementina]
 gb|ESR32687.1| hypothetical protein CICLE_v10005747mg [Citrus clementina]
Length=232

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDP WL+ILEKML+KC Y
Sbjct  12   DQFPAGLRVLVVDDDPIWLRILEKMLRKCLY  42



>dbj|BAA94549.1| response regulator 11 [Arabidopsis thaliana]
Length=457

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  8    PVGLRVLVVDDDPTWLKILEKMLKKCSY  35



>emb|CAA06431.1| receiver-like protein 3 [Arabidopsis thaliana]
Length=444

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  8    PVGLRVLVVDDDPTWLKILEKMLKKCSY  35



>ref|XP_010550447.1| PREDICTED: two-component response regulator ARR11-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010534175.1| PREDICTED: two-component response regulator ARR11-like isoform 
X1 [Tarenaya hassleriana]
Length=561

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  9    PVGLRVLVVDDDPTWLKILEKMLKKCSY  36



>ref|XP_009105312.1| PREDICTED: two-component response regulator ARR11 [Brassica rapa]
Length=512

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  7    PVGLRVLVVDDDPTWLKILEKMLKKCSY  34



>gb|KFK41176.1| hypothetical protein AALP_AA2G095600 [Arabis alpina]
Length=529

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  7    PVGLRVLVVDDDPTWLKILEKMLKKCSY  34



>ref|XP_010511720.1| PREDICTED: two-component response regulator ARR11 [Camelina sativa]
Length=528

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  8    PVGLRVLVVDDDPTWLKILEKMLKKCSY  35



>ref|XP_006302128.1| hypothetical protein CARUB_v10020133mg [Capsella rubella]
 gb|EOA35026.1| hypothetical protein CARUB_v10020133mg [Capsella rubella]
Length=528

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  8    PVGLRVLVVDDDPTWLKILEKMLKKCSY  35



>ref|XP_002888617.1| hypothetical protein ARALYDRAFT_894522 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64876.1| hypothetical protein ARALYDRAFT_894522 [Arabidopsis lyrata subsp. 
lyrata]
Length=529

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  8    PVGLRVLVVDDDPTWLKILEKMLKKCSY  35



>ref|XP_006391233.1| hypothetical protein EUTSA_v10018396mg [Eutrema salsugineum]
 gb|ESQ28519.1| hypothetical protein EUTSA_v10018396mg [Eutrema salsugineum]
Length=526

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  7    PVGLRVLVVDDDPTWLKILEKMLKKCSY  34



>ref|XP_010470687.1| PREDICTED: two-component response regulator ARR11 [Camelina sativa]
Length=526

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  8    PVGLRVLVVDDDPTWLKILEKMLKKCSY  35



>emb|CDY28869.1| BnaC06g26570D [Brassica napus]
Length=507

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  7    PVGLRVLVVDDDPTWLKILEKMLKKCSY  34



>ref|NP_176938.1| two-component response regulator ARR11 [Arabidopsis thaliana]
 sp|Q9FXD6.1|ARR11_ARATH RecName: Full=Two-component response regulator ARR11; AltName: 
Full=Receiver-like protein 3 [Arabidopsis thaliana]
 gb|AAG28891.1|AC008113_7 F12A21.15 [Arabidopsis thaliana]
 gb|AAP68207.1| At1g67710 [Arabidopsis thaliana]
 dbj|BAF00169.1| response regulator 11 [Arabidopsis thaliana]
 gb|AEE34686.1| two-component response regulator ARR11 [Arabidopsis thaliana]
Length=521

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  8    PVGLRVLVVDDDPTWLKILEKMLKKCSY  35



>ref|XP_006419446.1| hypothetical protein CICLE_v10005747mg [Citrus clementina]
 ref|XP_006419448.1| hypothetical protein CICLE_v10005747mg [Citrus clementina]
 gb|ESR32686.1| hypothetical protein CICLE_v10005747mg [Citrus clementina]
 gb|ESR32688.1| hypothetical protein CICLE_v10005747mg [Citrus clementina]
Length=241

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDP WL+ILEKML+KC Y
Sbjct  12   DQFPAGLRVLVVDDDPIWLRILEKMLRKCLY  42



>emb|CDY01838.1| BnaC06g28780D [Brassica napus]
Length=500

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  7    PVGLRVLVVDDDPTWLKILEKMLKKCSY  34



>emb|CDX96070.1| BnaA07g26610D [Brassica napus]
Length=513

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  7    PVGLRVLVVDDDPTWLKILEKMLKKCSY  34



>ref|XP_009105108.1| PREDICTED: two-component response regulator ARR11-like isoform 
X2 [Brassica rapa]
 emb|CDY07410.1| BnaA07g24890D [Brassica napus]
Length=509

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  7    PVGLRVLVVDDDPTWLKILEKMLKKCSY  34



>ref|XP_010415351.1| PREDICTED: two-component response regulator ARR11-like [Camelina 
sativa]
Length=528

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  8    PVGLRVLVVDDDPTWLKILEKMLKKCSY  35



>ref|XP_009105107.1| PREDICTED: two-component response regulator ARR11-like isoform 
X1 [Brassica rapa]
Length=537

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/28 (96%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  246  PAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P GLRVLVVDDDPTWLKILEKMLKKCSY
Sbjct  7    PVGLRVLVVDDDPTWLKILEKMLKKCSY  34



>ref|XP_010051575.1| PREDICTED: two-component response regulator ARR2-like [Eucalyptus 
grandis]
 gb|KCW87792.1| hypothetical protein EUGRSUZ_A00189 [Eucalyptus grandis]
Length=668

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L+ILEKMLK C Y
Sbjct  17   SDQFPAGLRVLVVDDDPTCLRILEKMLKTCQY  48



>ref|XP_006852154.1| hypothetical protein AMTR_s00049p00081480 [Amborella trichopoda]
 gb|ERN13621.1| hypothetical protein AMTR_s00049p00081480 [Amborella trichopoda]
Length=598

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 32/46 (70%), Gaps = 8/46 (17%)
 Frame = +3

Query  192  MESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            MESV+         S  FP GLRVLVVDDD TWLKILEKMLKKC Y
Sbjct  1    MESVLP--------SSQFPNGLRVLVVDDDLTWLKILEKMLKKCLY  38



>ref|XP_006380213.1| hypothetical protein POPTR_0008s22990g [Populus trichocarpa]
 gb|ERP58010.1| hypothetical protein POPTR_0008s22990g [Populus trichocarpa]
Length=670

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = +3

Query  192  MESVMAGGIFLPR--SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG++     +S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTATSGGVWKASDGASDQFPAGLRVLVVDDDPTCLVILEKMLRTCRY  58



>emb|CBM42558.1| putative B-type response regulator 12 [Populus x canadensis]
Length=690

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = +3

Query  192  MESVMAGGIFLPR--SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG++     +S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTATSGGVWKASDGASDQFPAGLRVLVVDDDPTCLVILEKMLRTCRY  58



>gb|ABG35774.1| SRR384 [Striga asiatica]
Length=569

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L+ILEKMLK C Y
Sbjct  24   SDQFPAGLRVLVVDDDPTCLRILEKMLKNCLY  55



>gb|EYU43994.1| hypothetical protein MIMGU_mgv1a002699mg [Erythranthe guttata]
Length=646

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L+ILEKMLK C Y
Sbjct  24   SDMFPAGLRVLVVDDDPTCLRILEKMLKNCLY  55



>gb|AAQ10678.1| type-B response regulator [Catharanthus roseus]
Length=643

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L+ILEKMLK C Y
Sbjct  29   SDQFPAGLRVLVVDDDPTCLRILEKMLKNCLY  60



>ref|XP_002978969.1| type B response regulator [Selaginella moellendorffii]
 gb|EFJ19926.1| type B response regulator [Selaginella moellendorffii]
Length=580

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = +3

Query  192  MESVMAGGIFLPRSSE--TFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M  V   GI +P++ +   FPAGLRVL VDDDPT L+IL +ML+KCSY
Sbjct  1    MVGVDKTGIAMPQAKDLGKFPAGLRVLAVDDDPTCLRILAQMLRKCSY  48



>ref|XP_004239797.1| PREDICTED: two-component response regulator ARR1-like [Solanum 
lycopersicum]
Length=663

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  228  RSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + S+ FPAGLRVLVVDDDPT L+ILEKML+ C Y
Sbjct  28   KVSDQFPAGLRVLVVDDDPTCLRILEKMLRNCHY  61



>ref|XP_011046396.1| PREDICTED: two-component response regulator ARR2-like isoform 
X10 [Populus euphratica]
Length=668

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 5/46 (11%)
 Frame = +3

Query  192  MESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG+     S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTASSGGV-----SDQFPAGLRVLVVDDDPTCLVILEKMLRTCRY  51



>ref|XP_011046395.1| PREDICTED: two-component response regulator ARR2-like isoform 
X9 [Populus euphratica]
Length=669

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 5/46 (11%)
 Frame = +3

Query  192  MESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG+     S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTASSGGV-----SDQFPAGLRVLVVDDDPTCLVILEKMLRTCRY  51



>ref|XP_011046394.1| PREDICTED: two-component response regulator ARR2-like isoform 
X8 [Populus euphratica]
Length=670

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 5/46 (11%)
 Frame = +3

Query  192  MESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG+     S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTASSGGV-----SDQFPAGLRVLVVDDDPTCLVILEKMLRTCRY  51



>ref|XP_011046392.1| PREDICTED: two-component response regulator ARR2-like isoform 
X7 [Populus euphratica]
Length=671

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 5/46 (11%)
 Frame = +3

Query  192  MESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG+     S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTASSGGV-----SDQFPAGLRVLVVDDDPTCLVILEKMLRTCRY  51



>ref|XP_011046391.1| PREDICTED: two-component response regulator ARR2-like isoform 
X6 [Populus euphratica]
Length=672

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 5/46 (11%)
 Frame = +3

Query  192  MESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG+     S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTASSGGV-----SDQFPAGLRVLVVDDDPTCLVILEKMLRTCRY  51



>ref|XP_011046390.1| PREDICTED: two-component response regulator ARR2-like isoform 
X5 [Populus euphratica]
Length=676

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 5/46 (11%)
 Frame = +3

Query  192  MESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG+     S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTASSGGV-----SDQFPAGLRVLVVDDDPTCLVILEKMLRTCRY  51



>ref|XP_011046389.1| PREDICTED: two-component response regulator ARR2-like isoform 
X4 [Populus euphratica]
Length=677

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 5/46 (11%)
 Frame = +3

Query  192  MESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG+     S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTASSGGV-----SDQFPAGLRVLVVDDDPTCLVILEKMLRTCRY  51



>ref|XP_011046388.1| PREDICTED: two-component response regulator ARR2-like isoform 
X3 [Populus euphratica]
Length=678

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 5/46 (11%)
 Frame = +3

Query  192  MESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG+     S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTASSGGV-----SDQFPAGLRVLVVDDDPTCLVILEKMLRTCRY  51



>ref|XP_011046387.1| PREDICTED: two-component response regulator ARR2-like isoform 
X2 [Populus euphratica]
Length=679

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 5/46 (11%)
 Frame = +3

Query  192  MESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG+     S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTASSGGV-----SDQFPAGLRVLVVDDDPTCLVILEKMLRTCRY  51



>ref|XP_011046386.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Populus euphratica]
Length=680

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 5/46 (11%)
 Frame = +3

Query  192  MESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG+     S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTASSGGV-----SDQFPAGLRVLVVDDDPTCLVILEKMLRTCRY  51



>ref|XP_008458388.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Cucumis melo]
Length=672

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L+ILEKML+ C Y
Sbjct  32   SDQFPAGLRVLVVDDDPTCLRILEKMLQNCCY  63



>emb|CBM42559.1| putative B-type response regulator 13 [Populus x canadensis]
Length=670

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 5/46 (11%)
 Frame = +3

Query  192  MESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG+     S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  1    MSTASSGGV-----SDQFPAGLRVLVVDDDPTCLVILEKMLRTCLY  41



>ref|XP_002314325.1| Two-component response regulator ARR2 family protein [Populus 
trichocarpa]
 gb|EEF00496.1| Two-component response regulator ARR2 family protein [Populus 
trichocarpa]
Length=634

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 5/46 (11%)
 Frame = +3

Query  192  MESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG+     S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTASSGGV-----SDQFPAGLRVLVVDDDPTCLVILEKMLRTCLY  51



>emb|CDO98804.1| unnamed protein product [Coffea canephora]
Length=675

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L+ILEKML+ C Y
Sbjct  28   SDQFPAGLRVLVVDDDPTCLRILEKMLRNCLY  59



>ref|XP_011071400.1| PREDICTED: two-component response regulator ARR2 isoform X2 [Sesamum 
indicum]
Length=669

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L+ILEKML+ C Y
Sbjct  24   SDQFPAGLRVLVVDDDPTCLRILEKMLRSCLY  55



>ref|XP_011071399.1| PREDICTED: two-component response regulator ARR2 isoform X1 [Sesamum 
indicum]
Length=670

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L+ILEKML+ C Y
Sbjct  24   SDQFPAGLRVLVVDDDPTCLRILEKMLRSCLY  55



>ref|XP_006363579.1| PREDICTED: two-component response regulator ARR1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006363580.1| PREDICTED: two-component response regulator ARR1-like isoform 
X2 [Solanum tuberosum]
Length=675

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FP GLRVLVVDDDPT LKILEKML+ C Y
Sbjct  22   SDQFPVGLRVLVVDDDPTCLKILEKMLRNCHY  53



>ref|XP_006345976.1| PREDICTED: two-component response regulator ARR1-like [Solanum 
tuberosum]
Length=663

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  228  RSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  28   KVSDQFPAGLRVLVVDDDPTCLMILEKMLRNCHY  61



>ref|XP_011100814.1| PREDICTED: two-component response regulator ARR2-like isoform 
X3 [Sesamum indicum]
Length=634

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L+ILEKMLK C Y
Sbjct  25   DQFPAGLRVLVVDDDPTCLRILEKMLKNCLY  55



>ref|XP_011100813.1| PREDICTED: two-component response regulator ARR2-like isoform 
X2 [Sesamum indicum]
Length=672

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L+ILEKMLK C Y
Sbjct  25   DQFPAGLRVLVVDDDPTCLRILEKMLKNCLY  55



>ref|XP_011100812.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Sesamum indicum]
Length=673

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L+ILEKMLK C Y
Sbjct  25   DQFPAGLRVLVVDDDPTCLRILEKMLKNCLY  55



>ref|XP_004229281.1| PREDICTED: two-component response regulator ARR2 [Solanum lycopersicum]
Length=677

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FP GLRVLVVDDDPT LKILEKMLK C Y
Sbjct  23   DQFPVGLRVLVVDDDPTCLKILEKMLKNCHY  53



>gb|KHG01283.1| Two-component response regulator ARR1 -like protein [Gossypium 
arboreum]
Length=672

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            ++ FPAGLRVLVVDDDPT L ILEKMLK C Y
Sbjct  27   ADQFPAGLRVLVVDDDPTCLMILEKMLKACQY  58



>gb|KHF98092.1| Two-component response regulator ARR1 -like protein [Gossypium 
arboreum]
Length=678

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L ILEKML+ CSY
Sbjct  30   DQFPAGLRVLVVDDDPTCLIILEKMLRNCSY  60



>ref|XP_009146503.1| PREDICTED: two-component response regulator ARR2-like [Brassica 
rapa]
Length=633

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 3/45 (7%)
 Frame = +3

Query  195  ESVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +S +AGG     +S+ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  11   DSGVAGG---SSNSDPFPAGLRVLVVDDDPTCLMILERMLRTCLY  52



>ref|XP_009801563.1| PREDICTED: two-component response regulator ARR2-like [Nicotiana 
sylvestris]
Length=643

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FP GLRVLVVDDDPT L+ILEKML+ C Y
Sbjct  5    SDQFPVGLRVLVVDDDPTCLRILEKMLRNCHY  36



>ref|XP_004508173.1| PREDICTED: two-component response regulator ARR2-like isoform 
X3 [Cicer arietinum]
Length=675

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  24   TSDQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  56



>ref|XP_004508172.1| PREDICTED: two-component response regulator ARR2-like isoform 
X2 [Cicer arietinum]
Length=676

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  24   TSDQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  56



>ref|XP_004508171.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Cicer arietinum]
Length=680

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  24   TSDQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  56



>ref|XP_009768392.1| PREDICTED: two-component response regulator ARR1-like [Nicotiana 
sylvestris]
Length=670

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLRVLVVDDDPT L+ILEKML+ C Y
Sbjct  29   FPAGLRVLVVDDDPTCLRILEKMLRNCHY  57



>ref|XP_002508755.1| g2-like myb-transcription factor with a n-terminal response regulator 
receiver domain [Micromonas sp. RCC299]
 gb|ACO70013.1| g2-like myb-transcription factor with a n-terminal response regulator 
receiver domain [Micromonas sp. RCC299]
Length=488

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  225  PRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            P  S+ FP GLRVLVVDDDP  LKI+EKMLK+C Y
Sbjct  4    PAVSKGFPIGLRVLVVDDDPLCLKIVEKMLKRCQY  38



>ref|XP_009591694.1| PREDICTED: two-component response regulator ARR1-like [Nicotiana 
tomentosiformis]
 ref|XP_009591695.1| PREDICTED: two-component response regulator ARR1-like [Nicotiana 
tomentosiformis]
 ref|XP_009591696.1| PREDICTED: two-component response regulator ARR1-like [Nicotiana 
tomentosiformis]
Length=678

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FP GLRVLVVDDDPT L+ILEKML+ C Y
Sbjct  25   SDKFPVGLRVLVVDDDPTCLRILEKMLRNCYY  56



>ref|XP_010268091.1| PREDICTED: two-component response regulator ARR2-like isoform 
X2 [Nelumbo nucifera]
Length=702

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L+IL+KML+ C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLRILDKMLRNCLY  57



>ref|XP_010268090.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Nelumbo nucifera]
Length=703

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L+IL+KML+ C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLRILDKMLRNCLY  57



>ref|XP_008790854.1| PREDICTED: two-component response regulator ARR2-like isoform 
X3 [Phoenix dactylifera]
Length=717

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLRVLVVDDDPT LKIL++ML+KC Y
Sbjct  26   FPAGLRVLVVDDDPTCLKILDRMLRKCLY  54



>ref|XP_010938331.1| PREDICTED: two-component response regulator ARR2-like isoform 
X4 [Elaeis guineensis]
 ref|XP_010938332.1| PREDICTED: two-component response regulator ARR2-like isoform 
X4 [Elaeis guineensis]
Length=739

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLRVLVVDDDPT LKIL++ML+KC Y
Sbjct  26   FPAGLRVLVVDDDPTCLKILDRMLRKCLY  54



>ref|XP_010938330.1| PREDICTED: two-component response regulator ARR2-like isoform 
X3 [Elaeis guineensis]
Length=740

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLRVLVVDDDPT LKIL++ML+KC Y
Sbjct  26   FPAGLRVLVVDDDPTCLKILDRMLRKCLY  54



>ref|XP_008790853.1| PREDICTED: two-component response regulator ARR1-like isoform 
X2 [Phoenix dactylifera]
Length=740

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLRVLVVDDDPT LKIL++ML+KC Y
Sbjct  26   FPAGLRVLVVDDDPTCLKILDRMLRKCLY  54



>ref|XP_008790852.1| PREDICTED: two-component response regulator ARR1-like isoform 
X1 [Phoenix dactylifera]
Length=741

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLRVLVVDDDPT LKIL++ML+KC Y
Sbjct  26   FPAGLRVLVVDDDPTCLKILDRMLRKCLY  54



>ref|XP_010938329.1| PREDICTED: two-component response regulator ARR2-like isoform 
X2 [Elaeis guineensis]
Length=744

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLRVLVVDDDPT LKIL++ML+KC Y
Sbjct  26   FPAGLRVLVVDDDPTCLKILDRMLRKCLY  54



>ref|XP_010938328.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Elaeis guineensis]
Length=745

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLRVLVVDDDPT LKIL++ML+KC Y
Sbjct  26   FPAGLRVLVVDDDPTCLKILDRMLRKCLY  54



>gb|EYU45518.1| hypothetical protein MIMGU_mgv1a003712mg [Erythranthe guttata]
Length=568

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L+ILEKML+ C Y
Sbjct  29   DQFPAGLRVLVVDDDPTCLRILEKMLRNCLY  59



>ref|XP_011000516.1| PREDICTED: two-component response regulator ARR2-like isoform 
X4 [Populus euphratica]
Length=684

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = +3

Query  192  MESVMAGGIFLPRSS--ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG++       + FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTATSGGVWKASDGVPDQFPAGLRVLVVDDDPTCLVILEKMLRTCLY  58



>ref|XP_011000515.1| PREDICTED: two-component response regulator ARR2-like isoform 
X3 [Populus euphratica]
Length=685

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = +3

Query  192  MESVMAGGIFLPRSS--ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG++       + FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTATSGGVWKASDGVPDQFPAGLRVLVVDDDPTCLVILEKMLRTCLY  58



>ref|XP_011000512.1| PREDICTED: two-component response regulator ARR2-like isoform 
X2 [Populus euphratica]
Length=686

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = +3

Query  192  MESVMAGGIFLPRSS--ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG++       + FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTATSGGVWKASDGVPDQFPAGLRVLVVDDDPTCLVILEKMLRTCLY  58



>ref|XP_011000511.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Populus euphratica]
Length=687

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 2/48 (4%)
 Frame = +3

Query  192  MESVMAGGIFLPRSS--ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            M +  +GG++       + FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  11   MSTATSGGVWKASDGVPDQFPAGLRVLVVDDDPTCLVILEKMLRTCLY  58



>ref|XP_010101901.1| Two-component response regulator [Morus notabilis]
 gb|EXB90367.1| Two-component response regulator [Morus notabilis]
Length=654

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  17   SDQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  48



>ref|XP_008223287.1| PREDICTED: two-component response regulator ARR2 isoform X2 [Prunus 
mume]
Length=675

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  57



>ref|XP_007225155.1| hypothetical protein PRUPE_ppa002408mg [Prunus persica]
 gb|EMJ26354.1| hypothetical protein PRUPE_ppa002408mg [Prunus persica]
Length=675

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  57



>ref|XP_008223286.1| PREDICTED: two-component response regulator ARR2 isoform X1 [Prunus 
mume]
Length=676

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  57



>ref|XP_003550512.1| PREDICTED: two-component response regulator ARR2-like [Glycine 
max]
 gb|KHN03323.1| Two-component response regulator ARR2 [Glycine soja]
Length=677

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  57



>gb|KHN02925.1| Two-component response regulator ARR2 [Glycine soja]
Length=679

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  57



>ref|XP_007154337.1| hypothetical protein PHAVU_003G110100g [Phaseolus vulgaris]
 gb|ESW26331.1| hypothetical protein PHAVU_003G110100g [Phaseolus vulgaris]
Length=679

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  57



>ref|XP_003529546.1| PREDICTED: two-component response regulator ARR2-like [Glycine 
max]
Length=679

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  57



>gb|KEH32327.1| two-component response regulator ARR2-like protein [Medicago 
truncatula]
Length=680

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  28   SDQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  59



>gb|KEH32325.1| two-component response regulator ARR2-like protein [Medicago 
truncatula]
Length=681

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  28   SDQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  59



>ref|XP_010905671.1| PREDICTED: two-component response regulator ARR1-like [Elaeis 
guineensis]
Length=757

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  228  RSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            R    FP GLRVLVVDDDPT LKIL+KML+KC Y
Sbjct  22   RPLSDFPVGLRVLVVDDDPTCLKILDKMLRKCLY  55



>ref|XP_006419449.1| hypothetical protein CICLE_v10004989mg [Citrus clementina]
 ref|XP_006419450.1| hypothetical protein CICLE_v10004989mg [Citrus clementina]
 gb|ESR32689.1| hypothetical protein CICLE_v10004989mg [Citrus clementina]
 gb|ESR32690.1| hypothetical protein CICLE_v10004989mg [Citrus clementina]
Length=436

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L+ILEKML+ C Y
Sbjct  12   DQFPAGLRVLVVDDDPTCLRILEKMLRTCLY  42



>ref|XP_006488883.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006488884.1| PREDICTED: two-component response regulator ARR2-like isoform 
X2 [Citrus sinensis]
Length=436

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L+ILEKML+ C Y
Sbjct  12   DQFPAGLRVLVVDDDPTCLRILEKMLRTCLY  42



>ref|XP_010271366.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010271367.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Nelumbo nucifera]
Length=677

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDD T LKILE+ML+KC Y
Sbjct  29   SDQFPAGLRVLVVDDDTTCLKILEQMLRKCLY  60



>ref|XP_010274996.1| PREDICTED: two-component response regulator ARR1-like [Nelumbo 
nucifera]
 ref|XP_010275062.1| PREDICTED: two-component response regulator ARR1-like [Nelumbo 
nucifera]
Length=678

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDD T LKILE+ML+KC Y
Sbjct  29   SDQFPAGLRVLVVDDDTTCLKILEQMLRKCLY  60



>ref|XP_002994006.1| hypothetical protein SELMODRAFT_187683, partial [Selaginella 
moellendorffii]
 gb|EFJ04946.1| hypothetical protein SELMODRAFT_187683, partial [Selaginella 
moellendorffii]
Length=376

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = +3

Query  222  LPRSSE--TFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +P++ +   FPAGLRVL VDDDPT L+IL +ML+KCSY
Sbjct  1    MPQAKDLGKFPAGLRVLAVDDDPTCLRILAQMLRKCSY  38



>ref|XP_010259415.1| PREDICTED: two-component response regulator ARR2-like isoform 
X2 [Nelumbo nucifera]
Length=697

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L+IL++ML+ C Y
Sbjct  24   SDQFPAGLRVLVVDDDPTCLRILDRMLRNCLY  55



>ref|XP_010259414.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Nelumbo nucifera]
Length=698

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L+IL++ML+ C Y
Sbjct  24   SDQFPAGLRVLVVDDDPTCLRILDRMLRNCLY  55



>ref|XP_010548968.1| PREDICTED: two-component response regulator ARR1 [Tarenaya hassleriana]
 ref|XP_010548969.1| PREDICTED: two-component response regulator ARR1 [Tarenaya hassleriana]
Length=707

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  27   SDQFPAGLRVLVVDDDPTCLMILERMLRNCLY  58



>emb|CDY09718.1| BnaC07g33430D [Brassica napus]
Length=601

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +S+ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  12   NSDPFPAGLRVLVVDDDPTCLMILERMLRTCLY  44



>ref|XP_010670915.1| PREDICTED: two-component response regulator ARR2 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=670

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S + FP GLRVLVVDDDPT L ILEKML+ C Y
Sbjct  26   SGDQFPVGLRVLVVDDDPTCLTILEKMLRTCRY  58



>ref|XP_010670914.1| PREDICTED: two-component response regulator ARR2 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=671

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S + FP GLRVLVVDDDPT L ILEKML+ C Y
Sbjct  26   SGDQFPVGLRVLVVDDDPTCLTILEKMLRTCRY  58



>ref|XP_006286049.1| hypothetical protein CARUB_v10007581mg [Capsella rubella]
 gb|EOA18947.1| hypothetical protein CARUB_v10007581mg [Capsella rubella]
Length=656

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +S+ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  15   NSDPFPAGLRVLVVDDDPTCLMILERMLRTCLY  47



>ref|XP_007138963.1| hypothetical protein PHAVU_009G253200g [Phaseolus vulgaris]
 gb|ESW10957.1| hypothetical protein PHAVU_009G253200g [Phaseolus vulgaris]
Length=672

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRV+VVDDDPT L+ILE+ML+ C Y
Sbjct  22   SDQFPAGLRVMVVDDDPTCLRILERMLRVCLY  53



>ref|XP_009369971.1| PREDICTED: two-component response regulator ARR1-like isoform 
X2 [Pyrus x bretschneideri]
Length=670

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLMILERMLRTCLY  57



>ref|XP_008390564.1| PREDICTED: two-component response regulator ARR1-like [Malus 
domestica]
Length=670

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLMILERMLRTCLY  57



>ref|XP_009369970.1| PREDICTED: two-component response regulator ARR1-like isoform 
X1 [Pyrus x bretschneideri]
Length=671

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLMILERMLRTCLY  57



>ref|XP_006586907.1| PREDICTED: two-component response regulator ARR2-like isoform 
X2 [Glycine max]
Length=636

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  22   SDQFPAGLRVLVVDDDPTCLMILERMLRACLY  53



>emb|CDX90546.1| BnaA03g42350D [Brassica napus]
Length=590

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +S+ FP+GLRVLVVDDDPT L ILE+MLK C Y
Sbjct  12   NSDPFPSGLRVLVVDDDPTCLMILERMLKTCLY  44



>ref|XP_009136741.1| PREDICTED: two-component response regulator ARR2 isoform X2 [Brassica 
rapa]
Length=592

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +S+ FP+GLRVLVVDDDPT L ILE+MLK C Y
Sbjct  12   NSDPFPSGLRVLVVDDDPTCLMILERMLKTCLY  44



>ref|XP_009136740.1| PREDICTED: two-component response regulator ARR2 isoform X1 [Brassica 
rapa]
Length=594

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +S+ FP+GLRVLVVDDDPT L ILE+MLK C Y
Sbjct  12   NSDPFPSGLRVLVVDDDPTCLMILERMLKTCLY  44



>ref|XP_003546340.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Glycine max]
Length=672

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  22   SDQFPAGLRVLVVDDDPTCLMILERMLRACLY  53



>gb|KHN12911.1| Two-component response regulator ARR2 [Glycine soja]
Length=673

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  22   SDQFPAGLRVLVVDDDPTCLMILERMLRACLY  53



>ref|XP_003533222.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Glycine max]
Length=673

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  22   SDQFPAGLRVLVVDDDPTCLMILERMLRACLY  53



>gb|KHN14648.1| Two-component response regulator ARR2 [Glycine soja]
Length=697

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  22   SDQFPAGLRVLVVDDDPTCLMILERMLRACLY  53



>ref|XP_009417757.1| PREDICTED: two-component response regulator ARR1-like [Musa acuminata 
subsp. malaccensis]
Length=731

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLRVL+VDDDPT LKIL++ML+KC Y
Sbjct  33   FPAGLRVLLVDDDPTCLKILDRMLRKCLY  61



>gb|KDP27872.1| hypothetical protein JCGZ_18952 [Jatropha curcas]
Length=680

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FP GLRVLVVDDDPT L ILEKMLK C Y
Sbjct  26   SDQFPIGLRVLVVDDDPTCLMILEKMLKTCLY  57



>ref|XP_002958010.1| ARR-B family transcription factor [Volvox carteri f. nagariensis]
 gb|EFJ40943.1| ARR-B family transcription factor [Volvox carteri f. nagariensis]
Length=254

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
              FPAGLR+LVVDDDP  LK++E+ML+KCSY
Sbjct  22   HNFPAGLRLLVVDDDPLCLKVVEQMLRKCSY  52



>ref|XP_003063042.1| g2-like myb-transcription factor with a n-terminal response regulator 
receiver domain [Micromonas pusilla CCMP1545]
 gb|EEH52981.1| g2-like myb-transcription factor with a n-terminal response regulator 
receiver domain [Micromonas pusilla CCMP1545]
Length=544

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDP  L+I+EKMLK+C Y
Sbjct  9    KVFPAGLRVLVVDDDPLCLRIVEKMLKRCQY  39



>ref|XP_004295112.1| PREDICTED: two-component response regulator ARR1-like [Fragaria 
vesca subsp. vesca]
Length=676

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 4/38 (11%)
 Frame = +3

Query  228  RSSET----FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +S ET    FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  20   KSGETVPDQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  57



>emb|CBI22927.3| unnamed protein product [Vitis vinifera]
Length=533

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  27   DQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  57



>gb|KEH20538.1| two-component response regulator ARR2-like protein [Medicago 
truncatula]
Length=538

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDD T L+ILEKMLKKC Y
Sbjct  23   DAFPAGLRVLVVDDDLTCLRILEKMLKKCFY  53



>ref|XP_004134232.1| PREDICTED: two-component response regulator ARR2-like [Cucumis 
sativus]
 ref|XP_004162202.1| PREDICTED: two-component response regulator ARR2-like [Cucumis 
sativus]
 gb|KGN57144.1| Sensor histidine kinase [Cucumis sativus]
Length=660

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 31/44 (70%), Gaps = 3/44 (7%)
 Frame = +3

Query  198  SVMAGGIFLPRSSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            SV   G  +P   + FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  8    SVRKAGEAVP---DQFPAGLRVLVVDDDPTCLMILEKMLRICRY  48



>gb|EYU45516.1| hypothetical protein MIMGU_mgv1a023212mg, partial [Erythranthe 
guttata]
Length=505

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLRVLVVDDDPT L+IL+KML+ C Y
Sbjct  1    FPAGLRVLVVDDDPTCLRILDKMLRSCLY  29



>ref|XP_006488891.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006488892.1| PREDICTED: two-component response regulator ARR2-like isoform 
X2 [Citrus sinensis]
Length=239

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L+ILEKML+ C Y
Sbjct  12   DQFPAGLRVLVVDDDPTCLRILEKMLRTCLY  42



>ref|XP_010649546.1| PREDICTED: two-component response regulator ARR1 isoform X2 [Vitis 
vinifera]
Length=680

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  27   DQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  57



>ref|XP_007035713.1| Sensor histidine kinase, putative isoform 1 [Theobroma cacao]
 gb|EOY06639.1| Sensor histidine kinase, putative isoform 1 [Theobroma cacao]
Length=681

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  27   DQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  57



>ref|XP_002275142.2| PREDICTED: two-component response regulator ARR1 isoform X1 [Vitis 
vinifera]
Length=681

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  27   DQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  57



>ref|XP_002519174.1| sensor histidine kinase, putative [Ricinus communis]
 gb|EEF43038.1| sensor histidine kinase, putative [Ricinus communis]
Length=682

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  27   DQFPAGLRVLVVDDDPTCLMILEKMLRTCLY  57



>ref|XP_006488890.1| PREDICTED: two-component response regulator ARR2-like isoform 
X3 [Citrus sinensis]
Length=679

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L+ILEKML  C Y
Sbjct  21   DQFPAGLRVLVVDDDPTCLRILEKMLGTCLY  51



>ref|XP_006419444.1| hypothetical protein CICLE_v10004470mg [Citrus clementina]
 ref|XP_006419445.1| hypothetical protein CICLE_v10004470mg [Citrus clementina]
 gb|ESR32684.1| hypothetical protein CICLE_v10004470mg [Citrus clementina]
 gb|ESR32685.1| hypothetical protein CICLE_v10004470mg [Citrus clementina]
Length=679

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L+ILEKML  C Y
Sbjct  21   DQFPAGLRVLVVDDDPTCLRILEKMLGTCLY  51



>ref|XP_006488888.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006488889.1| PREDICTED: two-component response regulator ARR2-like isoform 
X2 [Citrus sinensis]
Length=680

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L+ILEKML  C Y
Sbjct  21   DQFPAGLRVLVVDDDPTCLRILEKMLGTCLY  51



>ref|XP_006419443.1| hypothetical protein CICLE_v10004470mg [Citrus clementina]
 gb|ESR32683.1| hypothetical protein CICLE_v10004470mg [Citrus clementina]
Length=680

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L+ILEKML  C Y
Sbjct  21   DQFPAGLRVLVVDDDPTCLRILEKMLGTCLY  51



>ref|XP_008438918.1| PREDICTED: two-component response regulator ARR2-like [Cucumis 
melo]
Length=660

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            + FPAGLRVLVVDDDPT L ILEKML+ C Y
Sbjct  18   DQFPAGLRVLVVDDDPTCLMILEKMLRICRY  48



>gb|AEM23772.1| RRB2 type-b response regulator [Nicotiana tabacum]
Length=669

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLRVLVVDDDPT L+ILEKML  C Y
Sbjct  29   FPAGLRVLVVDDDPTCLRILEKMLWNCHY  57



>ref|XP_009615647.1| PREDICTED: two-component response regulator ARR2-like [Nicotiana 
tomentosiformis]
Length=678

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLRVLVVDDDPT L+ILEKML  C Y
Sbjct  29   FPAGLRVLVVDDDPTCLRILEKMLWNCHY  57



>ref|XP_001700734.1| hypothetical protein CHLREDRAFT_113139 [Chlamydomonas reinhardtii]
 gb|EDP06988.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=235

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  243  FPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            FPAGLR+LVVDDDP  LK++E+ML+KCSY
Sbjct  1    FPAGLRLLVVDDDPLCLKVVEQMLRKCSY  29



>ref|XP_010651334.1| PREDICTED: two-component response regulator ARR1 isoform X2 [Vitis 
vinifera]
Length=611

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDD T LKILE+ML++C Y
Sbjct  26   SDQFPAGLRVLVVDDDVTCLKILEQMLRRCLY  57



>gb|AFK34876.1| unknown [Medicago truncatula]
Length=606

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLMILERMLRFCLY  57



>ref|XP_003594816.1| Two-component response regulator ARR2 [Medicago truncatula]
 gb|AES65067.1| B-type response regulator [Medicago truncatula]
Length=606

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLMILERMLRFCLY  57



>emb|CBI26824.3| unnamed protein product [Vitis vinifera]
Length=428

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDD T LKILE+ML++C Y
Sbjct  26   SDQFPAGLRVLVVDDDVTCLKILEQMLRRCLY  57



>ref|XP_010651276.1| PREDICTED: two-component response regulator ARR1 isoform X1 [Vitis 
vinifera]
Length=662

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDD T LKILE+ML++C Y
Sbjct  26   SDQFPAGLRVLVVDDDVTCLKILEQMLRRCLY  57



>gb|KHG02654.1| Two-component response regulator ARR1 -like protein [Gossypium 
arboreum]
Length=679

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDDPT L ILEKML  C Y
Sbjct  26   SDQFPAGLRVLVVDDDPTCLMILEKMLIACLY  57



>ref|XP_008340754.1| PREDICTED: two-component response regulator ARR1-like isoform 
X2 [Malus domestica]
Length=673

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            ++ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  26   TDQFPAGLRVLVVDDDPTCLMILERMLRTCLY  57



>ref|XP_008340753.1| PREDICTED: two-component response regulator ARR1-like isoform 
X1 [Malus domestica]
Length=674

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            ++ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  26   TDQFPAGLRVLVVDDDPTCLMILERMLRTCLY  57



>emb|CBL94183.1| putative type-b response regulator (sensor histidine kinase) 
[Malus domestica]
Length=674

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            ++ FPAGLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  26   TDQFPAGLRVLVVDDDPTCLMILERMLRTCLY  57



>emb|CDX75892.1| BnaC03g39750D [Brassica napus]
Length=452

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FP+GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  30   EMFPSGLRVLVVDDDPTCLMILERMLRTCLY  60



>emb|CDX95898.1| BnaC05g36490D [Brassica napus]
Length=505

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FP+GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  29   EMFPSGLRVLVVDDDPTCLMILERMLRTCLY  59



>ref|XP_002533196.1| two-component sensor histidine kinase bacteria, putative [Ricinus 
communis]
 gb|EEF29188.1| two-component sensor histidine kinase bacteria, putative [Ricinus 
communis]
Length=669

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FPAGLRVLVVDDD T L+ILE+ML++C Y
Sbjct  36   SDQFPAGLRVLVVDDDTTCLRILEQMLRRCLY  67



>emb|CDX82389.1| BnaA03g34320D [Brassica napus]
Length=609

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FP+GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  25   EMFPSGLRVLVVDDDPTCLMILERMLRTCLY  55



>gb|AES92580.2| two-component response regulator ARR12-like protein [Medicago 
truncatula]
Length=590

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FPAG+RVL VDDDPT+LK+LEK L  C+Y
Sbjct  18   EGFPAGMRVLAVDDDPTYLKVLEKQLLTCNY  48



>ref|XP_003610383.1| Two-component response regulator EHD1 [Medicago truncatula]
Length=597

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FPAG+RVL VDDDPT+LK+LEK L  C+Y
Sbjct  18   EGFPAGMRVLAVDDDPTYLKVLEKQLLTCNY  48



>ref|XP_009135499.1| PREDICTED: two-component response regulator ARR1-like isoform 
X1 [Brassica rapa]
Length=650

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FP+GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  25   EMFPSGLRVLVVDDDPTCLMILERMLRTCLY  55



>ref|XP_010440207.1| PREDICTED: two-component response regulator ARR2-like [Camelina 
sativa]
Length=664

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +S+ FPAGLRVLVVDDDPT L ILE+ML  C Y
Sbjct  7    NSDPFPAGLRVLVVDDDPTCLMILERMLMTCLY  39



>ref|XP_010449851.1| PREDICTED: two-component response regulator ARR2-like isoform 
X1 [Camelina sativa]
Length=672

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +S+ FPAGLRVLVVDDDPT L ILE+ML  C Y
Sbjct  15   NSDPFPAGLRVLVVDDDPTCLMILERMLMTCLY  47



>ref|XP_010434886.1| PREDICTED: two-component response regulator ARR2-like [Camelina 
sativa]
Length=673

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  231  SSETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            +S+ FPAGLRVLVVDDDPT L ILE+ML  C Y
Sbjct  15   NSDPFPAGLRVLVVDDDPTCLMILERMLMTCLY  47



>ref|XP_009146053.1| PREDICTED: two-component response regulator ARR1 isoform X3 [Brassica 
rapa]
Length=661

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FP+GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  29   EMFPSGLRVLVVDDDPTCLMILERMLRTCLY  59



>dbj|BAJ34504.1| unnamed protein product [Thellungiella halophila]
Length=668

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FP+GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  29   EMFPSGLRVLVVDDDPTCLMILERMLRTCLY  59



>ref|NP_850600.2| response regulator 1 [Arabidopsis thaliana]
 dbj|BAH19591.1| AT3G16857 [Arabidopsis thaliana]
 gb|AEE75875.1| response regulator 1 [Arabidopsis thaliana]
Length=669

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FP+GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  31   EMFPSGLRVLVVDDDPTCLMILERMLRTCLY  61



>dbj|BAA74528.1| ARR1 protein [Arabidopsis thaliana]
Length=669

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FP+GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  31   EMFPSGLRVLVVDDDPTCLMILERMLRTCLY  61



>gb|KFK39028.1| hypothetical protein AALP_AA3G191300 [Arabis alpina]
Length=672

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FP+GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  26   EMFPSGLRVLVVDDDPTCLMILERMLRTCLY  56



>ref|XP_010548971.1| PREDICTED: two-component response regulator ARR1-like [Tarenaya 
hassleriana]
Length=203

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  234  SETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            S+ FP GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  27   SDQFPVGLRVLVVDDDPTCLMILERMLRNCLY  58



>ref|XP_009146052.1| PREDICTED: two-component response regulator ARR1 isoform X2 [Brassica 
rapa]
Length=676

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FP+GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  29   EMFPSGLRVLVVDDDPTCLMILERMLRTCLY  59



>ref|XP_009146051.1| PREDICTED: two-component response regulator ARR1 isoform X1 [Brassica 
rapa]
Length=681

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FP+GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  29   EMFPSGLRVLVVDDDPTCLMILERMLRTCLY  59



>ref|XP_002883031.1| hypothetical protein ARALYDRAFT_479152 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59290.1| hypothetical protein ARALYDRAFT_479152 [Arabidopsis lyrata subsp. 
lyrata]
Length=687

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FP+GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  29   EMFPSGLRVLVVDDDPTCLMILERMLRTCLY  59



>gb|AAL06987.1| AT3g16857/MUH15_1 [Arabidopsis thaliana]
Length=690

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FP+GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  31   EMFPSGLRVLVVDDDPTCLMILERMLRTCLY  61



>ref|NP_566561.2| response regulator 1 [Arabidopsis thaliana]
 sp|Q940D0.2|ARR1_ARATH RecName: Full=Two-component response regulator ARR1 [Arabidopsis 
thaliana]
 dbj|BAB03073.1| ARR1 protein [Arabidopsis thaliana]
 dbj|BAD44252.1| putative ARR1 protein [Arabidopsis thaliana]
 gb|AEE75876.1| response regulator 1 [Arabidopsis thaliana]
Length=690

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  237  ETFPAGLRVLVVDDDPTWLKILEKMLKKCSY  329
            E FP+GLRVLVVDDDPT L ILE+ML+ C Y
Sbjct  31   EMFPSGLRVLVVDDDPTCLMILERMLRTCLY  61



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519284018688