BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23588_g3_i1 len=1404 path=[3945:0-558 1856:559-1042 2294:1043-1088
1400:1089-1364 1676:1365-1403]

Length=1404
                                                                      Score     E

ref|XP_011079782.1|  PREDICTED: uncharacterized protein LOC105163215    513   4e-175   
ref|XP_009757082.1|  PREDICTED: uncharacterized protein LOC104209995    504   9e-172   
ref|XP_009614907.1|  PREDICTED: uncharacterized protein LOC104107733    502   9e-171   
ref|XP_002321050.1|  hypothetical protein POPTR_0014s13270g             494   2e-168   Populus trichocarpa [western balsam poplar]
emb|CBI32311.3|  unnamed protein product                                491   7e-168   
emb|CDP03587.1|  unnamed protein product                                493   4e-167   
ref|XP_004247482.1|  PREDICTED: uncharacterized protein LOC101265861    493   4e-167   
ref|XP_002271044.2|  PREDICTED: uncharacterized protein LOC100247717    493   4e-167   Vitis vinifera
ref|XP_006358440.1|  PREDICTED: uncharacterized protein LOC102606004    492   9e-167   
ref|XP_007200980.1|  hypothetical protein PRUPE_ppa004558mg             488   3e-165   
ref|XP_008234930.1|  PREDICTED: uncharacterized protein LOC103333818    487   1e-164   
ref|XP_011033662.1|  PREDICTED: uncharacterized protein LOC105132076    487   2e-164   
gb|KHG01957.1|  putative ybhP                                           484   9e-164   
ref|XP_007050713.1|  DNAse I-like superfamily protein                   484   1e-163   
ref|XP_006444162.1|  hypothetical protein CICLE_v10019778mg             483   5e-163   
ref|XP_002524784.1|  hydrolase, putative                                483   7e-163   Ricinus communis
ref|XP_008386588.1|  PREDICTED: uncharacterized protein LOC103449088    481   2e-162   
gb|KDP21522.1|  hypothetical protein JCGZ_21993                         481   2e-162   
gb|KHG02831.1|  putative ybhP                                           481   4e-162   
ref|XP_004290695.1|  PREDICTED: uncharacterized protein LOC101302029    479   5e-162   
ref|XP_010279198.1|  PREDICTED: uncharacterized protein LOC104613175    479   8e-162   
ref|XP_010107669.1|  hypothetical protein L484_008386                   476   1e-160   
ref|XP_010242554.1|  PREDICTED: uncharacterized protein LOC104586877    472   2e-158   
ref|XP_010667577.1|  PREDICTED: uncharacterized protein LOC104884592    464   7e-156   
ref|XP_010524002.1|  PREDICTED: uncharacterized protein LOC104802217    451   1e-151   
ref|XP_007144585.1|  hypothetical protein PHAVU_007G168200g             449   1e-150   
ref|XP_004496062.1|  PREDICTED: uncharacterized protein LOC101504254    449   2e-150   
ref|XP_009142487.1|  PREDICTED: uncharacterized protein LOC103866335    447   3e-150   
gb|KFK37555.1|  hypothetical protein AALP_AA4G271900                    447   6e-150   
gb|KHN46613.1|  hypothetical protein glysoja_035246                     447   3e-149   
gb|KEH43280.1|  endonuclease/exonuclease/phosphatase family protein     444   1e-148   
ref|XP_003536898.1|  PREDICTED: uncharacterized protein LOC100801298    444   1e-148   
ref|XP_006397995.1|  hypothetical protein EUTSA_v10001446mg             443   2e-148   
gb|KCW58935.1|  hypothetical protein EUGRSUZ_H01558                     434   5e-147   
ref|XP_006604414.1|  PREDICTED: uncharacterized protein LOC100820515    436   1e-146   
gb|KHN45385.1|  hypothetical protein glysoja_028392                     435   1e-145   
ref|XP_006419745.1|  hypothetical protein CICLE_v10005134mg             434   2e-145   
ref|XP_003520552.1|  PREDICTED: uncharacterized protein LOC100794761    434   2e-145   
ref|XP_006294213.1|  hypothetical protein CARUB_v10023211mg             436   2e-145   
ref|XP_006845796.1|  hypothetical protein AMTR_s00019p00255210          435   2e-145   
ref|XP_010496917.1|  PREDICTED: uncharacterized protein LOC104773943    435   2e-145   
gb|KCW58924.1|  hypothetical protein EUGRSUZ_H01547                     433   7e-145   
ref|XP_010413115.1|  PREDICTED: uncharacterized protein LOC104699509    432   7e-145   
emb|CBI26148.3|  unnamed protein product                                432   9e-145   
ref|XP_002882142.1|  endonuclease/exonuclease/phosphatase family ...    433   1e-144   
ref|XP_010912091.1|  PREDICTED: uncharacterized protein LOC105038101    434   5e-144   
ref|XP_010070272.1|  PREDICTED: uncharacterized protein LOC104457...    434   6e-144   
ref|XP_010506851.1|  PREDICTED: uncharacterized protein LOC104783392    431   7e-144   
ref|XP_006489272.1|  PREDICTED: uncharacterized protein LOC102620958    433   7e-144   
ref|XP_010070271.1|  PREDICTED: uncharacterized protein LOC104457...    434   9e-144   
ref|XP_007162383.1|  hypothetical protein PHAVU_001G147400g             432   1e-143   
emb|CDO98952.1|  unnamed protein product                                431   4e-143   
ref|XP_010070307.1|  PREDICTED: uncharacterized protein LOC104457...    428   5e-143   
ref|XP_010070306.1|  PREDICTED: uncharacterized protein LOC104457...    428   7e-143   
gb|KDO74935.1|  hypothetical protein CISIN_1g012520mg                   429   1e-142   
ref|NP_566121.1|  endonuclease/exonuclease/phosphatase domain-con...    428   2e-142   Arabidopsis thaliana [mouse-ear cress]
gb|KGN47880.1|  hypothetical protein Csa_6G409370                       429   2e-142   
ref|XP_002277228.1|  PREDICTED: uncharacterized protein LOC100259606    429   4e-142   Vitis vinifera
ref|XP_008795094.1|  PREDICTED: uncharacterized protein LOC103710938    427   5e-142   
ref|XP_004140218.1|  PREDICTED: uncharacterized protein LOC101212223    428   6e-142   
ref|XP_002516829.1|  hydrolase, putative                                428   7e-142   Ricinus communis
ref|XP_004158629.1|  PREDICTED: uncharacterized LOC101212223            428   9e-142   
ref|XP_011071511.1|  PREDICTED: uncharacterized protein LOC105156938    426   9e-142   
ref|XP_008449463.1|  PREDICTED: uncharacterized protein LOC103491341    426   3e-141   
ref|XP_009412182.1|  PREDICTED: uncharacterized protein LOC103993...    426   6e-141   
ref|XP_010070298.1|  PREDICTED: uncharacterized protein LOC104457...    421   1e-140   
gb|KCW58939.1|  hypothetical protein EUGRSUZ_H01562                     417   1e-140   
ref|XP_003542906.1|  PREDICTED: uncharacterized protein LOC100818965    422   9e-140   
ref|XP_003547225.1|  PREDICTED: uncharacterized protein LOC100776616    421   2e-139   
gb|KDP40059.1|  hypothetical protein JCGZ_02057                         421   4e-139   
ref|XP_009772474.1|  PREDICTED: uncharacterized protein LOC104222850    419   2e-138   
ref|XP_004486299.1|  PREDICTED: uncharacterized protein LOC101497549    417   4e-138   
ref|XP_004229477.1|  PREDICTED: uncharacterized protein LOC101267932    417   1e-137   
ref|XP_006365276.1|  PREDICTED: uncharacterized protein LOC102593112    416   2e-137   
ref|XP_009628600.1|  PREDICTED: uncharacterized protein LOC104118917    416   3e-137   
gb|KEH36727.1|  endonuclease/exonuclease/phosphatase family protein     415   3e-137   
gb|AES64309.2|  endonuclease/exonuclease/phosphatase family protein     416   3e-137   
ref|XP_010036232.1|  PREDICTED: uncharacterized protein LOC104425275    416   6e-137   
ref|XP_007147831.1|  hypothetical protein PHAVU_006G158700g             415   9e-137   
ref|XP_002312721.1|  endonuclease/exonuclease/phosphatase family ...    414   3e-136   Populus trichocarpa [western balsam poplar]
ref|XP_011006081.1|  PREDICTED: uncharacterized protein LOC105112182    413   6e-136   
ref|XP_008438759.1|  PREDICTED: uncharacterized protein LOC103483772    412   9e-136   
ref|XP_004134173.1|  PREDICTED: uncharacterized protein LOC101215085    409   7e-135   
ref|XP_004159838.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    409   1e-134   
ref|XP_002463284.1|  hypothetical protein SORBIDRAFT_02g041190          402   2e-132   Sorghum bicolor [broomcorn]
ref|XP_003559883.2|  PREDICTED: uncharacterized protein LOC100838950    402   7e-132   
dbj|BAC16719.1|  unknown protein                                        399   4e-131   Oryza sativa Japonica Group [Japonica rice]
gb|EYU43860.1|  hypothetical protein MIMGU_mgv1a019291mg                395   4e-130   
ref|XP_006299891.1|  hypothetical protein CARUB_v10016098mg             397   4e-130   
ref|XP_007035404.1|  DNAse I-like superfamily protein                   397   9e-130   
emb|CDY48894.1|  BnaA03g36330D                                          394   1e-129   
ref|XP_003594058.1|  hypothetical protein MTR_2g020860                  392   1e-129   
ref|XP_010510300.1|  PREDICTED: uncharacterized protein LOC104786565    395   1e-129   
ref|NP_188790.2|  DNAse I-like superfamily protein                      394   4e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466393.1|  PREDICTED: uncharacterized protein LOC104746579    394   6e-129   
ref|XP_006658894.1|  PREDICTED: uncharacterized protein LOC102709668    389   2e-128   
ref|XP_009135757.1|  PREDICTED: uncharacterized protein LOC103859913    392   3e-128   
gb|KFK39448.1|  hypothetical protein AALP_AA3G246400                    387   2e-127   
ref|XP_002885446.1|  endonuclease/exonuclease/phosphatase family ...    389   3e-127   
ref|XP_010530519.1|  PREDICTED: uncharacterized protein LOC104807106    380   6e-127   
tpg|DAA63905.1|  TPA: hypothetical protein ZEAMMB73_300645              387   3e-126   
gb|EEE67690.1|  hypothetical protein OsJ_25350                          388   3e-126   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82548.1|  hypothetical protein OsI_27091                          385   2e-125   Oryza sativa Indica Group [Indian rice]
ref|NP_001060456.2|  Os07g0645500                                       385   4e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006406259.1|  hypothetical protein EUTSA_v10022320mg             383   8e-125   
emb|CDY32434.1|  BnaC03g42180D                                          379   3e-123   
ref|XP_010551046.1|  PREDICTED: uncharacterized protein LOC104821...    378   7e-123   
ref|XP_004986976.1|  PREDICTED: uncharacterized protein LOC101775287    372   9e-121   
ref|XP_010545175.1|  PREDICTED: uncharacterized protein LOC104817622    369   1e-119   
ref|XP_010551045.1|  PREDICTED: uncharacterized protein LOC104821...    369   2e-119   
ref|XP_004958516.1|  PREDICTED: uncharacterized protein LOC101779280    361   2e-119   
ref|XP_010070299.1|  PREDICTED: uncharacterized protein LOC104457...    362   4e-119   
ref|XP_010551042.1|  PREDICTED: uncharacterized protein LOC104821...    366   4e-118   
ref|XP_010026266.1|  PREDICTED: uncharacterized protein LOC104416592    355   9e-115   
gb|KCW58970.1|  hypothetical protein EUGRSUZ_H01598                     347   8e-114   
gb|EYU33110.1|  hypothetical protein MIMGU_mgv1a025924mg                338   3e-108   
ref|XP_009412180.1|  PREDICTED: uncharacterized protein LOC103993...    337   9e-107   
ref|XP_006650104.1|  PREDICTED: uncharacterized protein LOC102718065    330   4e-106   
gb|EEE59088.1|  hypothetical protein OsJ_10924                          333   5e-106   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001168314.1|  uncharacterized protein LOC100382080               325   2e-105   Zea mays [maize]
gb|ABF96080.1|  Endonuclease/Exonuclease/phosphatase family prote...    333   2e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EAY90089.1|  hypothetical protein OsI_11658                          333   2e-104   Oryza sativa Indica Group [Indian rice]
gb|EMT32562.1|  hypothetical protein F775_03404                         311   2e-99    
ref|XP_011016806.1|  PREDICTED: uncharacterized protein LOC105120338    293   3e-93    
gb|KCW58961.1|  hypothetical protein EUGRSUZ_H01586                     290   5e-92    
ref|XP_008355479.1|  PREDICTED: uncharacterized protein LOC103419133    285   5e-90    
ref|XP_008368950.1|  PREDICTED: uncharacterized protein LOC103432533    282   5e-89    
ref|XP_010070287.1|  PREDICTED: uncharacterized protein LOC104457...    282   8e-89    
ref|XP_010070282.1|  PREDICTED: uncharacterized protein LOC104457...    282   9e-89    
gb|KEH43279.1|  endonuclease/exonuclease/phosphatase family protein     283   6e-87    
gb|KEH43278.1|  endonuclease/exonuclease/phosphatase family protein     280   3e-86    
gb|EPS71855.1|  hypothetical protein M569_02903                         276   6e-86    
gb|KEH36728.1|  endonuclease/exonuclease/phosphatase family protein     267   7e-81    
gb|KEH36726.1|  endonuclease/exonuclease/phosphatase family protein     267   1e-80    
ref|XP_010512798.1|  PREDICTED: uncharacterized protein LOC104788711    265   1e-80    
ref|XP_010507820.1|  PREDICTED: uncharacterized protein LOC104784492    264   2e-80    
gb|KCW58927.1|  hypothetical protein EUGRSUZ_H015501                    250   1e-76    
ref|XP_010026269.1|  PREDICTED: uncharacterized protein LOC104416596    254   8e-75    
ref|XP_010105681.1|  hypothetical protein L484_011292                   238   3e-69    
ref|XP_008355478.1|  PREDICTED: uncharacterized protein LOC103419132    234   9e-69    
gb|KCW58931.1|  hypothetical protein EUGRSUZ_H01553                     228   3e-68    
gb|EPS65789.1|  hypothetical protein M569_08992                         228   3e-68    
ref|XP_002973846.1|  hypothetical protein SELMODRAFT_414230             236   4e-68    
ref|XP_008366577.1|  PREDICTED: uncharacterized protein LOC103430217    193   3e-53    
gb|KCW58926.1|  hypothetical protein EUGRSUZ_H015502                    164   8e-45    
ref|XP_010070273.1|  PREDICTED: uncharacterized protein LOC104457042    164   1e-44    
gb|EYU43550.1|  hypothetical protein MIMGU_mgv1a016341mg                160   2e-43    
ref|XP_002314436.1|  endonuclease/exonuclease/phosphatase family ...    148   9e-39    Populus trichocarpa [western balsam poplar]
gb|KCW58955.1|  hypothetical protein EUGRSUZ_H01581                     131   6e-33    
ref|XP_010026254.1|  PREDICTED: uncharacterized protein LOC104416580    128   2e-30    
gb|EAY90087.1|  hypothetical protein OsI_11656                        97.8    3e-21    Oryza sativa Indica Group [Indian rice]
ref|WP_014434990.1|  hypothetical protein                             76.3    4e-12    
gb|KHN31749.1|  Putative polygalacturonase                            73.2    9e-12    
ref|XP_010086902.1|  hypothetical protein L484_005487                 63.5    2e-08    
ref|WP_033171844.1|  endonuclease                                     63.9    5e-08    
gb|EST41698.1|  hypothetical protein SS50377_18785                    63.5    1e-07    
ref|WP_008992073.1|  hypothetical protein                             62.4    1e-07    
ref|WP_011879953.1|  endonuclease                                     62.4    1e-07    
ref|WP_034192826.1|  endonuclease                                     62.0    2e-07    
ref|WP_035804522.1|  hypothetical protein                             60.8    4e-07    
ref|WP_014725722.1|  endonuclease                                     60.5    5e-07    
ref|WP_012064146.1|  endonuclease/exonuclease/phosphatase             61.6    7e-07    
gb|EON78771.1|  putative secreted protein                             60.5    7e-07    
ref|XP_005787766.1|  hypothetical protein EMIHUDRAFT_201362           61.2    7e-07    
ref|WP_037760545.1|  endonuclease                                     60.1    1e-06    
ref|WP_030961986.1|  endonuclease                                     59.3    1e-06    
ref|WP_035661161.1|  hypothetical protein                             58.2    3e-06    
ref|WP_028664866.1|  hypothetical protein                             57.8    3e-06    
ref|XP_002680484.1|  phosphatase                                      58.9    3e-06    Naegleria gruberi strain NEG-M
ref|WP_033562832.1|  hypothetical protein                             58.5    3e-06    
ref|WP_007660703.1|  endonuclease/exonuclease/phosphatase             57.8    5e-06    
ref|WP_013926549.1|  hypothetical protein                             57.8    5e-06    
ref|WP_013787246.1|  endonuclease                                     57.0    6e-06    
ref|WP_020737631.1|  hypothetical protein                             57.4    7e-06    
ref|WP_037324815.1|  hypothetical protein                             57.4    8e-06    
ref|WP_034679515.1|  endonuclease                                     57.4    9e-06    
ref|WP_026545577.1|  endonuclease/exonuclease/phosphatase             57.0    1e-05    
ref|WP_015923851.1|  endonuclease/exonuclease/phosphatase             57.0    1e-05    
gb|KGE14479.1|  endonuclease/exonuclease/phosphatase                  56.6    1e-05    
emb|CDS91540.1|  conserved exported hypothetical protein              56.6    1e-05    
ref|WP_022275420.1|  uncharacterized protein                          56.6    1e-05    
gb|AHM57913.1|  endonuclease/exonuclease/phosphatase                  55.8    1e-05    
ref|WP_008658672.1|  endonuclease/exonuclease/phosphatase family ...  57.0    2e-05    
ref|WP_009282742.1|  endonuclease                                     55.8    2e-05    
ref|WP_028645961.1|  hypothetical protein                             56.2    2e-05    
ref|WP_037497251.1|  endonuclease                                     56.2    2e-05    
ref|WP_012237417.1|  hypothetical protein                             56.2    2e-05    
ref|WP_008240760.1|  hypothetical protein                             56.2    2e-05    
ref|WP_038570355.1|  endonuclease                                     55.8    2e-05    
ref|WP_039053753.1|  endonuclease                                     55.8    2e-05    
ref|WP_013070541.1|  hypothetical protein                             56.2    2e-05    
ref|WP_007762486.1|  endonuclease                                     55.8    3e-05    
ref|WP_011545534.1|  endonuclease                                     55.8    3e-05    
ref|WP_024988328.1|  endonuclease                                     55.8    3e-05    
ref|XP_009033009.1|  hypothetical protein AURANDRAFT_70680            57.0    3e-05    
ref|WP_008646780.1|  endonuclease                                     55.5    3e-05    
ref|WP_008358523.1|  endonuclease/exonuclease/phosphatase family ...  56.2    3e-05    
ref|WP_008665481.1|  metallophosphoesterase                           55.8    3e-05    
ref|WP_002623555.1|  Endonuclease/Exonuclease/phosphatase family ...  55.5    3e-05    
ref|WP_008023545.1|  endonuclease                                     55.1    4e-05    
gb|KIF80558.1|  endonuclease                                          55.5    4e-05    
ref|WP_008708175.1|  endonuclease/exonuclease/phosphatase family ...  54.7    4e-05    
ref|WP_006398961.1|  endonuclease                                     55.1    4e-05    
ref|WP_006415934.1|  endonuclease/exonuclease/phosphatase family ...  55.1    4e-05    
ref|WP_039224212.1|  endonuclease                                     55.1    4e-05    
ref|WP_003008399.1|  endonuclease                                     54.7    5e-05    
ref|WP_006799945.1|  endonuclease                                     54.7    5e-05    
ref|WP_006411227.1|  endonuclease                                     55.1    5e-05    
ref|WP_006405123.1|  endonuclease                                     55.1    5e-05    
gb|EZP42436.1|  putative secreted protein                             55.1    5e-05    
ref|WP_020867148.1|  endonuclease                                     55.1    6e-05    
ref|WP_035956362.1|  endonuclease                                     54.7    6e-05    
ref|WP_032978896.1|  endonuclease                                     54.7    6e-05    
ref|WP_026327172.1|  hypothetical protein                             54.7    6e-05    
ref|WP_037532874.1|  endonuclease                                     54.7    6e-05    
ref|WP_032951913.1|  endonuclease                                     54.7    7e-05    
emb|CDR05246.1|  Endonuclease/exonuclease/phosphatase                 55.1    7e-05    
ref|WP_034235365.1|  endonuclease                                     54.3    7e-05    
ref|WP_008411183.1|  Endonuclease/exonuclease/phosphatase             53.9    7e-05    
ref|WP_014398116.1|  endonuclease/exonuclease/phosphatase             53.9    8e-05    
ref|WP_012336638.1|  endonuclease                                     54.3    8e-05    
ref|WP_002997343.1|  endonuclease                                     53.9    8e-05    
ref|WP_027813159.1|  endonuclease                                     54.3    8e-05    
ref|WP_027785983.1|  endonuclease                                     54.3    9e-05    
ref|WP_024689266.1|  hypothetical protein                             53.9    9e-05    
ref|WP_027806790.1|  endonuclease                                     53.9    1e-04    
ref|WP_023478140.1|  Endonuclease/Exonuclease/phosphatase family ...  53.9    1e-04    
ref|WP_024695599.1|  hypothetical protein                             53.9    1e-04    
ref|WP_009951183.1|  Metal-dependent hydrolase                        53.9    1e-04    
ref|WP_037964542.1|  metal-dependent hydrolase                        53.9    1e-04    
ref|WP_038719992.1|  endonuclease                                     53.5    1e-04    
ref|WP_023358501.1|  endonuclease/Exonuclease/phosphatase family ...  54.3    1e-04    
ref|WP_012923641.1|  endonuclease                                     53.9    1e-04    
ref|WP_011205603.1|  endonuclease                                     54.3    1e-04    
gb|AIV80231.1|  endonuclease/Exonuclease/phosphatase family protein   53.9    1e-04    
gb|KGC26868.1|  endonuclease/Exonuclease/phosphatase family protein   53.9    1e-04    
gb|EQA86756.1|  endonuclease                                          54.3    1e-04    
gb|KGS25253.1|  endonuclease/Exonuclease/phosphatase family protein   53.9    1e-04    
ref|WP_020889612.1|  putative secreted protein                        53.9    1e-04    
gb|AHE29200.1|  endonuclease/Exonuclease/phosphatase family protein   53.9    1e-04    
gb|AHE35625.1|  endonuclease/Exonuclease/phosphatase family protein   53.9    1e-04    
ref|WP_037501251.1|  hypothetical protein                             53.5    1e-04    
gb|KGC85853.1|  endonuclease/Exonuclease/phosphatase family protein   53.9    1e-04    
gb|EIF72932.1|  endonuclease/exonuclease/phosphatase family protein   53.9    1e-04    
ref|WP_020850201.1|  endonuclease/Exonuclease/phosphatase family ...  53.9    1e-04    
ref|WP_011853358.1|  endonuclease                                     53.9    1e-04    
gb|KGE13174.1|  endonuclease/exonuclease/phosphatase                  53.5    1e-04    
emb|CDA82606.1|  uncharacterized protein BN772_01106                  53.5    1e-04    
ref|WP_038725980.1|  MULTISPECIES: endonuclease                       53.1    1e-04    
ref|WP_004524317.1|  endonuclease                                     53.9    1e-04    
ref|WP_005268063.1|  endonuclease/exonuclease/phosphatase             53.5    1e-04    
ref|WP_038739498.1|  endonuclease                                     53.1    2e-04    
ref|WP_031313583.1|  endonuclease                                     53.1    2e-04    
ref|WP_038719128.1|  MULTISPECIES: endonuclease                       53.1    2e-04    
gb|EDO90044.1|  endonuclease/exonuclease/phosphatase family protein   53.9    2e-04    Burkholderia pseudomallei Pasteur 52237
ref|WP_034209226.1|  endonuclease                                     53.1    2e-04    
ref|WP_026903346.1|  hypothetical protein                             53.1    2e-04    
ref|WP_038721186.1|  endonuclease                                     53.1    2e-04    
ref|WP_012372631.1|  endonuclease                                     53.1    2e-04    
gb|EVT73086.1|  endonuclease                                          53.1    2e-04    
ref|WP_038765379.1|  endonuclease                                     53.1    2e-04    
ref|WP_013840886.1|  endonuclease                                     52.4    2e-04    
gb|KGS56260.1|  endonuclease/Exonuclease/phosphatase family protein   53.5    2e-04    
gb|AIV54351.1|  endonuclease/Exonuclease/phosphatase family protein   53.5    2e-04    
gb|KGD45292.1|  endonuclease/Exonuclease/phosphatase family protein   53.5    2e-04    
ref|WP_033832198.1|  endonuclease                                     53.1    2e-04    
ref|WP_006753759.1|  endonuclease                                     52.8    2e-04    
ref|WP_004549785.1|  endonuclease                                     53.1    2e-04    
gb|KGX69126.1|  endonuclease/Exonuclease/phosphatase family protein   53.1    2e-04    
gb|AIP06994.1|  endonuclease/Exonuclease/phosphatase family protein   53.1    2e-04    
gb|KGC91120.1|  endonuclease/Exonuclease/phosphatase family protein   53.1    2e-04    
gb|KGD10150.1|  endonuclease/Exonuclease/phosphatase family protein   53.1    2e-04    
ref|WP_009001247.1|  endonuclease                                     52.8    2e-04    
gb|KGD41307.1|  endonuclease/Exonuclease/phosphatase family protein   53.1    2e-04    
ref|WP_038718946.1|  endonuclease                                     52.4    2e-04    
ref|WP_038763558.1|  endonuclease                                     52.4    2e-04    
ref|WP_029671282.1|  endonuclease                                     52.4    2e-04    
ref|WP_035601046.1|  hypothetical protein                             52.4    3e-04    
ref|WP_035640225.1|  hypothetical protein                             52.8    3e-04    
ref|WP_038767932.1|  endonuclease                                     52.4    3e-04    
ref|WP_011660494.1|  endonuclease                                     52.8    3e-04    
ref|WP_032960121.1|  endonuclease                                     52.8    3e-04    
ref|WP_014647746.1|  endonuclease                                     52.4    4e-04    
ref|WP_032129768.1|  endonuclease                                     52.4    4e-04    
ref|WP_005410320.1|  endonuclease                                     52.4    4e-04    
ref|WP_004883795.1|  endonuclease/exonuclease/phosphatase             52.0    4e-04    
ref|WP_010093210.1|  endonuclease                                     52.0    4e-04    
gb|EQB83428.1|  hypothetical protein L950_02475                       50.8    5e-04    
ref|WP_026210385.1|  hypothetical protein                             51.6    6e-04    
ref|WP_036134501.1|  hypothetical protein                             51.6    6e-04    
ref|WP_007328723.1|  endonuclease                                     51.6    6e-04    
ref|WP_037534141.1|  endonuclease                                     51.2    7e-04    
ref|WP_024956632.1|  endonuclease                                     51.6    7e-04    
ref|WP_034466866.1|  endonuclease                                     50.8    7e-04    
ref|WP_019423445.1|  hypothetical protein                             50.8    8e-04    
ref|WP_026236060.1|  hypothetical protein                             51.2    8e-04    
ref|WP_012859693.1|  endonuclease                                     51.2    9e-04    



>ref|XP_011079782.1| PREDICTED: uncharacterized protein LOC105163215 [Sesamum indicum]
Length=490

 Score =   513 bits (1320),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 265/345 (77%), Positives = 286/345 (83%), Gaps = 12/345 (3%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA---NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTN  1234
             AKSM+ RPKSILKQSPLHP +   NLS QQ+F KS+LRVSINLPDNEISLK+SGQL F  
Sbjct  116   AKSMNDRPKSILKQSPLHPMSAQDNLSRQQKFAKSRLRVSINLPDNEISLKRSGQLSFDK  175

Query  1233  TFLDDEGDgrgksplrsssslnfssssagrsyr-----stRTVVEVLRELNADVLALQDV  1069
               L+D   G   S +    +   S+S    +       STRTVVEVLREL ADVLALQDV
Sbjct  176   --LEDSSGGSSISKILKGKTPLRSNSMFTSTTNYGDIGSTRTVVEVLRELKADVLALQDV  233

Query  1068  KAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVM  889
             KAEEE+ MKPLSDLAA LGM Y FAESWAPEYGNAILSKWPIK  K QKIFDD+DFRNV+
Sbjct  234   KAEEEKNMKPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKRWKAQKIFDDTDFRNVL  293

Query  888   KATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQR  709
             KATIDVP+ GEINFFCTLLDHLDENWRMKQINAIIQS+  PHILAGGLNSLDE DYS +R
Sbjct  294   KATIDVPQAGEINFFCTLLDHLDENWRMKQINAIIQSTGVPHILAGGLNSLDETDYSQER  353

Query  708   WAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTR  529
             W +IVKYYEEMGKPTPKVEVMKYLKSK+Y DAKDF GECESVVMIAKGQ VQGTCKYGTR
Sbjct  354   WTDIVKYYEEMGKPTPKVEVMKYLKSKEYTDAKDFAGECESVVMIAKGQSVQGTCKYGTR  413

Query  528   VDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGSG  394
             VDYI+SS D+ YKFVPGSYSVLSSKGTSDHHIVKVDV+K   GSG
Sbjct  414   VDYILSSADAPYKFVPGSYSVLSSKGTSDHHIVKVDVIKV--GSG  456



>ref|XP_009757082.1| PREDICTED: uncharacterized protein LOC104209995 [Nicotiana sylvestris]
Length=486

 Score =   504 bits (1298),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 260/341 (76%), Positives = 278/341 (82%), Gaps = 5/341 (1%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA---NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTN  1234
             AKS + RPKSILKQSPLHP+     L ++Q F KSKLRVSINLPDNEISLKKSG+L F  
Sbjct  114   AKSTNDRPKSILKQSPLHPSKEADTLLKKQAFAKSKLRVSINLPDNEISLKKSGRLSFLG  173

Query  1233  TFLDDEG--DgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAE  1060
                D E               S        G+SY S R+VVEVLRELNADVLALQDVKAE
Sbjct  174   CDSDSERFLGSNICRGKAPIRSTVSMPRIDGQSYTSRRSVVEVLRELNADVLALQDVKAE  233

Query  1059  EEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKAT  880
             EE+ MKPLSDLAA LGM Y FAESWAPEYGNAILSKWPIKS K+QKIFDDSDFRNV+KAT
Sbjct  234   EEKGMKPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKSWKIQKIFDDSDFRNVLKAT  293

Query  879   IDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAE  700
             IDVP VGE NF+CT LDHLDENWRMKQINAIIQSSD PHILAGGLNSLDE DYSP+RW +
Sbjct  294   IDVPRVGEFNFYCTHLDHLDENWRMKQINAIIQSSDKPHILAGGLNSLDETDYSPERWTD  353

Query  699   IVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDY  520
             IVKYYEEMGKPTPKVE+MK+LKSK+Y DAKDF GECESVVMIAKGQ VQGTCKYGTRVDY
Sbjct  354   IVKYYEEMGKPTPKVEIMKHLKSKEYTDAKDFAGECESVVMIAKGQSVQGTCKYGTRVDY  413

Query  519   IVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGS  397
             I+SS DS Y FVPGSYSV SSKGTSDHHIVKVD+VK   GS
Sbjct  414   ILSSSDSPYNFVPGSYSVFSSKGTSDHHIVKVDMVKVDTGS  454



>ref|XP_009614907.1| PREDICTED: uncharacterized protein LOC104107733 [Nicotiana tomentosiformis]
Length=488

 Score =   502 bits (1292),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 259/342 (76%), Positives = 280/342 (82%), Gaps = 3/342 (1%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA---NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTN  1234
             AKS + RPKSILKQSPLHP+     L ++Q F KSKLRVSINLPDNEISLKKSGQL F  
Sbjct  118   AKSSNDRPKSILKQSPLHPSKEADTLLKKQAFAKSKLRVSINLPDNEISLKKSGQLSFLG  177

Query  1233  TFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEE  1054
                +               S        G+SYRSTRTV+EVLRELNAD+LALQDVKA EE
Sbjct  178   CDSERFLGSGICRGKAPLRSTVSMPRIDGQSYRSTRTVLEVLRELNADILALQDVKAVEE  237

Query  1053  REMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATID  874
             + MKPLSDLAA LGM Y FAESWAPEYGNAI+SKWPIKS K+QKIFDDSDFRNV+KATID
Sbjct  238   KGMKPLSDLAAALGMNYVFAESWAPEYGNAIMSKWPIKSWKIQKIFDDSDFRNVLKATID  297

Query  873   VPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIV  694
             VP VGE NF+CT LDHLDENWRMKQINA+IQSSD PHI+AGGLNSLDE DYSP+RW +IV
Sbjct  298   VPRVGEFNFYCTHLDHLDENWRMKQINAVIQSSDKPHIIAGGLNSLDETDYSPERWTDIV  357

Query  693   KYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIV  514
             KYYEEMGKPTPKVEVMK+LKSK+Y DAKDF GECESVVMIAKGQ VQGTCKYGTRVDYI+
Sbjct  358   KYYEEMGKPTPKVEVMKHLKSKEYTDAKDFAGECESVVMIAKGQSVQGTCKYGTRVDYIL  417

Query  513   SSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGSGCH  388
             SS DS YKFVPGSYSV SSKGTSDHHIVKVD+VK   GS  H
Sbjct  418   SSSDSPYKFVPGSYSVFSSKGTSDHHIVKVDMVKVDTGSQQH  459



>ref|XP_002321050.1| hypothetical protein POPTR_0014s13270g [Populus trichocarpa]
 gb|EEE99365.1| hypothetical protein POPTR_0014s13270g [Populus trichocarpa]
Length=449

 Score =   494 bits (1272),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 260/376 (69%), Positives = 301/376 (80%), Gaps = 27/376 (7%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQF  1240
             AKS + RPKSILKQSPLHPN+     NLS+QQ+F KSKLRVSINLPDNEISL ++ QL  
Sbjct  95    AKSANDRPKSILKQSPLHPNSIDGNENLSKQQKFAKSKLRVSINLPDNEISLLRNRQL--  152

Query  1239  TNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAE  1060
               +F +DE +G     ++S  S                TV++VL+EL+AD+LALQDVKAE
Sbjct  153   --SFREDEKEGASSVNIKSYRSTR--------------TVLQVLKELDADILALQDVKAE  196

Query  1059  EEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKAT  880
             EE+ MKPLSDLAA LGM Y FAESWAPEYGNAILSKWPIK  KVQKIFDD+DFRNV+KAT
Sbjct  197   EEKAMKPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKRWKVQKIFDDTDFRNVLKAT  256

Query  879   IDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAE  700
             IDVP+ GE+NF CT LDHLDENWRMKQI+AIIQSSD PHILAGGLNSLDE DYS +RW +
Sbjct  257   IDVPQAGEVNFHCTHLDHLDENWRMKQIDAIIQSSDAPHILAGGLNSLDETDYSEERWTD  316

Query  699   IVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDY  520
             IVKYYEEMGKPTPKVEVM ++KSK Y DAKD+ GECE+VV++AKGQ VQGTCKYGTRVDY
Sbjct  317   IVKYYEEMGKPTPKVEVMSFMKSKHYTDAKDYAGECEAVVILAKGQNVQGTCKYGTRVDY  376

Query  519   IVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGSGCHHrrridrkkqqkkriv  340
             I++SP+S YKFVPGSYSV SSKGTSDHHIVKVD+VKA     C  + ++ RKK+Q K+ V
Sbjct  377   ILASPNSPYKFVPGSYSVFSSKGTSDHHIVKVDIVKA----RCSSQEKVARKKRQPKQKV  432

Query  339   kkITNSNLSMGIRKTQ  292
              KITNS+ + GI KT 
Sbjct  433   VKITNSSPTKGIWKTH  448



>emb|CBI32311.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   491 bits (1263),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 249/336 (74%), Positives = 275/336 (82%), Gaps = 23/336 (7%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQF  1240
              KS + RPKSILKQSPLHPN+     NLS+QQ+F KSK RVSINLPDNEISL ++ +L F
Sbjct  44    TKSANERPKSILKQSPLHPNSMILPENLSKQQKFAKSKPRVSINLPDNEISLGRNRKLSF  103

Query  1239  TNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAE  1060
                  + EG                   + G +YRS RTVVEVLREL+AD+LALQDVKAE
Sbjct  104   VE---EKEG---------------LEKVTEGEAYRSRRTVVEVLRELDADILALQDVKAE  145

Query  1059  EEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKAT  880
             EE+ MKPLSDLAA LGM Y FAESWAPEYGNAILSKWPIK  KVQKIFDD+DFRNV+KAT
Sbjct  146   EEKAMKPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKRWKVQKIFDDTDFRNVLKAT  205

Query  879   IDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAE  700
             IDVP+ GE+NF CT LDHLDENWRMKQIN+IIQS++ PHILAGGLNSLDE DYS +RW +
Sbjct  206   IDVPQAGEVNFHCTHLDHLDENWRMKQINSIIQSNEGPHILAGGLNSLDETDYSSERWTD  265

Query  699   IVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDY  520
             IVKYYEEMGKPTPKVEVMK+LKSKQY DAKDF GECESVVMIAKGQ VQGTCKYGTRVDY
Sbjct  266   IVKYYEEMGKPTPKVEVMKFLKSKQYTDAKDFAGECESVVMIAKGQSVQGTCKYGTRVDY  325

Query  519   IVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             I++SP S YKFVPGSYSV SSKGTSDHHIVKVD+ K
Sbjct  326   ILASPSSPYKFVPGSYSVFSSKGTSDHHIVKVDIAK  361



>emb|CDP03587.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   493 bits (1269),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 251/350 (72%), Positives = 286/350 (82%), Gaps = 14/350 (4%)
 Frame = -1

Query  1404  AKSMDHRP-KSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQ  1243
             AKSM+ RP KSILKQSPLH ++     +L++QQ+F +SKLRVSINLPDNEISL++SG L 
Sbjct  122   AKSMNGRPPKSILKQSPLHSSSMREPDSLTKQQKFARSKLRVSINLPDNEISLRRSGHLS  181

Query  1242  FTNTFLDDE--GDgrgksplrsssslnfssssagr------syrstRTVVEVLRELNADV  1087
             F     ++E  G+      L+  + L  + S          ++R+TR +VEVLRELNAD+
Sbjct  182   FRRDEKEEEYLGNSSISRVLKGKAPLRSTMSMPSSPIANGQNHRNTRAIVEVLRELNADI  241

Query  1086  LALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDS  907
             LALQDVKAEEER M+PLSDLAA LGM Y FAESWAPEYGNAILS++PIK  K QKIFDD+
Sbjct  242   LALQDVKAEEERGMQPLSDLAAALGMTYVFAESWAPEYGNAILSRYPIKRWKAQKIFDDA  301

Query  906   DFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEA  727
             DFRNV+KATIDVP +GE+NF+CT LDHLDENWRMKQINAIIQS+D PHILAGGLNSLDE+
Sbjct  302   DFRNVLKATIDVPHIGELNFYCTHLDHLDENWRMKQINAIIQSTDAPHILAGGLNSLDES  361

Query  726   DYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGT  547
             DYSP+RW +IVKYYEEMGKPTPKVEVMKYLKSKQY DAK F GECESVVMIAKGQ VQGT
Sbjct  362   DYSPERWTDIVKYYEEMGKPTPKVEVMKYLKSKQYTDAKHFAGECESVVMIAKGQSVQGT  421

Query  546   CKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGS  397
             CKYGTRVDYI+SSP   YKFVPGSYSV SSKGTSDHHIVKVDV+K    S
Sbjct  422   CKYGTRVDYILSSPSCPYKFVPGSYSVFSSKGTSDHHIVKVDVIKVADSS  471



>ref|XP_004247482.1| PREDICTED: uncharacterized protein LOC101265861 [Solanum lycopersicum]
Length=494

 Score =   493 bits (1268),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 252/334 (75%), Positives = 270/334 (81%), Gaps = 4/334 (1%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHPNAN----LSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTN  1234
             KS + RPKSILKQSPLHP       L ++Q F KSKLRVSINLPDNEISLKKSGQL+   
Sbjct  124   KSANDRPKSILKQSPLHPTKETDTLLLKRQNFSKSKLRVSINLPDNEISLKKSGQLRILG  183

Query  1233  TFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEE  1054
                +               S         +SYR TR+V+EVLRELNAD+LALQDVKAEEE
Sbjct  184   CDSERFSGSGICRGKSPLRSTVSMPRIDCQSYRITRSVLEVLRELNADILALQDVKAEEE  243

Query  1053  REMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATID  874
             + MKPLSDLA  LGM Y FAESWAPEYGNAI+SKWPIKS  +QKIFDDSDFRNV+KATID
Sbjct  244   KGMKPLSDLADALGMNYVFAESWAPEYGNAIMSKWPIKSWNIQKIFDDSDFRNVLKATID  303

Query  873   VPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIV  694
             VP VGE+NFFCT LDHLDENWRMKQINAIIQSSD PHILAGGLNSLDE DYS +RW EIV
Sbjct  304   VPRVGELNFFCTHLDHLDENWRMKQINAIIQSSDKPHILAGGLNSLDETDYSTERWTEIV  363

Query  693   KYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIV  514
             KYYEEMGKP PK EVMKYLKSK+Y DAKDF GECESVVMIAKGQ VQGTCKYGTRVDYI+
Sbjct  364   KYYEEMGKPIPKFEVMKYLKSKEYTDAKDFAGECESVVMIAKGQSVQGTCKYGTRVDYIL  423

Query  513   SSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             SS DS YKFVPGSYSV SSKGTSDHHIVKVD+VK
Sbjct  424   SSSDSPYKFVPGSYSVFSSKGTSDHHIVKVDLVK  457



>ref|XP_002271044.2| PREDICTED: uncharacterized protein LOC100247717 [Vitis vinifera]
Length=511

 Score =   493 bits (1270),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 250/345 (72%), Positives = 277/345 (80%), Gaps = 18/345 (5%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFT  1237
             KS + RPKSILKQSPLHPN+     NLS+QQ+F KSK RVSINLPDNEISL ++ +L F 
Sbjct  134   KSANERPKSILKQSPLHPNSMILPENLSKQQKFAKSKPRVSINLPDNEISLGRNRKLSFV  193

Query  1236  NTFLDDEGDgrgk----------splrsssslnfssssagrsyrstRTVVEVLRELNADV  1087
                 + EG                    S   +    + G +YRS RTVVEVLREL+AD+
Sbjct  194   E---EKEGSSSSTIGRILRGKAPLRSTVSFPASLEKVTEGEAYRSRRTVVEVLRELDADI  250

Query  1086  LALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDS  907
             LALQDVKAEEE+ MKPLSDLAA LGM Y FAESWAPEYGNAILSKWPIK  KVQKIFDD+
Sbjct  251   LALQDVKAEEEKAMKPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKRWKVQKIFDDT  310

Query  906   DFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEA  727
             DFRNV+KATIDVP+ GE+NF CT LDHLDENWRMKQIN+IIQS++ PHILAGGLNSLDE 
Sbjct  311   DFRNVLKATIDVPQAGEVNFHCTHLDHLDENWRMKQINSIIQSNEGPHILAGGLNSLDET  370

Query  726   DYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGT  547
             DYS +RW +IVKYYEEMGKPTPKVEVMK+LKSKQY DAKDF GECESVVMIAKGQ VQGT
Sbjct  371   DYSSERWTDIVKYYEEMGKPTPKVEVMKFLKSKQYTDAKDFAGECESVVMIAKGQSVQGT  430

Query  546   CKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             CKYGTRVDYI++SP S YKFVPGSYSV SSKGTSDHHIVKVD+ K
Sbjct  431   CKYGTRVDYILASPSSPYKFVPGSYSVFSSKGTSDHHIVKVDIAK  475



>ref|XP_006358440.1| PREDICTED: uncharacterized protein LOC102606004 [Solanum tuberosum]
Length=494

 Score =   492 bits (1266),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 251/334 (75%), Positives = 270/334 (81%), Gaps = 4/334 (1%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHPNAN----LSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTN  1234
             KS + RPKSILKQSPLHP       L ++Q F KSKLRVSINLPDNEISLKKSGQL+   
Sbjct  124   KSANDRPKSILKQSPLHPTNETDTILLKRQSFSKSKLRVSINLPDNEISLKKSGQLRILG  183

Query  1233  TFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEE  1054
                +               S         +SYR TR+V+EVLRELNAD+LALQDVKAEEE
Sbjct  184   CDSERYSGSGICRGKAPLRSTVSMPRIDCQSYRITRSVLEVLRELNADILALQDVKAEEE  243

Query  1053  REMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATID  874
             + MKPLSDLA  LGM Y FAESWAPEYGNAI+SKWPIKS  +QKIFDDSDFRNV+KATID
Sbjct  244   KGMKPLSDLADALGMNYVFAESWAPEYGNAIMSKWPIKSWNIQKIFDDSDFRNVLKATID  303

Query  873   VPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIV  694
             VP VGE+NFFCT LDHLDENWRMKQINAIIQSSD PHILAGGLNSLDE DYS +RW EIV
Sbjct  304   VPRVGELNFFCTHLDHLDENWRMKQINAIIQSSDKPHILAGGLNSLDETDYSTERWTEIV  363

Query  693   KYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIV  514
             KYYEEMGKP PK EVMKYLKSK+Y DAKDF GECESVVMIAKGQ VQGTCKYGTRVDY++
Sbjct  364   KYYEEMGKPIPKFEVMKYLKSKEYTDAKDFAGECESVVMIAKGQSVQGTCKYGTRVDYVL  423

Query  513   SSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             SS DS YKFVPGSYSV SSKGTSDHHIVKVD+VK
Sbjct  424   SSSDSPYKFVPGSYSVFSSKGTSDHHIVKVDLVK  457



>ref|XP_007200980.1| hypothetical protein PRUPE_ppa004558mg [Prunus persica]
 gb|EMJ02179.1| hypothetical protein PRUPE_ppa004558mg [Prunus persica]
Length=503

 Score =   488 bits (1256),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 253/361 (70%), Positives = 286/361 (79%), Gaps = 21/361 (6%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQF  1240
             AKS++ RPKSILKQSPLHPN+     NLS+QQ+F KSKLRVSINLPDNEISL ++ QL F
Sbjct  114   AKSVNDRPKSILKQSPLHPNSMNNTENLSKQQKFVKSKLRVSINLPDNEISLLRNRQLSF  173

Query  1239  T----------------NTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVL  1108
             +                 T L         S +   +++   ++  G  YRS RTV++VL
Sbjct  174   SEGGGGKEDSSCPSSSGKTRLLRGKAPLRSSSVSFCANIGNRTADGGEFYRSHRTVLDVL  233

Query  1107  RELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKV  928
             REL+AD+LALQDVKAEEE+ MKPLSDLAA LGM Y FAESWAPEYGNAILSKWPIK  KV
Sbjct  234   RELDADILALQDVKAEEEKAMKPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKRSKV  293

Query  927   QKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGG  748
             QKIFDD+DFRNV+KATIDVPE GE+NF CT LDHLDENWRM+QINAIIQSS+ PHILAGG
Sbjct  294   QKIFDDTDFRNVLKATIDVPEAGEVNFHCTHLDHLDENWRMRQINAIIQSSNEPHILAGG  353

Query  747   LNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAK  568
             LNSLDE+DYS +RW +IVKYYEEMGKP PKVEVM+YLKSKQY DAKDF GE ESVVMIAK
Sbjct  354   LNSLDESDYSQERWTDIVKYYEEMGKPRPKVEVMRYLKSKQYTDAKDFEGEYESVVMIAK  413

Query  567   GQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGSGCH  388
             GQ VQGTCKYGTRVDYI++S +S YKFVPGSYSV SSKGTSDHHIV+VDV+K   G G  
Sbjct  414   GQSVQGTCKYGTRVDYILASSNSPYKFVPGSYSVFSSKGTSDHHIVRVDVIKVDNGVGED  473

Query  387   H  385
             H
Sbjct  474   H  474



>ref|XP_008234930.1| PREDICTED: uncharacterized protein LOC103333818 [Prunus mume]
Length=522

 Score =   487 bits (1254),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 253/360 (70%), Positives = 286/360 (79%), Gaps = 20/360 (6%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQF  1240
             AKS++ RPKSILKQSPLHPN+     NLS+QQ+F KSKLRVSINLPDNEISL ++ QL F
Sbjct  134   AKSVNDRPKSILKQSPLHPNSMNNTENLSKQQKFVKSKLRVSINLPDNEISLLRNRQLNF  193

Query  1239  T---------------NTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLR  1105
             +                T L         S +   +++   ++  G  YRS RTV++VLR
Sbjct  194   SEGGGKEDSSCPSSTGKTRLLRGKAPLRSSSVSFCANIGNGTADGGEFYRSHRTVLDVLR  253

Query  1104  ELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQ  925
             EL+AD+LALQDVKAEEE+ MKPLSDLAA LGM Y FAESWAPEYGNAILSKWPIK  KVQ
Sbjct  254   ELDADILALQDVKAEEEKAMKPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKRSKVQ  313

Query  924   KIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGL  745
             KIFDD+DFRNV+KATIDVPE GE+NF CT LDHLDENWRM+QINAIIQSS+ PHILAGGL
Sbjct  314   KIFDDTDFRNVLKATIDVPEAGEVNFHCTHLDHLDENWRMRQINAIIQSSNEPHILAGGL  373

Query  744   NSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKG  565
             NSLDE+DYS +RW +IVKYYEEMGKP PKVEVM+YLKSKQY DAKDF GE ESVVMIAKG
Sbjct  374   NSLDESDYSQERWTDIVKYYEEMGKPRPKVEVMRYLKSKQYTDAKDFEGEYESVVMIAKG  433

Query  564   QCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGSGCHH  385
             Q VQGTCKYGTRVDYI++S +S YKFVPGSYSV SSKGTSDHHIV+VDV+K   G G  H
Sbjct  434   QSVQGTCKYGTRVDYILASSNSPYKFVPGSYSVFSSKGTSDHHIVRVDVIKVDNGVGEDH  493



>ref|XP_011033662.1| PREDICTED: uncharacterized protein LOC105132076 [Populus euphratica]
Length=518

 Score =   487 bits (1253),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 263/386 (68%), Positives = 302/386 (78%), Gaps = 19/386 (5%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQF  1240
             A+S + RPKSILKQSPLHPN      NLS+QQ+F KSKLRVSINLPDNEISL ++ QL F
Sbjct  136   AQSANDRPKSILKQSPLHPNCIDGNENLSKQQKFAKSKLRVSINLPDNEISLLRNRQLSF  195

Query  1239  ----------TNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNAD  1090
                        N      G    +    S +    +    G SYRSTRTV++VL+EL+AD
Sbjct  196   REEEKEGASSVNISRILRGKAPMRPKSVSFARNTGNDGIDGESYRSTRTVLQVLKELDAD  255

Query  1089  VLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDD  910
             +LALQDVKAEEE+ MKPLSDLAA LGM Y FAESWAPEYGNAILSKWPIK  KVQKIFDD
Sbjct  256   ILALQDVKAEEEKAMKPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKRWKVQKIFDD  315

Query  909   SDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDE  730
             +DFRNV+KATIDVP+ GE+NF CT LDHLDENWRMKQI+AIIQSSD PHILAGGLNSLDE
Sbjct  316   TDFRNVLKATIDVPKAGEVNFHCTHLDHLDENWRMKQIDAIIQSSDAPHILAGGLNSLDE  375

Query  729   ADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQG  550
              DYS +RW +IVKYYEEMGKPTPKVEVM ++KSK Y DAKD+ GECESVV++AKGQ VQG
Sbjct  376   TDYSEERWTDIVKYYEEMGKPTPKVEVMSFMKSKHYSDAKDYAGECESVVILAKGQNVQG  435

Query  549   TCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGSGCHHrrrid  370
             TCKYGTRVDYI++SP+S YKFVPGSYSV SSKGTSDHHIVKVD+VKA     C  + +  
Sbjct  436   TCKYGTRVDYILASPNSPYKFVPGSYSVFSSKGTSDHHIVKVDIVKA----RCSSQEKTA  491

Query  369   rkkqqkkrivkkITNSNLSMGIRKTQ  292
             RKK+Q K+ V K+T+S+ + GI KT 
Sbjct  492   RKKRQPKQKVVKVTDSSPTKGIWKTH  517



>gb|KHG01957.1| putative ybhP [Gossypium arboreum]
Length=489

 Score =   484 bits (1245),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 245/333 (74%), Positives = 276/333 (83%), Gaps = 6/333 (2%)
 Frame = -1

Query  1392  DHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTF  1228
             DHRPK ILKQSPLHPN+     +L++QQ+F KSKLRVSINLPDNEISL ++ QL F+   
Sbjct  120   DHRPKGILKQSPLHPNSMNENDSLTKQQKFVKSKLRVSINLPDNEISLLRNRQLSFSEN-  178

Query  1227  LDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEERE  1048
               + G  R      S S+   +       YRS +TV+EVLREL+AD+L LQDVKAEEE+ 
Sbjct  179   EKEGGGRRRCKAPVSFSTDLGNWFDDWEGYRSRKTVLEVLRELDADILGLQDVKAEEEKG  238

Query  1047  MKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVP  868
             M+PLSDLAA LGM Y FAESWAPEYGNA+LSKWPIK  KVQKIFDD+DFRNV+KATIDVP
Sbjct  239   MRPLSDLAAALGMNYVFAESWAPEYGNAVLSKWPIKRWKVQKIFDDADFRNVLKATIDVP  298

Query  867   EVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKY  688
             + GEI+F CT LDHLDENWRMKQINAIIQS D PHILAGGLNSL+E DYS +RW +IVKY
Sbjct  299   QTGEIDFHCTQLDHLDENWRMKQINAIIQSDDGPHILAGGLNSLEETDYSTERWTDIVKY  358

Query  687   YEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSS  508
             YEE+GKPTPKVEVMKYLK+KQY DAKDF GECE VV+IAKGQ VQGTCKYGTRVDYI++S
Sbjct  359   YEEIGKPTPKVEVMKYLKNKQYTDAKDFAGECEPVVVIAKGQSVQGTCKYGTRVDYILAS  418

Query  507   PDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             P+S YKFVPGSYSVLSSKGTSDHHIVKVDVVK 
Sbjct  419   PNSPYKFVPGSYSVLSSKGTSDHHIVKVDVVKT  451



>ref|XP_007050713.1| DNAse I-like superfamily protein [Theobroma cacao]
 gb|EOX94870.1| DNAse I-like superfamily protein [Theobroma cacao]
Length=515

 Score =   484 bits (1247),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 247/345 (72%), Positives = 281/345 (81%), Gaps = 14/345 (4%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQF  1240
             AKS + RPKSILKQSP+HPN+     NLS QQ+F KSKLRVSINLPDNEISL ++ QL F
Sbjct  134   AKSTNDRPKSILKQSPMHPNSINDKENLSNQQKFVKSKLRVSINLPDNEISLLRNRQLSF  193

Query  1239  TNTFLDDEGDgrgksplrsssslnfssssagr---------syrstRTVVEVLRELNADV  1087
                  +    G G   LR  + L  + S +            YRS +TV+EVLREL+AD+
Sbjct  194   AERGKEGSSSGGGSRILRGKAPLRSTVSFSTNMGNGVDSFERYRSRKTVLEVLRELDADI  253

Query  1086  LALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDS  907
             LALQDVKAEEE+ MKPLSDLAA LGM Y FAESWAPEYGNA+LSKWPIK  KVQKIFDD+
Sbjct  254   LALQDVKAEEEKAMKPLSDLAAALGMNYVFAESWAPEYGNAVLSKWPIKRWKVQKIFDDT  313

Query  906   DFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEA  727
             DFRNV+KATIDVP+ GE++F CT LDHLDENWRMKQINAIIQS+D PHILAGGLNSL+E 
Sbjct  314   DFRNVLKATIDVPQAGEVDFHCTHLDHLDENWRMKQINAIIQSNDGPHILAGGLNSLEET  373

Query  726   DYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGT  547
             DYS +RW +IVKYYEEMGKP PKVEVMK+LK+KQY DAKDF GECE VV+IAKGQ VQGT
Sbjct  374   DYSTERWTDIVKYYEEMGKPIPKVEVMKFLKNKQYTDAKDFAGECEPVVVIAKGQSVQGT  433

Query  546   CKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             CKYGTRVDYI++SP+S YKFVPGSYSVLSSKGTSDHH+VKVD++K
Sbjct  434   CKYGTRVDYILASPNSPYKFVPGSYSVLSSKGTSDHHMVKVDIIK  478



>ref|XP_006444162.1| hypothetical protein CICLE_v10019778mg [Citrus clementina]
 ref|XP_006479801.1| PREDICTED: uncharacterized protein LOC102610998 [Citrus sinensis]
 gb|ESR57402.1| hypothetical protein CICLE_v10019778mg [Citrus clementina]
 gb|KDO87487.1| hypothetical protein CISIN_1g010500mg [Citrus sinensis]
Length=509

 Score =   483 bits (1243),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 246/342 (72%), Positives = 277/342 (81%), Gaps = 10/342 (3%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQF  1240
             AKS+  RPKSILKQSPLH ++     NLS+QQ+F KSKLRVSINLPDNEISL ++ QL F
Sbjct  128   AKSVIDRPKSILKQSPLHSSSVNGTENLSKQQKFAKSKLRVSINLPDNEISLLRNRQLSF  187

Query  1239  TNTFLDDEGDgrgksp---lrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDV  1069
                  D+      +          S     +S+  S  STRTV+EVLREL+AD+LALQDV
Sbjct  188   REEDKDEPSSSAVRRILRGKAPLKSSVSFPTSSIASVGSTRTVLEVLRELDADLLALQDV  247

Query  1068  KAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVM  889
             KAEEE  MKPLSDLAA LGM Y FAESWAPEYGNA+LSKWPIK  KVQKIFDD+DFRNV+
Sbjct  248   KAEEENSMKPLSDLAAALGMNYVFAESWAPEYGNAVLSKWPIKRWKVQKIFDDTDFRNVL  307

Query  888   KATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSD--TPHILAGGLNSLDEADYSP  715
             KAT+DVP++GE+NF CT LDHLDENWRMKQ+NAIIQS+D    HILAG LNSLDE DYS 
Sbjct  308   KATVDVPQIGEVNFHCTHLDHLDENWRMKQMNAIIQSNDHGEAHILAGALNSLDETDYSS  367

Query  714   QRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYG  535
             +RW +IVKYYEEMGKPTPKVEVMK+LKSKQY D+KDF GECESVVMIAKGQ VQGTCKYG
Sbjct  368   ERWTDIVKYYEEMGKPTPKVEVMKFLKSKQYTDSKDFAGECESVVMIAKGQSVQGTCKYG  427

Query  534   TRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             TRVDYI++SP+S YKFVPGSYSV SSKGTSDHHIVKVD+ KA
Sbjct  428   TRVDYILASPNSPYKFVPGSYSVFSSKGTSDHHIVKVDITKA  469



>ref|XP_002524784.1| hydrolase, putative [Ricinus communis]
 gb|EEF37627.1| hydrolase, putative [Ricinus communis]
Length=523

 Score =   483 bits (1243),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 258/385 (67%), Positives = 294/385 (76%), Gaps = 15/385 (4%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHP-----NANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQF  1240
              +S + RPKSILKQSPLHP     N NLSEQQ+F KSKLRVSINLPDNEISL ++ QL F
Sbjct  139   TRSANDRPKSILKQSPLHPSSTNGNENLSEQQKFAKSKLRVSINLPDNEISLLRNRQLSF  198

Query  1239  ---------TNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADV  1087
                      ++                + SS N  +     +YRS RTVVEVL+EL+AD+
Sbjct  199   VKDGEEANSSSNLTRSLRGKAPVRSQSAISSRNVVNGVDRDNYRSRRTVVEVLKELDADI  258

Query  1086  LALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDS  907
             LALQDVKAEEE+EMKPLSDLAA LGM Y FAESWAPEYGNAILSKWPIK  +VQKIFDD+
Sbjct  259   LALQDVKAEEEKEMKPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKRWEVQKIFDDT  318

Query  906   DFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEA  727
             DFRNV+KATID P+ GE+N +CT LDHLDENWRMKQINAIIQS+D PHILAGGLNSLDE 
Sbjct  319   DFRNVLKATIDAPQKGEVNLYCTHLDHLDENWRMKQINAIIQSTDGPHILAGGLNSLDET  378

Query  726   DYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGT  547
             DYS +RW +IVKY+EE+GKPTPKVEVM +LKSK Y DAK+F GECESVVMIAKGQ VQGT
Sbjct  379   DYSAERWTDIVKYHEEIGKPTPKVEVMGFLKSKHYTDAKEFAGECESVVMIAKGQNVQGT  438

Query  546   CKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGSGCHHrrridr  367
             CKYGTRVDYI++S +S YKFVPGSYSV SSKGTSDHHIVKVD+VK V  S         +
Sbjct  439   CKYGTRVDYILASSNSPYKFVPGSYSVYSSKGTSDHHIVKVDIVK-VSSSSSDRENVARK  497

Query  366   kkqqkkrivkkITNSNLSMGIRKTQ  292
             ++Q  K  V +ITNS+ S GI K  
Sbjct  498   RRQPPKHKVVRITNSSPSKGIWKAH  522



>ref|XP_008386588.1| PREDICTED: uncharacterized protein LOC103449088 [Malus domestica]
Length=492

 Score =   481 bits (1237),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 246/341 (72%), Positives = 279/341 (82%), Gaps = 12/341 (4%)
 Frame = -1

Query  1398  SMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTN  1234
             S   RPKSILKQSPLHPN+     NL++QQ+F KSKLRVSINLPDNEISL K+ QL F+ 
Sbjct  114   SGSERPKSILKQSPLHPNSMNNSDNLTKQQKFSKSKLRVSINLPDNEISLLKNRQLSFSE  173

Query  1233  TFLDDEG-------DgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQ  1075
                 ++             S +R S  L   +++ G  Y S RTV+EVLRE++ADVLALQ
Sbjct  174   GRAKEDAFSPVTGKSPLRSSSVRFSGVLRSGAAADGDLYTSHRTVLEVLREMDADVLALQ  233

Query  1074  DVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRN  895
             DVKAEEE++MKPLSDLAA LGM Y FAESWAPEYGNAILSKWPIK  K+ KIFDD+DFRN
Sbjct  234   DVKAEEEKDMKPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKRSKIVKIFDDTDFRN  293

Query  894   VMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSP  715
             V+KATIDVPE GE+NF CT LDHLDE+WRM+QINAIIQSS+ PHILAGGLNSLDE+DYS 
Sbjct  294   VLKATIDVPEAGEVNFHCTHLDHLDESWRMRQINAIIQSSNEPHILAGGLNSLDESDYSQ  353

Query  714   QRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYG  535
             +RW +IVKYYE+MGKP PKVEVM+YLKSKQY DAKDF GE ESVVMIAKGQ VQGTCKYG
Sbjct  354   ERWTDIVKYYEDMGKPRPKVEVMRYLKSKQYTDAKDFEGEYESVVMIAKGQSVQGTCKYG  413

Query  534   TRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             TRVDYI++S +S YKFVPGSYSV SSKGTSDHHIV+VDVVK
Sbjct  414   TRVDYILASANSPYKFVPGSYSVFSSKGTSDHHIVRVDVVK  454



>gb|KDP21522.1| hypothetical protein JCGZ_21993 [Jatropha curcas]
Length=498

 Score =   481 bits (1238),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 246/345 (71%), Positives = 277/345 (80%), Gaps = 10/345 (3%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNAN-----LSEQQRFPKSKLRVSINLPDNEISLKKSGQLQF  1240
              KS + RPKSILK SPLHPN+      L +QQ++ KSKLRVSINLPDNEISL ++ QL F
Sbjct  116   TKSANDRPKSILKPSPLHPNSMNSNEILPKQQKYAKSKLRVSINLPDNEISLLRNRQLGF  175

Query  1239  TN-----TFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQ  1075
                    T          +      S    S  +   SYRSTRTV+EVL+EL+AD+LALQ
Sbjct  176   AEEKEKETTSASNLTRILRGKAPMRSQSARSIGNEVESYRSTRTVLEVLKELDADILALQ  235

Query  1074  DVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRN  895
             DVKAEEE+ MKPLSDLA+ LGM Y FAESWAPEYGNAILSKWPIK  +VQKIFDD+DFRN
Sbjct  236   DVKAEEEKAMKPLSDLASALGMNYVFAESWAPEYGNAILSKWPIKKWRVQKIFDDTDFRN  295

Query  894   VMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSP  715
             V+KATIDVPE GE+NF+CT LDHLDENWRMKQINAIIQS+D PHILAGGLNSLDE DYS 
Sbjct  296   VLKATIDVPEKGELNFYCTHLDHLDENWRMKQINAIIQSNDGPHILAGGLNSLDETDYSA  355

Query  714   QRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYG  535
             +RW +IVKYYEEMGKPTPKVEVM++LKSK Y DAK+F GECESVVMIAKGQ VQGTCKYG
Sbjct  356   ERWTDIVKYYEEMGKPTPKVEVMRFLKSKHYSDAKEFAGECESVVMIAKGQNVQGTCKYG  415

Query  534   TRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGG  400
             TRVDYI++S +S YKFVPGSYSV SSKGTSDHHIVKVD++K  GG
Sbjct  416   TRVDYILASSNSPYKFVPGSYSVFSSKGTSDHHIVKVDMIKMNGG  460



>gb|KHG02831.1| putative ybhP [Gossypium arboreum]
Length=523

 Score =   481 bits (1238),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 244/345 (71%), Positives = 278/345 (81%), Gaps = 14/345 (4%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQF  1240
             AKS + RPKSILKQSPLHP++     NLS+Q++F KSKLRVSINLPDNEISL ++ QL F
Sbjct  138   AKSTNDRPKSILKQSPLHPSSMNNKENLSQQKKFVKSKLRVSINLPDNEISLLRNRQLSF  197

Query  1239  TNTFLDDEGDgrgksplrsssslnfssssagr---------syrstRTVVEVLRELNADV  1087
                  D           R  + L    S             SYRS +TV+EVLREL+AD+
Sbjct  198   AEMGKDGSSSAAAGKAWRGKAPLRSVVSFPTNMGNGIEGCESYRSRKTVLEVLRELDADI  257

Query  1086  LALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDS  907
             LALQDVKAEEE+ MKPLSDLAA LGM Y FAESWAPEYGNA+LSKWPIK  KVQKIFDD+
Sbjct  258   LALQDVKAEEEKAMKPLSDLAAALGMNYVFAESWAPEYGNAVLSKWPIKRWKVQKIFDDT  317

Query  906   DFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEA  727
             DFRNV+KATIDVPE GE++F CT LDHLDENWRMKQINAIIQS+D PHILAGGLNSL+E 
Sbjct  318   DFRNVLKATIDVPETGEVDFHCTHLDHLDENWRMKQINAIIQSNDGPHILAGGLNSLEET  377

Query  726   DYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGT  547
             DYS +RW +I+KYYEEMGKP PKVEVMK+L+++QY DAKDF GECE VV+IAKGQ VQGT
Sbjct  378   DYSKERWTDIIKYYEEMGKPIPKVEVMKFLRNEQYTDAKDFAGECEPVVVIAKGQSVQGT  437

Query  546   CKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             CKYGTRVDYI++SP+S YKFVPGSYSVLSSKGTSDHHIVKVD++K
Sbjct  438   CKYGTRVDYILASPNSPYKFVPGSYSVLSSKGTSDHHIVKVDMIK  482



>ref|XP_004290695.1| PREDICTED: uncharacterized protein LOC101302029 [Fragaria vesca 
subsp. vesca]
Length=495

 Score =   479 bits (1234),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 247/350 (71%), Positives = 272/350 (78%), Gaps = 17/350 (5%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFT  1237
             KS   RPKSILKQSPLHPNA     N   QQ+F KSK+RVSINLPDNEISL KS QL F 
Sbjct  112   KSAMDRPKSILKQSPLHPNAMKSSENQKTQQKFVKSKMRVSINLPDNEISLLKSRQLSFA  171

Query  1236  NTFLDDEGDgrgksplrsssslnfssssagrsy------------rstRTVVEVLRELNA  1093
                  D  +          S        +                 S RTV+EVLREL+A
Sbjct  172   EGRELDTSNSLSSFSPSRVSKGKGPLKPSVSFPNNIGNCENGEYYTSHRTVLEVLRELDA  231

Query  1092  DVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFD  913
             D+LALQDVKAEEE+EMKPLSDLAA LGM Y FAESWAPEYGNAILSKWPIK  KVQKIFD
Sbjct  232   DILALQDVKAEEEKEMKPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKRSKVQKIFD  291

Query  912   DSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLD  733
             DSDFRNV+KATIDVP+ GE+NF CT LDHLDENWRM+Q+NAIIQSS+ PHILAGGLNSL+
Sbjct  292   DSDFRNVLKATIDVPQAGEVNFQCTHLDHLDENWRMRQVNAIIQSSNEPHILAGGLNSLE  351

Query  732   EADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQ  553
             E+DYS +RW +IVKYYEEMGKPTPKVEVM+YLKSKQY DAKDF GE ESVVMIAKGQ VQ
Sbjct  352   ESDYSQERWTDIVKYYEEMGKPTPKVEVMRYLKSKQYTDAKDFEGEYESVVMIAKGQSVQ  411

Query  552   GTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVG  403
             GTCKYGTRVDYI++S +S YKFVPGSYSV SSKGTSDHHIV+VDV+K+V 
Sbjct  412   GTCKYGTRVDYILASSNSPYKFVPGSYSVFSSKGTSDHHIVRVDVLKSVS  461



>ref|XP_010279198.1| PREDICTED: uncharacterized protein LOC104613175 [Nelumbo nucifera]
Length=510

 Score =   479 bits (1234),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 241/346 (70%), Positives = 283/346 (82%), Gaps = 17/346 (5%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQF  1240
             AK ++ RPKSILKQSPL+PN+     +LS Q++F KSKLRVSINLPDNEISLK+S QL F
Sbjct  131   AKFVNDRPKSILKQSPLYPNSLTSPEHLSRQKKFAKSKLRVSINLPDNEISLKRSRQLSF  190

Query  1239  ----------TNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNAD  1090
                        +T  +  G  +       S   +  +   G+++RS+RT++EVLRE++AD
Sbjct  191   DEEDRKGSSSNSTIRNQRG--KAPLKSSFSLPSSIRTGGDGKNFRSSRTILEVLREVDAD  248

Query  1089  VLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDD  910
             +LALQDVKAEEE+ MKPLSDLA  LGM+Y FAESWAPEYGNA+LSKWPIK   VQKI+DD
Sbjct  249   ILALQDVKAEEEKGMKPLSDLANALGMRYVFAESWAPEYGNAVLSKWPIKRWHVQKIYDD  308

Query  909   SDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDE  730
             +DFRNV+KAT+DVP+ GE+NF CT LDHLDENWRMKQINAIIQS+D PHILAGGLNSLDE
Sbjct  309   TDFRNVLKATVDVPQAGEVNFNCTHLDHLDENWRMKQINAIIQSNDGPHILAGGLNSLDE  368

Query  729   ADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQG  550
              DYS +RW +IVKYYEE+GKPTPKVEVMK+LK KQY DAKD+ GECESVVMIAKGQ VQG
Sbjct  369   TDYSAERWMDIVKYYEEIGKPTPKVEVMKFLKGKQYVDAKDYSGECESVVMIAKGQNVQG  428

Query  549   TCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             TCKYGTRVDYI++SP S YKFVPGSYSV+SSKGTSDHHIVKVD++K
Sbjct  429   TCKYGTRVDYILTSPGSPYKFVPGSYSVISSKGTSDHHIVKVDIIK  474



>ref|XP_010107669.1| hypothetical protein L484_008386 [Morus notabilis]
 gb|EXC16580.1| hypothetical protein L484_008386 [Morus notabilis]
Length=495

 Score =   476 bits (1225),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 250/352 (71%), Positives = 280/352 (80%), Gaps = 25/352 (7%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNANLSE-----------QQRFPKSKLRVSINLPDNEISLKK  1258
             +KS++ RPKSILKQS LHPN+  S            QQ+F +SKLRVSINLPDNEISL +
Sbjct  111   SKSLNDRPKSILKQSRLHPNSMSSNNNNNNLDNLSNQQKFARSKLRVSINLPDNEISLLR  170

Query  1257  SGQLQFT----------NTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVL  1108
             + QL F+          + FL  +           S S N  S +   SYRSTRTV+EVL
Sbjct  171   NRQLSFSEDGKEGSSSISRFLRGKA----PLRSSVSFSANIGSGTDEDSYRSTRTVLEVL  226

Query  1107  RELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKV  928
             REL+ D+LALQDVKAEEE+ MKPLSDLA+ LGM Y FAESWAPEYGNAILSKWPIK  KV
Sbjct  227   RELDTDILALQDVKAEEEKAMKPLSDLASALGMNYVFAESWAPEYGNAILSKWPIKRWKV  286

Query  927   QKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGG  748
             QKIFDD+DFRNV+KATIDVP+VGEINF CT LDHLDENWRMKQINAIIQS++ PHIL GG
Sbjct  287   QKIFDDTDFRNVLKATIDVPQVGEINFHCTHLDHLDENWRMKQINAIIQSNNEPHILVGG  346

Query  747   LNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAK  568
             LNSL+E DYS +RW +IVKYYEEMGKPTPKVEVM+YLKSKQY DAKDF GECESVVMIAK
Sbjct  347   LNSLEETDYSQERWTDIVKYYEEMGKPTPKVEVMRYLKSKQYTDAKDFAGECESVVMIAK  406

Query  567   GQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             GQ VQGTCKYGTRVDYI++SP+S YKFVPGSYSV SSKGTSDHHIVKVD+ K
Sbjct  407   GQSVQGTCKYGTRVDYILASPNSPYKFVPGSYSVFSSKGTSDHHIVKVDIRK  458



>ref|XP_010242554.1| PREDICTED: uncharacterized protein LOC104586877 [Nelumbo nucifera]
 ref|XP_010242555.1| PREDICTED: uncharacterized protein LOC104586877 [Nelumbo nucifera]
Length=528

 Score =   472 bits (1214),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 236/347 (68%), Positives = 276/347 (80%), Gaps = 21/347 (6%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQF  1240
             AKS++ RPKSILKQSPL  N+     +LS QQ+FP+SKLRVSINLPDNEISLK+S +   
Sbjct  156   AKSVNDRPKSILKQSPLKSNSMSSPEHLSRQQKFPRSKLRVSINLPDNEISLKRSRRFS-  214

Query  1239  TNTFLDDEGDgrgksplrsssslnfssssagrsyr-----------stRTVVEVLRELNA  1093
                 LD+EG+G        S     + +                  ++RT++EVLRE++A
Sbjct  215   ----LDEEGEGSSSKSAIRSQRGKDAMNYESLPSSVTVGRDGESWRNSRTILEVLREVDA  270

Query  1092  DVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFD  913
             D+LALQDVKAEEE+ MKPLSDLA  LGM Y FAESWAPEYGNA+LSKWPIK   VQKI D
Sbjct  271   DILALQDVKAEEEKGMKPLSDLADALGMNYVFAESWAPEYGNAVLSKWPIKRWHVQKICD  330

Query  912   DSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLD  733
             D+DFRNV+KAT+DVP+ GE+NF CT LDHLDENWRMKQINAI+QS+D PHILAGGLNSLD
Sbjct  331   DTDFRNVLKATVDVPQAGEVNFNCTHLDHLDENWRMKQINAIVQSNDGPHILAGGLNSLD  390

Query  732   EADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQ  553
             + DYS +RW +IVKYYEE+GKPTPKV+VM +LK KQY DAKDF GECES+VMIAKGQ VQ
Sbjct  391   KTDYSTERWTDIVKYYEEIGKPTPKVDVMTFLKGKQYVDAKDFSGECESLVMIAKGQDVQ  450

Query  552   GTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             GTCKYGTRVDYI++SPDS YKFVPGSYSV+SSKGTSDHHIVKVD++K
Sbjct  451   GTCKYGTRVDYILASPDSPYKFVPGSYSVISSKGTSDHHIVKVDIIK  497



>ref|XP_010667577.1| PREDICTED: uncharacterized protein LOC104884592 [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score =   464 bits (1194),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 233/337 (69%), Positives = 270/337 (80%), Gaps = 17/337 (5%)
 Frame = -1

Query  1386  RPKSILKQSPLHP-------NAN-----LSEQQRFPKSKLRVSINLPDNEISLKKSGQLQ  1243
             RPK ILKQSPLHP       N N     + +QQ+F KSKLRVSINLPDNEISL +S ++ 
Sbjct  133   RPKGILKQSPLHPASVNLKSNTNNEDSLIRQQQKFAKSKLRVSINLPDNEISLGRSRRIG  192

Query  1242  FTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKA  1063
             F      DE     +     +  +N +     R  RS R VV+VLREL+AD+LALQDVKA
Sbjct  193   FV-----DESKTPSRCLSERNIWMNDNHDEGERLLRSKRAVVDVLRELDADILALQDVKA  247

Query  1062  EEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKA  883
             EEE++MKPLSDLAA LGM Y FAESWAPEYGNA+LSKWPIK+ KVQKIFD +DFRNV+K 
Sbjct  248   EEEKQMKPLSDLAAALGMNYVFAESWAPEYGNAVLSKWPIKNSKVQKIFDHTDFRNVLKT  307

Query  882   TIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWA  703
             TIDVP+VGE+NF+CT LDHLDE WRM QINAII+S++ PHILAGGLNSLDE DYS +RW 
Sbjct  308   TIDVPQVGEMNFYCTHLDHLDEKWRMNQINAIIESNNEPHILAGGLNSLDECDYSQERWT  367

Query  702   EIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVD  523
             +IVKYYE++GKPTPKVEVM YLK KQY DAKDF GECESVVMIAKGQ VQGTCKYGTR+D
Sbjct  368   DIVKYYEDIGKPTPKVEVMNYLKDKQYTDAKDFAGECESVVMIAKGQSVQGTCKYGTRLD  427

Query  522   YIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             YI++SP+  Y+FVPGSY+VLSSKGTSDHHIVKVD++K
Sbjct  428   YILASPELEYQFVPGSYAVLSSKGTSDHHIVKVDLLK  464



>ref|XP_010524002.1| PREDICTED: uncharacterized protein LOC104802217 [Tarenaya hassleriana]
Length=422

 Score =   451 bits (1159),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 227/335 (68%), Positives = 270/335 (81%), Gaps = 14/335 (4%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHP--NANLS-EQQRFPKSKLRVSINLPDNEISLKKSGQLQFTN  1234
             +KS   RP+SILK SPLHP  + NLS  +QRF  SKLRVSINLPDNEIS + S       
Sbjct  87    SKSTLDRPRSILKNSPLHPMSDHNLSARKQRFAGSKLRVSINLPDNEISRQLS-------  139

Query  1233  TFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEE  1054
              F +DEGD  G+       S+   S  + +S R   T++EVL+E++AD+LALQDVKA+E 
Sbjct  140   -FREDEGDVSGRKLNPQLRSMVSFSGESHQSSRR--TILEVLKEVDADLLALQDVKADEA  196

Query  1053  REMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATID  874
              EM+PLSDLAA LGM + FA+SWAP+YGNA+LSKWPIK   V +IFDDSDFRNV+KATID
Sbjct  197   DEMRPLSDLAAALGMHFVFADSWAPQYGNAVLSKWPIKQSAVHRIFDDSDFRNVLKATID  256

Query  873   VPEVGEINFFCTLLDHLDENWRMKQINAIIQSSD-TPHILAGGLNSLDEADYSPQRWAEI  697
             VPE GE+ F CT LDHLDENWRMKQ++A+I S++  PH+LAG LNSLDE DYSP+RW++I
Sbjct  257   VPETGEVEFHCTHLDHLDENWRMKQVDAVIASANGAPHVLAGALNSLDETDYSPERWSDI  316

Query  696   VKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYI  517
             V+YYEEMGKP PK EVM+YL+ K+Y DAKDFGGECESVV++AKGQ VQGTCKYGTRVDYI
Sbjct  317   VRYYEEMGKPVPKAEVMRYLRRKEYTDAKDFGGECESVVVVAKGQNVQGTCKYGTRVDYI  376

Query  516   VSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             ++SP+S YKFVPGSYSVLSSKGTSDHHIVKVDVVK
Sbjct  377   MASPESPYKFVPGSYSVLSSKGTSDHHIVKVDVVK  411



>ref|XP_007144585.1| hypothetical protein PHAVU_007G168200g [Phaseolus vulgaris]
 gb|ESW16579.1| hypothetical protein PHAVU_007G168200g [Phaseolus vulgaris]
Length=462

 Score =   449 bits (1156),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 231/331 (70%), Positives = 261/331 (79%), Gaps = 17/331 (5%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFL  1225
             A   + RP+SILKQS        +E+    + K+RVSINLPDNEISL +S Q  F+    
Sbjct  112   ASKANSRPRSILKQS--QSVKKTAEESVGSRQKMRVSINLPDNEISLLRSRQSSFSEH--  167

Query  1224  DDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREM  1045
             D EG             L   S   G ++ S RTVVEVL+E++ADVL+LQDVKAEEE  M
Sbjct  168   DKEG-------------LKAWSWGGGGAHVSNRTVVEVLKEVDADVLSLQDVKAEEENGM  214

Query  1044  KPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPE  865
             KPLSDLAA LGM Y FAESWAPEYGNA+LSKWPIK C   +IFD +DFRNV+KATIDVP+
Sbjct  215   KPLSDLAAALGMNYVFAESWAPEYGNAVLSKWPIKRCVSHQIFDQTDFRNVLKATIDVPQ  274

Query  864   VGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYY  685
             VGE+N +CT LDHLDENWRMKQ+NAIIQSSD PHILAGGLNSLDE+DYS +RW +IVKYY
Sbjct  275   VGELNLYCTHLDHLDENWRMKQVNAIIQSSDEPHILAGGLNSLDESDYSQERWTDIVKYY  334

Query  684   EEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSP  505
             EEMGKPTPKVEVMKYLK+K Y DAKD+ GECESVVMIAKGQ VQGTCKYGTRVDYI+SS 
Sbjct  335   EEMGKPTPKVEVMKYLKTKDYTDAKDYAGECESVVMIAKGQSVQGTCKYGTRVDYILSSS  394

Query  504   DSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             +S YKFVPGSY VLSSKGTSDHHIVKVDVV+
Sbjct  395   NSPYKFVPGSYLVLSSKGTSDHHIVKVDVVR  425



>ref|XP_004496062.1| PREDICTED: uncharacterized protein LOC101504254 [Cicer arietinum]
Length=457

 Score =   449 bits (1154),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 226/335 (67%), Positives = 255/335 (76%), Gaps = 24/335 (7%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLD  1222
             ++   RPKSILKQ+    N N+    +  KSK RVSINLPDNEISL +S Q  F+    +
Sbjct  115   RTTKERPKSILKQTQ-EENINVV---KLSKSKTRVSINLPDNEISLLRSRQWSFSEQ--E  168

Query  1221  DEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMK  1042
              EG        R                    ++VEVLRE++ADVL LQDVKAEEE  MK
Sbjct  169   KEGGSTSIRGSRVR------------------SLVEVLREVDADVLGLQDVKAEEENGMK  210

Query  1041  PLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEV  862
             PLSDLA+ LGM Y FAESWAP+YGNA+LSKWPIK     +IFD +DFRNV+KATIDVPE 
Sbjct  211   PLSDLASALGMNYVFAESWAPQYGNAVLSKWPIKRWNAHQIFDHTDFRNVLKATIDVPES  270

Query  861   GEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYE  682
             GE+NF+CT LDHLDENWRMKQINAIIQS+D PHILAGGLN+LDE+DYS +RW +IVKYYE
Sbjct  271   GELNFYCTHLDHLDENWRMKQINAIIQSNDEPHILAGGLNTLDESDYSQERWTDIVKYYE  330

Query  681   EMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPD  502
             EMGKPTPKVEVMKYLKSK+Y DAKD+ GECESVVMIAKGQ VQGTCKYGTRVDYI+SS +
Sbjct  331   EMGKPTPKVEVMKYLKSKEYTDAKDYAGECESVVMIAKGQSVQGTCKYGTRVDYILSSSN  390

Query  501   SVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGS  397
             S YKFVPGSY VLSSKGTSDHHIVK DVVK    S
Sbjct  391   SQYKFVPGSYLVLSSKGTSDHHIVKADVVKVNNNS  425



>ref|XP_009142487.1| PREDICTED: uncharacterized protein LOC103866335 [Brassica rapa]
Length=427

 Score =   447 bits (1149),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 225/332 (68%), Positives = 260/332 (78%), Gaps = 21/332 (6%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFL  1225
             +KS   RP+SILKQSPLHP  N  +Q+RF KS+LRVSINLP NEIS + S        F 
Sbjct  76    SKSTLDRPRSILKQSPLHPINNNMKQERFAKSRLRVSINLPYNEISRQLS--------FR  127

Query  1224  DDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREM  1045
             +D                   + S      STRTV++VLREL+ADVLALQDVKA+E  +M
Sbjct  128   EDHS-------------PLRPALSFSGHLPSTRTVLDVLRELDADVLALQDVKADEADQM  174

Query  1044  KPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPE  865
             +PLSDLAA L M Y FAESWAPEYGNA+LSKWPIK+  V KIFD SDFRNV+KATIDVP 
Sbjct  175   RPLSDLAAALNMNYVFAESWAPEYGNAVLSKWPIKNSNVLKIFDHSDFRNVLKATIDVPG  234

Query  864   VGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYY  685
              GE+ F CT LDHLDENWRMKQ++AIIQS+D PHILAG LNSLDE+DYS +RW +IVKYY
Sbjct  235   SGEVEFHCTHLDHLDENWRMKQVHAIIQSTDVPHILAGALNSLDESDYSSERWTDIVKYY  294

Query  684   EEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSP  505
             +EMGKP PK +VM++LKSK+Y DAKDF GECESVV++AKGQ VQGTCKYGTRVDYI++S 
Sbjct  295   QEMGKPIPKAQVMRFLKSKEYTDAKDFAGECESVVVVAKGQSVQGTCKYGTRVDYILASA  354

Query  504   DSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             DS Y+FVPGSYSVLSSKGTSDHHIVKVD+VKA
Sbjct  355   DSPYQFVPGSYSVLSSKGTSDHHIVKVDLVKA  386



>gb|KFK37555.1| hypothetical protein AALP_AA4G271900 [Arabis alpina]
Length=435

 Score =   447 bits (1149),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 231/336 (69%), Positives = 263/336 (78%), Gaps = 21/336 (6%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHP----NANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFT  1237
             +KS   RPKSILKQSPLHP    N    +Q +F KS+LRVSINLPDNEIS + S      
Sbjct  78    SKSTVDRPKSILKQSPLHPMMTANPASRKQMKFAKSRLRVSINLPDNEISRQLS------  131

Query  1236  NTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEE  1057
               F +D          + S      S S     RSTRTV+EVLREL+ADVLALQDVKA+E
Sbjct  132   --FREDP---------QHSPLRPALSFSGEIGIRSTRTVLEVLRELDADVLALQDVKADE  180

Query  1056  EREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATI  877
               +M+PLSDLAA LGM Y FA+SWAPEYGNAILSKWPIK+  V KIFD +DFRNV+KATI
Sbjct  181   ADQMRPLSDLAAALGMNYVFADSWAPEYGNAILSKWPIKNSNVHKIFDHTDFRNVLKATI  240

Query  876   DVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEI  697
             DVP  GE+ F CT LDHLDE WRMKQ++AIIQS++ PHILAG LNSLDE+DYS +RW +I
Sbjct  241   DVPGSGEVEFHCTHLDHLDEKWRMKQVDAIIQSTNVPHILAGALNSLDESDYSLERWTDI  300

Query  696   VKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYI  517
             VKYYEEMGKPTPK EVM++LK K+Y DAKDF GECESVV++AKGQ VQGTCKYGTRVDYI
Sbjct  301   VKYYEEMGKPTPKAEVMRFLKRKEYTDAKDFAGECESVVVVAKGQSVQGTCKYGTRVDYI  360

Query  516   VSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             ++S DS Y+FVPGSYSVLSSKGTSDHHIVKVDVVKA
Sbjct  361   LASSDSPYQFVPGSYSVLSSKGTSDHHIVKVDVVKA  396



>gb|KHN46613.1| hypothetical protein glysoja_035246 [Glycine soja]
Length=486

 Score =   447 bits (1149),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 233/347 (67%), Positives = 259/347 (75%), Gaps = 34/347 (10%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLH------------PNANLSEQQ---RFPKSKLRVSINLPDNEI  1270
             +KS   RP+SILKQS                + N+  +Q   R  KSK+RVSINLPDNEI
Sbjct  122   SKSTKERPRSILKQSQSQSQSQSVKNRVNDSDTNVGSRQEAARLAKSKMRVSINLPDNEI  181

Query  1269  SLKKSGQLQFTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNAD  1090
             SL +S Q  F+      E D         +   N              TVVEVL+E++AD
Sbjct  182   SLLRSRQSSFS------EHDKASSWVGGGAHVSNR-------------TVVEVLKEVDAD  222

Query  1089  VLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDD  910
             VL LQDVKAEEE  MKPLSDLAA LGM Y FAESWAPEYGNA+LSKWPIK     KIFD 
Sbjct  223   VLGLQDVKAEEENGMKPLSDLAAALGMNYVFAESWAPEYGNAVLSKWPIKRWNSHKIFDH  282

Query  909   SDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDE  730
             +DFRNV+KATIDVP+ GE+NF+CT LDHLDENWRMKQ+NAIIQSSD PHILAGGLNSLDE
Sbjct  283   TDFRNVLKATIDVPQAGELNFYCTHLDHLDENWRMKQVNAIIQSSDEPHILAGGLNSLDE  342

Query  729   ADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQG  550
             +DYS +RW +IVKYY+EMGKPTPKVEVMKYLKSK Y DAKD+ GECESVVMIAKGQ VQG
Sbjct  343   SDYSLERWTDIVKYYKEMGKPTPKVEVMKYLKSKDYTDAKDYAGECESVVMIAKGQSVQG  402

Query  549   TCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             TCKYGTRVDYI+SS +S YKFVPGSY VLSSKGTSDHHIVKVDVVKA
Sbjct  403   TCKYGTRVDYILSSSNSQYKFVPGSYLVLSSKGTSDHHIVKVDVVKA  449



>gb|KEH43280.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=456

 Score =   444 bits (1142),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 238/367 (65%), Positives = 271/367 (74%), Gaps = 21/367 (6%)
 Frame = -1

Query  1392  DHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEG  1213
             D  PKSILKQ+    N NL +     KSK RVSINLPDNEIS+ +S Q  F+        
Sbjct  106   DRPPKSILKQTQSQKNINLVQ---LTKSKTRVSINLPDNEISMLRSRQSSFS--------  154

Query  1212  DgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLS  1033
                           + S     +  +S RT+VEVLRE++AD+L LQDVKAEEE  MKPLS
Sbjct  155   -------EHEKERASTSGVHYYKHVKSGRTLVEVLREVDADILGLQDVKAEEENGMKPLS  207

Query  1032  DLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEI  853
             DLAA LGM Y FAESWAPEYGNA+ SKWPIK   V KIFD +D RNV+KATIDVPE GE+
Sbjct  208   DLAAALGMNYVFAESWAPEYGNAVFSKWPIKRWNVNKIFDHTDIRNVLKATIDVPEAGEL  267

Query  852   NFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMG  673
             NF+CT LDHLDENWRMKQINAIIQS+D PHILAGGLNSLDE+DYS +RW +IVKYYEEMG
Sbjct  268   NFYCTHLDHLDENWRMKQINAIIQSNDEPHILAGGLNSLDESDYSQERWTDIVKYYEEMG  327

Query  672   KPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVY  493
             KPTPKVEVMK+LKSK Y DAK++ GE ESVVMIAKGQ VQGTCKYGTRVDYI+SS  S Y
Sbjct  328   KPTPKVEVMKHLKSKDYTDAKNYAGEYESVVMIAKGQSVQGTCKYGTRVDYILSSSYSPY  387

Query  492   KFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGSGCHHrrridrkkqqkkrivkkITNSNLS  313
             KFVPGSYSVLSSKGTSDHHIVKVDV+  V       +    +K QQ ++ + K+T+SN S
Sbjct  388   KFVPGSYSVLSSKGTSDHHIVKVDVMIKVNNDS---QENATKKPQQHRQKIVKVTHSNPS  444

Query  312   MGIRKTQ  292
              GI KT 
Sbjct  445   KGIWKTH  451



>ref|XP_003536898.1| PREDICTED: uncharacterized protein LOC100801298 [Glycine max]
 gb|KHN03767.1| hypothetical protein glysoja_010996 [Glycine soja]
Length=473

 Score =   444 bits (1143),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 231/334 (69%), Positives = 255/334 (76%), Gaps = 20/334 (6%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPN-ANLSEQ-QRFPKSKLRVSINLPDNEISLKKSGQLQFTNT  1231
             ++S   RP+SILKQS    N  N S+   R  KSK+RVSINLPDNEISL +S Q  F+  
Sbjct  121   SRSTKERPRSILKQSQSVKNRVNDSDNVTRLAKSKMRVSINLPDNEISLLRSRQSSFS--  178

Query  1230  FLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEER  1051
                 E D            ++              TVVEVL+E++ADVL LQDVKAEEE 
Sbjct  179   ----EHDKASSWWGGGGVHVSNR------------TVVEVLKEVDADVLGLQDVKAEEEN  222

Query  1050  EMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDV  871
              MKPLSDLAA LGM Y FAESWAPEYGNA+LSKWPIK     KIFD +DFRNV+KATIDV
Sbjct  223   GMKPLSDLAAALGMNYVFAESWAPEYGNAVLSKWPIKRWNSHKIFDHTDFRNVLKATIDV  282

Query  870   PEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVK  691
             P  GE+NF+CT LD LDENWRMKQ+NAIIQSSD PHILAGGLNSLDE+DYS +RW +IVK
Sbjct  283   PLAGELNFYCTNLDLLDENWRMKQVNAIIQSSDEPHILAGGLNSLDESDYSQERWTDIVK  342

Query  690   YYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVS  511
             YYEEMGKPTPKVEVMKYLKSK Y DAKD+ GECESVVMIAKGQ VQGTCKYGTRVDYI+S
Sbjct  343   YYEEMGKPTPKVEVMKYLKSKDYTDAKDYAGECESVVMIAKGQSVQGTCKYGTRVDYILS  402

Query  510   SPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             S +S YKFVPGSY VLSSKGTSDHHIVKVDVV A
Sbjct  403   SSNSPYKFVPGSYLVLSSKGTSDHHIVKVDVVMA  436



>ref|XP_006397995.1| hypothetical protein EUTSA_v10001446mg [Eutrema salsugineum]
 gb|ESQ39448.1| hypothetical protein EUTSA_v10001446mg [Eutrema salsugineum]
Length=446

 Score =   443 bits (1139),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 231/343 (67%), Positives = 265/343 (77%), Gaps = 27/343 (8%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLH-----------PNANLSEQQRFPKSKLRVSINLPDNEISLKK  1258
             +KS   RP+SILKQSPLH           P     +   F KS+LRVSINLPDNEIS + 
Sbjct  80    SKSTVDRPRSILKQSPLHGHMNKKASSAPPPPARQQTTSFAKSRLRVSINLPDNEISRQL  139

Query  1257  SGQLQFTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLAL  1078
             S        F +D             S L  + S +G   RSTRTV++VLREL+ADVLAL
Sbjct  140   S--------FREDP--------PPQHSPLRPALSFSGGGLRSTRTVLDVLRELDADVLAL  183

Query  1077  QDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFR  898
             QDVKA+E  +M+PLSDLAA LGM Y FAESWAPEYGNAILSKWPIKS  VQKIFD +DFR
Sbjct  184   QDVKADEADQMRPLSDLAAALGMSYVFAESWAPEYGNAILSKWPIKSSNVQKIFDPTDFR  243

Query  897   NVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYS  718
             NV+KATI+VP  GE+ F CT LDHLDENWRMKQ++AIIQS++ PHILAG LNSLDE+DYS
Sbjct  244   NVLKATIEVPGSGEVEFHCTHLDHLDENWRMKQVDAIIQSTNVPHILAGALNSLDESDYS  303

Query  717   PQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKY  538
             P+RW +IVKYYEEMGKP PK +VM++LKSK+Y DAKDF GECESVV++AKGQ VQGTCKY
Sbjct  304   PERWTDIVKYYEEMGKPIPKAQVMRFLKSKEYTDAKDFAGECESVVVVAKGQSVQGTCKY  363

Query  537   GTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             GTRVDYI++S DS Y+FVPGSYSVLSSKGTSDHHIVKVDVVKA
Sbjct  364   GTRVDYILASSDSPYQFVPGSYSVLSSKGTSDHHIVKVDVVKA  406



>gb|KCW58935.1| hypothetical protein EUGRSUZ_H01558 [Eucalyptus grandis]
Length=300

 Score =   434 bits (1116),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 224/332 (67%), Positives = 258/332 (78%), Gaps = 43/332 (13%)
 Frame = -1

Query  1395  MDHRPKSILKQSPLHP---NANLSEQQRFPKSKLRVSINLPDNEISLKKSGQ-LQFTNTF  1228
             MD R   ILKQSPLHP     +L++QQ+F +SKLRVSINLPDNEISL +S + L F+ + 
Sbjct  1     MDAR--GILKQSPLHPINGQDHLTKQQKFARSKLRVSINLPDNEISLLRSRRNLSFSGS-  57

Query  1227  LDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEERE  1048
                                            STRTVVEVLREL+A ++ALQDVKAEEERE
Sbjct  58    -------------------------------STRTVVEVLRELDAAIVALQDVKAEEERE  86

Query  1047  MKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVP  868
             M+ LS+LAA LGM YAFAESWAPEYGNA+LS+WPIK  KVQKIFDD+DFRNV+KATI+VP
Sbjct  87    MRSLSELAAALGMSYAFAESWAPEYGNAVLSRWPIKHWKVQKIFDDTDFRNVLKATIEVP  146

Query  867   EVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKY  688
              VGE+NF  T LDHLDENWRMKQ+ AII SSD+PHILAGGLNSLD+ DYS +RW +IVKY
Sbjct  147   HVGEVNFQRTHLDHLDENWRMKQVGAIIHSSDSPHILAGGLNSLDDTDYSQERWTDIVKY  206

Query  687   YEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSS  508
             YEEMGKPTPKVEVM++LKSKQY       GECESVV+IAKGQ VQGTCKYGTRVDY+++S
Sbjct  207   YEEMGKPTPKVEVMRFLKSKQY-----IAGECESVVVIAKGQSVQGTCKYGTRVDYLLAS  261

Query  507   PDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             PD  YKF+PGSY VLSSKGTSDHHI+KV+V K
Sbjct  262   PDCPYKFIPGSYLVLSSKGTSDHHIIKVNVTK  293



>ref|XP_006604414.1| PREDICTED: uncharacterized protein LOC100820515 [Glycine max]
Length=370

 Score =   436 bits (1120),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 232/343 (68%), Positives = 258/343 (75%), Gaps = 47/343 (14%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQS--PLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKS--------  1255
             AKS   RP+SILKQS  PL             KSKLRVSINLPDNEISL+++        
Sbjct  23    AKSPYDRPRSILKQSQPPL-----------LGKSKLRVSINLPDNEISLRQTSFSEHERS  71

Query  1254  --GQLQFTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLA  1081
               G L ++ +F   EG                         R  RTVVEVLRELNADVL 
Sbjct  72    KLGSLSWSWSFA--EG----------------------GKERQRRTVVEVLRELNADVLG  107

Query  1080  LQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDF  901
             LQDVKAEEE  MKPLSDLA+ LGM Y FAESWAP+YGNA+LSKWPIK  K+QKIFD +D+
Sbjct  108   LQDVKAEEENGMKPLSDLASSLGMNYVFAESWAPQYGNAVLSKWPIKRWKLQKIFDHNDY  167

Query  900   RNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADY  721
             RNV+KATIDVP+ GE++F+CT LDHLDENWRMKQINAIIQS+D PHILAG LNSL+E+DY
Sbjct  168   RNVLKATIDVPQEGELHFYCTHLDHLDENWRMKQINAIIQSNDEPHILAGCLNSLNESDY  227

Query  720   SPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCK  541
             S +RW +IVKYYEEMGKPTPKVEVMK+LKS+ Y DAKDF GECE VVMIAKGQ VQGTCK
Sbjct  228   SEERWTDIVKYYEEMGKPTPKVEVMKHLKSRHYTDAKDFSGECEPVVMIAKGQSVQGTCK  287

Query  540   YGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             YGTRVDYI+SS DS YKFV GSY VLSSKGTSDHHIVKVDVVK
Sbjct  288   YGTRVDYILSSSDSPYKFVTGSYLVLSSKGTSDHHIVKVDVVK  330



>gb|KHN45385.1| hypothetical protein glysoja_028392 [Glycine soja]
Length=418

 Score =   435 bits (1118),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 225/337 (67%), Positives = 255/337 (76%), Gaps = 47/337 (14%)
 Frame = -1

Query  1386  RPKSILKQS--PLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKS----------GQLQ  1243
             RP+SILKQS  PL             KSKLRVSINLPDNEISL+++          G L 
Sbjct  77    RPRSILKQSQPPL-----------LGKSKLRVSINLPDNEISLRQTSFSEHERSKLGSLS  125

Query  1242  FTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKA  1063
             ++ +F +   + + +                        TVVEVLRELNADVL LQDVKA
Sbjct  126   WSWSFAEGGKERQRR------------------------TVVEVLRELNADVLGLQDVKA  161

Query  1062  EEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKA  883
             EEE  MKPLSDLA+ LGM Y FAESWAP+YGNA+LSKWPIK  K+QKIFD +D+RNV+KA
Sbjct  162   EEENGMKPLSDLASSLGMNYVFAESWAPQYGNAVLSKWPIKRWKLQKIFDHNDYRNVLKA  221

Query  882   TIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWA  703
             TIDVP+ GE++F+CT LDHLDENWRMKQINAIIQS+D PHILAG LNSL+E+DYS +RW 
Sbjct  222   TIDVPQEGELHFYCTHLDHLDENWRMKQINAIIQSNDEPHILAGCLNSLNESDYSEERWT  281

Query  702   EIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVD  523
             +IVKYYEEMGKPTPKVEVMK+LKS+ Y DAKDF GECE VVMIAKGQ VQGTCKYGTRVD
Sbjct  282   DIVKYYEEMGKPTPKVEVMKHLKSRHYTDAKDFSGECEPVVMIAKGQSVQGTCKYGTRVD  341

Query  522   YIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             YI+SS DS YKFV GSY VLSSKGTSDHHIVKVDVVK
Sbjct  342   YILSSSDSPYKFVTGSYLVLSSKGTSDHHIVKVDVVK  378



>ref|XP_006419745.1| hypothetical protein CICLE_v10005134mg [Citrus clementina]
 gb|ESR32985.1| hypothetical protein CICLE_v10005134mg [Citrus clementina]
Length=390

 Score =   434 bits (1115),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/335 (66%), Positives = 259/335 (77%), Gaps = 21/335 (6%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPN----ANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFT  1237
             AK+  + PKSILKQSPLH +     +LS+Q+   +SKL+VSINLPDNEISL  S  L  +
Sbjct  37    AKAASYCPKSILKQSPLHTSLTSPEHLSKQKTVSRSKLKVSINLPDNEISLANSNVLMRS  96

Query  1236  NTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEE  1057
                L                      +    S + +R++ EVLRE++AD+L+LQDVKAEE
Sbjct  97    PVCLP-----------------TSMMTWMEESAKCSRSIAEVLREVDADILSLQDVKAEE  139

Query  1056  EREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATI  877
             E +MKPLSDLAA LGMKY FAESWAPEYGNAILSKWPIK  KVQKI DD DFRNV+KAT+
Sbjct  140   ENDMKPLSDLAAALGMKYVFAESWAPEYGNAILSKWPIKRWKVQKIADDKDFRNVLKATV  199

Query  876   DVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEI  697
             DVP  GE+N  CT LDHL+E WRMKQI AIIQS+D+PHILAGGLNSLD +DYS +RW +I
Sbjct  200   DVPWAGEVNVDCTQLDHLNEKWRMKQICAIIQSNDSPHILAGGLNSLDGSDYSAERWMDI  259

Query  696   VKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYI  517
             VKYYE++GKPTP+VEVMK LK  +Y D+K+F GECE VV+IAKGQ VQGTCKYGTRVDYI
Sbjct  260   VKYYEDIGKPTPRVEVMKLLKGIEYVDSKEFAGECEPVVIIAKGQNVQGTCKYGTRVDYI  319

Query  516   VSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             ++SPDS YKFVPGSYSV+SSKGTSDHHIVKVD+ K
Sbjct  320   LASPDSPYKFVPGSYSVISSKGTSDHHIVKVDITK  354



>ref|XP_003520552.1| PREDICTED: uncharacterized protein LOC100794761 [Glycine max]
 gb|KHN19855.1| hypothetical protein glysoja_033487 [Glycine soja]
Length=418

 Score =   434 bits (1117),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 226/327 (69%), Positives = 251/327 (77%), Gaps = 27/327 (8%)
 Frame = -1

Query  1386  RPKSILKQS--PLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEG  1213
             RP+SILKQS  PL   +          SKLRVSINLPDNEISL+++   +   + L    
Sbjct  77    RPRSILKQSKSPLLGKS----------SKLRVSINLPDNEISLRQTSFSEHERSKLGSFA  126

Query  1212  DgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLS  1033
             +GR +   +                    TVVEVLRELNADVL LQDVKAEEE  MKPLS
Sbjct  127   EGRIEEGGKERQRR---------------TVVEVLRELNADVLGLQDVKAEEENGMKPLS  171

Query  1032  DLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEI  853
             DLA+ LGM Y FAESWAP+YGNA+LSKWPIK  K+QKIFD  D+RNV+KATIDVP+ GE+
Sbjct  172   DLASALGMNYVFAESWAPQYGNAVLSKWPIKRWKLQKIFDHHDYRNVLKATIDVPQEGEL  231

Query  852   NFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMG  673
             +F+CT LD+LDENWRMKQINAIIQS+D PHILAGGLNSLDE DYS  RW +IVKYYEEMG
Sbjct  232   HFYCTHLDYLDENWRMKQINAIIQSNDEPHILAGGLNSLDETDYSQDRWTDIVKYYEEMG  291

Query  672   KPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVY  493
             KPTPKVEVMK+LKS+ Y DAKDF GECESVVMIAKGQ VQGTCKYGTRVDYI SS DS Y
Sbjct  292   KPTPKVEVMKHLKSRHYTDAKDFSGECESVVMIAKGQSVQGTCKYGTRVDYIFSSSDSPY  351

Query  492   KFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             KFV GSY VLSSKGTSDHHIVKVDVVK
Sbjct  352   KFVSGSYLVLSSKGTSDHHIVKVDVVK  378



>ref|XP_006294213.1| hypothetical protein CARUB_v10023211mg [Capsella rubella]
 gb|EOA27111.1| hypothetical protein CARUB_v10023211mg [Capsella rubella]
Length=448

 Score =   436 bits (1120),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 223/341 (65%), Positives = 260/341 (76%), Gaps = 33/341 (10%)
 Frame = -1

Query  1404  AKSMDHRPKSILK-QSPLHPNANLSEQQRFPKSKLR-VSINLPDNEISLKKSGQ------  1249
             +KS   RPKSILK  SP   ++   +Q RF KS+LR VSINLPDNEIS + S +      
Sbjct  94    SKSSVDRPKSILKPTSPSSHDSRRQQQLRFAKSRLRRVSINLPDNEISRQLSFREDPHRS  153

Query  1248  -LQFTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQD  1072
              L+ T +F  + G                         R+TRT +EVLREL+ADVLALQD
Sbjct  154   PLRATLSFSGEIG------------------------PRTTRTALEVLRELDADVLALQD  189

Query  1071  VKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNV  892
             VKA+E  +M+PLSDLAA LGM Y FAESWAPEYGNAILSKWPI    V +IFDD+DFRNV
Sbjct  190   VKADEADQMRPLSDLAAALGMNYVFAESWAPEYGNAILSKWPITHSNVLRIFDDTDFRNV  249

Query  891   MKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQ  712
             +KA+IDVP  GE+ F CT LDHLDE WRMKQ++AIIQS++ PHILAG LNSLDE+DYSP+
Sbjct  250   LKASIDVPGSGEVEFHCTHLDHLDEEWRMKQVDAIIQSTNVPHILAGALNSLDESDYSPE  309

Query  711   RWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGT  532
             RW +IVKYYEEMGKP PK +VM++LK+KQY DAKDF GECESVV++AKGQ VQGTCKYGT
Sbjct  310   RWTDIVKYYEEMGKPIPKAQVMRFLKTKQYTDAKDFAGECESVVVVAKGQSVQGTCKYGT  369

Query  531   RVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             RVDYI++S DS Y+FVPGSYSVLSSKGTSDHHIVKVDVVKA
Sbjct  370   RVDYILASSDSPYRFVPGSYSVLSSKGTSDHHIVKVDVVKA  410



>ref|XP_006845796.1| hypothetical protein AMTR_s00019p00255210 [Amborella trichopoda]
 gb|ERN07471.1| hypothetical protein AMTR_s00019p00255210 [Amborella trichopoda]
Length=428

 Score =   435 bits (1118),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 224/357 (63%), Positives = 262/357 (73%), Gaps = 19/357 (5%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNAN----LSEQQRFPK--SKLRVSINLPDNEISLKKSGQLQ  1243
              KS++ RPKSILKQ  +  + N     S  +R+    SKLRVSINLPDNEIS+ +S QL+
Sbjct  49    GKSLNDRPKSILKQKSVSHSMNDPNEFSPSKRYKSQGSKLRVSINLPDNEISIGRSRQLK  108

Query  1242  FT-------NTFLDDEGDgrgks----plrsssslnfssssagrsyrstRTVVEVLRELN  1096
                        ++   GD R +        S S                RTV+EVL+E+ 
Sbjct  109   IIENEEGTEKAWVLSNGDVRIRREKGPMRPSLSLPAQRIREKESENLRNRTVLEVLKEVE  168

Query  1095  ADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIF  916
             AD+LALQDVKAEEER MKPLSDLA GLGMKY FAESWAPEYGNA+LSKWPIK  + QKIF
Sbjct  169   ADILALQDVKAEEERGMKPLSDLAEGLGMKYVFAESWAPEYGNAVLSKWPIKRWQAQKIF  228

Query  915   DDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSL  736
             DDSDFRNV+K  +DVP  GE+N +CT LDHLDENWRMKQI AI+Q SD PHIL GGLNSL
Sbjct  229   DDSDFRNVLKVVVDVPTAGEVNVYCTHLDHLDENWRMKQITAILQGSDGPHILTGGLNSL  288

Query  735   DEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCV  556
             DE DYS +RW +IVKYY+E+GKPTPKVE+MK+LK K+Y DAK+F GECESVVM+AKGQ V
Sbjct  289   DETDYSEERWTDIVKYYQEIGKPTPKVEIMKFLKGKRYTDAKNFVGECESVVMLAKGQDV  348

Query  555   QGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVD--VVKAVGGSGC  391
             QGTCKYGTRVDYI++SPDS Y+FVPGSY+V+SSKGTS+HHIVK D  V     GS C
Sbjct  349   QGTCKYGTRVDYILASPDSPYRFVPGSYTVISSKGTSNHHIVKADIQVSSLPNGSTC  405



>ref|XP_010496917.1| PREDICTED: uncharacterized protein LOC104773943 [Camelina sativa]
Length=444

 Score =   435 bits (1119),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 226/338 (67%), Positives = 261/338 (77%), Gaps = 22/338 (7%)
 Frame = -1

Query  1404  AKSMDHRPKSILK-----QSPLHPNANLSEQQRFPKSKLR-VSINLPDNEISLKKSGQLQ  1243
             +KS   RPKSILK      SP H ++   +Q RF KS+LR VSINLPDNEIS + S    
Sbjct  82    SKSSVDRPKSILKPMSPVSSPSHHDSRKQQQLRFAKSRLRRVSINLPDNEISRQLS----  137

Query  1242  FTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKA  1063
                 F +D           S       S S     RSTRT +EVLREL+ADVLALQDVKA
Sbjct  138   ----FREDP--------QHSPLRAASLSFSGEIGLRSTRTALEVLRELDADVLALQDVKA  185

Query  1062  EEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKA  883
             +E  +M+PLSDLAA LGM Y FAESWAPEYGNAILSKWPIK+  V +IFDD+DFRNV+KA
Sbjct  186   DEADQMRPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKNSNVLRIFDDTDFRNVLKA  245

Query  882   TIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWA  703
             +IDVP  GE+ F CT LDHLDE WRMKQ++AII+S++ PHILAG LNSLDE+DYSP+RW 
Sbjct  246   SIDVPGSGEVEFHCTHLDHLDEKWRMKQVDAIIRSTNVPHILAGALNSLDESDYSPERWT  305

Query  702   EIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVD  523
             +IVKYYEEMGKP PK +VM++LKSK+Y DAKDF GECESVV++AKGQ VQGTCKYGTRVD
Sbjct  306   DIVKYYEEMGKPIPKAQVMRFLKSKEYTDAKDFAGECESVVVVAKGQSVQGTCKYGTRVD  365

Query  522   YIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             YI++S DS Y+FVPGSYSVLSSKGTSDHHIVKVDVVKA
Sbjct  366   YILASSDSPYQFVPGSYSVLSSKGTSDHHIVKVDVVKA  403



>gb|KCW58924.1| hypothetical protein EUGRSUZ_H01547 [Eucalyptus grandis]
Length=413

 Score =   433 bits (1113),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 200/238 (84%), Positives = 221/238 (93%), Gaps = 0/238 (0%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             TVVEVLREL+AD++ALQDVKAEEEREMKPLS+LAA LGM YAFAESWAPEYGNA+LS+WP
Sbjct  124   TVVEVLRELDADIVALQDVKAEEEREMKPLSELAAALGMSYAFAESWAPEYGNAVLSRWP  183

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTP  766
             IK  KVQKIFDD+DFRNV+KATI+VP +GE+NF CT LDHLDENWRMKQ+ AIIQSSD+P
Sbjct  184   IKRWKVQKIFDDTDFRNVLKATIEVPHIGEVNFQCTHLDHLDENWRMKQVGAIIQSSDSP  243

Query  765   HILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECES  586
             HILAGGLNSLDE DYS +RW +IVKYYEEMGKPTPKVEVM++LKSKQY DAKDF GECES
Sbjct  244   HILAGGLNSLDETDYSQERWTDIVKYYEEMGKPTPKVEVMRFLKSKQYTDAKDFAGECES  303

Query  585   VVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             VV+IAKGQ VQGTCKYGTRVDYI++SPD  YKF+PGSYSVLSSKGTSDHHIVKVDV K
Sbjct  304   VVVIAKGQSVQGTCKYGTRVDYILASPDCPYKFIPGSYSVLSSKGTSDHHIVKVDVTK  361



>ref|XP_010413115.1| PREDICTED: uncharacterized protein LOC104699509, partial [Camelina 
sativa]
Length=397

 Score =   432 bits (1111),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 225/338 (67%), Positives = 260/338 (77%), Gaps = 22/338 (7%)
 Frame = -1

Query  1404  AKSMDHRPKSILK-----QSPLHPNANLSEQQRFPKSKLR-VSINLPDNEISLKKSGQLQ  1243
             +KS   RPKSILK      SP H ++   +Q RF KS+LR VSINLPDNEIS + S    
Sbjct  35    SKSSVDRPKSILKPMSPASSPSHHDSRKQQQLRFAKSRLRRVSINLPDNEISRQLS----  90

Query  1242  FTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKA  1063
                 F +D           S       S S     RSTRT +EVLREL+ADVLALQDVKA
Sbjct  91    ----FREDP--------QHSPLRAASLSFSGEIGLRSTRTALEVLRELDADVLALQDVKA  138

Query  1062  EEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKA  883
             +E  +M+PLSDLAA LGM Y FAESWAPEYGNAILSKWPIK+  V +IFDD+DFRNV+KA
Sbjct  139   DEADQMRPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKNSNVLRIFDDTDFRNVLKA  198

Query  882   TIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWA  703
             +IDVP  GE+ F CT  DHLDE WRMKQ++AII+S++ PHILAG LNSLDE+DYSP+RW 
Sbjct  199   SIDVPGSGEVEFHCTHFDHLDEKWRMKQVDAIIRSTNVPHILAGALNSLDESDYSPERWT  258

Query  702   EIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVD  523
             +IVKYYEEMGKP PK +VM++LKSK+Y DAKDF GECESVV++AKGQ VQGTCKYGTRVD
Sbjct  259   DIVKYYEEMGKPIPKAQVMRFLKSKEYTDAKDFAGECESVVVVAKGQSVQGTCKYGTRVD  318

Query  522   YIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             YI++S DS Y+FVPGSYSVLSSKGTSDHHIVKVDVVKA
Sbjct  319   YILASSDSPYQFVPGSYSVLSSKGTSDHHIVKVDVVKA  356



>emb|CBI26148.3| unnamed protein product [Vitis vinifera]
Length=408

 Score =   432 bits (1111),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 217/326 (67%), Positives = 250/326 (77%), Gaps = 31/326 (10%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNANLSE---QQRFPKSKLRVSINLPDNEISLKKSGQLQFTN  1234
             AKS ++RPKSILKQSPLH   N  +   QQ+  +S+L+VSINLPDNEISL  S  L F  
Sbjct  68    AKSENYRPKSILKQSPLHSTPNTPDHLSQQKLTRSRLKVSINLPDNEISLANSKLLSFWE  127

Query  1233  TFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEE  1054
             +  + EG  R                          +++EVLRE+NAD+LALQDVKAEEE
Sbjct  128   S--EKEGSSR--------------------------SILEVLREVNADILALQDVKAEEE  159

Query  1053  REMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATID  874
             + MKPLSDLA  LGMKY FAESWAPE+GNAILSKWPIK  K QKI D  DFRNV+KATID
Sbjct  160   KGMKPLSDLAGALGMKYVFAESWAPEFGNAILSKWPIKRWKAQKIIDGEDFRNVLKATID  219

Query  873   VPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIV  694
             VP  GE+NF CT LDHLDENWRMKQ NAIIQSSD PHILAGGLNSL+ +DYS +RW +I+
Sbjct  220   VPWAGEVNFHCTQLDHLDENWRMKQTNAIIQSSDCPHILAGGLNSLNGSDYSRERWMDII  279

Query  693   KYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIV  514
             KYYEE+GKPTPKV+VM++LK K+Y DAK+F GECE VV+IAKGQ VQGTCKYGTRVDYI+
Sbjct  280   KYYEEIGKPTPKVDVMEFLKGKEYVDAKNFAGECEPVVIIAKGQNVQGTCKYGTRVDYIL  339

Query  513   SSPDSVYKFVPGSYSVLSSKGTSDHH  436
             +S DS YKFVP SYSV+SSKGTSDHH
Sbjct  340   ASQDSPYKFVPRSYSVISSKGTSDHH  365



>ref|XP_002882142.1| endonuclease/exonuclease/phosphatase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH58401.1| endonuclease/exonuclease/phosphatase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=444

 Score =   433 bits (1114),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 223/334 (67%), Positives = 260/334 (78%), Gaps = 19/334 (6%)
 Frame = -1

Query  1404  AKSMDHRPKSILK--QSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNT  1231
             +KS   RPKSILK   +   P  +  +Q+RF KS+ RVSINLPDNEIS + S        
Sbjct  85    SKSTVDRPKSILKPMNAAATPTHDSRKQERFAKSRPRVSINLPDNEISRQLS--------  136

Query  1230  FLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEER  1051
             F +D          + S      S S     RSTRT +EVLREL+ADVLALQDVKA+E  
Sbjct  137   FREDP---------QHSPLRPALSFSGEVGLRSTRTALEVLRELDADVLALQDVKADEAD  187

Query  1050  EMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDV  871
             +M+PLSDLAA LGM Y FAESWAPEYGNAILSKWPIKS  V +IFDD+DFRNV+KA+I+V
Sbjct  188   QMRPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKSSDVLRIFDDTDFRNVLKASIEV  247

Query  870   PEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVK  691
             P  GE+ F CT LDHLDE WRMKQ++AII+S++ PHILAG LNSLDE+DYSP+RW +IVK
Sbjct  248   PGSGEVEFHCTHLDHLDEKWRMKQVDAIIRSTNVPHILAGALNSLDESDYSPERWTDIVK  307

Query  690   YYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVS  511
             YYEEMGKP PK +VM++LKSK+Y DAKDF GECESVV++AKGQ VQGTCKYGTRVDYI++
Sbjct  308   YYEEMGKPIPKAQVMRFLKSKEYTDAKDFAGECESVVVVAKGQSVQGTCKYGTRVDYILA  367

Query  510   SPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             S DS Y+FVPGSYSVLSSKGTSDHHIVKVDVVKA
Sbjct  368   SSDSPYRFVPGSYSVLSSKGTSDHHIVKVDVVKA  401



>ref|XP_010912091.1| PREDICTED: uncharacterized protein LOC105038101 [Elaeis guineensis]
Length=490

 Score =   434 bits (1115),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 225/339 (66%), Positives = 262/339 (77%), Gaps = 26/339 (8%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLD  1222
             K+ + RPKSILKQ            Q F KS LRVSINLPDNEIS K+S Q   TN+   
Sbjct  138   KTANDRPKSILKQ------------QSFAKSNLRVSINLPDNEISKKRSKQ---TNSI--  180

Query  1221  DEGDgrgks--------plrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVK  1066
              EGD R  +            S S          S RS R+V++VLRE+ AD++ LQ+VK
Sbjct  181   -EGDDRKSADWKGKAPVSYSFSLSAGLGGERERESLRSNRSVLDVLREVGADIIGLQNVK  239

Query  1065  AEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMK  886
             AEEE+ MKPLSDLAAGLGM Y FAESWAPEYGNAILSKWPIK  +VQK+FDD+DFRNV+K
Sbjct  240   AEEEKGMKPLSDLAAGLGMNYVFAESWAPEYGNAILSKWPIKQWRVQKVFDDTDFRNVLK  299

Query  885   ATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRW  706
             ATI+VP  GE+NF CT LDHLDENWRMKQIN+I++ SD PHILAGGLN+L+E DYS +RW
Sbjct  300   ATIEVPNAGEVNFHCTHLDHLDENWRMKQINSILRFSDGPHILAGGLNALEETDYSAERW  359

Query  705   AEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRV  526
             A+IVKYYEE+GKPTPKVEVMK+LK K Y DAK+F GECE+VV++AKGQ VQGTCKYGTRV
Sbjct  360   ADIVKYYEEIGKPTPKVEVMKFLKEKHYLDAKNFAGECEAVVIVAKGQDVQGTCKYGTRV  419

Query  525   DYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             DYI++SP+S YKFVPGSY VLSSKGTSDHHIVKVD++ A
Sbjct  420   DYILASPNSPYKFVPGSYGVLSSKGTSDHHIVKVDIMIA  458



>ref|XP_010070272.1| PREDICTED: uncharacterized protein LOC104457041 isoform X2 [Eucalyptus 
grandis]
Length=524

 Score =   434 bits (1117),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 200/238 (84%), Positives = 221/238 (93%), Gaps = 0/238 (0%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             TVVEVLREL+AD++ALQDVKAEEEREMKPLS+LAA LGM YAFAESWAPEYGNA+LS+WP
Sbjct  238   TVVEVLRELDADIVALQDVKAEEEREMKPLSELAAALGMSYAFAESWAPEYGNAVLSRWP  297

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTP  766
             IK  KVQKIFDD+DFRNV+KATI+VP +GE+NF CT LDHLDENWRMKQ+ AIIQSSD+P
Sbjct  298   IKRWKVQKIFDDTDFRNVLKATIEVPHIGEVNFQCTHLDHLDENWRMKQVGAIIQSSDSP  357

Query  765   HILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECES  586
             HILAGGLNSLDE DYS +RW +IVKYYEEMGKPTPKVEVM++LKSKQY DAKDF GECES
Sbjct  358   HILAGGLNSLDETDYSQERWTDIVKYYEEMGKPTPKVEVMRFLKSKQYTDAKDFAGECES  417

Query  585   VVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             VV+IAKGQ VQGTCKYGTRVDYI++SPD  YKF+PGSYSVLSSKGTSDHHIVKVDV K
Sbjct  418   VVVIAKGQSVQGTCKYGTRVDYILASPDCPYKFIPGSYSVLSSKGTSDHHIVKVDVTK  475


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 3/47 (6%)
 Frame = -1

Query  1386  RPKSILKQSPLHP---NANLSEQQRFPKSKLRVSINLPDNEISLKKS  1255
             RP+ ILKQSPLHP     +L++QQ+F +SKLRVSINLPDNEISL +S
Sbjct  121   RPRGILKQSPLHPLNGQDHLTKQQKFARSKLRVSINLPDNEISLLRS  167



>ref|XP_010506851.1| PREDICTED: uncharacterized protein LOC104783392 [Camelina sativa]
Length=444

 Score =   431 bits (1109),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 225/338 (67%), Positives = 260/338 (77%), Gaps = 22/338 (7%)
 Frame = -1

Query  1404  AKSMDHRPKSILK-----QSPLHPNANLSEQQRFPKSKLR-VSINLPDNEISLKKSGQLQ  1243
             +KS   RPKSILK      SP H ++   +Q RF KS+LR VSINLPDNEIS + S    
Sbjct  82    SKSSVDRPKSILKPMSPASSPSHHDSRKQQQLRFAKSRLRRVSINLPDNEISRQLS----  137

Query  1242  FTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKA  1063
                 F +D           S       S S     RSTRT +EVLREL+ADVLALQDVKA
Sbjct  138   ----FREDP--------QHSPLRAASLSFSGEIGLRSTRTALEVLRELDADVLALQDVKA  185

Query  1062  EEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKA  883
             +E  +M+PLSDLAA LGM Y FAESWAPEYGNAILSKWPIK+  V +IFDD+DFRNV+KA
Sbjct  186   DEADQMRPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKNSNVLRIFDDTDFRNVLKA  245

Query  882   TIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWA  703
             +I VP  GE+ F CT LDHLDE WRMKQ++AII+S++ PHILAG LNSLDE+DYSP+RW 
Sbjct  246   SIVVPGSGEVEFHCTHLDHLDEKWRMKQVDAIIRSTNVPHILAGALNSLDESDYSPERWT  305

Query  702   EIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVD  523
             +IVKYYEEMGKP PK +VM++LKSK+Y DAKDF GECESVV++AKGQ VQGTCKYGTRVD
Sbjct  306   DIVKYYEEMGKPIPKAQVMRFLKSKEYTDAKDFAGECESVVVVAKGQSVQGTCKYGTRVD  365

Query  522   YIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             YI++S DS Y+FVPGSYSVLSSKGTSDHHIVKVDVVKA
Sbjct  366   YILASSDSPYQFVPGSYSVLSSKGTSDHHIVKVDVVKA  403



>ref|XP_006489272.1| PREDICTED: uncharacterized protein LOC102620958 [Citrus sinensis]
Length=483

 Score =   433 bits (1113),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 220/335 (66%), Positives = 259/335 (77%), Gaps = 21/335 (6%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFT  1237
             AK+  + PKSILKQSPLH +     +LS+Q+   +SKL+VSINLPDNEISL  S  L  +
Sbjct  130   AKAASYCPKSILKQSPLHTSLTSPEHLSKQKTVSRSKLKVSINLPDNEISLANSNVLMRS  189

Query  1236  NTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEE  1057
                L                      +    S + +R++ EVLRE++AD+L+LQDVKAEE
Sbjct  190   PVCLP-----------------TSMMTWMEESAKCSRSIAEVLREVDADILSLQDVKAEE  232

Query  1056  EREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATI  877
             E +MKPLSDLAA LGMKY FAESWAPEYGNAILSKWPIK  KVQKI DD DFRNV+KAT+
Sbjct  233   ENDMKPLSDLAAALGMKYVFAESWAPEYGNAILSKWPIKRWKVQKIADDKDFRNVLKATV  292

Query  876   DVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEI  697
             DVP  GE+N  CT LDHL+E WRMKQI AIIQS+D+PHILAGGLNSLD +DYS +RW +I
Sbjct  293   DVPWAGEVNVDCTQLDHLNEKWRMKQICAIIQSNDSPHILAGGLNSLDGSDYSAERWMDI  352

Query  696   VKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYI  517
             VKYYE++GKPTP+VEVMK LK  +Y D+K+F GECE VV+IAKGQ VQGTCKYGTRVDYI
Sbjct  353   VKYYEDIGKPTPRVEVMKLLKGIEYVDSKEFAGECEPVVIIAKGQNVQGTCKYGTRVDYI  412

Query  516   VSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             ++SPDS YKFVPGSYSV+SSKGTSDHHIVKVD+ K
Sbjct  413   LASPDSPYKFVPGSYSVISSKGTSDHHIVKVDITK  447



>ref|XP_010070271.1| PREDICTED: uncharacterized protein LOC104457041 isoform X1 [Eucalyptus 
grandis]
Length=527

 Score =   434 bits (1116),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 200/238 (84%), Positives = 221/238 (93%), Gaps = 0/238 (0%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             TVVEVLREL+AD++ALQDVKAEEEREMKPLS+LAA LGM YAFAESWAPEYGNA+LS+WP
Sbjct  238   TVVEVLRELDADIVALQDVKAEEEREMKPLSELAAALGMSYAFAESWAPEYGNAVLSRWP  297

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTP  766
             IK  KVQKIFDD+DFRNV+KATI+VP +GE+NF CT LDHLDENWRMKQ+ AIIQSSD+P
Sbjct  298   IKRWKVQKIFDDTDFRNVLKATIEVPHIGEVNFQCTHLDHLDENWRMKQVGAIIQSSDSP  357

Query  765   HILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECES  586
             HILAGGLNSLDE DYS +RW +IVKYYEEMGKPTPKVEVM++LKSKQY DAKDF GECES
Sbjct  358   HILAGGLNSLDETDYSQERWTDIVKYYEEMGKPTPKVEVMRFLKSKQYTDAKDFAGECES  417

Query  585   VVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             VV+IAKGQ VQGTCKYGTRVDYI++SPD  YKF+PGSYSVLSSKGTSDHHIVKVDV K
Sbjct  418   VVVIAKGQSVQGTCKYGTRVDYILASPDCPYKFIPGSYSVLSSKGTSDHHIVKVDVTK  475


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 3/47 (6%)
 Frame = -1

Query  1386  RPKSILKQSPLHP---NANLSEQQRFPKSKLRVSINLPDNEISLKKS  1255
             RP+ ILKQSPLHP     +L++QQ+F +SKLRVSINLPDNEISL +S
Sbjct  121   RPRGILKQSPLHPLNGQDHLTKQQKFARSKLRVSINLPDNEISLLRS  167



>ref|XP_007162383.1| hypothetical protein PHAVU_001G147400g [Phaseolus vulgaris]
 gb|ESW34377.1| hypothetical protein PHAVU_001G147400g [Phaseolus vulgaris]
Length=467

 Score =   432 bits (1110),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 226/342 (66%), Positives = 255/342 (75%), Gaps = 47/342 (14%)
 Frame = -1

Query  1401  KSMDHRPKSILKQS--PLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKS---------  1255
             KS   RP+ ILKQS  PL             KSKLRVSINLPDNEISL+++         
Sbjct  121   KSTYDRPRGILKQSQSPL-----------LGKSKLRVSINLPDNEISLRQTSFSEHERAK  169

Query  1254  GQLQFTNTFLDD-EGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLAL  1078
             G   ++ +F +  EG+ + K                        TV+EVLRE+NADVL L
Sbjct  170   GSFSWSWSFAEGVEGERQRK------------------------TVLEVLREVNADVLGL  205

Query  1077  QDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFR  898
             QDVKAEEE  MKPLSDLA  LGM Y FAESWAP+YGNA+LSKWPIK  K+QKIFD +DFR
Sbjct  206   QDVKAEEENGMKPLSDLARALGMNYVFAESWAPQYGNAVLSKWPIKRWKLQKIFDHTDFR  265

Query  897   NVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYS  718
             NV+KATIDVPE GE+ F+CT LDHLDE WRMKQINAII+S++ PHILAGGLNSLDE+DYS
Sbjct  266   NVLKATIDVPEEGELQFYCTNLDHLDEKWRMKQINAIIESNEEPHILAGGLNSLDESDYS  325

Query  717   PQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKY  538
              +RW +IVKYYEEMGKPTPKVEVMKYLK++QY DAK+F GE ESVVMIAKGQ VQGTCKY
Sbjct  326   QERWTDIVKYYEEMGKPTPKVEVMKYLKNRQYRDAKEFSGEYESVVMIAKGQSVQGTCKY  385

Query  537   GTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             GTRVDYI+SS DS YKFV GSY VLSSKGTSDHHIVK DVVK
Sbjct  386   GTRVDYILSSSDSPYKFVSGSYLVLSSKGTSDHHIVKADVVK  427



>emb|CDO98952.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   431 bits (1107),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 217/335 (65%), Positives = 257/335 (77%), Gaps = 4/335 (1%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHPNAN----LSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTN  1234
             K +  RPKSILKQSPLHP        S Q +  +SK +VSINLP+NEISL ++  L F  
Sbjct  108   KPVSGRPKSILKQSPLHPTIGDPELTSSQIKLTRSKPKVSINLPENEISLAQNKVLSFEE  167

Query  1233  TFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEE  1054
                 +       S     S + F    A      ++++ +VL+EL+AD+LALQDVKAEEE
Sbjct  168   DSSTNIVSFYTNSIAPMRSPICFPLGMANWMNDGSKSIYDVLKELDADILALQDVKAEEE  227

Query  1053  REMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATID  874
             ++M PLS+LA  LGM Y FAESWAPEYGNAI+SKWPIK  KVQ+I+DD DFRNV+KATID
Sbjct  228   KQMTPLSNLAEALGMYYVFAESWAPEYGNAIMSKWPIKKWKVQRIYDDKDFRNVLKATID  287

Query  873   VPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIV  694
             VP VG++NF+CT LDHLDENWRMKQINAIIQSSD PHILAGGLNSLD +DYS +RW  IV
Sbjct  288   VPWVGDLNFYCTQLDHLDENWRMKQINAIIQSSDHPHILAGGLNSLDASDYSSERWTNIV  347

Query  693   KYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIV  514
             KYYEE+GKPTPK +V+ +LK K+Y DAK F GE E VV+IAKGQ VQGTCKYGTRVDYI+
Sbjct  348   KYYEELGKPTPKTQVVNFLKEKEYTDAKHFPGEFEPVVIIAKGQSVQGTCKYGTRVDYIM  407

Query  513   SSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             +SPD  Y FVPGSYSV+SSKGTSDHHIVKVD++KA
Sbjct  408   ASPDLPYNFVPGSYSVISSKGTSDHHIVKVDIMKA  442



>ref|XP_010070307.1| PREDICTED: uncharacterized protein LOC104457063 isoform X2 [Eucalyptus 
grandis]
Length=422

 Score =   428 bits (1101),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 198/238 (83%), Positives = 221/238 (93%), Gaps = 0/238 (0%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             TVVEVLREL+AD++ALQDVKAEEEREMKPLS+LAA LGM YAFAESWAPEYGNA+LS+WP
Sbjct  136   TVVEVLRELDADIVALQDVKAEEEREMKPLSELAAALGMSYAFAESWAPEYGNAVLSRWP  195

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTP  766
             IK  KVQKIFDD+DFRNV+KATI+VP VGE+NF CT LDHLDENWRMKQ+ AIIQSSD+P
Sbjct  196   IKHWKVQKIFDDTDFRNVLKATIEVPHVGEVNFQCTHLDHLDENWRMKQVGAIIQSSDSP  255

Query  765   HILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECES  586
             HILAGGLNSLDE +YS +RW +IVKYYEEMGKPTPKVEVM++LKSKQY DAKDF GECES
Sbjct  256   HILAGGLNSLDETNYSQERWTDIVKYYEEMGKPTPKVEVMRFLKSKQYTDAKDFAGECES  315

Query  585   VVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             VV+IAKGQ VQGTCKYGTRVDY+++SPD  YKF+PGSYSVLSSKGTS HHIVKVDV+K
Sbjct  316   VVVIAKGQSVQGTCKYGTRVDYLLASPDCPYKFIPGSYSVLSSKGTSYHHIVKVDVMK  373


 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 3/52 (6%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHP---NANLSEQQRFPKSKLRVSINLPDNEISLKKS  1255
             K  D   +  +KQSPLHP     +L++QQ+F +SKLRVSINLPDNEISL +S
Sbjct  13    KPEDMDARGTIKQSPLHPINGQDHLTKQQKFARSKLRVSINLPDNEISLLRS  64



>ref|XP_010070306.1| PREDICTED: uncharacterized protein LOC104457063 isoform X1 [Eucalyptus 
grandis]
 gb|KCW58949.1| hypothetical protein EUGRSUZ_H01575 [Eucalyptus grandis]
 gb|KCW58950.1| hypothetical protein EUGRSUZ_H01575 [Eucalyptus grandis]
Length=425

 Score =   428 bits (1101),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 198/238 (83%), Positives = 221/238 (93%), Gaps = 0/238 (0%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             TVVEVLREL+AD++ALQDVKAEEEREMKPLS+LAA LGM YAFAESWAPEYGNA+LS+WP
Sbjct  136   TVVEVLRELDADIVALQDVKAEEEREMKPLSELAAALGMSYAFAESWAPEYGNAVLSRWP  195

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTP  766
             IK  KVQKIFDD+DFRNV+KATI+VP VGE+NF CT LDHLDENWRMKQ+ AIIQSSD+P
Sbjct  196   IKHWKVQKIFDDTDFRNVLKATIEVPHVGEVNFQCTHLDHLDENWRMKQVGAIIQSSDSP  255

Query  765   HILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECES  586
             HILAGGLNSLDE +YS +RW +IVKYYEEMGKPTPKVEVM++LKSKQY DAKDF GECES
Sbjct  256   HILAGGLNSLDETNYSQERWTDIVKYYEEMGKPTPKVEVMRFLKSKQYTDAKDFAGECES  315

Query  585   VVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             VV+IAKGQ VQGTCKYGTRVDY+++SPD  YKF+PGSYSVLSSKGTS HHIVKVDV+K
Sbjct  316   VVVIAKGQSVQGTCKYGTRVDYLLASPDCPYKFIPGSYSVLSSKGTSYHHIVKVDVMK  373


 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 3/52 (6%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHP---NANLSEQQRFPKSKLRVSINLPDNEISLKKS  1255
             K  D   +  +KQSPLHP     +L++QQ+F +SKLRVSINLPDNEISL +S
Sbjct  13    KPEDMDARGTIKQSPLHPINGQDHLTKQQKFARSKLRVSINLPDNEISLLRS  64



>gb|KDO74935.1| hypothetical protein CISIN_1g012520mg [Citrus sinensis]
Length=461

 Score =   429 bits (1102),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 220/335 (66%), Positives = 258/335 (77%), Gaps = 21/335 (6%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFT  1237
             AK+  + PKSILKQSPLH +     +LS+Q+   +SKL+VSINLPDNEISL  S  L  +
Sbjct  113   AKAASYCPKSILKQSPLHTSLTSPEHLSKQKTVSRSKLKVSINLPDNEISLANSNVLMRS  172

Query  1236  NTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEE  1057
                L                      +    S + +R++ EVLRE++AD+L+LQDVKAEE
Sbjct  173   PVCLP-----------------TSMMTWMEESAKCSRSIAEVLREVDADILSLQDVKAEE  215

Query  1056  EREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATI  877
             E +MKPLSDLAA LGMKY FAESWAPEYGNAILSKWPIK  KVQKI DD DFRNV+KAT+
Sbjct  216   ENDMKPLSDLAAALGMKYVFAESWAPEYGNAILSKWPIKRWKVQKIADDKDFRNVLKATV  275

Query  876   DVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEI  697
             DVP  GE+N   T LDHL+E WRMKQI AIIQS+D+PHILAGGLNSLD +DYS +RW +I
Sbjct  276   DVPWAGEVNVDSTQLDHLNEKWRMKQICAIIQSNDSPHILAGGLNSLDGSDYSAERWMDI  335

Query  696   VKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYI  517
             VKYYE++GKPTP+VEVMK LK  +Y D+K+F GECE VV+IAKGQ VQGTCKYGTRVDYI
Sbjct  336   VKYYEDIGKPTPRVEVMKLLKGIEYVDSKEFAGECEPVVIIAKGQNVQGTCKYGTRVDYI  395

Query  516   VSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             ++SPDS YKFVPGSYSV+SSKGTSDHHIVKVDV K
Sbjct  396   LASPDSPYKFVPGSYSVISSKGTSDHHIVKVDVTK  430



>ref|NP_566121.1| endonuclease/exonuclease/phosphatase domain-containing protein 
[Arabidopsis thaliana]
 gb|AAD13707.1| expressed protein [Arabidopsis thaliana]
 gb|AAM67334.1| unknown [Arabidopsis thaliana]
 gb|ABG25088.1| At2g48030 [Arabidopsis thaliana]
 gb|AEC10926.1| endonuclease/exonuclease/phosphatase domain-containing protein 
[Arabidopsis thaliana]
Length=438

 Score =   428 bits (1100),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 220/337 (65%), Positives = 255/337 (76%), Gaps = 25/337 (7%)
 Frame = -1

Query  1404  AKSMDHRPKSILK--QSPLHPNANLSEQQRFPKSK-LRVSINLPDNEISLKKSGQLQFTN  1234
             +KS   RPKSILK   +   P  +  +QQRF KS+  RVSINLPDNEIS + S       
Sbjct  82    SKSTVDRPKSILKPMNAAASPTHDSRKQQRFAKSRPRRVSINLPDNEISRQLS-------  134

Query  1233  TFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEE  1054
              F +D                +          RSTRT +EVL EL+ADVLALQDVKA+E 
Sbjct  135   -FREDP--------------QHSPLRPGEIGLRSTRTALEVLSELDADVLALQDVKADEA  179

Query  1053  REMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATID  874
              +M+PLSDLAA LGM Y FAESWAPEYGNAILSKWPIKS  V +IFD +DFRNV+KA+I+
Sbjct  180   DQMRPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKSSNVLRIFDHTDFRNVLKASIE  239

Query  873   VPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIV  694
             VP  GE+ F CT LDHLDE WRMKQ++AIIQS++ PHILAG LNSLDE+DYSP+RW +IV
Sbjct  240   VPGSGEVEFHCTHLDHLDEKWRMKQVDAIIQSTNVPHILAGALNSLDESDYSPERWTDIV  299

Query  693   KYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIV  514
             KYYEEMGKP PK +VM++LKSK+Y DAKDF GECESVV++AKGQ VQGTCKYGTRVDYI+
Sbjct  300   KYYEEMGKPIPKAQVMRFLKSKEYTDAKDFAGECESVVVVAKGQSVQGTCKYGTRVDYIL  359

Query  513   SSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVG  403
             +S DS Y+FVPGSYSVLSSKGTSDHHIVKVDVVKA  
Sbjct  360   ASSDSPYRFVPGSYSVLSSKGTSDHHIVKVDVVKATS  396



>gb|KGN47880.1| hypothetical protein Csa_6G409370 [Cucumis sativus]
Length=480

 Score =   429 bits (1102),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 225/340 (66%), Positives = 266/340 (78%), Gaps = 14/340 (4%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQL-------  1246
              KS++ RPKSILKQSPLH N   S      ++K RVSINLPDNEISL ++ Q        
Sbjct  113   TKSVNDRPKSILKQSPLHTN---SINNGVARTKPRVSINLPDNEISLLRNRQASEYEMEE  169

Query  1245  QFTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVK  1066
               +++  D +G     +   +      S  S   +YR +RTVVEVLREL+AD+LALQDVK
Sbjct  170   NLSSSGNDRKG--MRIAKSGTPLRWTVSMPSERGTYRCSRTVVEVLRELDADILALQDVK  227

Query  1065  AEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMK  886
             AEEE++M+PLSDLA  LGMKY FAESWAPEYGNA+LS+WPIK  KV+KIFDD+DFRNV+K
Sbjct  228   AEEEKQMRPLSDLAEALGMKYVFAESWAPEYGNAVLSRWPIKRWKVEKIFDDTDFRNVLK  287

Query  885   ATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDT-PHILAGGLNSLDEADYSPQR  709
             ATIDV EVGE+N  CT LDHLDENWRMKQI +II+S++  PHIL GGLNSLD  DYS QR
Sbjct  288   ATIDVEEVGEVNVQCTHLDHLDENWRMKQIKSIIRSNNNEPHILLGGLNSLDPTDYSQQR  347

Query  708   WAEIVKYYEEMGKPTPKVEVMKYLKSK-QYCDAKDFGGECESVVMIAKGQCVQGTCKYGT  532
             W +IVKYYEE+GKPTP+ +V K+LKS  QY DAK+FGGECESVVMIAKGQ VQGTCKYGT
Sbjct  348   WMDIVKYYEEIGKPTPEAKVTKFLKSNMQYRDAKEFGGECESVVMIAKGQSVQGTCKYGT  407

Query  531   RVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             RVDYI++SPD+ Y+FV GSYSV+SSKGTSDHHIVKVD +K
Sbjct  408   RVDYIMASPDANYEFVQGSYSVISSKGTSDHHIVKVDFLK  447



>ref|XP_002277228.1| PREDICTED: uncharacterized protein LOC100259606 [Vitis vinifera]
Length=486

 Score =   429 bits (1102),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 220/334 (66%), Positives = 255/334 (76%), Gaps = 13/334 (4%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNANLSE---QQRFPKSKLRVSINLPDNEISLKKSGQLQFTN  1234
             AKS ++RPKSILKQSPLH   N  +   QQ+  +S+L+VSINLPDNEISL  S  L F  
Sbjct  112   AKSENYRPKSILKQSPLHSTPNTPDHLSQQKLTRSRLKVSINLPDNEISLANSKLLSFWE  171

Query  1233  TFLDDEGDgrgksplrsssslnfssssagrsy--------rstRTVVEVLRELNADVLAL  1078
             +  + EG        R    +                   RS+R+++EVLRE+NAD+LAL
Sbjct  172   S--EKEGSSSNGRNYRYKVPMRSPVCYPSSMSDYPIGEGLRSSRSILEVLREVNADILAL  229

Query  1077  QDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFR  898
             QDVKAEEE+ MKPLSDLA  LGMKY FAESWAPE+GNAILSKWPIK  K QKI D  DFR
Sbjct  230   QDVKAEEEKGMKPLSDLAGALGMKYVFAESWAPEFGNAILSKWPIKRWKAQKIIDGEDFR  289

Query  897   NVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYS  718
             NV+KATIDVP  GE+NF CT LDHLDENWRMKQ NAIIQSSD PHILAGGLNSL+ +DYS
Sbjct  290   NVLKATIDVPWAGEVNFHCTQLDHLDENWRMKQTNAIIQSSDCPHILAGGLNSLNGSDYS  349

Query  717   PQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKY  538
              +RW +I+KYYEE+GKPTPKV+VM++LK K+Y DAK+F GECE VV+IAKGQ VQGTCKY
Sbjct  350   RERWMDIIKYYEEIGKPTPKVDVMEFLKGKEYVDAKNFAGECEPVVIIAKGQNVQGTCKY  409

Query  537   GTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHH  436
             GTRVDYI++S DS YKFVP SYSV+SSKGTSDHH
Sbjct  410   GTRVDYILASQDSPYKFVPRSYSVISSKGTSDHH  443



>ref|XP_008795094.1| PREDICTED: uncharacterized protein LOC103710938 [Phoenix dactylifera]
Length=456

 Score =   427 bits (1098),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 221/345 (64%), Positives = 262/345 (76%), Gaps = 18/345 (5%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLD  1222
             K+ + RPKSILKQ            Q F +S LRVSINLPDNEIS K+S Q+  T    D
Sbjct  103   KTANDRPKSILKQ------------QSFARSNLRVSINLPDNEISAKRSKQMNSTKEGYD  150

Query  1221  D---EGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEER  1051
                 +  G+       S S          S+R +R+V++VLRE+ AD++ LQ+VKAEEE+
Sbjct  151   STRADWKGKSPVSYSFSLSAPLRGERGRESFRGSRSVLDVLREVGADIIGLQNVKAEEEK  210

Query  1050  EMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDV  871
              MKPLSDLAAGLGM Y FAESWA EYGNAILSKWPIK  +VQKIFDD+DFRNV+KATI+V
Sbjct  211   GMKPLSDLAAGLGMNYVFAESWALEYGNAILSKWPIKHWRVQKIFDDTDFRNVLKATIEV  270

Query  870   PEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVK  691
             P  GE+NF CT LDHLDENWRMKQ+N+I++ SD PHILAGGLN+L+E DYS +RWA+IVK
Sbjct  271   PNAGEVNFHCTHLDHLDENWRMKQMNSILRFSDGPHILAGGLNALEETDYSAERWADIVK  330

Query  690   YYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVS  511
             Y EE+GKPTPKVEVMK+LK K Y DAK+F GECE+VV++AKGQ VQGTCKYGTRVDYI++
Sbjct  331   YNEEIGKPTPKVEVMKFLKEKHYLDAKNFAGECEAVVVVAKGQDVQGTCKYGTRVDYILA  390

Query  510   SPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA---VGGSGCHH  385
             SP+S YKFVPGSY VLSSKGTSDHHIVKVD++ A      S C H
Sbjct  391   SPNSPYKFVPGSYGVLSSKGTSDHHIVKVDIMIANIKENDSRCRH  435



>ref|XP_004140218.1| PREDICTED: uncharacterized protein LOC101212223, partial [Cucumis 
sativus]
Length=486

 Score =   428 bits (1100),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 225/340 (66%), Positives = 266/340 (78%), Gaps = 14/340 (4%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQL-------  1246
              KS++ RPKSILKQSPLH N   S      ++K RVSINLPDNEISL ++ Q        
Sbjct  119   TKSVNDRPKSILKQSPLHTN---SINNGVARTKPRVSINLPDNEISLLRNRQASEYEMEE  175

Query  1245  QFTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVK  1066
               +++  D +G     +   +      S  S   +YR +RTVVEVLREL+AD+LALQDVK
Sbjct  176   NLSSSGNDRKG--MRIAKSGTPLRWTVSMPSERGTYRCSRTVVEVLRELDADILALQDVK  233

Query  1065  AEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMK  886
             AEEE++M+PLSDLA  LGMKY FAESWAPEYGNA+LS+WPIK  KV+KIFDD+DFRNV+K
Sbjct  234   AEEEKQMRPLSDLAEALGMKYVFAESWAPEYGNAVLSRWPIKRWKVEKIFDDTDFRNVLK  293

Query  885   ATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDT-PHILAGGLNSLDEADYSPQR  709
             ATIDV EVGE+N  CT LDHLDENWRMKQI +II+S++  PHIL GGLNSLD  DYS QR
Sbjct  294   ATIDVEEVGEVNVQCTHLDHLDENWRMKQIKSIIRSNNNEPHILLGGLNSLDPTDYSQQR  353

Query  708   WAEIVKYYEEMGKPTPKVEVMKYLKSK-QYCDAKDFGGECESVVMIAKGQCVQGTCKYGT  532
             W +IVKYYEE+GKPTP+ +V K+LKS  QY DAK+FGGECESVVMIAKGQ VQGTCKYGT
Sbjct  354   WMDIVKYYEEIGKPTPEAKVTKFLKSNMQYRDAKEFGGECESVVMIAKGQSVQGTCKYGT  413

Query  531   RVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             RVDYI++SPD+ Y+FV GSYSV+SSKGTSDHHIVKVD +K
Sbjct  414   RVDYIMASPDANYEFVQGSYSVISSKGTSDHHIVKVDFLK  453



>ref|XP_002516829.1| hydrolase, putative [Ricinus communis]
 gb|EEF45443.1| hydrolase, putative [Ricinus communis]
Length=490

 Score =   428 bits (1100),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 224/348 (64%), Positives = 268/348 (77%), Gaps = 20/348 (6%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNANL--SEQQRFPK--SKLRVSINLPDNEISLKKSGQLQFT  1237
             AK ++H PKSILKQSPL   ANL  S +Q  P+  SK +VSINLPDNEISL     L F 
Sbjct  114   AKPVNHHPKSILKQSPLRA-ANLISSPEQLSPQKVSKRKVSINLPDNEISLAHKKFLSFI  172

Query  1236  NTFLDDEGDgrgksplrsssslnfsss------------sagrsyrstRTVVEVLRELNA  1093
                 DD+         R++ S     S            +     +S+R+++EVLRE++A
Sbjct  173   E---DDKVGSSNIIASRNNRSSVVLRSPVCLPAKFLSHFTDEEGLKSSRSILEVLREVDA  229

Query  1092  DVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFD  913
             DVLALQDVKA+EE+ M+PLSDLAA LGMKYAFAESWAP+YGNAILSKWPIK  KVQKI +
Sbjct  230   DVLALQDVKAQEEKGMRPLSDLAASLGMKYAFAESWAPDYGNAILSKWPIKRWKVQKIAN  289

Query  912   DSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLD  733
             D DFRNV+KATI VP  GE++F+CT LDHL+ENWRMKQINAIIQS+++PH+LAGGLNSL 
Sbjct  290   DEDFRNVLKATISVPGAGELDFYCTQLDHLNENWRMKQINAIIQSTNSPHVLAGGLNSLT  349

Query  732   EADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQ  553
              +DYSP+RW +IVKYYEE+GKP PK+EV  +LK K+Y DAKDF GECE VV+IAKGQ VQ
Sbjct  350   GSDYSPERWMDIVKYYEEIGKPRPKIEVTNFLKGKEYIDAKDFAGECEPVVIIAKGQNVQ  409

Query  552   GTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             GTCKYGTRVDY+++S DS YKFVPGSY+V+SSKGTSDHHIVKVD+ KA
Sbjct  410   GTCKYGTRVDYVLASQDSPYKFVPGSYTVISSKGTSDHHIVKVDITKA  457



>ref|XP_004158629.1| PREDICTED: uncharacterized LOC101212223, partial [Cucumis sativus]
Length=491

 Score =   428 bits (1100),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 225/340 (66%), Positives = 266/340 (78%), Gaps = 14/340 (4%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQL-------  1246
              KS++ RPKSILKQSPLH N   S      ++K RVSINLPDNEISL ++ Q        
Sbjct  124   TKSVNDRPKSILKQSPLHTN---SINNGVARTKPRVSINLPDNEISLLRNRQASEYEMEE  180

Query  1245  QFTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVK  1066
               +++  D +G     +   +      S  S   +YR +RTVVEVLREL+AD+LALQDVK
Sbjct  181   NLSSSGNDRKG--MRIAKSGTPLRWTVSMPSERGTYRCSRTVVEVLRELDADILALQDVK  238

Query  1065  AEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMK  886
             AEEE++M+PLSDLA  LGMKY FAESWAPEYGNA+LS+WPIK  KV+KIFDD+DFRNV+K
Sbjct  239   AEEEKQMRPLSDLAEALGMKYVFAESWAPEYGNAVLSRWPIKRWKVEKIFDDTDFRNVLK  298

Query  885   ATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDT-PHILAGGLNSLDEADYSPQR  709
             ATIDV EVGE+N  CT LDHLDENWRMKQI +II+S++  PHIL GGLNSLD  DYS QR
Sbjct  299   ATIDVEEVGEVNVQCTHLDHLDENWRMKQIKSIIRSNNNEPHILLGGLNSLDPTDYSQQR  358

Query  708   WAEIVKYYEEMGKPTPKVEVMKYLKSK-QYCDAKDFGGECESVVMIAKGQCVQGTCKYGT  532
             W +IVKYYEE+GKPTP+ +V K+LKS  QY DAK+FGGECESVVMIAKGQ VQGTCKYGT
Sbjct  359   WMDIVKYYEEIGKPTPEAKVTKFLKSNMQYRDAKEFGGECESVVMIAKGQSVQGTCKYGT  418

Query  531   RVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             RVDYI++SPD+ Y+FV GSYSV+SSKGTSDHHIVKVD +K
Sbjct  419   RVDYIMASPDANYEFVQGSYSVISSKGTSDHHIVKVDFLK  458



>ref|XP_011071511.1| PREDICTED: uncharacterized protein LOC105156938 [Sesamum indicum]
Length=457

 Score =   426 bits (1096),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 212/326 (65%), Positives = 247/326 (76%), Gaps = 5/326 (2%)
 Frame = -1

Query  1389  HRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEGD  1210
              RPK ILKQSPLH   N SE     KSK +VSINLP+NEISL ++  +            
Sbjct  101   RRPKGILKQSPLHSMMNASE-----KSKPKVSINLPENEISLAQNKVISIVEDSSSKTFS  155

Query  1209  grgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLSD  1030
                +           ++         +RT+ +VL+E++AD+LALQDVKAEEE++M+PLSD
Sbjct  156   FNNRMRSPICFPAGMANWLTDVGLCGSRTIFDVLKEVDADILALQDVKAEEEKDMRPLSD  215

Query  1029  LAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEIN  850
             LA  LGM Y FAESWAPEYGNA+LSKWPIK  KVQKIFDD DFRNV+KATIDVP  GE+N
Sbjct  216   LARALGMNYVFAESWAPEYGNAVLSKWPIKRWKVQKIFDDKDFRNVIKATIDVPWTGELN  275

Query  849   FFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGK  670
              +CT LDHLDE WRM Q+NAIIQ+SD PHILAGGLNSLD +DYS +RW +IVKYYEE+GK
Sbjct  276   VYCTQLDHLDERWRMNQMNAIIQTSDQPHILAGGLNSLDASDYSSERWNDIVKYYEELGK  335

Query  669   PTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYK  490
             PTP+VEV  +LK ++Y DAK F GECE VVMIAKGQ VQGTCKYGTRVDYI+ SPD  YK
Sbjct  336   PTPRVEVTNFLKGREYTDAKHFPGECEPVVMIAKGQNVQGTCKYGTRVDYILGSPDLPYK  395

Query  489   FVPGSYSVLSSKGTSDHHIVKVDVVK  412
             FVPGSYSVLSSKGTSDHHIVKVD++K
Sbjct  396   FVPGSYSVLSSKGTSDHHIVKVDIMK  421



>ref|XP_008449463.1| PREDICTED: uncharacterized protein LOC103491341 [Cucumis melo]
Length=476

 Score =   426 bits (1094),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 226/340 (66%), Positives = 266/340 (78%), Gaps = 14/340 (4%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQL-------  1246
              KS++ RPKSILKQSPLH N   S      K+K RVSINLPDNEISL ++ Q        
Sbjct  113   TKSVNDRPKSILKQSPLHTN---SINSGVAKTKPRVSINLPDNEISLLRNRQASEYEMEE  169

Query  1245  QFTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVK  1066
               +++  D  G   G +   +      S  S   SYR +RTVVEVLR+L+AD+LALQDVK
Sbjct  170   NLSSSGNDRRG--MGIAKSGTPLRWTVSMPSERGSYRCSRTVVEVLRDLDADILALQDVK  227

Query  1065  AEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMK  886
             AEEE++M+PLSDLA  LGMKY FAESWAPEYGNA+LS+WPIK  KV+KIFDD+DFRNV+K
Sbjct  228   AEEEKQMRPLSDLAEALGMKYVFAESWAPEYGNAVLSRWPIKRWKVEKIFDDTDFRNVLK  287

Query  885   ATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDT-PHILAGGLNSLDEADYSPQR  709
             ATIDV EVGE+N  CT LDHLDENWRMKQI +II+S++  PHIL GGLNSLD  DYS QR
Sbjct  288   ATIDVEEVGEVNVQCTHLDHLDENWRMKQIKSIIRSNNNEPHILLGGLNSLDPTDYSQQR  347

Query  708   WAEIVKYYEEMGKPTPKVEVMKYLKSK-QYCDAKDFGGECESVVMIAKGQCVQGTCKYGT  532
             W +IVKYYEE+GKPTP+ +V K+LKS  QY DAK++GGECESVVMIAKGQ VQGTCKYGT
Sbjct  348   WTDIVKYYEEIGKPTPEAKVTKFLKSNMQYRDAKEYGGECESVVMIAKGQSVQGTCKYGT  407

Query  531   RVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             RVDYI++SPD+ Y+FV GSYSV+SSKGTSDHHIVKVD +K
Sbjct  408   RVDYILASPDANYEFVQGSYSVISSKGTSDHHIVKVDFLK  447



>ref|XP_009412182.1| PREDICTED: uncharacterized protein LOC103993734 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=503

 Score =   426 bits (1095),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 221/344 (64%), Positives = 257/344 (75%), Gaps = 17/344 (5%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLD  1222
             K+ + RPKSILKQ  L             K+KLRVSINLPDNEIS+++S Q        +
Sbjct  149   KAANDRPKSILKQPSL------------AKAKLRVSINLPDNEISVERSKQSSSRRQVGE  196

Query  1221  DEGDg---rgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEER  1051
             +       +       S S            R+ R+++EVLRE+ ADV+ LQ+VKAEEE+
Sbjct  197   ETTAAWKGKAPVSHSFSMSAVHGLGKEPEKLRADRSILEVLREVGADVIGLQNVKAEEEK  256

Query  1050  EMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDV  871
              MKPLSDLA GLGMKY FAESWAPEYGNAILSKWPIK  K +KI DD+DFRNV+KATI+V
Sbjct  257   GMKPLSDLAEGLGMKYVFAESWAPEYGNAILSKWPIKQWKAEKILDDADFRNVLKATIEV  316

Query  870   PEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVK  691
             P  GE+ F CT LDHLDENWRMKQIN+I++SSD PHIL GGLNSLDE DYS +RWA+IVK
Sbjct  317   PGAGEVEFHCTHLDHLDENWRMKQINSILRSSDRPHILVGGLNSLDETDYSAERWADIVK  376

Query  690   YYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVS  511
             YYEE+GKPTPKVEVMK+L+ KQY DAK+F GECE+VV++AKGQ VQGTCKYGTRVDYI+S
Sbjct  377   YYEEIGKPTPKVEVMKFLRGKQYLDAKNFAGECEAVVVVAKGQDVQGTCKYGTRVDYILS  436

Query  510   SPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVV--KAVGGSGCHH  385
             SP S YKFVPGSY VLSSKGTSDHHIVKVD+V  K  G S   H
Sbjct  437   SPYSPYKFVPGSYGVLSSKGTSDHHIVKVDMVIAKTDGSSSSRH  480



>ref|XP_010070298.1| PREDICTED: uncharacterized protein LOC104457057 isoform X1 [Eucalyptus 
grandis]
 gb|KCW58963.1| hypothetical protein EUGRSUZ_H01588 [Eucalyptus grandis]
Length=372

 Score =   421 bits (1081),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 197/238 (83%), Positives = 217/238 (91%), Gaps = 0/238 (0%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             TVVEVLREL  D++ALQDVKAEEEREMKPLS+LAA LG  YAFAESWAPEYGNA+LS WP
Sbjct  83    TVVEVLRELEVDIVALQDVKAEEEREMKPLSELAAVLGTSYAFAESWAPEYGNAVLSGWP  142

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTP  766
             IK  KVQKIFDD+DFRNV+KATI+VP VGE+NF CT LDHLDENWRMKQ+ AIIQSSD+P
Sbjct  143   IKHWKVQKIFDDTDFRNVLKATIEVPHVGEVNFQCTHLDHLDENWRMKQVGAIIQSSDSP  202

Query  765   HILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECES  586
             HILAGGLNSL+E DYS +RW +IVKYYEEMGKPTPKVEVM++LKSKQY DAKDF GECES
Sbjct  203   HILAGGLNSLEETDYSQERWTDIVKYYEEMGKPTPKVEVMRFLKSKQYTDAKDFAGECES  262

Query  585   VVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             VV+IAKGQ VQGTCKYGTRVDY+++SPD  YKF+PGSYSVLSSKGTSDHHIVKVDV K
Sbjct  263   VVVIAKGQSVQGTCKYGTRVDYLLASPDCPYKFIPGSYSVLSSKGTSDHHIVKVDVTK  320



>gb|KCW58939.1| hypothetical protein EUGRSUZ_H01562 [Eucalyptus grandis]
Length=292

 Score =   417 bits (1072),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/238 (82%), Positives = 217/238 (91%), Gaps = 0/238 (0%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             TVVEVLREL+ D++ALQDVKAEEEREMKPLS+LAA LGM Y FAESWA EYGNA+LS+WP
Sbjct  3     TVVEVLRELDVDIVALQDVKAEEEREMKPLSELAAALGMSYVFAESWALEYGNAVLSRWP  62

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTP  766
             IK  KVQKIFD +DF+NV+KATI+VP VGE+NF CT LDHLDENWRMKQ+ AIIQSSD+P
Sbjct  63    IKHLKVQKIFDVTDFKNVLKATIEVPHVGEVNFQCTHLDHLDENWRMKQVGAIIQSSDSP  122

Query  765   HILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECES  586
             HILAGGLNSLD+ DYS +RW +IV+YYEEMGKPTPKVEVM++LKSKQY DAKDF GECES
Sbjct  123   HILAGGLNSLDKTDYSQERWTDIVRYYEEMGKPTPKVEVMRFLKSKQYTDAKDFAGECES  182

Query  585   VVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             VV+IAKGQ VQGTCKYGTRVDYI++SPD  YKF+PGSYSVLSSKGTSDHHIVKVDV K
Sbjct  183   VVVIAKGQSVQGTCKYGTRVDYILASPDCPYKFIPGSYSVLSSKGTSDHHIVKVDVTK  240



>ref|XP_003542906.1| PREDICTED: uncharacterized protein LOC100818965 [Glycine max]
 gb|KHN37537.1| hypothetical protein glysoja_007240 [Glycine soja]
Length=494

 Score =   422 bits (1086),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 215/336 (64%), Positives = 256/336 (76%), Gaps = 12/336 (4%)
 Frame = -1

Query  1383  PKSILKQSPLHPN----ANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQ-------FT  1237
             PKSILKQSPLH +     NLS     P+S L+VSINLPDNEISL  S  L         +
Sbjct  111   PKSILKQSPLHASLDKAQNLSASNILPRSNLKVSINLPDNEISLANSRLLASMERKEGTS  170

Query  1236  NTFLDD-EGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAE  1060
             +T   +  G  +  +          +       +  +R+++EVLRE++ADVLALQDVKAE
Sbjct  171   DTITGNVSGRHQVPARSPVCFPFVMNYCEDTERFTCSRSIMEVLREIDADVLALQDVKAE  230

Query  1059  EEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKAT  880
             EE+ MKPLSDLAA LGMKY FAESWAPEYGNAILSKWPIK  +VQKI DD DFRNV+KAT
Sbjct  231   EEKNMKPLSDLAAALGMKYVFAESWAPEYGNAILSKWPIKKSRVQKIADDDDFRNVLKAT  290

Query  879   IDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAE  700
             IDVP  GEINF  T LDHLDE+WRMKQ++AII+S+D PHILAGGLNSL  ADYS +RW +
Sbjct  291   IDVPWAGEINFHSTQLDHLDESWRMKQVHAIIRSNDPPHILAGGLNSLYGADYSSERWTD  350

Query  699   IVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDY  520
             I KYYE++GKP P+ EVM ++KSK Y DAKD+ GECE +V+IAKGQ VQGTCKYGTRVDY
Sbjct  351   IFKYYEKLGKPRPRSEVMNFMKSKGYVDAKDYAGECEPIVIIAKGQNVQGTCKYGTRVDY  410

Query  519   IVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             I++SP+S YK+VPGSYSV+SSKGTSDHHIVKVD++K
Sbjct  411   ILASPNSPYKYVPGSYSVISSKGTSDHHIVKVDIMK  446



>ref|XP_003547225.1| PREDICTED: uncharacterized protein LOC100776616 [Glycine max]
 gb|KHN33095.1| hypothetical protein glysoja_010086 [Glycine soja]
Length=490

 Score =   421 bits (1083),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 213/336 (63%), Positives = 258/336 (77%), Gaps = 12/336 (4%)
 Frame = -1

Query  1383  PKSILKQSPLHPNAN----LSEQQRFPKSKLRVSINLPDNEISLKKSGQLQ-------FT  1237
             PKSILKQSPLH + +    LS+ +  P+S L+VSINLPDNEISL  S  L         +
Sbjct  111   PKSILKQSPLHASLDKAQSLSDSEILPRSNLKVSINLPDNEISLANSRLLASIESKEGTS  170

Query  1236  NTFLDD-EGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAE  1060
             +T + +  G  +  +          +       +  +R+++EVLRE++ADVLALQDVKAE
Sbjct  171   DTIMGNVSGRHQVPARSPVCFPFIMNYCEGTERFTCSRSILEVLREIDADVLALQDVKAE  230

Query  1059  EEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKAT  880
             EE+ MKPLSDLAA LGMKY FAESWAPEYGNAILSKWPIK  +VQKI DD DFRNV+KAT
Sbjct  231   EEKNMKPLSDLAAALGMKYVFAESWAPEYGNAILSKWPIKKWRVQKIADDDDFRNVLKAT  290

Query  879   IDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAE  700
             +DVP  GEINF  T LDHLDENWRMKQ++AII+S+D PHILAGGLNSL  ADYS +RW +
Sbjct  291   VDVPWAGEINFHSTQLDHLDENWRMKQVHAIIRSNDPPHILAGGLNSLYGADYSSERWTD  350

Query  699   IVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDY  520
             I KYYE++GKP P+ EVM ++KSK Y DAKD+ GECE + +IAKGQ VQGTCKYGTRVDY
Sbjct  351   IFKYYEKLGKPRPRSEVMNFVKSKGYVDAKDYAGECEPIAIIAKGQNVQGTCKYGTRVDY  410

Query  519   IVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             I++SP+S YK+VPGSYSV+SSKGTSDHHIVKVD++K
Sbjct  411   ILASPNSHYKYVPGSYSVISSKGTSDHHIVKVDIMK  446



>gb|KDP40059.1| hypothetical protein JCGZ_02057 [Jatropha curcas]
Length=489

 Score =   421 bits (1082),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 212/347 (61%), Positives = 265/347 (76%), Gaps = 19/347 (5%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLD  1222
             KS++  PKSILKQSPLH +   S +Q  P+ K +VSINLP NEISL +S  L    +F++
Sbjct  116   KSLNCHPKSILKQSPLHTSLQTSPEQ-LPQQK-KVSINLPHNEISLAQSKLL----SFIE  169

Query  1221  DEGDgrgksplrsssslnf-------------ssssagrsyrstRTVVEVLRELNADVLA  1081
             DE           +   +              +  +     +++R+++EVL+E++AD+LA
Sbjct  170   DEKVESSNIIASRNYRSSVVLRSPVCLPANFLTQFTGEEKSKNSRSILEVLKEVDADILA  229

Query  1080  LQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDF  901
             LQDVKA+EE+ M+PLSDLAA LGMKY FAESWAPEYGNAILSKWPIK  KVQKI +D DF
Sbjct  230   LQDVKAQEEKGMRPLSDLAALLGMKYVFAESWAPEYGNAILSKWPIKRWKVQKIANDEDF  289

Query  900   RNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADY  721
             RNV+KATI+VP  GE++F+CT LDHLDENWRMKQIN+I+Q+S++PHILAGG+NSL  +DY
Sbjct  290   RNVLKATINVPWAGELDFYCTQLDHLDENWRMKQINSIMQTSNSPHILAGGINSLTGSDY  349

Query  720   SPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCK  541
             SP+RW +IVKYYE++GKP PK+EV  +LK K+Y DAKDF GECE VVMIAKGQ VQGTCK
Sbjct  350   SPERWMDIVKYYEDIGKPRPKIEVTNFLKGKEYIDAKDFAGECEPVVMIAKGQNVQGTCK  409

Query  540   YGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGG  400
             YGTRVDY+++S D  YKFVPGSYSV+SSKGTSDHHIVK ++VK   G
Sbjct  410   YGTRVDYVLASADLSYKFVPGSYSVVSSKGTSDHHIVKAEIVKVSEG  456



>ref|XP_009772474.1| PREDICTED: uncharacterized protein LOC104222850 [Nicotiana sylvestris]
Length=492

 Score =   419 bits (1077),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 216/341 (63%), Positives = 262/341 (77%), Gaps = 13/341 (4%)
 Frame = -1

Query  1395  MDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKS---GQLQFTNTFL  1225
             ++ RPKSILK SPLHP           K K +VSINLP+NEISL ++   G L+  +T +
Sbjct  127   INSRPKSILKHSPLHPTL-----INGAKPKPKVSINLPENEISLAQNRVFGMLEDDSTKI  181

Query  1224  DDEGDgrgksplrs----ssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEE  1057
                 +             + +   ++   G     TR++++VL+E++AD+LALQDVKAEE
Sbjct  182   LSLNNNSLAPVRSPICFPAMAKWMNNDYGGDYLSGTRSILDVLKEVDADILALQDVKAEE  241

Query  1056  EREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATI  877
             E++M PLSDLA  LGM Y FAESWAPE+GNAILSKWPIK  ++QKIFDD DFRNV+KATI
Sbjct  242   EKDMSPLSDLAHALGMHYVFAESWAPEFGNAILSKWPIKRWRIQKIFDDKDFRNVLKATI  301

Query  876   DVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEI  697
             DVP +GE+NF CT LDHLDENWRMKQ+NAIIQS+D PHILAGGLNSLD +DYS +RW +I
Sbjct  302   DVPRMGELNFCCTQLDHLDENWRMKQVNAIIQSNDNPHILAGGLNSLDASDYSIERWTDI  361

Query  696   VKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYI  517
             VKYYEE+GKPTP+VEVMK+LK K+Y DAK+F GECESVV+IAKGQ VQGTCKYGTRVDYI
Sbjct  362   VKYYEEIGKPTPRVEVMKFLKGKEYSDAKEFAGECESVVIIAKGQNVQGTCKYGTRVDYI  421

Query  516   VSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGSG  394
             + S    Y FVPGSYSV+SSKGTSDHHIVKV+++K V GSG
Sbjct  422   LGSQGLPYAFVPGSYSVVSSKGTSDHHIVKVEIMK-VAGSG  461



>ref|XP_004486299.1| PREDICTED: uncharacterized protein LOC101497549 [Cicer arietinum]
Length=456

 Score =   417 bits (1072),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 213/325 (66%), Positives = 252/325 (78%), Gaps = 10/325 (3%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEGDgr  1204
             PKSILKQSPLH +         P+S L+VSINLPDNEISL  S  +   +    ++   R
Sbjct  99    PKSILKQSPLHGS--------IPRSNLKVSINLPDNEISLANSSNM--VSVSRRNQVPAR  148

Query  1203  gksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLSDLA  1024
                      ++N+S   + +    +R+++EVLRE++ADV+ALQDVKAEEE+ MKPLSDLA
Sbjct  149   SPVCFPFMMNMNYSCEGSEKLSGGSRSILEVLREIDADVVALQDVKAEEEKSMKPLSDLA  208

Query  1023  AGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFF  844
             A LGMKY FAESWAPEYGNAILSKWPIK  KVQKI DD DFRNV+KATIDVP  GEINF 
Sbjct  209   AALGMKYVFAESWAPEYGNAILSKWPIKKWKVQKIADDDDFRNVIKATIDVPWAGEINFH  268

Query  843   CTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPT  664
              T LDHLDENWRMKQ+NA+I+S+D PHILAGGLNSL  ADYS +RW +IV YYE++GKP 
Sbjct  269   STQLDHLDENWRMKQVNALIRSNDPPHILAGGLNSLYRADYSSERWTDIVNYYEKLGKPR  328

Query  663   PKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFV  484
             P  EVM ++KSK Y DAKD+ GECE +V+IAKGQ VQGTCKYGTRVDYI+ S +S YKFV
Sbjct  329   PMTEVMNFMKSKYYDDAKDYAGECEPIVIIAKGQNVQGTCKYGTRVDYILGSSNSPYKFV  388

Query  483   PGSYSVLSSKGTSDHHIVKVDVVKA  409
             PGSYSV+SSKGTSDHHIVKVD++K 
Sbjct  389   PGSYSVISSKGTSDHHIVKVDIMKV  413



>ref|XP_004229477.1| PREDICTED: uncharacterized protein LOC101267932 [Solanum lycopersicum]
Length=492

 Score =   417 bits (1072),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 215/344 (63%), Positives = 259/344 (75%), Gaps = 22/344 (6%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHPN-ANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFL  1225
             KS ++RPKSILK SPLHP  AN +      K K +VSINLP+NEISL ++  L      L
Sbjct  125   KSENNRPKSILKHSPLHPILANGA------KPKQKVSINLPENEISLAQNRVL----GIL  174

Query  1224  DDEGDgrgksplrsssslnfssssagrsy-----------rstRTVVEVLRELNADVLAL  1078
             +D+          +   +         +              TRT+++VL+E++AD+LAL
Sbjct  175   EDDSTKILSLNNNNLGPVRSPICFPAMANWMINDYGGFCLSGTRTILDVLKEVDADILAL  234

Query  1077  QDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFR  898
             QDVKAEEE++M PLSDLA  LGM Y FAESWAPEYGNAILSKWPIK  ++QKI+DD DFR
Sbjct  235   QDVKAEEEKDMSPLSDLARALGMNYVFAESWAPEYGNAILSKWPIKKWRIQKIYDDKDFR  294

Query  897   NVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYS  718
             NV+KAT+DVP +GE+NF CT LDHLDENWRMKQINAIIQS+D+PHILAGG+NSL  +DYS
Sbjct  295   NVLKATVDVPRMGELNFCCTQLDHLDENWRMKQINAIIQSNDSPHILAGGVNSLQASDYS  354

Query  717   PQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKY  538
              +RW +IVKYYEE+GKPTP+VEVM +LK K+Y DAK+F GECESVV+IAKGQ VQGTCKY
Sbjct  355   LERWNDIVKYYEEIGKPTPRVEVMNFLKQKEYNDAKEFAGECESVVIIAKGQNVQGTCKY  414

Query  537   GTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAV  406
             GTRVDYI+ S    Y FVPGSYSV+SSKGTSDHHIVKVD++KA 
Sbjct  415   GTRVDYILGSQGLPYAFVPGSYSVVSSKGTSDHHIVKVDIMKAA  458



>ref|XP_006365276.1| PREDICTED: uncharacterized protein LOC102593112 [Solanum tuberosum]
Length=487

 Score =   416 bits (1070),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 213/343 (62%), Positives = 256/343 (75%), Gaps = 20/343 (6%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLD  1222
             KS ++RPKSILK SPLHP           K K +VSINLP+NEISL ++  L      L+
Sbjct  125   KSENNRPKSILKHSPLHPILTNGA-----KPKQKVSINLPENEISLAQNRVL----GILE  175

Query  1221  DEGDgrgksplrsssslnfssssagrsy-----------rstRTVVEVLRELNADVLALQ  1075
             D+          S   +         +              TRT+++VL+E++AD+LALQ
Sbjct  176   DDSTKILSLNNNSLGPVRSPICFPAMANWMINDYGGCCLSGTRTILDVLKEVDADILALQ  235

Query  1074  DVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRN  895
             DVKAEEE++M PLSDLA  LGM Y FAESWAPE+GNAILSKWPIK  ++QKI+DD DFRN
Sbjct  236   DVKAEEEKDMSPLSDLARALGMNYVFAESWAPEFGNAILSKWPIKKWRIQKIYDDKDFRN  295

Query  894   VMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSP  715
             V+KAT+DVP +GE+NF CT LDHLDENWRMKQINAIIQS+D+PHILAGG+NSL+ +DYS 
Sbjct  296   VLKATVDVPRMGELNFCCTQLDHLDENWRMKQINAIIQSNDSPHILAGGINSLEASDYSL  355

Query  714   QRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYG  535
             +RW +IVKYYEE+GKPTP+VEVM +LK K+Y DAK+F GECESVV+IAKGQ VQGTCKYG
Sbjct  356   ERWNDIVKYYEEIGKPTPRVEVMNFLKQKEYNDAKEFAGECESVVIIAKGQNVQGTCKYG  415

Query  534   TRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAV  406
             TRVDYI+ S    Y FVPGSYSV SSKGTSDHHIVKVD++KA 
Sbjct  416   TRVDYILGSQGLPYAFVPGSYSVFSSKGTSDHHIVKVDIMKAA  458



>ref|XP_009628600.1| PREDICTED: uncharacterized protein LOC104118917 [Nicotiana tomentosiformis]
Length=488

 Score =   416 bits (1069),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 212/340 (62%), Positives = 259/340 (76%), Gaps = 12/340 (4%)
 Frame = -1

Query  1395  MDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKS---GQLQFTNTFL  1225
             ++ RPKSILK SPLHP           K K +VSINLP+NEISL ++   G L+  +T +
Sbjct  127   INSRPKSILKHSPLHPTL-----INGAKPKPKVSINLPENEISLAQNRVFGMLEDDSTKI  181

Query  1224  DDEGDgrgksplrs----ssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEE  1057
                 +             + +   ++   G     TR++++VL+E++AD+LALQDVKAEE
Sbjct  182   LSLNNNSLAPVRSPICFPAMAKWMNNDYGGDYLSGTRSILDVLKEVDADILALQDVKAEE  241

Query  1056  EREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATI  877
             E++M+PLS LA  LGM Y FAESWAPE+GNAILSKWPIK  ++QKIFDD DFRNV+KATI
Sbjct  242   EKDMRPLSGLAHALGMHYVFAESWAPEFGNAILSKWPIKRWRIQKIFDDKDFRNVLKATI  301

Query  876   DVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEI  697
             DVP +GE+NF CT LDHLDENWRMKQINAIIQS+D PHILAGGLNSLD +DYS +RW +I
Sbjct  302   DVPRIGELNFCCTQLDHLDENWRMKQINAIIQSNDNPHILAGGLNSLDASDYSLERWTDI  361

Query  696   VKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYI  517
             VKYYEE+GKPTP+VEVMK+LK K+Y DAK+F GECESVV+IAKGQ VQGTCKYGTRVDYI
Sbjct  362   VKYYEEIGKPTPRVEVMKFLKGKEYSDAKEFAGECESVVIIAKGQNVQGTCKYGTRVDYI  421

Query  516   VSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGS  397
             + S    Y FVP SYSV+SSKGTSDHHIVKV+++K  G +
Sbjct  422   LGSQGLPYAFVPESYSVVSSKGTSDHHIVKVEIMKVAGSA  461



>gb|KEH36727.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=470

 Score =   415 bits (1067),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 217/338 (64%), Positives = 251/338 (74%), Gaps = 17/338 (5%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLS--EQQRFPKSKLR-VSINLPDNEISLKKSGQLQFTNTFLDDEG  1213
             PKSILKQSPLH + NLS  +    P+S L+ VSINLPDNEISL  S  L      ++D G
Sbjct  106   PKSILKQSPLHSSMNLSNSDTNIMPRSNLKQVSINLPDNEISLANSKIL----GSIEDIG  161

Query  1212  Dgrgksplr----------sssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKA  1063
                 +                +            + S+R+++EVLRE++ADV+ALQDVKA
Sbjct  162   SVSSRRNQVPARSPVCFPFLMNMNMNYCEEVNEKFSSSRSILEVLREIDADVVALQDVKA  221

Query  1062  EEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKA  883
             EEE+ M+PLSDLAA LGMKY FAESWAPEYGNAILSKWPIK  KVQKI DD DFRNV+KA
Sbjct  222   EEEKCMRPLSDLAAALGMKYVFAESWAPEYGNAILSKWPIKKWKVQKIADDDDFRNVLKA  281

Query  882   TIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWA  703
             TIDVP  GEIN   T LDHLDENWRMKQ+NAII+S+D PHILAGGLNSL  ADYS QRW 
Sbjct  282   TIDVPWAGEINLHSTQLDHLDENWRMKQVNAIIRSNDPPHILAGGLNSLYRADYSSQRWT  341

Query  702   EIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVD  523
             +IV YYE++GKP P  EVM ++KSK Y DAKD+ GECE +V+IAKGQ VQGTCKYGTRVD
Sbjct  342   DIVNYYEKLGKPRPMTEVMNFMKSKDYDDAKDYAGECEPIVIIAKGQNVQGTCKYGTRVD  401

Query  522   YIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             YI+ S  S YKFVPGSYSV+SSKGTSDHHIVKVD++K 
Sbjct  402   YILGSSKSPYKFVPGSYSVISSKGTSDHHIVKVDIMKV  439



>gb|AES64309.2| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=488

 Score =   416 bits (1069),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 217/338 (64%), Positives = 251/338 (74%), Gaps = 17/338 (5%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLS--EQQRFPKSKLR-VSINLPDNEISLKKSGQLQFTNTFLDDEG  1213
             PKSILKQSPLH + NLS  +    P+S L+ VSINLPDNEISL  S  L      ++D G
Sbjct  124   PKSILKQSPLHSSMNLSNSDTNIMPRSNLKQVSINLPDNEISLANSKIL----GSIEDIG  179

Query  1212  Dgrgksplr----------sssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKA  1063
                 +                +            + S+R+++EVLRE++ADV+ALQDVKA
Sbjct  180   SVSSRRNQVPARSPVCFPFLMNMNMNYCEEVNEKFSSSRSILEVLREIDADVVALQDVKA  239

Query  1062  EEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKA  883
             EEE+ M+PLSDLAA LGMKY FAESWAPEYGNAILSKWPIK  KVQKI DD DFRNV+KA
Sbjct  240   EEEKCMRPLSDLAAALGMKYVFAESWAPEYGNAILSKWPIKKWKVQKIADDDDFRNVLKA  299

Query  882   TIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWA  703
             TIDVP  GEIN   T LDHLDENWRMKQ+NAII+S+D PHILAGGLNSL  ADYS QRW 
Sbjct  300   TIDVPWAGEINLHSTQLDHLDENWRMKQVNAIIRSNDPPHILAGGLNSLYRADYSSQRWT  359

Query  702   EIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVD  523
             +IV YYE++GKP P  EVM ++KSK Y DAKD+ GECE +V+IAKGQ VQGTCKYGTRVD
Sbjct  360   DIVNYYEKLGKPRPMTEVMNFMKSKDYDDAKDYAGECEPIVIIAKGQNVQGTCKYGTRVD  419

Query  522   YIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             YI+ S  S YKFVPGSYSV+SSKGTSDHHIVKVD++K 
Sbjct  420   YILGSSKSPYKFVPGSYSVISSKGTSDHHIVKVDIMKV  457



>ref|XP_010036232.1| PREDICTED: uncharacterized protein LOC104425275 [Eucalyptus grandis]
 gb|KCW84359.1| hypothetical protein EUGRSUZ_B01211 [Eucalyptus grandis]
Length=496

 Score =   416 bits (1068),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 222/349 (64%), Positives = 266/349 (76%), Gaps = 22/349 (6%)
 Frame = -1

Query  1395  MDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTN------  1234
             +D +P+SILKQSPLHP+ N     R  +S L+VSINLP+NEIS+  S  L F        
Sbjct  125   LDSQPRSILKQSPLHPSVN----GRPARSNLKVSINLPENEISIANSKLLGFIQENDVKS  180

Query  1233  --TFLDDEGDgrgksplrs------ssslnfssssagrsyrstRTVVEVLRELNADVLAL  1078
                 +    + R K P+RS      S +L  S S+   + RS ++++EVLRE+NAD+LAL
Sbjct  181   PPIMITSSANTRSKVPVRSPICFPYSLALGNSRSNHEENLRSGKSILEVLREVNADILAL  240

Query  1077  QDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFR  898
             QDVKAEEE+ M+PLSDLA+ LGM Y FAESWAPEYGNAILS+WPIK  +VQKI DD DFR
Sbjct  241   QDVKAEEEKGMRPLSDLASALGMDYVFAESWAPEYGNAILSRWPIKRWRVQKIADDDDFR  300

Query  897   NVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYS  718
             NV+KATIDVP  GE++F CT LDHLDE WRM+QI AI+QS D PHILAGGLNSLDE+DYS
Sbjct  301   NVLKATIDVPWAGELSFNCTQLDHLDEFWRMRQIRAIVQSYDPPHILAGGLNSLDESDYS  360

Query  717   PQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKY  538
               RW +IVKYYE++GKPTPKVEV K+LK K Y DAK+  G+CE VV+IAKGQ VQGTCKY
Sbjct  361   ISRWMDIVKYYEDIGKPTPKVEVTKFLKGKDYIDAKNSAGDCEPVVIIAKGQNVQGTCKY  420

Query  537   GTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGSGC  391
             GTRVDY+ +SP++ YKFVP SYSV+SSKGTSDHHIVKVDVVK    +GC
Sbjct  421   GTRVDYVWASPEAPYKFVPNSYSVISSKGTSDHHIVKVDVVK----TGC  465



>ref|XP_007147831.1| hypothetical protein PHAVU_006G158700g [Phaseolus vulgaris]
 gb|ESW19825.1| hypothetical protein PHAVU_006G158700g [Phaseolus vulgaris]
Length=492

 Score =   415 bits (1066),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 210/337 (62%), Positives = 250/337 (74%), Gaps = 13/337 (4%)
 Frame = -1

Query  1383  PKSILKQSPLHPNAN----LSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDE  1216
             PKSILKQSPLH + N    LS+ +  P+S L+VSINLPDNEISL  S  L    +  +  
Sbjct  110   PKSILKQSPLHASLNKAQHLSDSESLPRSNLKVSINLPDNEISLANSRLLASMESTKEGT  169

Query  1215  GDgrgksplrsssslnfsss---------sagrsyrstRTVVEVLRELNADVLALQDVKA  1063
              D    +          S                + S+R+++EVLRE++ADV+ALQDVKA
Sbjct  170   SDTIMGNVSGRHQVPARSPVCFPFIMNCCEGSERFTSSRSILEVLREIDADVMALQDVKA  229

Query  1062  EEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKA  883
             EEE+ MKPLSDLAA LGMKY FAESWAPEYGNAILSKWPIK  KVQKI DD+DFRNV+KA
Sbjct  230   EEEKNMKPLSDLAAALGMKYVFAESWAPEYGNAILSKWPIKKWKVQKIADDNDFRNVLKA  289

Query  882   TIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWA  703
             TIDVP  GEIN   T LDHLDENWRMKQ+ AI  S+D PHILAGGLNSL   DYS QRW 
Sbjct  290   TIDVPWAGEINLHSTQLDHLDENWRMKQVKAIFGSNDPPHILAGGLNSLYAPDYSSQRWT  349

Query  702   EIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVD  523
             +I  YYE++GKP P+ EVM  +KS+ Y DAKD+ GECE +V+IAKGQ VQGTCKYGTRVD
Sbjct  350   DIFNYYEKLGKPRPRSEVMNLMKSRGYIDAKDYAGECEPIVIIAKGQNVQGTCKYGTRVD  409

Query  522   YIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             Y+++SP+S YK+VPGSYSV+SSKGTSDHHIVKV++++
Sbjct  410   YVLASPNSPYKYVPGSYSVISSKGTSDHHIVKVEIMR  446



>ref|XP_002312721.1| endonuclease/exonuclease/phosphatase family protein [Populus 
trichocarpa]
 gb|EEE90088.1| endonuclease/exonuclease/phosphatase family protein [Populus 
trichocarpa]
Length=493

 Score =   414 bits (1063),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 215/349 (62%), Positives = 268/349 (77%), Gaps = 19/349 (5%)
 Frame = -1

Query  1398  SMDHRPKSILKQSPLHPNANLSEQ----QRFPKSKLRVSINLPDNEISLKKSGQLQFTNT  1231
             S+ + PKSILKQSPLH +   SEQ    ++  +SKL+VSINLPDNEISL  S  L F + 
Sbjct  115   SVSYYPKSILKQSPLHDSLKNSEQFPAEKKVSRSKLKVSINLPDNEISLANSKLLGFVD-  173

Query  1230  FLDDEGDgrgksplrssss-----------lnfssssagrsyrstRTVVEVLRELNADVL  1084
               D++G        R+  S            N +   +   ++S+R+++EVL+E+++D+L
Sbjct  174   --DEKGGSSNIVASRNYRSNVVMRSPVCLPANMTQFISEEGWKSSRSIMEVLKEVDSDIL  231

Query  1083  ALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSD  904
             ALQDVKA+EE+ M PLSDLAA LGMKY FAESWAP YGNAILSKWPIK  KVQKI +D D
Sbjct  232   ALQDVKADEEKGMSPLSDLAASLGMKYVFAESWAPGYGNAILSKWPIKRWKVQKIANDED  291

Query  903   FRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSD-TPHILAGGLNSLDEA  727
             FRNV+KATI VP  GE++F+CT LDHLDENWRMKQI A+I+S+D TPHILAGG+NSLD +
Sbjct  292   FRNVLKATIYVPWAGEVDFYCTQLDHLDENWRMKQIGAMIKSNDMTPHILAGGINSLDGS  351

Query  726   DYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGT  547
             DYS +RW +IVKYYE++GKPTP++EV K+LK K Y DAK++ GECE VV++AKGQ VQGT
Sbjct  352   DYSSERWMDIVKYYEDIGKPTPRIEVTKFLKGKGYVDAKEYAGECEPVVIVAKGQNVQGT  411

Query  546   CKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGG  400
             CKYGTRVDY+++SP S YKFVPGSYSV+SSKGTSDHHIVK D++K   G
Sbjct  412   CKYGTRVDYMLASPYSPYKFVPGSYSVISSKGTSDHHIVKADIIKVGEG  460



>ref|XP_011006081.1| PREDICTED: uncharacterized protein LOC105112182 [Populus euphratica]
Length=493

 Score =   413 bits (1061),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 212/346 (61%), Positives = 261/346 (75%), Gaps = 13/346 (4%)
 Frame = -1

Query  1398  SMDHRPKSILKQSPLHPNANLSEQ----QRFPKSKLRVSINLPDNEISLKKSGQLQF---  1240
             S+ + PKSILKQSPLH +   SEQ    ++  +SKL+VSINLPDNEISL  S  L F   
Sbjct  115   SVSYYPKSILKQSPLHDSLKNSEQFPAEKKVSRSKLKVSINLPDNEISLANSKLLGFVDD  174

Query  1239  -----TNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQ  1075
                  +N                     N +   +   ++S+R+++EVL+E+++D+LALQ
Sbjct  175   ESGGCSNIVTSRNYRSNVVMRSPVCLPANMTQFISEEGWKSSRSIMEVLKEVDSDILALQ  234

Query  1074  DVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRN  895
             DVKA+EE+ M PLSDLA  LGMKY FAESWAP YGNAILSKWPIK  KVQKI +D DFRN
Sbjct  235   DVKADEEKGMSPLSDLATSLGMKYVFAESWAPGYGNAILSKWPIKRWKVQKIANDEDFRN  294

Query  894   VMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSD-TPHILAGGLNSLDEADYS  718
             V+KATI VP  GE++F+CT LDHLDENWRMKQI A+I+S+D TPHILAGG+NSLD +DYS
Sbjct  295   VLKATIYVPWAGEVDFYCTQLDHLDENWRMKQIGAMIKSNDMTPHILAGGINSLDGSDYS  354

Query  717   PQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKY  538
              +RW +IVKYYE++GKPTP+ EV ++LK K Y DAKD+ GECE VV++AKGQ VQGTCKY
Sbjct  355   SERWMDIVKYYEDIGKPTPRTEVTRFLKGKGYVDAKDYAGECEPVVIVAKGQNVQGTCKY  414

Query  537   GTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGG  400
             GTRVDY+++SP S YKFVPGSYSV+SSKGTSDHHIVK D++KA  G
Sbjct  415   GTRVDYMLASPYSPYKFVPGSYSVISSKGTSDHHIVKADILKAGEG  460



>ref|XP_008438759.1| PREDICTED: uncharacterized protein LOC103483772 [Cucumis melo]
Length=473

 Score =   412 bits (1058),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 212/335 (63%), Positives = 252/335 (75%), Gaps = 10/335 (3%)
 Frame = -1

Query  1395  MDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISL---KKSGQLQFTNTFL  1225
             ++H PKSILKQSPLH NA LS+ +   +SK +VSINLPDNEISL   K S  ++     L
Sbjct  106   VNHCPKSILKQSPLH-NA-LSKTESLSRSKPKVSINLPDNEISLANNKLSASMEEETPSL  163

Query  1224  DDEGDgrgksplrsssslnfssssagr-----syrstRTVVEVLRELNADVLALQDVKAE  1060
                 D R         S      S           S++T++EVL+E +AD+LALQDVKAE
Sbjct  164   TKTTDKRYFKSQVPVRSPVCFPFSIANWHCEDHLTSSKTILEVLKEADADILALQDVKAE  223

Query  1059  EEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKAT  880
             E + MKPLSDLAA LGM Y FAESWAPEYGNA+LSKWPI+  KVQKI DD DFRN++K  
Sbjct  224   ESKGMKPLSDLAAALGMDYVFAESWAPEYGNAVLSKWPIRRWKVQKIADDDDFRNLLKVA  283

Query  879   IDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAE  700
             IDVP  GE+N +CT LDHLDENWRMKQINAI +S D PHIL GGLNSL+ +DYSP RW +
Sbjct  284   IDVPGTGEVNIYCTQLDHLDENWRMKQINAITKSVDCPHILVGGLNSLERSDYSPGRWTD  343

Query  699   IVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDY  520
             IV+YYE++GKPTPKVEVMK+L  K Y D+KD+ G+CE VV++AKGQ VQGTCKYGTRVDY
Sbjct  344   IVEYYEKVGKPTPKVEVMKFLSGKGYIDSKDYAGDCEPVVIMAKGQNVQGTCKYGTRVDY  403

Query  519   IVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVV  415
             I++SPDS +KFVPGSYSV+SSKGTSDHHIVK + V
Sbjct  404   ILASPDSTFKFVPGSYSVISSKGTSDHHIVKAEFV  438



>ref|XP_004134173.1| PREDICTED: uncharacterized protein LOC101215085 [Cucumis sativus]
 gb|KGN57048.1| hypothetical protein Csa_3G150770 [Cucumis sativus]
Length=472

 Score =   409 bits (1052),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 211/335 (63%), Positives = 250/335 (75%), Gaps = 10/335 (3%)
 Frame = -1

Query  1395  MDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISL---KKSGQLQFTNTFL  1225
             ++H PKSILKQSPLH    LS+ +   +SK +VSINLPDNEISL   K S  ++     L
Sbjct  106   VNHCPKSILKQSPLH--TALSKTESLSRSKPKVSINLPDNEISLANNKLSASMENGTPGL  163

Query  1224  DDEGDgrgksplrsssslnfssssagr-----syrstRTVVEVLRELNADVLALQDVKAE  1060
                 D R         S      S           S+RT++EVL+E +AD+LALQDVKAE
Sbjct  164   TKTTDKRYFKSQVPVRSPVCFPFSIANWHCEDDLTSSRTILEVLKEADADILALQDVKAE  223

Query  1059  EEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKAT  880
             E + MKPLSDLAA LGM Y FAESWAPEYGNA+LSKWPIK  KVQKI DD DFRN++K  
Sbjct  224   ESKGMKPLSDLAAALGMDYVFAESWAPEYGNAVLSKWPIKRWKVQKIADDDDFRNLLKVA  283

Query  879   IDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAE  700
             IDVP  GE+N +CT LDHLDENWRMKQINAI +S D PHIL GGLNSL+++DYSP+RW  
Sbjct  284   IDVPGTGEVNIYCTQLDHLDENWRMKQINAITKSVDCPHILVGGLNSLEKSDYSPERWTN  343

Query  699   IVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDY  520
             IV+YYE++GKPTPKVEVMK+L  K Y D+KD+ G+CE VV++AKGQ VQGTCKYGTRVDY
Sbjct  344   IVEYYEKVGKPTPKVEVMKFLSGKGYIDSKDYAGDCEPVVIMAKGQNVQGTCKYGTRVDY  403

Query  519   IVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVV  415
             I++S DS +KFVPGSYSV+SSKGTSDHHIVK + V
Sbjct  404   ILASQDSTFKFVPGSYSVVSSKGTSDHHIVKAEFV  438



>ref|XP_004159838.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101215085 
[Cucumis sativus]
Length=472

 Score =   409 bits (1051),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 211/335 (63%), Positives = 250/335 (75%), Gaps = 10/335 (3%)
 Frame = -1

Query  1395  MDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISL---KKSGQLQFTNTFL  1225
             ++H PKSILKQSPLH    LS+ +   +SK +VSINLPDNEISL   K S  ++     L
Sbjct  106   VNHCPKSILKQSPLH--TALSKTESLSRSKPKVSINLPDNEISLANNKLSASMENGTPGL  163

Query  1224  DDEGDgrgksplrsssslnfssssagr-----syrstRTVVEVLRELNADVLALQDVKAE  1060
                 D R         S      S           S+RT++EVL+E +AD+LALQDVKAE
Sbjct  164   TKTTDKRYFKSQVPVRSPVCFPFSIANWHCEDDLTSSRTILEVLKEADADILALQDVKAE  223

Query  1059  EEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKAT  880
             E + MKPLSDLAA LGM Y FAESWAPEYGNA+LSKWPIK  KVQKI DD DFRN++K  
Sbjct  224   ESKGMKPLSDLAAALGMDYVFAESWAPEYGNAVLSKWPIKRWKVQKIADDDDFRNLLKVA  283

Query  879   IDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAE  700
             IDVP  GE+N +CT LDHLDENWRMKQINAI +S D PHIL GGLNSL+++DYSP+RW  
Sbjct  284   IDVPGTGEVNIYCTQLDHLDENWRMKQINAITKSVDCPHILVGGLNSLEKSDYSPERWTN  343

Query  699   IVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDY  520
             IV+YYE++GKPTPKVEVMK+L  K Y D+KD+ G+CE VV++AKGQ VQGTCKYGTRVDY
Sbjct  344   IVEYYEKVGKPTPKVEVMKFLSGKGYIDSKDYAGDCEPVVIMAKGQNVQGTCKYGTRVDY  403

Query  519   IVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVV  415
             I++S DS +KFVPGSYSV+SSKGTSDHHIVK + V
Sbjct  404   ILASQDSTFKFVPGSYSVVSSKGTSDHHIVKAEFV  438



>ref|XP_002463284.1| hypothetical protein SORBIDRAFT_02g041190 [Sorghum bicolor]
 gb|EER99805.1| hypothetical protein SORBIDRAFT_02g041190 [Sorghum bicolor]
Length=451

 Score =   402 bits (1034),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 200/323 (62%), Positives = 243/323 (75%), Gaps = 20/323 (6%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEGDgr  1204
             PK ILK       A+L+   R P SK RVSINL DNEISL++      T  +    G   
Sbjct  117   PKGILKA---QAAASLA---RSP-SKARVSINLQDNEISLER------TRLWRGGGGGST  163

Query  1203  gksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLSDLA  1024
              +   +   + +              +V EVLRE  AD++ LQ+V+AEEER M+PLS+LA
Sbjct  164   KRQQQQPVPASSAPRPRRW-------SVEEVLREAGADIIGLQNVRAEEERGMRPLSELA  216

Query  1023  AGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFF  844
              GLGM+Y FAESWAPEYGNA+LS+WPIK  K  ++ D SDFRNV++ATI+VP+ GE+NF 
Sbjct  217   EGLGMRYVFAESWAPEYGNAVLSRWPIKRWKAHRVADQSDFRNVLRATIEVPDAGEVNFH  276

Query  843   CTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPT  664
             CT LDHLDE WRMKQ++AII+S D PHILAGGLN+LD  DYS  RWA+IVKYYEE+GKPT
Sbjct  277   CTHLDHLDERWRMKQVDAIIRSGDGPHILAGGLNALDGTDYSADRWADIVKYYEEIGKPT  336

Query  663   PKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFV  484
             PKVEVM+YLK+KQY DAKDF GECE+VV++AKGQ VQGTCKYGTRVDYI++SP+S YKFV
Sbjct  337   PKVEVMQYLKAKQYVDAKDFAGECEAVVVVAKGQNVQGTCKYGTRVDYILASPNSSYKFV  396

Query  483   PGSYSVLSSKGTSDHHIVKVDVV  415
             PGSY+V+SSKGTSDHHIV+VDV 
Sbjct  397   PGSYTVVSSKGTSDHHIVRVDVA  419



>ref|XP_003559883.2| PREDICTED: uncharacterized protein LOC100838950 [Brachypodium 
distachyon]
Length=483

 Score =   402 bits (1033),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 199/328 (61%), Positives = 237/328 (72%), Gaps = 11/328 (3%)
 Frame = -1

Query  1389  HRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEGD  1210
              RPK ILK       A  S   R P SK RVSIN+ DNEISL +SG+L  T         
Sbjct  121   RRPKGILK-------AQASLLSRTP-SKARVSINIQDNEISLDRSGKLLGTAAMRGSSSK  172

Query  1209  grgks---plrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKP  1039
                +               S+         R+V EVLRE  ADV+ALQ+V+AEE   M+P
Sbjct  173   KLRQQHGLSFSGRQGHQQDSTVGRLDSGRRRSVEEVLREAGADVIALQNVRAEEGSGMRP  232

Query  1038  LSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVG  859
             LS+LAA LGM YAFAESWAPEYGNA+LS+WPI   K  ++ D SD RNV++ATI+VP  G
Sbjct  233   LSELAAALGMGYAFAESWAPEYGNAVLSRWPITRWKALRVADPSDLRNVLRATIEVPNAG  292

Query  858   EINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEE  679
              +N  CT LDHLDE+WRMKQ++A+++S+D PHILAGGLN+LD  DYSP RWA+IVKYYEE
Sbjct  293   PVNIHCTQLDHLDESWRMKQVDAMLRSADGPHILAGGLNALDATDYSPHRWADIVKYYEE  352

Query  678   MGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDS  499
             +GKPTPK EVM+YLK KQY DAKDF GECE+VV++AKGQ VQGTCKYGTRVDYI++SP S
Sbjct  353   IGKPTPKAEVMRYLKGKQYVDAKDFAGECEAVVVVAKGQDVQGTCKYGTRVDYILASPGS  412

Query  498   VYKFVPGSYSVLSSKGTSDHHIVKVDVV  415
              YKFVPGSY+V+SSKGTSDHHIV+VDV 
Sbjct  413   PYKFVPGSYTVVSSKGTSDHHIVRVDVA  440



>dbj|BAC16719.1| unknown protein [Oryza sativa Japonica Group]
Length=443

 Score =   399 bits (1024),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 203/326 (62%), Positives = 245/326 (75%), Gaps = 24/326 (7%)
 Frame = -1

Query  1389  HRPKSILK-QSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEG  1213
              RPK ILK Q+ L   A          SK RVSINL DNEIS ++S             G
Sbjct  107   RRPKGILKAQASLARTA----------SKARVSINLQDNEISRERS-----------KLG  145

Query  1212  DgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLS  1033
                 +S   ++++   +    G +    R+V EVLRE+ AD++ LQ+V+AEEER M PLS
Sbjct  146   STAARSTTTATTTPAATQQLNGGAEGRRRSVEEVLREVGADIIGLQNVRAEEERGMSPLS  205

Query  1032  DLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEI  853
             +LA GLGM+Y FAESWAPEYGNA+LS+WPIK  K Q++ D SDF NV++ATI+VP  GE+
Sbjct  206   ELAEGLGMRYVFAESWAPEYGNAVLSRWPIKRWKSQRVADQSDF-NVLRATIEVPRAGEV  264

Query  852   NFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMG  673
             NF CT LDHLDE+WRMKQ+NAI++SSD PHIL GGLN+LD  DYS +RWA+IVKYYEE+G
Sbjct  265   NFHCTHLDHLDESWRMKQMNAILRSSDGPHILTGGLNALDGTDYSDERWADIVKYYEEIG  324

Query  672   KPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVY  493
             KPTPK EVMKYLK KQY DAKDF GECE+VV++AKGQ VQGTCKYGTRVDYI++SP+S Y
Sbjct  325   KPTPKAEVMKYLKGKQYVDAKDFAGECEAVVVVAKGQ-VQGTCKYGTRVDYILASPNSPY  383

Query  492   KFVPGSYSVLSSKGTSDHHIVKVDVV  415
             KFVPGSY+V+SSKGTSDHHIVKVDV 
Sbjct  384   KFVPGSYTVISSKGTSDHHIVKVDVT  409



>gb|EYU43860.1| hypothetical protein MIMGU_mgv1a019291mg, partial [Erythranthe 
guttata]
Length=428

 Score =   395 bits (1016),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 204/330 (62%), Positives = 241/330 (73%), Gaps = 10/330 (3%)
 Frame = -1

Query  1380  KSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLD-------  1222
             K ILKQSPLH N     +    KSK +VSINLP+NEISL ++  L+      +       
Sbjct  97    KGILKQSPLHINHTTENET---KSKPKVSINLPENEISLSRNRVLRVVQDSCNINKTPSF  153

Query  1221  DEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMK  1042
             +                + ++     +    RT+ +VL+E++AD+LALQDVKA+EE EMK
Sbjct  154   NSSAPNNPMRSPICFPSSMANWLNCANLCGVRTIFDVLKEVDADILALQDVKADEENEMK  213

Query  1041  PLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEV  862
             PLSDLA  LGM Y FAESWAPEYGNA+LSKWPIK  K+QKI+D+ DFRNV+KATIDVP  
Sbjct  214   PLSDLARALGMYYVFAESWAPEYGNAVLSKWPIKKSKIQKIYDEKDFRNVIKATIDVPLN  273

Query  861   GEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYE  682
             GE+NF+ T LDHLDENWR+KQINA+I+S    HILAGGLN+LD +DYS +RW  IVKYYE
Sbjct  274   GELNFYSTQLDHLDENWRIKQINAMIESDGEHHILAGGLNALDSSDYSLERWNHIVKYYE  333

Query  681   EMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPD  502
             E+GKPTPKVEV   LK + Y DAKDF GECE VVMIAKGQ VQGTCKYGTRVDYI+ S D
Sbjct  334   ELGKPTPKVEVTNLLKGRGYIDAKDFPGECEPVVMIAKGQNVQGTCKYGTRVDYILGSSD  393

Query  501   SVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
               Y FVPGSYSV+SSKGTSDHHIVKVDVV+
Sbjct  394   LPYAFVPGSYSVISSKGTSDHHIVKVDVVR  423



>ref|XP_006299891.1| hypothetical protein CARUB_v10016098mg [Capsella rubella]
 gb|EOA32789.1| hypothetical protein CARUB_v10016098mg [Capsella rubella]
Length=459

 Score =   397 bits (1019),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 208/327 (64%), Positives = 244/327 (75%), Gaps = 15/327 (5%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDD----E  1216
             PK ILKQSPLH +A      R PK    V INLPDNEISL +S    F +   +D    E
Sbjct  102   PKGILKQSPLHSSA-----ARKPK----VCINLPDNEISLSQS--YSFLSMVENDNDGKE  150

Query  1215  GDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPL  1036
               G             +    +   Y S R++ E+LREL+AD+LALQDVKAEEE  MKPL
Sbjct  151   NRGNISMRSPVCLPSCWWDQESFNGYSSRRSIAELLRELDADILALQDVKAEEETLMKPL  210

Query  1035  SDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGE  856
             SDLA+ LGMKY FAESWAPEYGNAILSKWPIK  +VQ+I D  DFRNV+K TI+VP  GE
Sbjct  211   SDLASALGMKYVFAESWAPEYGNAILSKWPIKKWRVQRIADADDFRNVLKVTIEVPWAGE  270

Query  855   INFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEM  676
             +N +CT LDHLDENWRMKQI+AI +  ++PHIL GGLNSLD +DYS  RW  IVKYYE+ 
Sbjct  271   VNVYCTQLDHLDENWRMKQIDAITRGDESPHILLGGLNSLDGSDYSIARWNHIVKYYEDS  330

Query  675   GKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSV  496
             GKPTP+VEVM++LK K Y D+K+F GECE VV+IAKGQ VQGTCKYGTRVDYI++SP+S 
Sbjct  331   GKPTPRVEVMRFLKGKGYLDSKEFAGECEPVVIIAKGQNVQGTCKYGTRVDYILASPESP  390

Query  495   YKFVPGSYSVLSSKGTSDHHIVKVDVV  415
             Y+FVPGSYSV+SSKGTSDHHIVKVD+V
Sbjct  391   YEFVPGSYSVVSSKGTSDHHIVKVDLV  417



>ref|XP_007035404.1| DNAse I-like superfamily protein [Theobroma cacao]
 gb|EOY06330.1| DNAse I-like superfamily protein [Theobroma cacao]
Length=511

 Score =   397 bits (1021),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 212/344 (62%), Positives = 261/344 (76%), Gaps = 12/344 (3%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFT  1237
              KS +  PKSILKQSPLH +     ++S+Q++F +SK +VSINLPDNEISL +   L F 
Sbjct  130   TKSPNCYPKSILKQSPLHNSHTSPDSISKQKKFSRSKQKVSINLPDNEISLAQRKLLTFV  189

Query  1236  NTFLDDEGDgrgksplrssss--------lnfssssagrsyrstRTVVEVLRELNADVLA  1081
                 +   D       R++           +  +     S RS R++ EVLRE++AD+LA
Sbjct  190   EDVKEGASDMITSRINRNNVIMRSPVCLPSSMINFWNEGSLRSGRSIAEVLREVDADILA  249

Query  1080  LQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDF  901
             LQDVKA+EE+ MKPLSDLAA LGMKY FAESWAP+YGNAILSKWPIK   VQKI DD DF
Sbjct  250   LQDVKAQEEKGMKPLSDLAAALGMKYVFAESWAPDYGNAILSKWPIKRWTVQKIADDDDF  309

Query  900   RNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADY  721
             RNV+KATI+VP  GE+NF+CT LDHLDENWRMKQI AI +S+++ H+L GGLNSL+ +DY
Sbjct  310   RNVLKATIEVPWAGEVNFYCTQLDHLDENWRMKQIKAITESNNSSHLLLGGLNSLNGSDY  369

Query  720   SPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCK  541
             S +RW +IVKYYE++GKP P+ EVMK L+ ++Y DAKD+ GECE VV+IAKGQ VQGTCK
Sbjct  370   SSERWTDIVKYYEDIGKPRPRTEVMKLLRGREYTDAKDYAGECEPVVIIAKGQNVQGTCK  429

Query  540   YGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             YGTRVDYI++S +S Y FVPGSYSV+SSKGTSDHHIVKVD+VK 
Sbjct  430   YGTRVDYILASSNSPYNFVPGSYSVISSKGTSDHHIVKVDLVKG  473



>emb|CDY48894.1| BnaA03g36330D [Brassica napus]
Length=425

 Score =   394 bits (1013),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 204/323 (63%), Positives = 242/323 (75%), Gaps = 25/323 (8%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEGDgr  1204
             PK ILKQSPLH +A           K RV INLPDNEISL +S    F +    +E D  
Sbjct  98    PKGILKQSPLHSSA---------IKKPRVCINLPDNEISLAQS--FSFLSMVDGEEDDNE  146

Query  1203  gksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLSDLA  1024
             GK    S+S  +               V E+L EL+AD+LALQDVKAEEE+ M+PLSDLA
Sbjct  147   GKENRGSNSMRS--------------PVSELLGELDADILALQDVKAEEEKLMEPLSDLA  192

Query  1023  AGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFF  844
             + LGMKY FAESWAPEYGNAILSKWPIK  +VQ+I D  DFRNV+K TI+VP  GE+N +
Sbjct  193   SALGMKYVFAESWAPEYGNAILSKWPIKKWRVQRIADADDFRNVLKVTIEVPWAGEVNVY  252

Query  843   CTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPT  664
             CT LDHLDENWRMKQI+AI +  ++PHIL GGLNSLD +DYS +RW  IVKYYE+ GKPT
Sbjct  253   CTQLDHLDENWRMKQIDAITRGDESPHILLGGLNSLDGSDYSTERWNHIVKYYEDTGKPT  312

Query  663   PKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFV  484
             P+V+V++YLK K Y D+K+  GECE VV+IAKGQ VQGTCKYGTRVDYI++SP+S Y+FV
Sbjct  313   PRVDVIRYLKGKGYSDSKESAGECEPVVIIAKGQNVQGTCKYGTRVDYILASPESPYEFV  372

Query  483   PGSYSVLSSKGTSDHHIVKVDVV  415
             PGSYSV+SSKGTSDHHIVKVD+V
Sbjct  373   PGSYSVVSSKGTSDHHIVKVDLV  395



>ref|XP_003594058.1| hypothetical protein MTR_2g020860 [Medicago truncatula]
Length=356

 Score =   392 bits (1006),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 203/315 (64%), Positives = 235/315 (75%), Gaps = 15/315 (5%)
 Frame = -1

Query  1320  FPKSKLR-VSINLPDNEISLKKSGQLQFTNTFLDDEGDgrgksplr----------ssss  1174
             F +S L+ VSINLPDNEISL  S  L      ++D G    +                + 
Sbjct  15    FDRSNLKQVSINLPDNEISLANSKIL----GSIEDIGSVSSRRNQVPARSPVCFPFLMNM  70

Query  1173  lnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFA  994
                        + S+R+++EVLRE++ADV+ALQDVKAEEE+ M+PLSDLAA LGMKY FA
Sbjct  71    NMNYCEEVNEKFSSSRSILEVLREIDADVVALQDVKAEEEKCMRPLSDLAAALGMKYVFA  130

Query  993   ESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDEN  814
             ESWAPEYGNAILSKWPIK  KVQKI DD DFRNV+KATIDVP  GEIN   T LDHLDEN
Sbjct  131   ESWAPEYGNAILSKWPIKKWKVQKIADDDDFRNVLKATIDVPWAGEINLHSTQLDHLDEN  190

Query  813   WRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLK  634
             WRMKQ+NAII+S+D PHILAGGLNSL  ADYS QRW +IV YYE++GKP P  EVM ++K
Sbjct  191   WRMKQVNAIIRSNDPPHILAGGLNSLYRADYSSQRWTDIVNYYEKLGKPRPMTEVMNFMK  250

Query  633   SKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSK  454
             SK Y DAKD+ GECE +V+IAKGQ VQGTCKYGTRVDYI+ S  S YKFVPGSYSV+SSK
Sbjct  251   SKDYDDAKDYAGECEPIVIIAKGQNVQGTCKYGTRVDYILGSSKSPYKFVPGSYSVISSK  310

Query  453   GTSDHHIVKVDVVKA  409
             GTSDHHIVKVD++K 
Sbjct  311   GTSDHHIVKVDIMKV  325



>ref|XP_010510300.1| PREDICTED: uncharacterized protein LOC104786565 [Camelina sativa]
 ref|XP_010510307.1| PREDICTED: uncharacterized protein LOC104786565 [Camelina sativa]
 ref|XP_010510313.1| PREDICTED: uncharacterized protein LOC104786565 [Camelina sativa]
Length=459

 Score =   395 bits (1016),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 206/327 (63%), Positives = 244/327 (75%), Gaps = 15/327 (5%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDD----E  1216
             P+ ILKQSPLH +A      R PK    V INLPDNEISL +S   +F +   +D    E
Sbjct  102   PRGILKQSPLHSSA-----ARKPK----VCINLPDNEISLSQS--YRFLSMVENDKDGKE  150

Query  1215  GDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPL  1036
               G             +    +   Y S R++ E+LREL+AD+LALQDVKAEEE  MKPL
Sbjct  151   NRGSISMRSPVCLPSCWWDQESFNGYSSRRSIAELLRELDADILALQDVKAEEETLMKPL  210

Query  1035  SDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGE  856
             SDLA+ LGMKY FAESWAPEYGNAILSKWPIK  +VQ+I D  DFRNV+K TI+VP  G+
Sbjct  211   SDLASALGMKYVFAESWAPEYGNAILSKWPIKKWRVQRIADADDFRNVLKVTIEVPWAGD  270

Query  855   INFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEM  676
             +N +CT LDHLDENWRMKQI+AI +  ++PHIL GGLNSLD +DYS  RW  IVKYYE+ 
Sbjct  271   VNVYCTQLDHLDENWRMKQIDAITRGDESPHILLGGLNSLDGSDYSIARWNHIVKYYEDS  330

Query  675   GKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSV  496
             GKPTP+VEVM+ LK K Y D+K+F GECE VV+IAKGQ VQGTCKYGTRVDYI++SP+S 
Sbjct  331   GKPTPRVEVMRLLKGKGYSDSKEFAGECEPVVIIAKGQNVQGTCKYGTRVDYILASPESP  390

Query  495   YKFVPGSYSVLSSKGTSDHHIVKVDVV  415
             Y+FVPGSYSV+SSKGTSDHHIVKVD+V
Sbjct  391   YEFVPGSYSVVSSKGTSDHHIVKVDLV  417



>ref|NP_188790.2| DNAse I-like superfamily protein [Arabidopsis thaliana]
 dbj|BAB02348.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD44493.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76520.1| DNAse I-like superfamily protein [Arabidopsis thaliana]
Length=458

 Score =   394 bits (1013),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 205/327 (63%), Positives = 244/327 (75%), Gaps = 15/327 (5%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDD----E  1216
             PK ILKQSPLH +A      R PK    V INLPDNEISL +S    F +   +D    E
Sbjct  101   PKGILKQSPLHSSA-----VRKPK----VCINLPDNEISLAQS--YSFLSMVENDNDGKE  149

Query  1215  GDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPL  1036
               G             +    +   Y S R++ E+LREL+AD+LALQDVKAEEE  MKPL
Sbjct  150   NRGSLSMRSPVCLPSCWWDQESFNGYSSRRSIAELLRELDADILALQDVKAEEETLMKPL  209

Query  1035  SDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGE  856
             SDLA+ LGMKY FAESWAPEYGNAILSKWPIK  +VQ+I D  DFRNV+K T+++P  G+
Sbjct  210   SDLASALGMKYVFAESWAPEYGNAILSKWPIKKWRVQRIADVDDFRNVLKVTVEIPWAGD  269

Query  855   INFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEM  676
             +N +CT LDHLDENWRMKQI+AI +  ++PHIL GGLNSLD +DYS  RW  IVKYYE+ 
Sbjct  270   VNVYCTQLDHLDENWRMKQIDAITRGDESPHILLGGLNSLDGSDYSIARWNHIVKYYEDS  329

Query  675   GKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSV  496
             GKPTP+VEVM++LK K Y D+K+F GECE VV+IAKGQ VQGTCKYGTRVDYI++SP+S 
Sbjct  330   GKPTPRVEVMRFLKGKGYLDSKEFAGECEPVVIIAKGQNVQGTCKYGTRVDYILASPESP  389

Query  495   YKFVPGSYSVLSSKGTSDHHIVKVDVV  415
             Y+FVPGSYSV+SSKGTSDHHIVKVD+V
Sbjct  390   YEFVPGSYSVVSSKGTSDHHIVKVDLV  416



>ref|XP_010466393.1| PREDICTED: uncharacterized protein LOC104746579 [Camelina sativa]
 ref|XP_010466394.1| PREDICTED: uncharacterized protein LOC104746579 [Camelina sativa]
 ref|XP_010466395.1| PREDICTED: uncharacterized protein LOC104746579 [Camelina sativa]
 ref|XP_010466397.1| PREDICTED: uncharacterized protein LOC104746579 [Camelina sativa]
 ref|XP_010466398.1| PREDICTED: uncharacterized protein LOC104746579 [Camelina sativa]
 ref|XP_010466399.1| PREDICTED: uncharacterized protein LOC104746579 [Camelina sativa]
Length=459

 Score =   394 bits (1011),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 206/329 (63%), Positives = 244/329 (74%), Gaps = 15/329 (5%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDD----E  1216
             PK ILKQSPLH +A      R PK    V INLPDNEISL +S    F +   +D    E
Sbjct  102   PKGILKQSPLHSSA-----ARKPK----VCINLPDNEISLSQS--YSFLSMVENDKDGKE  150

Query  1215  GDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPL  1036
               G             +    +   Y S R++ E+LREL+AD+LALQDVKAEEE  MKPL
Sbjct  151   NRGSISMRSPVCLPSCWWDQESFNGYSSRRSIAELLRELDADILALQDVKAEEETLMKPL  210

Query  1035  SDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGE  856
             SDLA+ LGMKY FAESWAPE+GNAILSKWPIK  +VQ+I D  DFRNV+K TI+VP  G+
Sbjct  211   SDLASALGMKYVFAESWAPEFGNAILSKWPIKKWRVQRIADADDFRNVLKVTIEVPWAGD  270

Query  855   INFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEM  676
             +N +CT LDHLDENWRMKQI+AI +  ++PHIL GGLNSLD +DYS  RW  IVKYYE+ 
Sbjct  271   VNVYCTQLDHLDENWRMKQIDAITRGDESPHILLGGLNSLDGSDYSIARWNHIVKYYEDS  330

Query  675   GKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSV  496
             GKPTP+VEVM+ LK K Y D+K++ GECE VV+IAKGQ VQGTCKYGTRVDYI++SP+S 
Sbjct  331   GKPTPRVEVMRLLKGKGYSDSKEYAGECEPVVIIAKGQNVQGTCKYGTRVDYILASPESP  390

Query  495   YKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
             Y+FVPGSYSV+SSKGTSDHHIVKVD+V A
Sbjct  391   YEFVPGSYSVVSSKGTSDHHIVKVDLVIA  419



>ref|XP_006658894.1| PREDICTED: uncharacterized protein LOC102709668 [Oryza brachyantha]
Length=359

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/315 (62%), Positives = 232/315 (74%), Gaps = 21/315 (7%)
 Frame = -1

Query  1311  SKLRVSINLPDNEISLKKSGQLQFTNTFLDDEGDgrgksplrsssslnfssssagrsyrs  1132
             SK RVSINL DNEIS ++S                   +   + ++        G     
Sbjct  16    SKARVSINLQDNEISRERSKLGSTAARSA-----TTAAAKKSAPATQQHHPQQNGGGEGR  70

Query  1131  tRTVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSK  952
              R+V EVLRE+ AD++ LQ+V+AEEER M PLS+LA GLGM+Y FAESWAPEYGNA+LS+
Sbjct  71    RRSVEEVLREVRADIIGLQNVRAEEERGMSPLSELAEGLGMRYVFAESWAPEYGNAVLSR  130

Query  951   WPIKSCKVQKIFDDSDFR----------------NVMKATIDVPEVGEINFFCTLLDHLD  820
             WPIK  K Q++ D SDFR                NV++ATI+VP  GE+NF CT LDHLD
Sbjct  131   WPIKRWKSQRVADQSDFRSVSPPPPPYPRAAASPNVLRATIEVPRAGEVNFHCTHLDHLD  190

Query  819   ENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKY  640
             E+WRMKQ+NAI++S D PHILAGGLN+LD  DYS +RWA+IVKYYEE+GKPTPKVEVMK+
Sbjct  191   ESWRMKQMNAILRSGDGPHILAGGLNALDGTDYSDERWADIVKYYEEIGKPTPKVEVMKF  250

Query  639   LKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLS  460
             LK KQY DAKDF GECE+VV++AKGQ VQGTCKYGTRVDYI++SPDS YKFVPGSY+V+S
Sbjct  251   LKGKQYVDAKDFAGECEAVVVVAKGQDVQGTCKYGTRVDYILASPDSPYKFVPGSYTVIS  310

Query  459   SKGTSDHHIVKVDVV  415
             SKGTSDHHIVKVDV 
Sbjct  311   SKGTSDHHIVKVDVT  325



>ref|XP_009135757.1| PREDICTED: uncharacterized protein LOC103859913 [Brassica rapa]
Length=446

 Score =   392 bits (1006),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 206/330 (62%), Positives = 247/330 (75%), Gaps = 18/330 (5%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEGDgr  1204
             PK ILKQSPLH +A           K RV INLPDNEISL +S    F +    +E D  
Sbjct  98    PKGILKQSPLHSSA---------IKKPRVCINLPDNEISLAQS--FSFLSMVDGEEDDNE  146

Query  1203  gksplrsssslnfs-------sssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREM  1045
             GK    S+S  +            +   Y S R++ E+L EL+AD+LALQDVKAEEE+ M
Sbjct  147   GKENRGSNSMRSPVCLPSCWWDQESFNGYNSRRSIAELLGELDADILALQDVKAEEEKLM  206

Query  1044  KPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPE  865
             +PLSDLA+ LGMKY FAESWAPEYGNAILSKWPIK  +VQ+I D  DFRNV+K TI+VP 
Sbjct  207   EPLSDLASALGMKYVFAESWAPEYGNAILSKWPIKKWRVQRIADADDFRNVLKVTIEVPW  266

Query  864   VGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYY  685
              GE+N +CT LDHLDENWRMKQI+AI +  ++PHIL GGLNSLD +DYS +RW  IVKYY
Sbjct  267   AGEVNVYCTQLDHLDENWRMKQIDAITRGDESPHILLGGLNSLDGSDYSTERWNHIVKYY  326

Query  684   EEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSP  505
             E+ GKPTP+V+V++YLK K Y D+K+  GECE VV+IAKGQ VQGTCKYGTRVDYI++SP
Sbjct  327   EDTGKPTPRVDVIRYLKGKGYSDSKESAGECEPVVIIAKGQNVQGTCKYGTRVDYILASP  386

Query  504   DSVYKFVPGSYSVLSSKGTSDHHIVKVDVV  415
             +S Y+FVPGSYSV+SSKGTSDHHIVKVD+V
Sbjct  387   ESPYEFVPGSYSVVSSKGTSDHHIVKVDLV  416



>gb|KFK39448.1| hypothetical protein AALP_AA3G246400 [Arabis alpina]
Length=380

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 203/328 (62%), Positives = 240/328 (73%), Gaps = 14/328 (4%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQ-LQFTNTFLDD----  1219
             PK IL+QSPLH +A           K +V INLPDNEISL +S   L       DD    
Sbjct  20    PKGILRQSPLHSSA---------VKKPKVCINLPDNEISLAQSYNFLSLVEREKDDNDGK  70

Query  1218  EGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKP  1039
             E  G             +    +   Y S R++ E+L EL+AD+LALQDVKAEEE+ M+P
Sbjct  71    ENRGNISMRSPVCLPSCWWDQESFNGYSSRRSIAELLGELDADILALQDVKAEEEKLMEP  130

Query  1038  LSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVG  859
             LSDLA+ LGMKY FAESWAPEYGNAILSKWPIK  +VQ+I D  DFRNV+K TI+VP  G
Sbjct  131   LSDLASALGMKYVFAESWAPEYGNAILSKWPIKKWRVQRIADADDFRNVLKVTIEVPWAG  190

Query  858   EINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEE  679
             E+N +CT LDHLDE WRMKQI+AI +  D+PHIL GGLNSLD +DYS  RW  IVKYYE+
Sbjct  191   EVNVYCTQLDHLDEKWRMKQIDAITRGDDSPHILLGGLNSLDGSDYSIARWNHIVKYYED  250

Query  678   MGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDS  499
              GKPTP+VEVM++LK   Y D+K+F GECE VV+IAKGQ VQGTCKYGTRVDYI++SP+S
Sbjct  251   SGKPTPRVEVMRFLKGIGYSDSKEFAGECEPVVIIAKGQNVQGTCKYGTRVDYILASPES  310

Query  498   VYKFVPGSYSVLSSKGTSDHHIVKVDVV  415
              Y+FVPGSYSV+SSKGTSDHHIVKVD+V
Sbjct  311   PYEFVPGSYSVVSSKGTSDHHIVKVDLV  338



>ref|XP_002885446.1| endonuclease/exonuclease/phosphatase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH61705.1| endonuclease/exonuclease/phosphatase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=460

 Score =   389 bits (1000),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 206/329 (63%), Positives = 244/329 (74%), Gaps = 17/329 (5%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDD----E  1216
             PK ILKQSPLH +A      R PK    V INLPDNEISL +S    F +   +D    E
Sbjct  101   PKGILKQSPLHSSA-----VRKPK----VCINLPDNEISLAQS--YSFLSMVENDSDGKE  149

Query  1215  GDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPL  1036
               G             +    +   Y S R++ E+LREL+AD+LALQDVKAEEE  MKPL
Sbjct  150   NRGSISMRSPVCLPSCWWDQESFNGYSSRRSIAELLRELDADILALQDVKAEEETLMKPL  209

Query  1035  SDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGE  856
             SDLA+ LGMKY FAESWAPEYGNAILSKWPIK  +VQ+I D  DFRNV+K T++VP  G+
Sbjct  210   SDLASALGMKYVFAESWAPEYGNAILSKWPIKKWRVQRIADVDDFRNVLKVTVEVPWAGD  269

Query  855   INFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEI--VKYYE  682
             +N +CT LDHLDENWRMKQI+AI +  ++PHIL GGLNSLD +DYS  RW  I  VKYYE
Sbjct  270   VNVYCTQLDHLDENWRMKQIDAITRGDESPHILLGGLNSLDGSDYSIARWNHILKVKYYE  329

Query  681   EMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPD  502
             + GKPTP+VEVM++LK K Y D+K+F GECE VV+IAKGQ VQGTCKYGTRVDYI++SP+
Sbjct  330   DSGKPTPRVEVMRFLKGKGYLDSKEFAGECEPVVIIAKGQNVQGTCKYGTRVDYILASPE  389

Query  501   SVYKFVPGSYSVLSSKGTSDHHIVKVDVV  415
             S Y+FVPGSYSV+SSKGTSDHHIVKVD+V
Sbjct  390   SPYEFVPGSYSVVSSKGTSDHHIVKVDLV  418



>ref|XP_010530519.1| PREDICTED: uncharacterized protein LOC104807106, partial [Tarenaya 
hassleriana]
Length=235

 Score =   380 bits (976),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 200/224 (89%), Gaps = 1/224 (0%)
 Frame = -1

Query  1080  LQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDF  901
             LQDVKA+E  EM+PLSDLAA LGM + FA+SWAP+YGNA+LSKWPIK   V +IFDDSDF
Sbjct  1     LQDVKADEADEMRPLSDLAAALGMHFVFADSWAPQYGNAVLSKWPIKQSAVHRIFDDSDF  60

Query  900   RNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSD-TPHILAGGLNSLDEAD  724
             RNV+KATIDVPE GE+ F CT LDHLDENWRMKQ++A+I S++  PH+LAG LNSLDE D
Sbjct  61    RNVLKATIDVPETGEVEFHCTHLDHLDENWRMKQVDAVIASANGAPHVLAGALNSLDETD  120

Query  723   YSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTC  544
             YSP+RW++IV+YYEEMGKP PK EVM+YL+ K+Y DAKDFGGECESVV++AKGQ VQGTC
Sbjct  121   YSPERWSDIVRYYEEMGKPVPKAEVMRYLRRKEYTDAKDFGGECESVVVVAKGQNVQGTC  180

Query  543   KYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             KYGTRVDYI++SP+S YKFVPGSYSVLSSKGTSDHHIVKVDVVK
Sbjct  181   KYGTRVDYIMASPESPYKFVPGSYSVLSSKGTSDHHIVKVDVVK  224



>tpg|DAA63905.1| TPA: hypothetical protein ZEAMMB73_300645 [Zea mays]
Length=447

 Score =   387 bits (993),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 193/323 (60%), Positives = 240/323 (74%), Gaps = 25/323 (8%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEGDgr  1204
             PK ILK          S   R P S+ RVSIN+ DNEISL++      T  +    G+G+
Sbjct  111   PKGILKAQ------AASSLARSP-SRPRVSINVQDNEISLER------TRLWRGVGGNGK  157

Query  1203  gksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLSDLA  1024
              +   +   +                +V EVLRE  AD++ LQ+V+AEEER M+PLS+LA
Sbjct  158   RQQQQQQQQAGPRRR-----------SVEEVLREAGADIIGLQNVRAEEERGMRPLSELA  206

Query  1023  AGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFF  844
              GLGM+Y FAESWAP+YGNA+LS+WPIK  K  ++ D SDFRNV++ TI+VP+ GE+NF 
Sbjct  207   EGLGMRYVFAESWAPQYGNAVLSRWPIKRWKAHRVADQSDFRNVLRVTIEVPDAGEVNFH  266

Query  843   CTLLDHLDENWRMKQINAIIQSS-DTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKP  667
             CT LDHLDE WRMKQ++AI++S  D PHILAGGLN+LD  DYS  RWA+IVKYYEE+GKP
Sbjct  267   CTHLDHLDEGWRMKQVDAIMRSGGDGPHILAGGLNALDGTDYSADRWADIVKYYEEIGKP  326

Query  666   TPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKF  487
             TPKVEVM+YLK+KQY DAKDF GECE+VV++AKGQ VQGTCKYGTRVDYI++SP+  YKF
Sbjct  327   TPKVEVMQYLKAKQYVDAKDFAGECEAVVVVAKGQDVQGTCKYGTRVDYIMASPNCPYKF  386

Query  486   VPGSYSVLSSKGTSDHHIVKVDV  418
             VPGSY+V+SSKGTSDHH+V+VDV
Sbjct  387   VPGSYTVVSSKGTSDHHVVRVDV  409



>gb|EEE67690.1| hypothetical protein OsJ_25350 [Oryza sativa Japonica Group]
Length=486

 Score =   388 bits (996),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 204/367 (56%), Positives = 246/367 (67%), Gaps = 63/367 (17%)
 Frame = -1

Query  1389  HRPKSILK-QSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEG  1213
              RPK ILK Q+ L   A          SK RVSINL DNEIS ++S             G
Sbjct  107   RRPKGILKAQASLARTA----------SKARVSINLQDNEISRERS-----------KLG  145

Query  1212  DgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLS  1033
                 +S   ++++   +    G +    R+V EVLRE+ AD++ LQ+V+AEEER M PLS
Sbjct  146   STAARSTTTATTTPAATQQLNGGAEGRRRSVEEVLREVGADIIGLQNVRAEEERGMSPLS  205

Query  1032  DLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFR---------------  898
             +LA GLGM+Y FAESWAPEYGNA+LS+WPIK  K Q++ D SDFR               
Sbjct  206   ELAEGLGMRYVFAESWAPEYGNAVLSRWPIKRWKSQRVADQSDFRCSKVRYVRAKNFRVE  265

Query  897   --------------------------NVMKATIDVPEVGEINFFCTLLDHLDENWRMKQI  796
                                       NV++ATI+VP  GE+NF CT LDHLDE+WRMKQ+
Sbjct  266   SKHGLILNVDNHLSDRSKKCLYFEMKNVLRATIEVPRAGEVNFHCTHLDHLDESWRMKQM  325

Query  795   NAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCD  616
             NAI++SSD PHIL GGLN+LD  DYS +RWA+IVKYYEE+GKPTPK EVMKYLK KQY D
Sbjct  326   NAILRSSDGPHILTGGLNALDGTDYSDERWADIVKYYEEIGKPTPKAEVMKYLKGKQYVD  385

Query  615   AKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHH  436
             AKDF GECE+VV++AKGQ VQGTCKYGTRVDYI++SP+S YKFVPGSY+V+SSKGTSDHH
Sbjct  386   AKDFAGECEAVVVVAKGQDVQGTCKYGTRVDYILASPNSPYKFVPGSYTVISSKGTSDHH  445

Query  435   IVKVDVV  415
             IVKVDV 
Sbjct  446   IVKVDVT  452



>gb|EEC82548.1| hypothetical protein OsI_27091 [Oryza sativa Indica Group]
Length=486

 Score =   385 bits (990),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 203/367 (55%), Positives = 246/367 (67%), Gaps = 63/367 (17%)
 Frame = -1

Query  1389  HRPKSILK-QSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEG  1213
              RPK ILK Q+ L   A          SK RVSINL DNEIS ++S             G
Sbjct  107   RRPKGILKAQASLARTA----------SKARVSINLQDNEISRERS-----------KLG  145

Query  1212  DgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLS  1033
                 +S   ++++   +    G +    R+V EVLRE+ AD++ LQ+V+AEEER M PLS
Sbjct  146   STAARSTTTATTTPAATQQLNGGAEGRRRSVEEVLREVGADIIGLQNVRAEEERGMSPLS  205

Query  1032  DLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFR---------------  898
             +LA GLGM+Y FAESWAPEYG+A+LS+WPIK  K Q++ D SDFR               
Sbjct  206   ELAEGLGMRYVFAESWAPEYGDAVLSRWPIKRWKSQRVADQSDFRCSKVRYVRAKNFRVE  265

Query  897   --------------------------NVMKATIDVPEVGEINFFCTLLDHLDENWRMKQI  796
                                       NV++ATI+VP  GE+NF CT LDHLDE+WRMKQ+
Sbjct  266   SKHGLILNVDNHLSDRSKKCLYFEMKNVLRATIEVPRAGEVNFHCTHLDHLDESWRMKQM  325

Query  795   NAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCD  616
             NAI++SSD PHIL GGLN+LD  DYS +RWA+IVKYYEE+GKPTPK EVMKYLK KQY D
Sbjct  326   NAILRSSDGPHILTGGLNALDGTDYSDERWADIVKYYEEIGKPTPKAEVMKYLKGKQYVD  385

Query  615   AKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHH  436
             AKDF GECE+VV++AKGQ VQGTCKYGTRVDYI++SP+S YKFVPGSY+V+SSKGTSDHH
Sbjct  386   AKDFAGECEAVVVVAKGQDVQGTCKYGTRVDYILASPNSPYKFVPGSYTVISSKGTSDHH  445

Query  435   IVKVDVV  415
             IVKVDV 
Sbjct  446   IVKVDVT  452



>ref|NP_001060456.2| Os07g0645500 [Oryza sativa Japonica Group]
 dbj|BAF22370.2| Os07g0645500 [Oryza sativa Japonica Group]
Length=494

 Score =   385 bits (989),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 205/380 (54%), Positives = 247/380 (65%), Gaps = 71/380 (19%)
 Frame = -1

Query  1404  AKSMDHRPKSILK-QSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTF  1228
             A     RPK ILK Q+ L   A          SK RVSINL DNEIS ++S         
Sbjct  102   AAGGGRRPKGILKAQASLARTA----------SKARVSINLQDNEISRERS---------  142

Query  1227  LDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEERE  1048
                 G    +S   ++++   +    G +    R+V EVLRE+ AD++ LQ+V+AEEER 
Sbjct  143   --KLGSTAARSTTTATTTPAATQQLNGGAEGRRRSVEEVLREVGADIIGLQNVRAEEERG  200

Query  1047  MKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFR----------  898
             M PLS+LA GLGM+Y FAESWAPEYGNA+LS+WPIK  K Q++ D SDFR          
Sbjct  201   MSPLSELAEGLGMRYVFAESWAPEYGNAVLSRWPIKRWKSQRVADQSDFRLVSSCPRCLE  260

Query  897   ---------------------------------------NVMKATIDVPEVGEINFFCTL  835
                                                    NV++ATI+VP  GE+NF CT 
Sbjct  261   FPGRVAVAAQLLGRTIAVTVAVGIRSLLHNPTRGNMITGNVLRATIEVPRAGEVNFHCTH  320

Query  834   LDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKV  655
             LDHLDE+WRMKQ+NAI++SSD PHIL GGLN+LD  DYS +RWA+IVKYYEE+GKPTPK 
Sbjct  321   LDHLDESWRMKQMNAILRSSDGPHILTGGLNALDGTDYSDERWADIVKYYEEIGKPTPKA  380

Query  654   EVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGS  475
             EVMKYLK KQY DAKDF GECE+VV++AKGQ VQGTCKYGTRVDYI++SP+S YKFVPGS
Sbjct  381   EVMKYLKGKQYVDAKDFAGECEAVVVVAKGQDVQGTCKYGTRVDYILASPNSPYKFVPGS  440

Query  474   YSVLSSKGTSDHHIVKVDVV  415
             Y+V+SSKGTSDHHIVKVDV 
Sbjct  441   YTVISSKGTSDHHIVKVDVT  460



>ref|XP_006406259.1| hypothetical protein EUTSA_v10022320mg [Eutrema salsugineum]
 gb|ESQ47712.1| hypothetical protein EUTSA_v10022320mg [Eutrema salsugineum]
Length=456

 Score =   383 bits (984),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 199/324 (61%), Positives = 238/324 (73%), Gaps = 13/324 (4%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDD--EGD  1210
             P+ ILKQSPLH +A           K +V INLPDNEISL +S    F +    D  E  
Sbjct  101   PRGILKQSPLHCSA---------AKKPKVCINLPDNEISLAQS--YSFLSMVEQDGKENR  149

Query  1209  grgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLSD  1030
             G             +    +   Y S R++ E+L EL+AD+LALQDVKAEEE+ MKPLSD
Sbjct  150   GSISMRSPVCLPSCWWDQESFNGYSSGRSIAELLGELDADILALQDVKAEEEKLMKPLSD  209

Query  1029  LAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEIN  850
             LA+ LGM Y FAESWAPEYGNAILSKWP+K  +VQ+I D  DFRNV+K TI+VP  GE+N
Sbjct  210   LASALGMNYVFAESWAPEYGNAILSKWPVKKWRVQRIADADDFRNVLKVTIEVPWAGEVN  269

Query  849   FFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGK  670
              +CT LDHLDE WRMKQI+AI +  ++PHIL GGLNSLD +DYS  RW  IVKYYE+ GK
Sbjct  270   VYCTQLDHLDEKWRMKQIDAITRGDESPHILLGGLNSLDGSDYSIARWNHIVKYYEDSGK  329

Query  669   PTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYK  490
             PTP+VEVM+ LK K Y D+K++ GECE VV+IAKGQ VQGTCKYGTRVDYI++SP+S Y+
Sbjct  330   PTPRVEVMRSLKGKGYSDSKEYAGECEPVVIIAKGQNVQGTCKYGTRVDYILASPESPYE  389

Query  489   FVPGSYSVLSSKGTSDHHIVKVDV  418
             FVPGSYSV+SSKGTSDHHIVKVD+
Sbjct  390   FVPGSYSVVSSKGTSDHHIVKVDL  413



>emb|CDY32434.1| BnaC03g42180D [Brassica napus]
Length=451

 Score =   379 bits (973),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 204/350 (58%), Positives = 241/350 (69%), Gaps = 52/350 (15%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEGDgr  1204
             PK ILKQSPLH +A           K RV INLPDNEISL +S    F +    +E D  
Sbjct  97    PKGILKQSPLHSSA---------IKKPRVCINLPDNEISLAQS--YSFLSMGEGEEDDNE  145

Query  1203  gksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLSDLA  1024
             GK    S+S  +               V E+L +L+AD+LALQDVKAEEE+ M+PLSDLA
Sbjct  146   GKENRGSNSMRS--------------PVSELLGDLDADILALQDVKAEEEKRMEPLSDLA  191

Query  1023  AGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDF-------------------  901
             + LGMKY FAESWAPEYGNAILSKWPIK  +VQ+I D  DF                   
Sbjct  192   SALGMKYVFAESWAPEYGNAILSKWPIKKWRVQRIADADDFSSSDPEKSMGVLSDLERSG  251

Query  900   --------RNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGL  745
                     RNV+K TI+VP  GE+N +CT LDHLDENWRMKQI+AI +  ++PHIL GGL
Sbjct  252   RLNSEKGNRNVLKVTIEVPWAGEVNVYCTQLDHLDENWRMKQIDAITRGDESPHILLGGL  311

Query  744   NSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKG  565
             NSLD +DYS +RW  IVKYYE+ GKPT +VEVM+YLK K Y D+K+  GECE VV+IAKG
Sbjct  312   NSLDGSDYSTERWNHIVKYYEDTGKPTSRVEVMRYLKGKGYSDSKESAGECEPVVIIAKG  371

Query  564   QCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVV  415
             Q VQGTCKYGTRVDYI++SP+S Y+FVPGSYSV+SSKGTSDHHIVKVD+V
Sbjct  372   QNVQGTCKYGTRVDYILASPESPYEFVPGSYSVVSSKGTSDHHIVKVDLV  421



>ref|XP_010551046.1| PREDICTED: uncharacterized protein LOC104821760 isoform X3 [Tarenaya 
hassleriana]
Length=450

 Score =   378 bits (970),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 196/330 (59%), Positives = 242/330 (73%), Gaps = 12/330 (4%)
 Frame = -1

Query  1380  KSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEGDgrg  1201
             K ILKQSPLH +            K +V INLPDNEISL ++    F +    D+  G  
Sbjct  101   KGILKQSPLHSSTG---------KKPKVCINLPDNEISLAQN--YSFLSLVERDKDRGNI  149

Query  1200  ksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLSDLAA  1021
                      L++    +     S R++ E+L E++AD+LALQDVKAEEE+ MKPLSDLA+
Sbjct  150   SMRSPVCLPLSWWDQESFNGISSRRSMAELLGEVDADILALQDVKAEEEKGMKPLSDLAS  209

Query  1020  GLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFC  841
              LGM YAFAESWAPEYGNAILSKWPIK  + Q+I D+ DFRNV+KATI+VP  GE+N +C
Sbjct  210   ALGMNYAFAESWAPEYGNAILSKWPIKKWRAQRIADEDDFRNVLKATIEVPWAGEVNVYC  269

Query  840   TLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTP  661
             T LDHLDENWRMKQI+ + +   +PHIL GGLNSLD +DYS +RW  IVKYYE++GKPTP
Sbjct  270   TQLDHLDENWRMKQIDEVTRGDKSPHILLGGLNSLDVSDYSAERWNHIVKYYEDIGKPTP  329

Query  660   KVEVMKYLKSK-QYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFV  484
             + ++M++LK +  Y DAK+F G  E VV+IAKGQ VQGTCKYGTRVDYI++S DS Y+FV
Sbjct  330   RDDLMRFLKGEGAYSDAKEFAGVFEPVVIIAKGQNVQGTCKYGTRVDYILASQDSPYEFV  389

Query  483   PGSYSVLSSKGTSDHHIVKVDVVKAVGGSG  394
             PGSYSV+SSKG+SDHHI+KVDVV   GGSG
Sbjct  390   PGSYSVVSSKGSSDHHIIKVDVVVTDGGSG  419



>ref|XP_004986976.1| PREDICTED: uncharacterized protein LOC101775287 [Setaria italica]
Length=445

 Score =   372 bits (955),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 234/325 (72%), Gaps = 19/325 (6%)
 Frame = -1

Query  1380  KSILK-QSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEGDgr  1204
             K ILK Q P  P           K +LRVSINL D+EI+ ++                  
Sbjct  111   KGILKAQGPASPV----------KQQLRVSINLQDDEITAERVRNAAGGAGAG-------  153

Query  1203  gksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLSDLA  1024
               S  + +            S R TR+V EVLRE+ AD++ LQ+V+AEE R M+PL+DLA
Sbjct  154   -SSSSKDARGGARVPEWRRSSSRRTRSVAEVLREVGADIVGLQNVRAEEWRGMRPLADLA  212

Query  1023  AGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFF  844
              GLGM+Y FAESWAPEYGNA+LS+WPIK  K  ++ D SDFRNV++ T+DVP  GE+NF 
Sbjct  213   EGLGMRYVFAESWAPEYGNAVLSRWPIKRWKAHRVADHSDFRNVLRVTVDVPGAGEVNFH  272

Query  843   CTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPT  664
             CT LDHL+E  RMKQ+N+I++S+D  HILAGGLN+LD  DYS  RWA+IVKYYEE+GKP 
Sbjct  273   CTHLDHLNEVLRMKQVNSILRSADGHHILAGGLNALDATDYSGDRWADIVKYYEEIGKPA  332

Query  663   PKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFV  484
             PK EVM+YLK+K+Y DAKDF GECE+VV++AKGQ VQGTCKYGTRVDYI++SP+S YKFV
Sbjct  333   PKTEVMRYLKAKRYVDAKDFAGECEAVVVVAKGQDVQGTCKYGTRVDYILASPNSPYKFV  392

Query  483   PGSYSVLSSKGTSDHHIVKVDVVKA  409
             PGSY+V+SS+GTSDHHIVK DV  A
Sbjct  393   PGSYAVVSSRGTSDHHIVKADVTVA  417



>ref|XP_010545175.1| PREDICTED: uncharacterized protein LOC104817622 [Tarenaya hassleriana]
Length=444

 Score =   369 bits (948),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 204/337 (61%), Positives = 241/337 (72%), Gaps = 32/337 (9%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNA--NLS-EQQRFPKSKLRVSINLPDNEISLKKSGQLQFTN  1234
             +KS   RPKSILKQSPLHP +  NLS  ++RF +S+LRVSINLPDNEIS     QL F  
Sbjct  99    SKSTLDRPKSILKQSPLHPTSDHNLSARRERFARSRLRVSINLPDNEISR----QLSFRG  154

Query  1233  TFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEE  1054
                D  G         +S   +  S S  R   S RTV+EVLRE+ ADVLALQDVKA+E 
Sbjct  155   DDRDAAG------RTMNSQVRSTVSFSGEREGSSRRTVLEVLREVEADVLALQDVKADEA  208

Query  1053  REMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATID  874
              EM+PLSDLAA L             +   I +   +  C           RNV+KATID
Sbjct  209   DEMRPLSDLAAALDQTRLI-------HIVVIGTDIGLYEC-----------RNVLKATID  250

Query  873   VPEVGEINFFCTLLDHLDENWRMKQINAIIQSSD-TPHILAGGLNSLDEADYSPQRWAEI  697
             VP  GE+ F CT LDHLDENWRMKQI+AII+SS+  PHILAG LNSLDE DYSP+RW +I
Sbjct  251   VPVTGEVEFHCTHLDHLDENWRMKQIDAIIRSSNGVPHILAGALNSLDETDYSPERWTDI  310

Query  696   VKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYI  517
             VKYYEEMGKP P+ EVM++LKSK+Y DAKD+ GECESVV++AKGQ VQGTCKYGTRVDYI
Sbjct  311   VKYYEEMGKPVPRAEVMRFLKSKEYTDAKDYAGECESVVVVAKGQSVQGTCKYGTRVDYI  370

Query  516   VSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAV  406
             ++SP+S Y+FVPGSYSVLSSKGTSDHH+VKVD++K+V
Sbjct  371   MASPESPYEFVPGSYSVLSSKGTSDHHVVKVDLLKSV  407



>ref|XP_010551045.1| PREDICTED: uncharacterized protein LOC104821760 isoform X2 [Tarenaya 
hassleriana]
Length=459

 Score =   369 bits (948),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 196/339 (58%), Positives = 242/339 (71%), Gaps = 21/339 (6%)
 Frame = -1

Query  1380  KSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEGDgrg  1201
             K ILKQSPLH +            K +V INLPDNEISL ++    F +    D+  G  
Sbjct  101   KGILKQSPLHSSTG---------KKPKVCINLPDNEISLAQN--YSFLSLVERDKDRGNI  149

Query  1200  ksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLSDLAA  1021
                      L++    +     S R++ E+L E++AD+LALQDVKAEEE+ MKPLSDLA+
Sbjct  150   SMRSPVCLPLSWWDQESFNGISSRRSMAELLGEVDADILALQDVKAEEEKGMKPLSDLAS  209

Query  1020  GLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFC  841
              LGM YAFAESWAPEYGNAILSKWPIK  + Q+I D+ DFRNV+KATI+VP  GE+N +C
Sbjct  210   ALGMNYAFAESWAPEYGNAILSKWPIKKWRAQRIADEDDFRNVLKATIEVPWAGEVNVYC  269

Query  840   TLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVK---------Y  688
             T LDHLDENWRMKQI+ + +   +PHIL GGLNSLD +DYS +RW  IVK         Y
Sbjct  270   TQLDHLDENWRMKQIDEVTRGDKSPHILLGGLNSLDVSDYSAERWNHIVKVGWYCDGCQY  329

Query  687   YEEMGKPTPKVEVMKYLKSK-QYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVS  511
             YE++GKPTP+ ++M++LK +  Y DAK+F G  E VV+IAKGQ VQGTCKYGTRVDYI++
Sbjct  330   YEDIGKPTPRDDLMRFLKGEGAYSDAKEFAGVFEPVVIIAKGQNVQGTCKYGTRVDYILA  389

Query  510   SPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGSG  394
             S DS Y+FVPGSYSV+SSKG+SDHHI+KVDVV   GGSG
Sbjct  390   SQDSPYEFVPGSYSVVSSKGSSDHHIIKVDVVVTDGGSG  428



>ref|XP_004958516.1| PREDICTED: uncharacterized protein LOC101779280 [Setaria italica]
Length=245

 Score =   361 bits (927),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -1

Query  1047  MKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVP  868
             M+PLS+LA GLGM+Y FAESWAPEYGNA+LS+WPIK  K  ++ D SDFRNV++ATI+VP
Sbjct  1     MRPLSELAEGLGMRYVFAESWAPEYGNAVLSRWPIKRWKAHRVADQSDFRNVLRATIEVP  60

Query  867   EVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKY  688
             E GEINF CT LDHLDE WRMKQ++AII+S D PHILAGGLN+LD  DYS +RWA+IVKY
Sbjct  61    EAGEINFHCTHLDHLDEGWRMKQVDAIIRSGDGPHILAGGLNALDGTDYSAERWADIVKY  120

Query  687   YEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSS  508
             YEE+GKPTPKVEVMKYLK KQY DAKDF GECE+VV++AKGQ VQGTCKYGTRVDYI++S
Sbjct  121   YEEIGKPTPKVEVMKYLKGKQYVDAKDFAGECEAVVVVAKGQDVQGTCKYGTRVDYILAS  180

Query  507   PDSVYKFVPGSYSVLSSKGTSDHHIVKVDVV  415
             P S YKFVPGSYSV+SSKGTSDHHIV+VDV 
Sbjct  181   PSSPYKFVPGSYSVISSKGTSDHHIVRVDVT  211



>ref|XP_010070299.1| PREDICTED: uncharacterized protein LOC104457057 isoform X2 [Eucalyptus 
grandis]
Length=291

 Score =   362 bits (930),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/206 (82%), Positives = 188/206 (91%), Gaps = 0/206 (0%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             TVVEVLREL  D++ALQDVKAEEEREMKPLS+LAA LG  YAFAESWAPEYGNA+LS WP
Sbjct  83    TVVEVLRELEVDIVALQDVKAEEEREMKPLSELAAVLGTSYAFAESWAPEYGNAVLSGWP  142

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTP  766
             IK  KVQKIFDD+DFRNV+KATI+VP VGE+NF CT LDHLDENWRMKQ+ AIIQSSD+P
Sbjct  143   IKHWKVQKIFDDTDFRNVLKATIEVPHVGEVNFQCTHLDHLDENWRMKQVGAIIQSSDSP  202

Query  765   HILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECES  586
             HILAGGLNSL+E DYS +RW +IVKYYEEMGKPTPKVEVM++LKSKQY DAKDF GECES
Sbjct  203   HILAGGLNSLEETDYSQERWTDIVKYYEEMGKPTPKVEVMRFLKSKQYTDAKDFAGECES  262

Query  585   VVMIAKGQCVQGTCKYGTRVDYIVSS  508
             VV+IAKGQ VQGTCKYGTRVDY++++
Sbjct  263   VVVIAKGQSVQGTCKYGTRVDYLLAN  288



>ref|XP_010551042.1| PREDICTED: uncharacterized protein LOC104821760 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010551043.1| PREDICTED: uncharacterized protein LOC104821760 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010551044.1| PREDICTED: uncharacterized protein LOC104821760 isoform X1 [Tarenaya 
hassleriana]
Length=467

 Score =   366 bits (940),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 196/347 (56%), Positives = 242/347 (70%), Gaps = 29/347 (8%)
 Frame = -1

Query  1380  KSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEGDgrg  1201
             K ILKQSPLH +            K +V INLPDNEISL ++    F +    D+  G  
Sbjct  101   KGILKQSPLHSSTG---------KKPKVCINLPDNEISLAQN--YSFLSLVERDKDRGNI  149

Query  1200  ksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLSDLAA  1021
                      L++    +     S R++ E+L E++AD+LALQDVKAEEE+ MKPLSDLA+
Sbjct  150   SMRSPVCLPLSWWDQESFNGISSRRSMAELLGEVDADILALQDVKAEEEKGMKPLSDLAS  209

Query  1020  GLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFC  841
              LGM YAFAESWAPEYGNAILSKWPIK  + Q+I D+ DFRNV+KATI+VP  GE+N +C
Sbjct  210   ALGMNYAFAESWAPEYGNAILSKWPIKKWRAQRIADEDDFRNVLKATIEVPWAGEVNVYC  269

Query  840   TLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVK----------  691
             T LDHLDENWRMKQI+ + +   +PHIL GGLNSLD +DYS +RW  IVK          
Sbjct  270   TQLDHLDENWRMKQIDEVTRGDKSPHILLGGLNSLDVSDYSAERWNHIVKSLLEYYDKVG  329

Query  690   -------YYEEMGKPTPKVEVMKYLKSK-QYCDAKDFGGECESVVMIAKGQCVQGTCKYG  535
                    YYE++GKPTP+ ++M++LK +  Y DAK+F G  E VV+IAKGQ VQGTCKYG
Sbjct  330   WYCDGCQYYEDIGKPTPRDDLMRFLKGEGAYSDAKEFAGVFEPVVIIAKGQNVQGTCKYG  389

Query  534   TRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKAVGGSG  394
             TRVDYI++S DS Y+FVPGSYSV+SSKG+SDHHI+KVDVV   GGSG
Sbjct  390   TRVDYILASQDSPYEFVPGSYSVVSSKGSSDHHIIKVDVVVTDGGSG  436



>ref|XP_010026266.1| PREDICTED: uncharacterized protein LOC104416592 [Eucalyptus grandis]
Length=386

 Score =   355 bits (910),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  993  ESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDEN  814
            ESWAPEYGNA+LS+WPIK  KVQKIFDD+DFRNV+KATI+VP VGE+NF CT LDHLDEN
Sbjct  142  ESWAPEYGNAVLSRWPIKHLKVQKIFDDTDFRNVLKATIEVPHVGEVNFQCTHLDHLDEN  201

Query  813  WRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLK  634
            WRMKQ++AIIQSSD+PHILAGGLNSLDE DY  +RW +IVKYYEEMGKPTPKVEVM++LK
Sbjct  202  WRMKQVDAIIQSSDSPHILAGGLNSLDETDYLQERWTDIVKYYEEMGKPTPKVEVMRFLK  261

Query  633  SKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSK  454
            SKQY DAKDF GECESVV+IAKGQ VQGTCKYGTRVDY+++SPD  YKF+PGSYSVLSSK
Sbjct  262  SKQYTDAKDFAGECESVVVIAKGQSVQGTCKYGTRVDYLLASPDCPYKFIPGSYSVLSSK  321

Query  453  GTSDHHIVKVDVVK  412
            GTSDHHIVKVDV K
Sbjct  322  GTSDHHIVKVDVTK  335



>gb|KCW58970.1| hypothetical protein EUGRSUZ_H01598 [Eucalyptus grandis]
Length=236

 Score =   347 bits (889),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/218 (75%), Positives = 186/218 (85%), Gaps = 3/218 (1%)
 Frame = -1

Query  1047  MKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVP  868
             MKPLS+LAA LGM Y FAESW  EYGNA+LS+WPIK  KVQKIFDD+DFRNV+KA I+VP
Sbjct  1     MKPLSELAAALGMSYTFAESWTQEYGNAVLSRWPIKHLKVQKIFDDTDFRNVLKAMIEVP  60

Query  867   EVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKY  688
              VGE+NF CT LDHLD+NWRMKQ+ AII+SSD+ HILAGGLNSL+E DYS +RW +I+KY
Sbjct  61    HVGEVNFQCTHLDHLDKNWRMKQVGAIIRSSDSHHILAGGLNSLNETDYSQERWTDIIKY  120

Query  687   YEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSS  508
             YEE+GKPTPKVE M++LKS+Q  DAKDF GECESVV+IAKGQ +QGTCKYG RVDYI++S
Sbjct  121   YEEIGKPTPKVEAMRFLKSEQCTDAKDFAGECESVVVIAKGQSLQGTCKYGMRVDYILAS  180

Query  507   PDSVYKFVPGSYSVLSSKGTSDHHIVKV---DVVKAVG  403
              D  YKFVPGSYSVLSSKGTSDHHIVK     VVK  G
Sbjct  181   LDYPYKFVPGSYSVLSSKGTSDHHIVKRKHQTVVKITG  218



>gb|EYU33110.1| hypothetical protein MIMGU_mgv1a025924mg, partial [Erythranthe 
guttata]
Length=386

 Score =   338 bits (866),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 175/269 (65%), Positives = 195/269 (72%), Gaps = 21/269 (8%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHP--------NANLSEQQRFPKSKLRVSINLPDNEISLKKSGQ  1249
             AKSM+ RPKSILKQSPLHP          NL  Q +F KS+LRVSINLPDNEISLK+SGQ
Sbjct  116   AKSMNDRPKSILKQSPLHPITTAAMIAQDNLPRQPKFAKSRLRVSINLPDNEISLKRSGQ  175

Query  1248  LQFTNTFLDDEG-------------DgrgksplrsssslnfssssagrsyrstRTVVEVL  1108
             L F+ T    +G                         S   ++        S+RT+VEVL
Sbjct  176   LSFSTTAAAMDGPSSSSSSISRILKGKAPLRSNSLHHSSKTTAYGDDNYRSSSRTIVEVL  235

Query  1107  RELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKV  928
             RELNADVLALQDVKAEEE+ MKPLSDLAA LGM Y FAESWAP+YGNAILSKWPIK  K 
Sbjct  236   RELNADVLALQDVKAEEEKNMKPLSDLAAALGMNYVFAESWAPDYGNAILSKWPIKRWKA  295

Query  927   QKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGG  748
             QKIFDDSD RNV+KATIDVP+ GE+NFFCTLLDHLDE WRMKQIN+IIQS+  PHILAGG
Sbjct  296   QKIFDDSDIRNVLKATIDVPQAGEMNFFCTLLDHLDEKWRMKQINSIIQSTGVPHILAGG  355

Query  747   LNSLDEADYSPQRWAEIVKYYEEMGKPTP  661
             LNSLDE+DYS +RW +IVKYYEEMG   P
Sbjct  356   LNSLDESDYSQERWTDIVKYYEEMGNRHP  384



>ref|XP_009412180.1| PREDICTED: uncharacterized protein LOC103993734 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=467

 Score =   337 bits (864),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 174/283 (61%), Positives = 208/283 (73%), Gaps = 15/283 (5%)
 Frame = -1

Query  1401  KSMDHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLD  1222
             K+ + RPKSILKQ  L             K+KLRVSINLPDNEIS+++S Q        +
Sbjct  149   KAANDRPKSILKQPSL------------AKAKLRVSINLPDNEISVERSKQSSSRRQVGE  196

Query  1221  DEGDg---rgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEER  1051
             +       +       S S            R+ R+++EVLRE+ ADV+ LQ+VKAEEE+
Sbjct  197   ETTAAWKGKAPVSHSFSMSAVHGLGKEPEKLRADRSILEVLREVGADVIGLQNVKAEEEK  256

Query  1050  EMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDV  871
              MKPLSDLA GLGMKY FAESWAPEYGNAILSKWPIK  K +KI DD+DFRNV+KATI+V
Sbjct  257   GMKPLSDLAEGLGMKYVFAESWAPEYGNAILSKWPIKQWKAEKILDDADFRNVLKATIEV  316

Query  870   PEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVK  691
             P  GE+ F CT LDHLDENWRMKQIN+I++SSD PHIL GGLNSLDE DYS +RWA+IVK
Sbjct  317   PGAGEVEFHCTHLDHLDENWRMKQINSILRSSDRPHILVGGLNSLDETDYSAERWADIVK  376

Query  690   YYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQ  562
             YYEE+GKPTPKVEVMK+L+ KQY DAK+F GECE+VV++AKGQ
Sbjct  377   YYEEIGKPTPKVEVMKFLRGKQYLDAKNFAGECEAVVVVAKGQ  419



>ref|XP_006650104.1| PREDICTED: uncharacterized protein LOC102718065, partial [Oryza 
brachyantha]
Length=324

 Score =   330 bits (846),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 191/238 (80%), Gaps = 3/238 (1%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             +V EVLRE  AD++ALQ+V+AEE R M+PLS+LA  LGM+Y FAESWAPEYGNA+LS+WP
Sbjct  49    SVAEVLREAGADMVALQNVRAEEGRGMRPLSELAERLGMRYVFAESWAPEYGNAVLSRWP  108

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQ-SSDT  769
             IK  K  ++ D  DFRNV++ATIDVP  GE++F+CT LDHLDE  RM+Q+N+I++ +   
Sbjct  109   IKRWKAHRLADHFDFRNVLRATIDVPGAGEVSFYCTHLDHLDEGLRMRQVNSILRFAGGR  168

Query  768   PHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDF--GGE  595
              HILAGGLN+LD  DYS  RWA I KY+EE+GKP PK EVM++LK+K+Y DAKDF  GG 
Sbjct  169   HHILAGGLNALDATDYSADRWAAIAKYHEEIGKPAPKAEVMRHLKAKRYVDAKDFAGGGA  228

Query  594   CESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVD  421
              E++ +   GQ VQGTCKYGTRVDYI++SP S Y+FVPGSY+V+ S+GTSDHHIV VD
Sbjct  229   RETLEVAPGGQDVQGTCKYGTRVDYILASPSSPYRFVPGSYAVVPSRGTSDHHIVMVD  286



>gb|EEE59088.1| hypothetical protein OsJ_10924 [Oryza sativa Japonica Group]
Length=392

 Score =   333 bits (853),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 193/242 (80%), Gaps = 2/242 (1%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             +V E LRE  AD++ALQ+V+AEE R M+PLS+LA GLGM+Y FAESWAPEYGNA+LS+WP
Sbjct  118   SVAEALREAGADMVALQNVRAEEGRGMRPLSELAEGLGMRYVFAESWAPEYGNAVLSRWP  177

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDT-  769
             IK    +++ D  DFRNVM+ATI+VP  GE+N +CT LDHLDE  RMKQ+++I++ +D  
Sbjct  178   IKRWNARRLADHFDFRNVMRATIEVPGAGEVNLYCTHLDHLDEGLRMKQVDSILRFADGH  237

Query  768   PHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDF-GGEC  592
              HILAGGLN+LD +DYS  RWA I KY+EE+GKP PK EVM++LK+K+Y DAKDF GG  
Sbjct  238   HHILAGGLNALDASDYSADRWAAIAKYHEEIGKPPPKSEVMRHLKAKRYVDAKDFAGGRD  297

Query  591   ESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
               +V++  GQ VQGTCKYGTRVDYI++SP+S Y FVPGSY+V+ S GTSDHHIV VDV  
Sbjct  298   AGLVVVPNGQDVQGTCKYGTRVDYILASPNSPYNFVPGSYAVVPSMGTSDHHIVMVDVAV  357

Query  411   AV  406
             A 
Sbjct  358   AA  359



>ref|NP_001168314.1| uncharacterized protein LOC100382080 [Zea mays]
 gb|ACN27790.1| unknown [Zea mays]
Length=237

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 145/199 (73%), Positives = 175/199 (88%), Gaps = 1/199 (1%)
 Frame = -1

Query  1011  MKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLL  832
             M+Y FAESWAP+YGNA+LS+WPIK  K  ++ D SDFRNV++ TI+VP+ GE+NF CT L
Sbjct  1     MRYVFAESWAPQYGNAVLSRWPIKRWKAHRVADQSDFRNVLRVTIEVPDAGEVNFHCTHL  60

Query  831   DHLDENWRMKQINAIIQSS-DTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKV  655
             DHLDE WRMKQ++AI++S  D PHILAGGLN+LD  DYS  RWA+IVKYYEE+GKPTPKV
Sbjct  61    DHLDEGWRMKQVDAIMRSGGDGPHILAGGLNALDGTDYSADRWADIVKYYEEIGKPTPKV  120

Query  654   EVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGS  475
             EVM+YLK+KQY DAKDF GECE+VV++AKGQ VQGTCKYGTRVDYI++SP+  YKFVPGS
Sbjct  121   EVMQYLKAKQYVDAKDFAGECEAVVVVAKGQDVQGTCKYGTRVDYIMASPNCPYKFVPGS  180

Query  474   YSVLSSKGTSDHHIVKVDV  418
             Y+V+SSKGTSDHH+V+VDV
Sbjct  181   YTVVSSKGTSDHHVVRVDV  199



>gb|ABF96080.1| Endonuclease/Exonuclease/phosphatase family protein, expressed 
[Oryza sativa Japonica Group]
Length=523

 Score =   333 bits (854),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 193/242 (80%), Gaps = 2/242 (1%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             +V E LRE  AD++ALQ+V+AEE R M+PLS+LA GLGM+Y FAESWAPEYGNA+LS+WP
Sbjct  249   SVAEALREAGADMVALQNVRAEEGRGMRPLSELAEGLGMRYVFAESWAPEYGNAVLSRWP  308

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDT-  769
             IK    +++ D  DFRNVM+ATI+VP  GE+N +CT LDHLDE  RMKQ+++I++ +D  
Sbjct  309   IKRWNARRLADHFDFRNVMRATIEVPGAGEVNLYCTHLDHLDEGLRMKQVDSILRFADGH  368

Query  768   PHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDF-GGEC  592
              HILAGGLN+LD +DYS  RWA I KY+EE+GKP PK EVM++LK+K+Y DAKDF GG  
Sbjct  369   HHILAGGLNALDASDYSADRWAAIAKYHEEIGKPPPKSEVMRHLKAKRYVDAKDFAGGRD  428

Query  591   ESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
               +V++  GQ VQGTCKYGTRVDYI++SP+S Y FVPGSY+V+ S GTSDHHIV VDV  
Sbjct  429   AGLVVVPNGQDVQGTCKYGTRVDYILASPNSPYNFVPGSYAVVPSMGTSDHHIVMVDVAV  488

Query  411   AV  406
             A 
Sbjct  489   AA  490



>gb|EAY90089.1| hypothetical protein OsI_11658 [Oryza sativa Indica Group]
Length=523

 Score =   333 bits (853),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 193/242 (80%), Gaps = 2/242 (1%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             +V E LRE  AD++ALQ+V+AEE R M+PLS+LA GLGM+Y FAESWAPEYGNA+LS+WP
Sbjct  249   SVAEALREAGADMVALQNVRAEEGRGMRPLSELAEGLGMRYVFAESWAPEYGNAVLSRWP  308

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDT-  769
             IK    +++ D  DFRNVM+ATI+VP  GE+N +CT LDHLDE  RMKQ+++I++ +D  
Sbjct  309   IKRWNARRLADHFDFRNVMRATIEVPGAGEVNLYCTHLDHLDEGLRMKQVDSILRFADGH  368

Query  768   PHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDF-GGEC  592
              HILAGGLN+LD +DYS  RWA I KY+EE+GKP PK EVM++LK+K+Y DAKDF GG  
Sbjct  369   HHILAGGLNALDASDYSADRWAAIAKYHEEIGKPPPKSEVMRHLKAKRYVDAKDFAGGRD  428

Query  591   ESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
               +V++  GQ VQGTCKYGTRVDYI++SP+S Y FVPGSY+V+ S GTSDHHIV VDV  
Sbjct  429   AGLVVVPNGQDVQGTCKYGTRVDYILASPNSPYSFVPGSYAVVPSMGTSDHHIVMVDVAV  488

Query  411   AV  406
             A 
Sbjct  489   AA  490



>gb|EMT32562.1| hypothetical protein F775_03404 [Aegilops tauschii]
Length=265

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 174/228 (76%), Gaps = 30/228 (13%)
 Frame = -1

Query  1011  MKYAFAESWAPEYG---NAILSKWPIKSCKVQKIFDDSDFR-------------------  898
             M+Y FAESWAPEYG   NA+LS+WPIK  K  ++ D SDF                    
Sbjct  1     MRYVFAESWAPEYGTYGNAVLSRWPIKRWKALRVADQSDFSIIVFPGGSFLLLSRAVSRL  60

Query  897   --------NVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLN  742
                     NV++ATI+VP  GE+NF CT LDHLDE+WRMKQ++A+++S D PHILAGGLN
Sbjct  61    TRVPSQKWNVLRATIEVPRAGEVNFHCTHLDHLDESWRMKQVDAMLRSVDGPHILAGGLN  120

Query  741   SLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQ  562
             +LD  DYS  RWA+IVKYYEE+GKPTPKVEVMKYLK KQY DAKDF GECE+VV++AKGQ
Sbjct  121   ALDGTDYSADRWADIVKYYEEIGKPTPKVEVMKYLKGKQYVDAKDFAGECEAVVVVAKGQ  180

Query  561   CVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDV  418
              VQGTCKYGTRVDYI++SP S YKFVPGSY+V+SSKGTSDHHIV+VDV
Sbjct  181   DVQGTCKYGTRVDYILASPSSPYKFVPGSYTVVSSKGTSDHHIVRVDV  228



>ref|XP_011016806.1| PREDICTED: uncharacterized protein LOC105120338, partial [Populus 
euphratica]
Length=218

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -1

Query  900  RNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADY  721
            RNV+KATIDVP+ GE+NF CT LDHLDENWRMKQI+AIIQSSD PHILAGGLNSLDE DY
Sbjct  19   RNVLKATIDVPKAGEVNFHCTHLDHLDENWRMKQIDAIIQSSDAPHILAGGLNSLDETDY  78

Query  720  SPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCK  541
            S +RW +IVKYYEEMGKPTPKVEVM ++KSK Y DAKD+ GECESVV++AKGQ VQGTCK
Sbjct  79   SEERWTDIVKYYEEMGKPTPKVEVMSFMKSKHYSDAKDYAGECESVVILAKGQNVQGTCK  138

Query  540  YGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
            YGTRVDYI++SP+S YKFVPGSYSV SSKGTSDHHIVKVD+VKA
Sbjct  139  YGTRVDYILASPNSPYKFVPGSYSVFSSKGTSDHHIVKVDIVKA  182



>gb|KCW58961.1| hypothetical protein EUGRSUZ_H01586 [Eucalyptus grandis]
Length=206

 Score =   290 bits (741),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/162 (83%), Positives = 149/162 (92%), Gaps = 0/162 (0%)
 Frame = -1

Query  897  NVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYS  718
            NV+KATI+VP VGE+NF CT LDHLDENWRMKQ++AIIQSSD+PHILAGGLNSLDE DY 
Sbjct  5    NVLKATIEVPHVGEVNFQCTHLDHLDENWRMKQVDAIIQSSDSPHILAGGLNSLDETDYL  64

Query  717  PQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKY  538
             +RW +IVKYYEEMGKPTPKVEVM++LKSKQY DAKDF GECESVV+IAKGQ VQGTCKY
Sbjct  65   QERWTDIVKYYEEMGKPTPKVEVMRFLKSKQYTDAKDFAGECESVVVIAKGQSVQGTCKY  124

Query  537  GTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
            GTRVDY+++SPD  YKF+PGSYSVLSSKGTSDHHIVKVDV K
Sbjct  125  GTRVDYLLASPDCPYKFIPGSYSVLSSKGTSDHHIVKVDVTK  166



>ref|XP_008355479.1| PREDICTED: uncharacterized protein LOC103419133 [Malus domestica]
Length=204

 Score =   285 bits (728),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -1

Query  900  RNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADY  721
            RNV+KATIDVPE GE NF CT LDHLDE+WRM+QINAIIQSS+ PHILAG LNSLDE+DY
Sbjct  4    RNVLKATIDVPEAGEANFHCTHLDHLDESWRMRQINAIIQSSNEPHILAGDLNSLDESDY  63

Query  720  SPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCK  541
            S +RW +IVKYYE+MGKP PKVEVM+YLKSKQY DAKDF GE ESVVMIAKGQ VQGTCK
Sbjct  64   SQERWTDIVKYYEDMGKPXPKVEVMRYLKSKQYTDAKDFEGEYESVVMIAKGQSVQGTCK  123

Query  540  YGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
            YGTRVDYI++S +S YKFVPGSYSV SSKGTSDHHIV+VDVVK
Sbjct  124  YGTRVDYILASANSPYKFVPGSYSVFSSKGTSDHHIVRVDVVK  166



>ref|XP_008368950.1| PREDICTED: uncharacterized protein LOC103432533 [Malus domestica]
Length=204

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -1

Query  900  RNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADY  721
            RNV+KATIDVPE GE NF CT LDHLDE+WRM+QI AIIQSS+ PHILAG LNSLDE+DY
Sbjct  4    RNVLKATIDVPEAGEANFHCTHLDHLDESWRMRQIXAIIQSSNEPHILAGDLNSLDESDY  63

Query  720  SPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCK  541
            S +RW +IVKYYE+MGKP PKVEVM+YLKSKQY DAKDF GE ESVVMIAKGQ VQGTCK
Sbjct  64   SQERWTDIVKYYEDMGKPXPKVEVMRYLKSKQYTDAKDFEGEYESVVMIAKGQSVQGTCK  123

Query  540  YGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
            YGTRVDYI++S +S YKFVPGSYSV SSKGTSDHHIV+VDVVK
Sbjct  124  YGTRVDYILASANSPYKFVPGSYSVFSSKGTSDHHIVRVDVVK  166



>ref|XP_010070287.1| PREDICTED: uncharacterized protein LOC104457047 isoform X2 [Eucalyptus 
grandis]
Length=225

 Score =   282 bits (722),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  900  RNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADY  721
            RNV+K TI+VP VGE+NF CT LDHLDENWRMKQ++AIIQSSD+PHILAGGLNSLDE DY
Sbjct  22   RNVLKVTIEVPHVGEVNFQCTHLDHLDENWRMKQVSAIIQSSDSPHILAGGLNSLDETDY  81

Query  720  SPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCK  541
            S ++W +IVK+YEE+GKPTPKVEVM++LKSKQY DAKDF GECES+V+IAKGQ +QGTCK
Sbjct  82   SQEQWTDIVKFYEEIGKPTPKVEVMRFLKSKQYTDAKDFSGECESMVVIAKGQSMQGTCK  141

Query  540  YGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
            YGTRVDYI++SPD  YKFVPG YSVLSSKGT DHH+VKVDV K 
Sbjct  142  YGTRVDYILASPDCPYKFVPGLYSVLSSKGTLDHHVVKVDVTKC  185



>ref|XP_010070282.1| PREDICTED: uncharacterized protein LOC104457047 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010070283.1| PREDICTED: uncharacterized protein LOC104457047 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010070284.1| PREDICTED: uncharacterized protein LOC104457047 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010070285.1| PREDICTED: uncharacterized protein LOC104457047 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010070286.1| PREDICTED: uncharacterized protein LOC104457047 isoform X1 [Eucalyptus 
grandis]
Length=237

 Score =   282 bits (722),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -1

Query  900  RNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADY  721
            RNV+K TI+VP VGE+NF CT LDHLDENWRMKQ++AIIQSSD+PHILAGGLNSLDE DY
Sbjct  22   RNVLKVTIEVPHVGEVNFQCTHLDHLDENWRMKQVSAIIQSSDSPHILAGGLNSLDETDY  81

Query  720  SPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCK  541
            S ++W +IVK+YEE+GKPTPKVEVM++LKSKQY DAKDF GECES+V+IAKGQ +QGTCK
Sbjct  82   SQEQWTDIVKFYEEIGKPTPKVEVMRFLKSKQYTDAKDFSGECESMVVIAKGQSMQGTCK  141

Query  540  YGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVKA  409
            YGTRVDYI++SPD  YKFVPG YSVLSSKGT DHH+VKVDV K 
Sbjct  142  YGTRVDYILASPDCPYKFVPGLYSVLSSKGTLDHHVVKVDVTKC  185



>gb|KEH43279.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=387

 Score =   283 bits (724),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 168/236 (71%), Gaps = 18/236 (8%)
 Frame = -1

Query  1392  DHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEG  1213
             D  PKSILKQ+    N NL +     KSK RVSINLPDNEIS+ +S Q  F+        
Sbjct  118   DRPPKSILKQTQSQKNINLVQ---LTKSKTRVSINLPDNEISMLRSRQSSFS--------  166

Query  1212  DgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLS  1033
                           + S     +  +S RT+VEVLRE++AD+L LQDVKAEEE  MKPLS
Sbjct  167   -------EHEKERASTSGVHYYKHVKSGRTLVEVLREVDADILGLQDVKAEEENGMKPLS  219

Query  1032  DLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEI  853
             DLAA LGM Y FAESWAPEYGNA+ SKWPIK   V KIFD +D RNV+KATIDVPE GE+
Sbjct  220   DLAAALGMNYVFAESWAPEYGNAVFSKWPIKRWNVNKIFDHTDIRNVLKATIDVPEAGEL  279

Query  852   NFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYY  685
             NF+CT LDHLDENWRMKQINAIIQS+D PHILAGGLNSLDE+DYS +RW +IVK Y
Sbjct  280   NFYCTHLDHLDENWRMKQINAIIQSNDEPHILAGGLNSLDESDYSQERWTDIVKVY  335



>gb|KEH43278.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=347

 Score =   280 bits (715),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 167/234 (71%), Gaps = 18/234 (8%)
 Frame = -1

Query  1392  DHRPKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEG  1213
             D  PKSILKQ+    N NL +     KSK RVSINLPDNEIS+ +S Q  F+        
Sbjct  118   DRPPKSILKQTQSQKNINLVQ---LTKSKTRVSINLPDNEISMLRSRQSSFS--------  166

Query  1212  DgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLS  1033
                           + S     +  +S RT+VEVLRE++AD+L LQDVKAEEE  MKPLS
Sbjct  167   -------EHEKERASTSGVHYYKHVKSGRTLVEVLREVDADILGLQDVKAEEENGMKPLS  219

Query  1032  DLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEI  853
             DLAA LGM Y FAESWAPEYGNA+ SKWPIK   V KIFD +D RNV+KATIDVPE GE+
Sbjct  220   DLAAALGMNYVFAESWAPEYGNAVFSKWPIKRWNVNKIFDHTDIRNVLKATIDVPEAGEL  279

Query  852   NFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVK  691
             NF+CT LDHLDENWRMKQINAIIQS+D PHILAGGLNSLDE+DYS +RW +IVK
Sbjct  280   NFYCTHLDHLDENWRMKQINAIIQSNDEPHILAGGLNSLDESDYSQERWTDIVK  333



>gb|EPS71855.1| hypothetical protein M569_02903, partial [Genlisea aurea]
Length=265

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 175/232 (75%), Gaps = 8/232 (3%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDEGDgr  1204
             P+SILK SPLH + N+    +F KS LRVSINLPDNEISL++SG L F  +F        
Sbjct  41    PRSILKNSPLH-HLNV-HTHKFSKSGLRVSINLPDNEISLRRSGNLSFDGSF-----SES  93

Query  1203  gksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEEREMKPLSDLA  1024
              +  L+    +   S   G    STRT++EVLR+L+AD+LALQDV+AEEE+ MKPLSDLA
Sbjct  94    ARRSLKGKGPVRSISVDYGGHEHSTRTILEVLRDLDADLLALQDVRAEEEKNMKPLSDLA  153

Query  1023  AGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFF  844
               LGMK+ FAESWAP+YGNAILSKWPI+  K  KI DDSDFRNV+KATIDVPE GEIN F
Sbjct  154   DALGMKFVFAESWAPDYGNAILSKWPIRRWKAVKICDDSDFRNVLKATIDVPEAGEINLF  213

Query  843   CTLLDHLDENWRMKQINAII-QSSDTPHILAGGLNSLDEADYSPQRWAEIVK  691
             CT+LDHLDENWRMKQ++AII  S+  PHILAG LNSLD+ DYS QRW +IVK
Sbjct  214   CTVLDHLDENWRMKQVDAIIGASAGVPHILAGTLNSLDQTDYSHQRWTDIVK  265



>gb|KEH36728.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=379

 Score =   267 bits (682),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 171/243 (70%), Gaps = 17/243 (7%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLS--EQQRFPKSKLR-VSINLPDNEISLKKSGQLQFTNTFLDDEG  1213
             PKSILKQSPLH + NLS  +    P+S L+ VSINLPDNEISL  S  L      ++D G
Sbjct  106   PKSILKQSPLHSSMNLSNSDTNIMPRSNLKQVSINLPDNEISLANSKIL----GSIEDIG  161

Query  1212  Dgrgksplr----------sssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKA  1063
                 +                +            + S+R+++EVLRE++ADV+ALQDVKA
Sbjct  162   SVSSRRNQVPARSPVCFPFLMNMNMNYCEEVNEKFSSSRSILEVLREIDADVVALQDVKA  221

Query  1062  EEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKA  883
             EEE+ M+PLSDLAA LGMKY FAESWAPEYGNAILSKWPIK  KVQKI DD DFRNV+KA
Sbjct  222   EEEKCMRPLSDLAAALGMKYVFAESWAPEYGNAILSKWPIKKWKVQKIADDDDFRNVLKA  281

Query  882   TIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWA  703
             TIDVP  GEIN   T LDHLDENWRMKQ+NAII+S+D PHILAGGLNSL  ADYS QRW 
Sbjct  282   TIDVPWAGEINLHSTQLDHLDENWRMKQVNAIIRSNDPPHILAGGLNSLYRADYSSQRWT  341

Query  702   EIV  694
             +IV
Sbjct  342   DIV  344



>gb|KEH36726.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=397

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 148/243 (61%), Positives = 171/243 (70%), Gaps = 17/243 (7%)
 Frame = -1

Query  1383  PKSILKQSPLHPNANLS--EQQRFPKSKLR-VSINLPDNEISLKKSGQLQFTNTFLDDEG  1213
             PKSILKQSPLH + NLS  +    P+S L+ VSINLPDNEISL  S  L      ++D G
Sbjct  124   PKSILKQSPLHSSMNLSNSDTNIMPRSNLKQVSINLPDNEISLANSKIL----GSIEDIG  179

Query  1212  Dgrgksplr----------sssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKA  1063
                 +                +            + S+R+++EVLRE++ADV+ALQDVKA
Sbjct  180   SVSSRRNQVPARSPVCFPFLMNMNMNYCEEVNEKFSSSRSILEVLREIDADVVALQDVKA  239

Query  1062  EEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKA  883
             EEE+ M+PLSDLAA LGMKY FAESWAPEYGNAILSKWPIK  KVQKI DD DFRNV+KA
Sbjct  240   EEEKCMRPLSDLAAALGMKYVFAESWAPEYGNAILSKWPIKKWKVQKIADDDDFRNVLKA  299

Query  882   TIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWA  703
             TIDVP  GEIN   T LDHLDENWRMKQ+NAII+S+D PHILAGGLNSL  ADYS QRW 
Sbjct  300   TIDVPWAGEINLHSTQLDHLDENWRMKQVNAIIRSNDPPHILAGGLNSLYRADYSSQRWT  359

Query  702   EIV  694
             +IV
Sbjct  360   DIV  362



>ref|XP_010512798.1| PREDICTED: uncharacterized protein LOC104788711 [Camelina sativa]
Length=321

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 174/244 (71%), Gaps = 22/244 (9%)
 Frame = -1

Query  1404  AKSMDHRPKSILK-----QSPLHPNANLSEQQRFPKSKLR-VSINLPDNEISLKKSGQLQ  1243
             +KS   RPKSILK      SP H ++   +Q RF KS+LR VSINLPDNEIS + S    
Sbjct  82    SKSSVDRPKSILKPMSPASSPSHHDSRKQQQLRFAKSRLRRVSINLPDNEISRQLS----  137

Query  1242  FTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKA  1063
                 F +D           S    +  S S     RSTRT +EVLREL+ADVLALQDVKA
Sbjct  138   ----FREDP--------QHSPLRASSLSFSGEIGLRSTRTALEVLRELDADVLALQDVKA  185

Query  1062  EEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKA  883
             +E  +M+PLSDLAA LGM Y FAESWAPEYGNAILSKWPIK+  V +IFDD+DFRNV+KA
Sbjct  186   DEADQMRPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKNSNVLRIFDDTDFRNVLKA  245

Query  882   TIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWA  703
             +IDVP  GE+ F CT  DHLDE WRMKQ++AII+S++ PHILAG LNSLDE+DYSP+RW 
Sbjct  246   SIDVPGSGEVEFHCTHFDHLDEKWRMKQVDAIIRSTNVPHILAGALNSLDESDYSPERWT  305

Query  702   EIVK  691
             +IVK
Sbjct  306   DIVK  309



>ref|XP_010507820.1| PREDICTED: uncharacterized protein LOC104784492 [Camelina sativa]
Length=326

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 174/244 (71%), Gaps = 22/244 (9%)
 Frame = -1

Query  1404  AKSMDHRPKSILK-----QSPLHPNANLSEQQRFPKSKLR-VSINLPDNEISLKKSGQLQ  1243
             +KS   RPKSILK      SP H ++   +Q RF KS+LR VSINLPDNEIS + S    
Sbjct  87    SKSSVDRPKSILKPMSPASSPSHHDSRKQQQLRFAKSRLRRVSINLPDNEISRQLS----  142

Query  1242  FTNTFLDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKA  1063
                 F +D           S    +  S S     RSTRT +EVLREL+ADVLALQDVKA
Sbjct  143   ----FREDP--------QHSPLRASSLSFSGEIGLRSTRTALEVLRELDADVLALQDVKA  190

Query  1062  EEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMKA  883
             +E  +M+PLSDLAA LGM Y FAESWAPEYGNAILSKWPIK+  V +IFDD+DFRNV+KA
Sbjct  191   DEADQMRPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKNSNVLRIFDDTDFRNVLKA  250

Query  882   TIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWA  703
             +IDVP  GE+ F CT  DHLDE WRMKQ++AII+S++ PHILAG LNSLDE+DYSP+RW 
Sbjct  251   SIDVPGSGEVEFHCTHFDHLDEKWRMKQVDAIIRSTNVPHILAGALNSLDESDYSPERWT  310

Query  702   EIVK  691
             +IVK
Sbjct  311   DIVK  314



>gb|KCW58927.1| hypothetical protein EUGRSUZ_H015501, partial [Eucalyptus grandis]
Length=206

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 134/158 (85%), Gaps = 4/158 (3%)
 Frame = -1

Query  885  ATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRW  706
            ATI+VP VGE+NF CT LDHLDENWRMKQ+ AIIQ SD+PHILAGGLNSLDE +YS   W
Sbjct  1    ATIEVPHVGEVNFQCTHLDHLDENWRMKQVGAIIQLSDSPHILAGGLNSLDETNYSQDWW  60

Query  705  AEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRV  526
             +IVK    MGKPTPKVEVM++LKSKQ+ DAKDF GECESVV+IAKGQ VQGTCKY TRV
Sbjct  61   TDIVK----MGKPTPKVEVMRFLKSKQFTDAKDFAGECESVVVIAKGQSVQGTCKYETRV  116

Query  525  DYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
            DYI++S D  YKFVP SY VLSSKGTSDHHI+KVDV K
Sbjct  117  DYILASSDCPYKFVPRSYLVLSSKGTSDHHIIKVDVTK  154



>ref|XP_010026269.1| PREDICTED: uncharacterized protein LOC104416596 [Eucalyptus grandis]
Length=477

 Score =   254 bits (649),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             TVVEVLREL+AD++ALQDVKAEEEREMKPLS LAA LGM Y F +SWAPEYGNA+LS+WP
Sbjct  327   TVVEVLRELDADIVALQDVKAEEEREMKPLSKLAAALGMSYVFTKSWAPEYGNAVLSRWP  386

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTP  766
             IK  KVQKIFDD+DFRNV+KATI+VP VGE+NF CT LDHLDENWRMKQ+ AIIQSSD+P
Sbjct  387   IKHWKVQKIFDDTDFRNVLKATIEVPHVGEVNFQCTHLDHLDENWRMKQVGAIIQSSDSP  446

Query  765   HILAGGLNSLDEADYSPQRWAEIVKY  688
             HILAGGLNSLDE DYS +RW +IVK+
Sbjct  447   HILAGGLNSLDETDYSQERWTDIVKH  472


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 3/47 (6%)
 Frame = -1

Query  1386  RPKSILKQSPLHP---NANLSEQQRFPKSKLRVSINLPDNEISLKKS  1255
             R + +LKQSPLHP     +L++QQ+F +SKLRVSINLPDNEIS  +S
Sbjct  210   RARGMLKQSPLHPINGQDHLTKQQKFARSKLRVSINLPDNEISPLRS  256



>ref|XP_010105681.1| hypothetical protein L484_011292 [Morus notabilis]
 gb|EXC05712.1| hypothetical protein L484_011292 [Morus notabilis]
Length=417

 Score =   238 bits (606),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 151/338 (45%), Positives = 187/338 (55%), Gaps = 75/338 (22%)
 Frame = -1

Query  1392  DHRPKSILKQSPLHPNANLSE-QQRFPKSKLRVSINLPDNEISLKKSGQLQFTNTFLDDE  1216
             + RPKSILK SP+   A   E   +  +S L+VSINLPDNEISL  +  L          
Sbjct  105   NDRPKSILK-SPVSAAAASPECVSKLSRSNLKVSINLPDNEISLANNKLLTLMEAEKQGS  163

Query  1215  GDgrgksplrsssslnfssssagrsy----------rstRTVVEVLRELNADVLALQDVK  1066
              +       RSS  +                     +S+R+++EVLRE++AD+LALQDVK
Sbjct  164   SNMASGKAYRSSVPVRSPLCFPSSMTGGWNWHDDGLKSSRSILEVLREVDADILALQDVK  223

Query  1065  AEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRNVMK  886
             AEEE+ MKPLSDLA  LGMKY FAESWAPEYGNAILSKWPIK  KVQKI ++ DFR    
Sbjct  224   AEEEKGMKPLSDLAGALGMKYVFAESWAPEYGNAILSKWPIKRWKVQKIANNDDFRK---  280

Query  885   ATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYSPQRW  706
                           C    + ++               TP +                  
Sbjct  281   --------------CEFWQYYED-----------MGKPTPKV------------------  297

Query  705   AEIVKYYEEMGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRV  526
              E++K+ +  G                Y DAKD+ GECE VV+IAKGQ VQGTCKYGTRV
Sbjct  298   -EVMKFLKGKG----------------YTDAKDYAGECEPVVIIAKGQNVQGTCKYGTRV  340

Query  525   DYIVSSPDSVYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             DY++SS +S YKFVPGSYSV+SSKGTSDHH+VK D++K
Sbjct  341   DYVLSSSESPYKFVPGSYSVVSSKGTSDHHMVKADIIK  378



>ref|XP_008355478.1| PREDICTED: uncharacterized protein LOC103419132, partial [Malus 
domestica]
Length=325

 Score =   234 bits (596),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 150/199 (75%), Gaps = 12/199 (6%)
 Frame = -1

Query  1398  SMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTN  1234
             S   RPKSILKQSPLHPN+     NL++QQ+F KSKLRVSINLPDNEISL K+ QL F+ 
Sbjct  127   SGSERPKSILKQSPLHPNSMNNSENLTKQQKFSKSKLRVSINLPDNEISLLKNRQLSFSE  186

Query  1233  TFLDDEG-------DgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQ  1075
                 ++             S +R S  L   +++ G   RS RTV+EVLREL+ADVLALQ
Sbjct  187   GRAKEDAFSPVTGKSPLRSSSVRISGVLRSGATADGDLXRSHRTVLEVLRELDADVLALQ  246

Query  1074  DVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRN  895
             DVKAEEE++MKPLSDLAA LGM Y FAESWAPEYGNAILSKWPIK  KV+KIFDD+DFRN
Sbjct  247   DVKAEEEKDMKPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKRSKVEKIFDDTDFRN  306

Query  894   VMKATIDVPEVGEINFFCT  838
             V+KATIDVPE GE+NF CT
Sbjct  307   VLKATIDVPEAGEVNFHCT  325



>gb|KCW58931.1| hypothetical protein EUGRSUZ_H01553 [Eucalyptus grandis]
Length=185

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -1

Query  807  MKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSK  628
            MKQ++AIIQSSD+PHILAGGLNSLDE DYS ++W +IVK+YEE+GKPTPKVEVM++LKSK
Sbjct  1    MKQVSAIIQSSDSPHILAGGLNSLDETDYSQEQWTDIVKFYEEIGKPTPKVEVMRFLKSK  60

Query  627  QYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGT  448
            QY DAKDF GECES+V+IAKGQ +QGTCKYGTRVDYI++SPD  YKFVPG YSVLSSKGT
Sbjct  61   QYTDAKDFSGECESMVVIAKGQSMQGTCKYGTRVDYILASPDCPYKFVPGLYSVLSSKGT  120

Query  447  SDHHIVKVDVVK  412
             DHH+VKVDV K
Sbjct  121  LDHHVVKVDVTK  132



>gb|EPS65789.1| hypothetical protein M569_08992, partial [Genlisea aurea]
Length=203

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             +V++VLREL+AD+LALQDVKAEEE++MKPLSDLA  L M Y FA+SWAPEYGNAILS+WP
Sbjct  41    SVLDVLRELDADILALQDVKAEEEKDMKPLSDLARALDMNYVFADSWAPEYGNAILSRWP  100

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTP  766
             IK  KVQKI DD DFRNV+KATI+VP  GE++ +CT LDHLDE WRMKQ+ AII+S+D P
Sbjct  101   IKRWKVQKICDDKDFRNVVKATIEVPWSGELSVYCTQLDHLDEEWRMKQVLAIIESNDEP  160

Query  765   HILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKS  631
             HILAGGLNSLD +DYS +RW  +VK  E M  P   V + +++ S
Sbjct  161   HILAGGLNSLDSSDYSAERWHTLVKVSEIM--PLVCVSLQQFIHS  203



>ref|XP_002973846.1| hypothetical protein SELMODRAFT_414230 [Selaginella moellendorffii]
 gb|EFJ24801.1| hypothetical protein SELMODRAFT_414230 [Selaginella moellendorffii]
Length=471

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 165/247 (67%), Gaps = 31/247 (13%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             +V EVLR+  AD++ALQ+V+AEEE+ M PL+DLA  LGM YA+AESWAPE+GNAILS   
Sbjct  242   SVFEVLRDSKADLIALQEVRAEEEKGMSPLTDLAEALGMHYAYAESWAPEFGNAILS---  298

Query  945   IKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQ-SSDT  769
                            RN++K  +DVP  GE+ + CT LDHLDE+WR+KQ++AI++ +   
Sbjct  299   ---------------RNLLKVVVDVPSFGEVCYCCTHLDHLDEDWRIKQVSAILEDTKKV  343

Query  768   PHILAGGLNSLDEADYSPQRWAEIVK---YYE------EMGKPTPKVEVM-KYLKSKQYC  619
             PH LAG LNSL+  DYS +RWAEI K   +++      E  K  P+ +VM + L  K Y 
Sbjct  344   PHFLAGDLNSLNRPDYSQERWAEIAKASSFFQACQLRAENRKMAPRSDVMERLLVEKGYM  403

Query  618   DAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDH  439
             D+         +  + +GQ +QGTCK+ TR+DYI++SP   Y+F+PGSY V+SS+GTSDH
Sbjct  404   DSCAVAS--PEIPALVRGQEIQGTCKHNTRIDYILASPHLQYRFIPGSYKVVSSRGTSDH  461

Query  438   HIVKVDV  418
             H+V VD+
Sbjct  462   HLVTVDI  468



>ref|XP_008366577.1| PREDICTED: uncharacterized protein LOC103430217, partial [Malus 
domestica]
Length=328

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 131/179 (73%), Gaps = 12/179 (7%)
 Frame = -1

Query  1398  SMDHRPKSILKQSPLHPNA-----NLSEQQRFPKSKLRVSINLPDNEISLKKSGQLQFTN  1234
             S   RPKSILKQSPLHPN+     NL++QQ+F KSKLRVSINLPDNEISL K+ QL F+ 
Sbjct  144   SGSERPKSILKQSPLHPNSMNNSDNLTKQQKFSKSKLRVSINLPDNEISLLKNRQLSFSE  203

Query  1233  TFLDDEG-------DgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQ  1075
                 ++             S +R S  L   +++ G  Y S RTV+EVLRE++ADVLALQ
Sbjct  204   GRAKEDAFSPVTGKSPLRSSSVRFSGVLRSGAAADGDLYTSHRTVLEVLREMDADVLALQ  263

Query  1074  DVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFR  898
             DVKAEEE++MKPLSDLAA LGM Y FAESWAPEYGNAILSKWPIK  K+ KIFDD+DFR
Sbjct  264   DVKAEEEKDMKPLSDLAAALGMNYVFAESWAPEYGNAILSKWPIKRSKIVKIFDDTDFR  322



>gb|KCW58926.1| hypothetical protein EUGRSUZ_H015502, partial [Eucalyptus grandis]
Length=131

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 115/171 (67%), Gaps = 44/171 (26%)
 Frame = -1

Query  1395  MDHRPKSILKQSPLHP---NANLSEQQRFPKSKLRVSINLPDNEISLKKSGQ-LQFTNTF  1228
             MD R   ILKQSPLHP     +L++QQ+F +SKLRVSINLPDNEISL +S + L F+ + 
Sbjct  1     MDAR--GILKQSPLHPINGQDHLTKQQKFARSKLRVSINLPDNEISLLRSRRNLSFSES-  57

Query  1227  LDDEGDgrgksplrsssslnfssssagrsyrstRTVVEVLRELNADVLALQDVKAEEERE  1048
                                            STRTVVEVLREL+AD++ALQDVKAEEERE
Sbjct  58    -------------------------------STRTVVEVLRELDADIVALQDVKAEEERE  86

Query  1047  MKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFRN  895
             MKPL +LAA LGM YAFAESWAPEYGNA+LS+      KVQKIFDD+DFR+
Sbjct  87    MKPLLELAAALGMSYAFAESWAPEYGNAVLSR------KVQKIFDDTDFRS  131



>ref|XP_010070273.1| PREDICTED: uncharacterized protein LOC104457042 [Eucalyptus grandis]
Length=141

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = -1

Query  678  MGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDS  499
            MGKPTPKVEVM++LKSKQY DAKDF GECESVV+IAKGQ VQGTCKYGTRVDYI++SPD 
Sbjct  1    MGKPTPKVEVMRFLKSKQYTDAKDFAGECESVVVIAKGQSVQGTCKYGTRVDYILASPDC  60

Query  498  VYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             YKF+PGSYSVLSSKGTSDHHIVKVDV K
Sbjct  61   PYKFIPGSYSVLSSKGTSDHHIVKVDVTK  89



>gb|EYU43550.1| hypothetical protein MIMGU_mgv1a016341mg [Erythranthe guttata]
Length=125

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -1

Query  678  MGKPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDS  499
            MGKPTPK EVMKYLKSK+Y DAKDF GECESVVMIAKGQ VQGTCKYGTR+DYI+SS ++
Sbjct  1    MGKPTPKAEVMKYLKSKEYTDAKDFAGECESVVMIAKGQSVQGTCKYGTRIDYILSSENA  60

Query  498  VYKFVPGSYSVLSSKGTSDHHIVKVDVVK  412
             YKFVPGSYSV SSKGTSDHHIVKVD++K
Sbjct  61   PYKFVPGSYSVFSSKGTSDHHIVKVDLIK  89



>ref|XP_002314436.1| endonuclease/exonuclease/phosphatase family protein [Populus 
trichocarpa]
 gb|EEF00607.1| endonuclease/exonuclease/phosphatase family protein [Populus 
trichocarpa]
Length=141

 Score =   148 bits (373),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 77/151 (51%), Positives = 95/151 (63%), Gaps = 29/151 (19%)
 Frame = -1

Query  900  RNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADY  721
            RNV+KATIDVP  GE+ F+CT LDHLDENWR++QI                        Y
Sbjct  7    RNVLKATIDVPWAGEVEFYCTQLDHLDENWRLRQIGR---------------------RY  45

Query  720  SPQRWAEIVKYYEEM-----GKPTPKVEVMKYLKSKQYCDAKDFG-GECESVVMIAKGQC  559
               RW  ++    EM     GKPTPK+EV K+LK K   DAKD+  GECE VV+I KGQ 
Sbjct  46   QFFRWIRLL--IREMDGHCQGKPTPKIEVTKFLKGKGCVDAKDYAEGECEPVVIIPKGQN  103

Query  558  VQGTCKYGTRVDYIVSSPDSVYKFVPGSYSV  466
            VQGTCKYGTRVDY+++SP++  KFVPG  ++
Sbjct  104  VQGTCKYGTRVDYVLASPNTPCKFVPGDLTL  134



>gb|KCW58955.1| hypothetical protein EUGRSUZ_H01581 [Eucalyptus grandis]
Length=121

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -1

Query  648  MKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYS  469
            M++LKSKQY DAKDF GECES+V+IAKGQ +QGTCKYGTR DYI++SPD  YKFV G YS
Sbjct  1    MRFLKSKQYTDAKDFSGECESMVVIAKGQSMQGTCKYGTRGDYILASPDCPYKFVLGLYS  60

Query  468  VLSSKGTSDHHIVKVDVVK  412
            VLSSKGTSDHHIVKVDV K
Sbjct  61   VLSSKGTSDHHIVKVDVTK  79



>ref|XP_010026254.1| PREDICTED: uncharacterized protein LOC104416580 [Eucalyptus grandis]
Length=251

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWP  946
             TVVEVLREL+ D++ALQDVKAEEEREMKPLS+LAA LGM Y FAESWA EYGNA+LS+WP
Sbjct  3     TVVEVLRELDVDIVALQDVKAEEEREMKPLSELAAALGMSYVFAESWALEYGNAVLSRWP  62

Query  945   IKSCKVQKIFDDSDFRN  895
             IK  KVQKIFD +DF++
Sbjct  63    IKHLKVQKIFDVTDFKS  79


 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -1

Query  897  NVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSSDTPHILAGGLNSLDEADYS  718
            NV+KATI+VP VGE+NF CT LDHLDENWRMKQ+ AIIQSSD+PHILAGGLNSLD+ DYS
Sbjct  174  NVLKATIEVPHVGEVNFQCTHLDHLDENWRMKQVGAIIQSSDSPHILAGGLNSLDKTDYS  233

Query  717  PQRWAEIVKYY  685
             +RW +IV+ +
Sbjct  234  QERWTDIVRVF  244



>gb|EAY90087.1| hypothetical protein OsI_11656 [Oryza sativa Indica Group]
Length=79

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -1

Query  1089  VLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDD  910
             ++ALQ+V+AEE R M+PLS+LA GLGM+Y FAESWAPEYGNA+LS+WPIK    +++ D 
Sbjct  1     MVALQNVRAEEGRGMRPLSELAEGLGMRYVFAESWAPEYGNAVLSRWPIKRWNARRLADH  60

Query  909   SDFRN  895
              DFR+
Sbjct  61    FDFRS  65



>ref|WP_014434990.1| hypothetical protein [Caldilinea aerophila]
 ref|YP_005443664.1| hypothetical protein CLDAP_37270 [Caldilinea aerophila DSM 14535 
= NBRC 104270]
 dbj|BAM01767.1| hypothetical protein CLDAP_37270 [Caldilinea aerophila DSM 14535 
= NBRC 104270]
Length=282

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 110/267 (41%), Gaps = 41/267 (15%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDV---KAEEEREMKPLSDLAAGLGMKYAFAE--SWAPE-----  976
              V +VLR ++AD++ L +V   +         L  LAA L M + F     W  E     
Sbjct  22    AVTDVLRAIDADIIGLNEVFHPRVVPGDAQPALEALAARLQMHFVFGPCLRWPAEKNMPA  81

Query  975   --YGNAILSKWPIKSCKVQK----------IFDDSDFRNVMKATIDVPEVGEINFFCTLL  832
               YGNA+LS+WPI +               +  D + R +++A + +P       + T L
Sbjct  82    NAYGNALLSRWPILASSAHHLTPKEEDKSGVLQDKEQRGLLEARLLLPGGRTFTVYVTHL  141

Query  831   DHLDENWRMKQINA----IIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPT  664
             DH DE+ RM Q+      +++    PH + G  N++   D+  ++ A + K     G   
Sbjct  142   DHTDEDARMVQLRVARTWLVRDRSRPHAVMGDFNAISRWDWPEEQLAALRKQPLHQGGNL  201

Query  663   PKVE----VMKYLKSKQYCDA-KDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDS  499
                E    V++ ++   Y D  + FG         A G     T  +  R+DYI +S   
Sbjct  202   AGDEKGPQVIEAMEKAGYVDLYRQFG---------APGAATYLTDDWPIRIDYIFAS-QP  251

Query  498   VYKFVPGSYSVLSSKGTSDHHIVKVDV  418
             +   V        + G SDH  V  D+
Sbjct  252   LAPLVTHCSIWTQADGVSDHRPVLADI  278



>gb|KHN31749.1| Putative polygalacturonase [Glycine soja]
Length=137

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  1029  LAAGLGMKYAFAESWAPEYGNAILSKWPIKSCKVQKIFDDSDFR  898
             LA+ LGM Y FAESWAP+YGN +LSKWPIK  K+QKIFD  D+R
Sbjct  28    LASALGMNYVFAESWAPQYGNTVLSKWPIKRWKLQKIFDHHDYR  71



>ref|XP_010086902.1| hypothetical protein L484_005487 [Morus notabilis]
 gb|EXB24693.1| hypothetical protein L484_005487 [Morus notabilis]
Length=176

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (67%), Gaps = 11/66 (17%)
 Frame = -1

Query  1404  AKSMDHRPKSILKQSPLHPNANLSE-----------QQRFPKSKLRVSINLPDNEISLKK  1258
             AKS++ RP +ILKQSPLHPN   S            QQ+F +SKLRVSINLPDNEIS+  
Sbjct  95    AKSLNDRPNTILKQSPLHPNLMSSNNNNNNLDNLSNQQKFERSKLRVSINLPDNEISMMW  154

Query  1257  SGQLQF  1240
             + QL F
Sbjct  155   NRQLSF  160



>ref|WP_033171844.1| endonuclease [Streptomyces sp. URHA0041]
Length=275

 Score = 63.9 bits (154),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 65/226 (29%), Positives = 100/226 (44%), Gaps = 41/226 (18%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWAPE-----------  976
             ++ VLR+L  DV+ LQ+V A     +     LA+ LGM + +A S APE           
Sbjct  22    ILTVLRDLRPDVVGLQEVWACGGENLAEW--LASSLGMHWTWAASRAPEGWQRRIGDSTV  79

Query  975   -YGNAILSKWPI-KSCKVQKIF--DDSDFRNVMKATIDVPEVGEINFFCT-LLDHLDENW  811
               GNA+LS+WPI +  + +  F   D D R  + A ID PE  ++ FF T L   +D + 
Sbjct  80    DIGNAVLSRWPITEHARAELPFREGDDDGRLALYARIDAPE-HQVPFFTTHLTSAVDASA  138

Query  810   -RMKQINAII-------QSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKV  655
              R +Q+ A+        + S  P ++ G  N+  ++D         V+ +    K  P V
Sbjct  139   VRCRQVTALAGFVTARSRGSHFPPVVTGDFNAFPDSDE--------VRLFGGY-KTAPAV  189

Query  654   EVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYI  517
                 +L + +Y D         S+   A    V    +   RVDYI
Sbjct  190   PGQVFLDAWEYADPAQ-----PSMTWDAANPYVAAGFEPSARVDYI  230



>gb|EST41698.1| hypothetical protein SS50377_18785 [Spironucleus salmonicida]
Length=344

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 92/196 (47%), Gaps = 19/196 (10%)
 Frame = -1

Query  999  FAESWAPEYGNAILSKWPIKSCKVQKIFDDSDF----RNVMKATIDVPEVGEINFFCTLL  832
            FA +  P +GNAILS+    S ++ ++F   +     R+ + A +D P    I    T L
Sbjct  144  FAGTQNPNFGNAILSRHQFSSLRIIQLFGKQNQPWSQRSAISAILDTP--VPIQIITTHL  201

Query  831  DHLDENWRMKQ----INAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPT  664
            DHL E  R+ Q    ++ +  S+  P +L G  NSL + DY+  +   I    ++     
Sbjct  202  DHLKEEERIVQCQQLMDILTVSNVMPQLLMGDFNSLTQQDYTSDQLLHINNKRKKNNIEL  261

Query  663  PKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFV  484
             K +++  L+ K + D    G +      + +G     T ++ TR+DYI +  + V+   
Sbjct  262  AKFDLINLLQQKSWLDCAWNGPK-----PVFEGTAA-TTSRFDTRIDYIFT--NRVFVNC  313

Query  483  PGSYSVLSSKGTSDHH  436
              SY + + + T DH+
Sbjct  314  IASYRIFTMQET-DHN  328



>ref|WP_008992073.1| hypothetical protein [Galbibacter marinus]
 gb|EKF54743.1| putative secreted protein [Galbibacter marinus]
Length=251

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 89/198 (45%), Gaps = 31/198 (16%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDV--KAEEEREMKPLSDLAAGLGMKYAFAESW---APEYGNAIL  958
             + +V+     D++ALQ+V  K +  +     ++LA   GM   FA++       YG  +L
Sbjct  39    ISDVINNTKPDLVALQEVDYKTKRAKNFDLTTELAQRTGMTSYFAKAMDYDGGAYGEGVL  98

Query  957   SKWPIKSCKVQKIFDD--SDFRNVMKATIDVPEVGEINFFCTLLDHLDENW-RMKQINAI  787
             SKWPI S K   +     S+ R   + TI +     I F  T LDHL +N  RM Q+ AI
Sbjct  99    SKWPILSAKNIPLPHQPTSEPRAAAEITIAISPGDTIRFIGTHLDHLKDNRDRMMQVQAI  158

Query  786   IQS---SDTPHILAGGLNSL---DEADYSPQRWAEIVKYYEEMGKPT-----PKVEV---  649
              Q     D P ILAG LN     +  +    +W+    Y E   +PT     PK ++   
Sbjct  159   NQKLIPGDYPSILAGDLNDTPGSEPIEILESKWS--AAYQETTLEPTFPSDDPKGKIDYI  216

Query  648   -------MKYLKSKQYCD  616
                     K L+SK  CD
Sbjct  217   MYTPKKAWKVLESKTICD  234



>ref|WP_011879953.1| endonuclease [Burkholderia vietnamiensis]
 ref|YP_001115001.1| endonuclease/exonuclease/phosphatase [Burkholderia vietnamiensis 
G4]
 gb|ABO58746.1| Endonuclease/exonuclease/phosphatase [Burkholderia vietnamiensis 
G4]
Length=263

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESW-APE--YGNAILSK  952
             +V V+REL+ADV+ALQ+V     R    L+ L    GM  A   +   PE  YGNA+LS+
Sbjct  51    IVAVIRELDADVIALQEVPLGGTRAPDVLAHLRDATGMHAAAGPTIDTPERRYGNAVLSR  110

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
              PI++ +   + F   + R  + A ID    G I    T L  L  N R  Q+  ++ + 
Sbjct  111   CPIRAARTLDLSFHQREPRGALDADIDC-SAGPIRVVATHLG-LSANERSAQVQRLLAAF  168

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  169   DTGAMPVILMGDIN  182



>ref|WP_034192826.1| endonuclease [Burkholderia sp. WP42]
Length=263

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESW-APE--YGNAILSK  952
             +V V+REL+ADV+ALQ+V     R    L+ L    GM  A   +   PE  YGNA+LS+
Sbjct  51    IVAVIRELDADVIALQEVPLGGTRAPDVLAHLRDATGMHAAAGPTIDTPERRYGNAVLSR  110

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
              PI++ +   + F   + R  + A ID    G I    T L  L  N R  Q+  ++ + 
Sbjct  111   CPIRAARTLDLSFHQREPRGALDADIDC-GAGPIRVVATHLG-LSANERSAQVQRLLAAF  168

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  169   DTGAMPVILMGDIN  182



>ref|WP_035804522.1| hypothetical protein [Cyclobacteriaceae bacterium AK24]
Length=233

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 75/150 (50%), Gaps = 16/150 (11%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLG----MKYAFAESW---APEYGN  967
              +  V+R+  AD++ALQ+V    ER  + L   AA LG    M + F +S      EYGN
Sbjct  21    AIARVIRDSGADLVALQEVDVFTERSGRYLHQ-AARLGELTEMYWYFYKSIDHAGGEYGN  79

Query  966   AILSKWPIKSCKVQKIFDDSDFRNVMKATIDV--PEVGEINFFCTLLDHLDENWRMKQIN  793
             AILSK+PI +     + +D+D        +DV  P  G I F  T L+   E   +KQ  
Sbjct  80    AILSKYPILAKGGWDLPNDADTEPRTAVYVDVMLPGGGAITFAGTHLEFKREEVTLKQAK  139

Query  792   AIIQ----SSDTPHILAGGLNSLDEADYSP  715
             ++ +     SD P ILAG  NS  EA  SP
Sbjct  140   SLAEFLGARSDRPLILAGDFNS--EAGKSP  167



>ref|WP_014725722.1| endonuclease [Burkholderia sp. KJ006]
 ref|YP_006336405.1| Endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
sp. KJ006]
 gb|AFJ89674.1| Endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
sp. KJ006]
Length=259

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 67/134 (50%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESW-APE--YGNAILSK  952
             +V V+REL+ADV+ALQ+V     R    L+ L    GM      +   PE  YGNA+LS+
Sbjct  47    IVAVIRELDADVIALQEVPLGGTRAPDVLAHLRDATGMHAVAGPTIDTPERRYGNAVLSR  106

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
              PI++ +   + F   + R  + A ID    G I    T L  L  N R  Q+  ++ + 
Sbjct  107   CPIRAARTLDLSFHQREPRGALDADIDC-SAGPIRVVATHLG-LSANERSAQVQRLLAAF  164

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  165   DTGAMPVILMGDIN  178



>ref|WP_012064146.1| endonuclease/exonuclease/phosphatase [Alkaliphilus metalliredigens]
 ref|YP_001320838.1| endonuclease/exonuclease/phosphatase [Alkaliphilus metalliredigens 
QYMF]
 gb|ABR49179.1| Endonuclease/exonuclease/phosphatase [Alkaliphilus metalliredigens 
QYMF]
Length=379

 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 75/139 (54%), Gaps = 16/139 (12%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDV-----KAEEEREMKPLSDLAAGLGMKYAFAESW---APEYGN  967
             + EV++E  A+V+ LQ+V     + + + ++K LS+    LGM YA+  +      +YGN
Sbjct  174   IAEVIKESRAEVIGLQEVDQHFIRTKFQDQIKYLSE---ELGMNYAYGPNLNIVGAKYGN  230

Query  966   AILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAI  787
             A+LS  PI+  +   I    + R ++K TIDV E   ++FF T L  L++  RM Q+  I
Sbjct  231   AVLSVHPIEDYENVMIPSGRESRGLLKTTIDV-EGQLVDFFVTHLG-LNQKERMGQVKVI  288

Query  786   IQSSD---TPHILAGGLNS  739
              Q  D    P IL G  N+
Sbjct  289   EQQIDMAQNPVILVGDFNA  307



>gb|EON78771.1| putative secreted protein [Cyclobacteriaceae bacterium AK24]
Length=274

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 75/150 (50%), Gaps = 16/150 (11%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLG----MKYAFAESW---APEYGN  967
              +  V+R+  AD++ALQ+V    ER  + L   AA LG    M + F +S      EYGN
Sbjct  62    AIARVIRDSGADLVALQEVDVFTERSGRYLHQ-AARLGELTEMYWYFYKSIDHAGGEYGN  120

Query  966   AILSKWPIKSCKVQKIFDDSDFRNVMKATIDV--PEVGEINFFCTLLDHLDENWRMKQIN  793
             AILSK+PI +     + +D+D        +DV  P  G I F  T L+   E   +KQ  
Sbjct  121   AILSKYPILAKGGWDLPNDADTEPRTAVYVDVMLPGGGAITFAGTHLEFKREEVTLKQAK  180

Query  792   AIIQ----SSDTPHILAGGLNSLDEADYSP  715
             ++ +     SD P ILAG  NS  EA  SP
Sbjct  181   SLAEFLGARSDRPLILAGDFNS--EAGKSP  208



>ref|XP_005787766.1| hypothetical protein EMIHUDRAFT_201362 [Emiliania huxleyi CCMP1516]
 gb|EOD35337.1| hypothetical protein EMIHUDRAFT_201362 [Emiliania huxleyi CCMP1516]
Length=329

 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 87/225 (39%), Gaps = 57/225 (25%)
 Frame = -1

Query  1068  KAEEEREMKPLSDLAAGLGMKY--------------AFAESWAPEY--GNAILSKWPIK-  940
             + +E  E   L  LAA LG+ +               FA  +  +Y  GNAILS++P+  
Sbjct  91    RPDERDEDNYLRRLAAALGLPHICFGAAVGTDPEPRPFARCFFAQYPFGNAILSRFPLSD  150

Query  939   -------------SCKVQKIFD-DSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMK  802
                          +C  Q   D D + R +  A + +P  G +                 
Sbjct  151   VRHSLLSVSPADLTCGDQPRTDSDLEHRALTTARLRLPGGGSLGV---------------  195

Query  801   QINAIIQS-----SDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEM--GKPTPKVEVMK  643
              + A ++         PH+L G LNS    D S ++W+EI   YE    G P P   V  
Sbjct  196   AVAAAVERCAGAFGSLPHVLCGDLNSFSRGDMSARQWSEICALYESRGWGSPRPDSLVRA  255

Query  642   YLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSS  508
              L +  YCD+  FG      V+         TC   TR+DY++ S
Sbjct  256   VLHAAGYCDS--FGAILRPAVL--PNVLPPPTCWTNTRLDYVLLS  296



>ref|WP_037760545.1| endonuclease [Streptomyces sp. CNH287]
Length=284

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 65/235 (28%), Positives = 96/235 (41%), Gaps = 52/235 (22%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFA-----ESW---------  985
             +  VLR L  DV+ LQ+V ++    +     LA  LG+ + +A     E W         
Sbjct  28    IRTVLRALRPDVVGLQEVWSDGTENLA--GTLADDLGLHWTWAPSSRSERWNRRLAGPSS  85

Query  984   -AP--EYG--NAILSKWPIKSCKVQKIFDDS---DFRNVMKATIDVPEVGEINFFCTLLD  829
              AP  EYG  NA+LS+WP+    V ++  D    D R  + A +D P  G + FF T L+
Sbjct  86    TAPPTEYGVGNAVLSRWPVLDRTVLRLPADGARDDGRLALHARLDAPG-GPLPFFTTHLN  144

Query  828   HL--DENWRMKQINAIIQ-------SSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEM  676
                 D   R  Q+ A+ +        +D P +L G  N+L ++D               +
Sbjct  145   SAPHDSALRCAQVTALARFVAEHRGGTDFPPVLTGDFNALPDSD-----------ELRLL  193

Query  675   G--KPTPKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYI  517
             G  +  P V     L + +Y D         SV        V  T   G R+DYI
Sbjct  194   GGHRTAPAVPGQVLLDAWEYADPA-----APSVTWDPANPYVAETFSPGGRIDYI  243



>ref|WP_030961986.1| endonuclease, partial [Streptomyces sp. NRRL F-5140]
Length=250

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 99/233 (42%), Gaps = 47/233 (20%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKA---EEEREMKPLSDLAAGLGMKYAFAESWAPE--------  976
             ++  LREL  DV+ LQ+V A   E + E      LA  LGM +A+A S APE        
Sbjct  22    ILTELRELRPDVVGLQEVWAAGGENQAEW-----LAGELGMHWAWAPSPAPERWRRRIGD  76

Query  975   ----YGNAILSKWPI---KSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDE  817
                  GNA+LS+WP+   ++ ++    D  D R  +   +  P   +I+FF T L    +
Sbjct  77    PTVDIGNAVLSRWPVTDRRTLRLPAPADVDDGRLALFTRLAAPSY-DISFFTTHLTSAPD  135

Query  816   N--WRMKQINAIIQ-----SSDT--PHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPT  664
                 R +Q+ A+ +       DT  P I+ G  N+L ++D       EI  +     +  
Sbjct  136   GSAVRCRQVTALAEFIAENRGDTTFPTIVTGDFNALPDSD-------EISLFGGH--RTA  186

Query  663   PKVEVMKYLKSKQYCDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSP  505
             P V    +L + +Y D         ++        V      G R+DYI   P
Sbjct  187   PVVPGQVFLDAWRYADPA-----APALTWDRANAHVPAGPGPGGRIDYIHVGP  234



>ref|WP_035661161.1| hypothetical protein [Bacillus akibai]
 dbj|GAE33247.1| endonuclease/exonuclease/phosphatase family protein [Bacillus 
akibai JCM 9157]
Length=240

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 68/137 (50%), Gaps = 9/137 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEERE--MKPLSDLAAGLGMKYAFAESW---APEYGNAIL  958
              +E LR L AD+++LQ+V+    R      ++ +A  LGM   F+ S       YGNAIL
Sbjct  38    TIETLRGLEADIISLQEVERNSFRSYFTDQVTTIANALGMNAVFSPSLNYPGLYYGNAIL  97

Query  957   SKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAI---  787
             SK+PI+        +  + R  M   + + E   I    T L  L+ + R++ I+ I   
Sbjct  98    SKYPIEDTATIPFSNRIENRTAMLTKLTISEEQSIYVLNTHLG-LNRSERLEAIDEIHDR  156

Query  786   IQSSDTPHILAGGLNSL  736
             ++  D P +L G LNSL
Sbjct  157   LKRLDQPILLTGDLNSL  173



>ref|WP_028664866.1| hypothetical protein [Runella zeae]
Length=228

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 109/243 (45%), Gaps = 50/243 (21%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMK--PLSDLAAGLGMKYAFA---ESWAPEYGNAIL  958
             VVE++++   D++ALQ++ +   R  K   ++ L+   G K AF+   E    +YG  IL
Sbjct  20    VVELIKKHKPDLVALQEIDSVVTRSGKVNQMNILSLLTGYKSAFSDAIELQGGKYGLGIL  79

Query  957   SKWPIKSCKVQKIFD--DSDFRNVMKATIDVPEVGEINFFCTLLDH---LDENWRMKQIN  793
             SK+PI+S +  K+ +  D++ R +M A + + +   + F  T LDH   L    +   IN
Sbjct  80    SKYPIESVQKLKLPNPEDAEPRILMCALVPLSDSKYVRFCNTHLDHRSALGRGLQAAVIN  139

Query  792   AIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCDA  613
               +Q+S  P I+ G  N+  + D++ +    + KY+ + GK T                 
Sbjct  140   ENLQNSIYPVIVGGDFNATTD-DHTLE---AMTKYWNDAGKNTD----------------  179

Query  612   KDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHHI  433
                GG    V                 R+DY  +   S +K +   Y VL    TSDH+ 
Sbjct  180   ---GGTLPDV---------------NKRIDYFWTHQSSAFKMI--DYKVLYEPQTSDHYP  219

Query  432   VKV  424
             V V
Sbjct  220   VIV  222



>ref|XP_002680484.1| phosphatase [Naegleria gruberi]
 gb|EFC47740.1| phosphatase [Naegleria gruberi]
Length=310

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 69/269 (26%), Positives = 113/269 (42%), Gaps = 46/269 (17%)
 Frame = -1

Query  1110  LRELNADVLALQDVKAEEEREMKPLSDLAAGL----------GMKYAFAESWAPEYGNAI  961
             L + N D++ L +V  + E    PL DL   L             Y +         N I
Sbjct  44    LHKNNFDIVCLNEVYEDSEYS-HPLRDLVYALNSSLPEEVEVARPYQYRSGPTNYESNII  102

Query  960   LSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAII-  784
             LSK+PI   + + +      R+V+   ID P V   N F T LDH+ EN R+ Q+  ++ 
Sbjct  103   LSKYPILFQEKKDVGRGE--RSVLGIKIDHPLVR--NVFVTHLDHVSENKRVLQLKRVLS  158

Query  783   --------QSSDTPH------ILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVM  646
                     +  D P+      IL G  NS+   DY+ + W  ++K   + G   P  +V 
Sbjct  159   FMKHFIDRKLVDYPNDENKNFILLGDFNSMRMDDYTDKFWDYLIKQRIQYGWEAPDTQVT  218

Query  645   KYL---------KSKQYCDAKDFGG---ECESVV---MIAKGQCVQGTCKYGTRVDYIVS  511
               L          S +  D         +C  V+   +I +G+   G+ +  TR+DY++S
Sbjct  219   SLLFNEPTTPESHSTEEADEPKLKMPLVDCWKVLNPDIIFEGEKGTGSSRLDTRIDYVIS  278

Query  510   SPDSVYKFVPGSYSVLSSKGTSDHHIVKV  424
             + + +  ++  S+    + G SDH  V V
Sbjct  279   NTE-LQPYLKQSWIDSDASGISDHLPVVV  306



>ref|WP_033562832.1| hypothetical protein [Sphingobacteriaceae bacterium DW12]
Length=272

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 74/143 (52%), Gaps = 15/143 (10%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKP---LSDLAAGLGMKYAFAES---WAPEYGNAI  961
             + EV++  + D++ALQ+V     R  K      +LAA  GM Y FA++   +  EYG+A+
Sbjct  57    IAEVIKRADPDLVALQEVDKFTTRNAKNGDVAKELAALTGMDYFFAKAIDVYGGEYGDAV  116

Query  960   LSKWPIKSCKVQKIFDD----SDFRNVMKATIDVPEVGEINFFCTLLDHL-DENWRMKQI  796
             LSK P+K  K   +  D     + R+V +  ++  +     F  T  DHL DE  R+KQ 
Sbjct  117   LSKLPVKEKKAFNLEVDPALGGERRSVARVLVEKSD-KNFYFISTHFDHLGDERNRVKQA  175

Query  795   N---AIIQSSDTPHILAGGLNSL  736
             +   A+ +S D P I+    N+L
Sbjct  176   SDFVALAKSFDRPVIVGSDFNAL  198



>ref|WP_007660703.1| endonuclease/exonuclease/phosphatase [Pontibacter sp. BAB1700]
 gb|EJF08118.1| endonuclease/exonuclease/phosphatase [Pontibacter sp. BAB1700]
Length=269

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 69/140 (49%), Gaps = 12/140 (9%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEERE--MKPLSDLAAGLGMKYAFAES---WAPEYGNAI  961
              +  V+R    D++ALQ+V     R   +     LAA LGM + FA++      EYG AI
Sbjct  49    AIAGVIRSEEPDLVALQEVDVHIPRSGNVHQAEALAAMLGMHFYFAKAIDFGGGEYGVAI  108

Query  960   LSKWPIKSC-KVQKIFDDS---DFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQIN  793
             LS++P+    KV+   +DS   + R +  AT+ +P    I F  T LD      R +Q+ 
Sbjct  109   LSRYPLSDTRKVELPKEDSPKAEGRVLAVATVQLPGGQRIRFGSTHLDIQSSANRQQQVQ  168

Query  792   AII---QSSDTPHILAGGLN  742
              II    +   P ILAG LN
Sbjct  169   TIIAVAAADQLPFILAGDLN  188



>ref|WP_013926549.1| hypothetical protein [Runella slithyformis]
 ref|YP_004654359.1| hypothetical protein [Runella slithyformis DSM 19594]
 gb|AEI47227.1| Endonuclease/exonuclease/phosphatase [Runella slithyformis DSM 
19594]
Length=262

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 110/246 (45%), Gaps = 56/246 (23%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEER-----EMKPLSDLAAGLGMKYAFAES---WAPEYGN  967
             VVE++++   D++ALQ++ +   R     +M+ LS L+   G + AF ++      +YG 
Sbjct  54    VVELIKKHKPDLVALQEIDSGAVRSGKLNQMRILSLLS---GYEEAFGKTIDFQGGKYGL  110

Query  966   AILSKWPIKSCKVQKI--FDDSDFRNVMKATIDVPEVGEINFFCTLLDH---LDENWRMK  802
              ILS  PI++ +  K+   D ++ R +M A I++P    + F  T LDH   L+   +  
Sbjct  111   GILSAHPIEAVQRLKLPNPDSTEPRLLMCALIELPNNKYVRFCTTHLDHRSPLNRGLQAA  170

Query  801   QINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQY  622
              IN  +Q+S  P I+ G  N+  E D++ +    + KY+ + G  TP             
Sbjct  171   VINENLQNSLYPVIVGGDFNATAE-DHTLE---AMTKYWNDAGANTPWA-----------  215

Query  621   CDAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSD  442
                                    GT   G R+DY  +  +S +K +   Y VL    TSD
Sbjct  216   --------------------TYPGT---GKRIDYFWTHKESTFKVL--DYVVLYEPTTSD  250

Query  441   HHIVKV  424
             H  V V
Sbjct  251   HQPVIV  256



>ref|WP_013787246.1| endonuclease [Thermoanaerobacterium xylanolyticum]
 ref|YP_004470167.1| hypothetical protein Thexy_0443 [Thermoanaerobacterium xylanolyticum 
LX-11]
 gb|AEF16495.1| Endonuclease/exonuclease/phosphatase [Thermoanaerobacterium xylanolyticum 
LX-11]
Length=231

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 66/135 (49%), Gaps = 9/135 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEERE--MKPLSDLAAGLGMKYAFAESWA---PEYGNAIL  958
             +  ++RE+  D++ LQ+V    +R   +  +  LA  L M YAF  +       +GN IL
Sbjct  25    ISNLIREIGVDIVGLQEVDVFLKRSYFLNEIKYLAKRLKMHYAFGPNLRIGFGSFGNGIL  84

Query  957   SKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQ---INAI  787
             S++PI   K   I+   + R V+ A I + E  +I F  T L  L+   R+ Q   I  I
Sbjct  85    SRYPIVKKKNHHIYSKGERRGVLTALIQLNENKKIWFLTTHLG-LNRKERLVQSQEILKI  143

Query  786   IQSSDTPHILAGGLN  742
             + + + P I+ G  N
Sbjct  144   VSNLEYPVIMTGDFN  158



>ref|WP_020737631.1| hypothetical protein [Sorangium cellulosum]
 ref|YP_008152111.1| hypothetical protein SCE1572_28605 [Sorangium cellulosum So0157-2]
 gb|AGP38084.1| hypothetical protein SCE1572_28605 [Sorangium cellulosum So0157-2]
Length=259

 Score = 57.4 bits (137),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 71/256 (28%), Positives = 112/256 (44%), Gaps = 47/256 (18%)
 Frame = -1

Query  1110  LRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAES----WAPEYGNAILSKWPI  943
             LREL+ADV+ LQ+V + E R +    D+A GLG + AF  +        +GNA+LS+WPI
Sbjct  24    LRELDADVVGLQEVMSYEGRSLA--DDIAEGLGYEIAFGAAHDLGGGVLFGNAVLSRWPI  81

Query  942   KSCKVQKI--FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENW-------RMKQINA  790
                +   +   +  + R+++ A +  P  G I FF T   HL  NW       R  Q+ A
Sbjct  82    GRSQAFPLPTGETDEKRSILLAELASPR-GVIPFFVT---HL--NWKFHHGVVREAQVAA  135

Query  789   IIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYL-----KSKQ  625
             + +       LA GL  +   D++ Q  A  +++             MK L     KS  
Sbjct  136   VAEIVMREAPLA-GLPPIVVGDFNAQPEAAEIRF-------------MKGLQSLNQKSVY  181

Query  624   YCDAKDFGGECESVVM-IAKGQCVQGTCKYGTRVDYI-VSSPDSVYKFVPGSYSVLSSK-  454
             + D  D  G+         +      T +Y  R+DYI V  P+   +  P +  V+  + 
Sbjct  182   FADTFDQVGKGPGFTFDPVRNPFAAITNEYPRRIDYIFVRGPNEQGRGKPLASRVVFEEL  241

Query  453   ----GTSDHHIVKVDV  418
                   SDH+ V  ++
Sbjct  242   EDGVAASDHYGVLSEI  257



>ref|WP_037324815.1| hypothetical protein [Salinimicrobium terrae]
Length=270

 Score = 57.4 bits (137),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 71/138 (51%), Gaps = 11/138 (8%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKP--LSDLAAGLGMKYAFAESW---APEYGNAIL  958
             V +V+ +L  D++ALQ+V     R  K    ++LA   GM   FA++      EYG ++ 
Sbjct  54    VAKVINDLKPDLVALQEVDLRTNRAQKRDINTELALKTGMSSIFAKAVDFDGGEYGQSLF  113

Query  957   SKWP-IKSCKVQKIFD-DSDFRNVMKATIDVPEVGEINFFCTLLDHL----DENWRMKQI  796
             S+W  +K+ K++     D + R    ATI +P    I    T +DHL    D   + ++I
Sbjct  114   SRWTFLKTGKIELPGSPDKEPRIAATATIILPAGDTIRLLGTHMDHLEKSPDRLAQARKI  173

Query  795   NAIIQSSDTPHILAGGLN  742
             N+ I+ +  P ILAG LN
Sbjct  174   NSFIEKNTIPTILAGDLN  191



>ref|WP_034679515.1| endonuclease [Bacillus megaterium]
Length=276

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 72/145 (50%), Gaps = 18/145 (12%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVK---AEEEREMKPLSDLAAGLGMKYAFAESW----AP----  979
             ++  V++E NAD++A+Q+V     E  + +    +LA  +G  Y F  +     AP    
Sbjct  61    SIANVIKETNADIIAIQEVDRYFGERSQFVDQARELAKLVGYHYTFGANLNLKPAPGQVE  120

Query  978   --EYGNAILSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRM  805
               +YG AILSK+PI   K   +  D + R ++   ++V  V  +  F T L  L    RM
Sbjct  121   NRQYGTAILSKYPIIDSKNIHLSSDGEQRGLLIGKVNVRGV-HLTVFNTHLG-LSHVERM  178

Query  804   KQINAIIQSS---DTPHILAGGLNS  739
              Q+  II+ S   + P +L G LN+
Sbjct  179   GQVEEIIEISSYYNEPTVLMGDLNA  203



>ref|WP_026545577.1| endonuclease/exonuclease/phosphatase [Arthrobacter sp. 35/47]
Length=282

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 84/178 (47%), Gaps = 31/178 (17%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSD-------LAAGLGMKYAFA----------  994
             +  V+ +  ADV+ LQ+V    +      SD       LA  LGM YA+A          
Sbjct  54    IAGVIEDSGADVIGLQEV----DNHWSSRSDFQDQAAWLAERLGMHYAYAANLDRDPAAG  109

Query  993   ESWAPEYGNAILSKWPIKSCK------VQKIFDDSDFRNVMKATIDVPEVGEINFFCTLL  832
             ++   +YG A+LS++PI S +      ++     ++ R +++  I+V E   I+F+ T L
Sbjct  110   QTERRQYGTAVLSEYPILSSENHLLTNIEYEVRPTEQRGLLETVINV-EGNHISFYNTHL  168

Query  831   DHLDENWR---MKQINAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKP  667
             DH     R   MK+I AI +  D P +L G LN++          ++    +E +G+P
Sbjct  169   DHQRSEQRQSQMKEILAISEEMDRPAVLVGDLNAVPGTPEMETVLSQFSDVFEVLGQP  226



>ref|WP_015923851.1| endonuclease/exonuclease/phosphatase [Halothermothrix orenii]
 ref|YP_002509877.1| endonuclease/exonuclease/phosphatase [Halothermothrix orenii 
H 168]
 gb|ACL70882.1| Endonuclease/exonuclease/phosphatase [Halothermothrix orenii 
H 168]
Length=281

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 68/136 (50%), Gaps = 9/136 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEERE--MKPLSDLAAGLGMKYAFA---ESWAPEYGNAIL  958
             +  VL++ ++D++ L +V    +R      +  LA  L M YA+    ++    YGNA+L
Sbjct  72    IARVLKKTDSDIIGLNEVDRGLKRSGFQHQVQILARKLKMNYAYGPNLQTGEGSYGNAVL  131

Query  957   SKWPIKSC--KVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLL--DHLDENWRMKQINA  790
             SK+PI     K   + D ++ R +++A + +P   E+    T L  D  +   ++K IN 
Sbjct  132   SKYPISEVINKPLPVIDSTEKRGLLQAIVSLPGGPELKIMVTHLSTDFKEREQQLKWINE  191

Query  789   IIQSSDTPHILAGGLN  742
                + +TP IL G  N
Sbjct  192   YTNNIETPFILMGDFN  207



>gb|KGE14479.1| endonuclease/exonuclease/phosphatase [Sphingobacterium sp. ACCC 
05744]
Length=258

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 74/137 (54%), Gaps = 9/137 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMK--PLSDLAAGLGMKYAFAES---WAPEYGNAIL  958
             +  V+R+ NA+++ALQ+V     R  K      LAA LGM+Y F++S      EYG AIL
Sbjct  47    IAAVIRQSNAELIALQEVDVNVPRSGKVNQAEQLAALLGMEYHFSKSIDYQGGEYGVAIL  106

Query  957   SKWPIKSCKVQKI--FDDSDFRNVMKATIDVPEVGEINFFCTLLD-HL-DENWRMKQINA  790
             SK+P+ + +   +      + R+V+ A++ +P    I F  T  D H+ +   + +++N 
Sbjct  107   SKYPLSNKRRMDLPMSIPGEKRSVVLASVVLPNGETIEFGSTHFDLHVPNRTVQAEELNI  166

Query  789   IIQSSDTPHILAGGLNS  739
             + QS+  P  + G  N+
Sbjct  167   LSQSTAKPLFIGGDYNA  183



>emb|CDS91540.1| conserved exported hypothetical protein [Sphingobacterium sp. 
PM2-P1-29]
Length=262

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 97/193 (50%), Gaps = 26/193 (13%)
 Frame = -1

Query  1113  VLRELNADVLALQDVKAEEEREMKPL---SDLAAGLGMKYA-FAESWA---PEYGNAILS  955
             V+++++ DV++LQ+V  E    + P+    +LAA  GMKY  FA +      +YGN ILS
Sbjct  53    VIKKVDPDVVSLQEV--ERNTAVNPMDFPKELAALTGMKYYYFAHALTLKQGDYGNVILS  110

Query  954   KWPI---KSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDH-LDENWRMKQINAI  787
             K+P+   +S  +    D  D R++  A I+  E  E  F  T L + LD+  R+KQ+  I
Sbjct  111   KYPLQDTQSFHLSVADDGDDIRSLGYARIE-KEGKEFYFATTHLGYKLDDATRLKQVGEI  169

Query  786   ---IQSSDTPHILAGGLNSLDEADYSP--QRW------AEIVKYYEEMGKPTPKVEVMKY  640
                ++    P IL G LNS   +   P  Q+W      A   ++   + KPT   + + Y
Sbjct  170   LSHVKDLKKPIILGGDLNSRPNSQTMPALQKWFTLACEANACEWTVPVPKPTYTCDWIIY  229

Query  639   LKSKQYCDAKDFG  601
               ++ + D KD+ 
Sbjct  230   APNQAF-DVKDYA  241



>ref|WP_022275420.1| uncharacterized protein [Bacteroides finegoldii CAG:203]
 emb|CDC53224.1| uncharacterized protein BN532_01003 [Bacteroides finegoldii CAG:203]
Length=264

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 72/142 (51%), Gaps = 16/142 (11%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPL---SDLAAGLGMKYA-FAESW----APEYGN  967
             + EV+++ N D+++LQ++  E   E+ P      L+   GMKY  FA +       +YGN
Sbjct  51    IAEVIKKENPDIVSLQEI--ERNTEINPWDTPKKLSELTGMKYYYFAHALDIPTGGDYGN  108

Query  966   AILSKWPIKSCKVQK--IFDDSDFRNVMKATIDVPEVGEINFFCTLLDH-LDENWRMKQI  796
              ILSK+P+   K  K  +  + D+         V E  E  F  T LDH  ++  R+KQ+
Sbjct  109   VILSKYPVSEEKSFKLSVLKEGDYVRSFGYVKVVKEGKEFYFATTHLDHKYEDAARLKQV  168

Query  795   NAI---IQSSDTPHILAGGLNS  739
             + I   ++  D P IL G LNS
Sbjct  169   DEILACVEHLDKPVILGGDLNS  190



>gb|AHM57913.1| endonuclease/exonuclease/phosphatase [Eubacterium acidaminophilum 
DSM 3953]
Length=232

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 63/135 (47%), Gaps = 12/135 (9%)
 Frame = -1

Query  1116  EVLRELNADVLALQDVKAEEEREMKPLSDL--AAGLGMKYAFAE----SWAPEYGNAILS  955
               L  L ADV+ LQ+V     R +     L  A  LGM+Y+F      S    YGNAILS
Sbjct  28    RALEALGADVICLQEVDMNRARTLYANQALKFAGLLGMEYSFGAAIKYSGGGAYGNAILS  87

Query  954   KWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINA----I  787
             + PI   K  ++      R + +  ++V E   I  F T ++ LD+  R++QI      +
Sbjct  88    RHPIVQQKNHRLPGQGSKRAIQEVQVEV-EGSRIAIFNTHME-LDQEQRLQQIEGFIVPL  145

Query  786   IQSSDTPHILAGGLN  742
             + S   P +L G  N
Sbjct  146   VSSYTGPAVLCGDFN  160



>ref|WP_008658672.1| endonuclease/exonuclease/phosphatase family protein [Rhodopirellula 
europaea]
 gb|EMB15622.1| endonuclease/exonuclease/phosphatase family protein [Rhodopirellula 
europaea 6C]
Length=330

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 71/138 (51%), Gaps = 11/138 (8%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEERE--MKPLSDLAAGLGMKYAFAESW---APEYGNAIL  958
             +  V+R ++ D++A+Q+V     R   +K +  LAA  G+   FA+       EYG A+L
Sbjct  115   LANVIRSVDPDLVAVQEVDQNTHRNGMVKQVEILAARTGLHGKFAKQIDYDGGEYGQAVL  174

Query  957   SKWPIKSCKVQKIFDD--SDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQ---IN  793
             SK+PIKS +V  +  D   + R V  A I  P    + F  T L H   + R KQ   +N
Sbjct  175   SKYPIKSLEVHWLPGDPIRERRIVGVAEIQ-PHETPLRFATTHLHHARADLREKQATELN  233

Query  792   AIIQSSDTPHILAGGLNS  739
              ++ + + P I+AG  N+
Sbjct  234   RLLANGNAPVIVAGDFNA  251



>ref|WP_009282742.1| endonuclease [Fibrisoma limi]
 emb|CCH54162.1| Endonuclease/exonuclease/phosphatase [Fibrisoma limi BUZ 3]
Length=232

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 79/145 (54%), Gaps = 14/145 (10%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLS---DLAAGLGMKYAFAESW---APEYGNAI  961
             +  V+ +   D++ALQ+V    ER  K L+   +LA   GM++ FA++      +YG A+
Sbjct  22    IARVINKAKPDLVALQEVDVNTERSGKGLNQAKELARQTGMQFFFAKAIDHQGGDYGVAV  81

Query  960   LSKWP-IKSCKVQKIFDDS---DFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQIN  793
             LS++P I S ++    D +   + R +   T+++ +   I F  T LD L E  R+ Q +
Sbjct  82    LSRFPIIDSTRLILPIDPAIGGETRTIAAITVEIAKGKLIIFASTHLD-LKEQNRLTQAD  140

Query  792   AII---QSSDTPHILAGGLNSLDEA  727
              I+   ++S+ P +LAG  N+L ++
Sbjct  141   QIVNLFKTSNLPVVLAGDFNALPDS  165



>ref|WP_028645961.1| hypothetical protein [Nocardioides sp. JGI 0001009-J09]
Length=268

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 99/243 (41%), Gaps = 50/243 (21%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEER--EMKPLSDLAAGLGMKYAFAES---WAPEYGNAIL  958
             + EV++    DV+ALQ+V    +R  ++   ++ A    M   FA +      EYG  +L
Sbjct  52    IAEVIKATQPDVVALQEVDRNVKRTNQVDQPAEYAKLTAMNAGFARAIDLQGGEYGQVVL  111

Query  957   SKWPIKSCKVQKI--FDDSDFRNVMKATIDVPEVG--EINFFCTLLDHLDENWRMKQ---  799
             S++P+K+ K   +   +  + R   +  I+ P  G     F  T L H D   R++Q   
Sbjct  112   SRFPMKAVKTHVLPKKEGQETRIAFETRIE-PTNGLPPFTFVSTHLHHDDPKIRVEQALK  170

Query  798   INAIIQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYC  619
             IN I    D P ++AG  N+L E+D                        VM+ +      
Sbjct  171   INEIFAKHDGPALIAGDFNALPESD------------------------VMQTI------  200

Query  618   DAKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDH  439
                  G E +SV  +        + K   ++D+I+  P   ++ +     V+  K  SDH
Sbjct  201   -----GKEWKSVTPVGTKHLTSPSSKPRNQIDFILFRPADRFRVI--EVKVIDEKVASDH  253

Query  438   HIV  430
               V
Sbjct  254   RPV  256



>ref|WP_037497251.1| endonuclease [Sphingobacterium sp. ACCC 05744]
Length=268

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 74/137 (54%), Gaps = 9/137 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMK--PLSDLAAGLGMKYAFAES---WAPEYGNAIL  958
             +  V+R+ NA+++ALQ+V     R  K      LAA LGM+Y F++S      EYG AIL
Sbjct  57    IAAVIRQSNAELIALQEVDVNVPRSGKVNQAEQLAALLGMEYHFSKSIDYQGGEYGVAIL  116

Query  957   SKWPIKSCKVQKI--FDDSDFRNVMKATIDVPEVGEINFFCTLLD-HL-DENWRMKQINA  790
             SK+P+ + +   +      + R+V+ A++ +P    I F  T  D H+ +   + +++N 
Sbjct  117   SKYPLSNKRRMDLPMSIPGEKRSVVLASVVLPNGETIEFGSTHFDLHVPNRTVQAEELNI  176

Query  789   IIQSSDTPHILAGGLNS  739
             + QS+  P  + G  N+
Sbjct  177   LSQSTAKPLFIGGDYNA  193



>ref|WP_012237417.1| hypothetical protein [Sorangium cellulosum]
 ref|YP_001615428.1| hypothetical protein sce4785 [Sorangium cellulosum So ce56]
 emb|CAN94948.1| probable secreted protein [Sorangium cellulosum So ce56]
Length=286

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 70/263 (27%), Positives = 112/263 (43%), Gaps = 51/263 (19%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAES----WAPEYGNAIL  958
              + E LREL+ DV+ LQ+V + E R +     +A GLG + AF  +        +GNA+L
Sbjct  46    VIREGLRELDPDVVGLQEVLSYEGRSLA--DGIADGLGYEVAFGAAHDLGGGVLFGNAVL  103

Query  957   SKWPIKSCKVQKI--FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENW-------RM  805
             S+WPI   +   +   +  + R+++ A +  P  G I FF T L     NW       R 
Sbjct  104   SRWPIARSQAFPLPTGETDEKRSILLAELGSPH-GAIPFFVTHL-----NWKFHHGAVRE  157

Query  804   KQINAI--IQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYL--  637
              Q+ A+  I   + P     GL  +   D++ Q  A  +++             MK L  
Sbjct  158   AQVAAVADIVMREAP---MEGLPPIVVGDFNAQPEATEIRF-------------MKGLHA  201

Query  636   ---KSKQYCDAKDFGGECESVVM-IAKGQCVQGTCKYGTRVDYI-VSSPDSVYKFVPGSY  472
                KS  + D  D  G+         +      T +Y  R+DY+ V  PD+  +  P S 
Sbjct  202   LNQKSVYFADTFDQTGKGPGFTFDPVRNPFAAITNEYPRRIDYVFVRGPDAQGRGKPLSS  261

Query  471   SVL-----SSKGTSDHHIVKVDV  418
              V+     +    SDH+ V  ++
Sbjct  262   RVVFEEIRNGVAASDHYGVLSEI  284



>ref|WP_008240760.1| hypothetical protein [Imtechella halotolerans]
 gb|EID72741.1| hypothetical protein W5A_11449 [Imtechella halotolerans K1]
Length=289

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 73/146 (50%), Gaps = 14/146 (10%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMK-----YAFAES---WAPEYGN  967
             V  VL+   A ++ LQ++    ER  K L D+   L  +     Y F++S       YG 
Sbjct  77    VANVLKNSEAAIIGLQEIDVFTERSGKDL-DMTKELAERADYPYYYFSKSIDYQGGAYGT  135

Query  966   AILSKWPIKSCKVQKIFD--DSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQIN  793
             AILSK+P+   +   + +   S+ R +  AT+ + +  +I F  T LD+ + +  M+Q+ 
Sbjct  136   AILSKYPLSETETIALPNPAGSEPRTLSVATVTINDTLQIRFANTHLDYTNASNNMEQVK  195

Query  792   AI---IQSSDTPHILAGGLNSLDEAD  724
             A+   +  SD P IL G  N+  +AD
Sbjct  196   AMSSNLSQSDIPVILTGDFNAKPDAD  221



>ref|WP_038570355.1| endonuclease [Burkholderia cenocepacia]
 gb|AIO37946.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
cenocepacia]
Length=271

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 66/134 (49%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESW-APE--YGNAILSK  952
             +  V+ EL+ADV+ALQ+V     R    L+ L    GM  A   +   PE  YGNA+LS+
Sbjct  51    IAAVIDELDADVIALQEVPLGGTRAPDVLAHLRDATGMHAAAGPTIDTPERRYGNAVLSR  110

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
              PI++ +   + F   + R  + A ID    G +    T L  L  N R  Q+  ++ + 
Sbjct  111   CPIRAARTLDLSFHQREPRGALDADIDC-GAGMLRVVATHLG-LSANERSAQVQRLLAAF  168

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  169   DTGAMPVILMGDIN  182



>ref|WP_039053753.1| endonuclease [Sphingobacterium sp. T2]
Length=261

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 83/160 (52%), Gaps = 20/160 (13%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMK--PLSDLAAGLGMKYAFAESW---APEYGNAIL  958
             +  V+R+  A+++ALQ+V     R  K    ++LA  L M Y F++S      EYG AIL
Sbjct  51    IANVIRKSGAEIIALQEVDVNVPRSGKVNQAAELAKLLNMNYYFSKSIDYNGGEYGVAIL  110

Query  957   SKWPIKSCKVQKIFDDS--DFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQ---IN  793
             SK+ + + + + + + +  + R++  ATI +P    I F  T LD L+E  RM Q   IN
Sbjct  111   SKYTLSNARKELLPNPASGEQRSIAIATITLPGDVTIEFAATHLD-LNETNRMAQVEYIN  169

Query  792   AIIQSSDTPHILAGGLNSLDEADYSPQRWA-EIVKYYEEM  676
             ++ ++   P  + G        DY+ +  + E+ K+ EE 
Sbjct  170   SLSKTLSKPLFVGG--------DYNAESSSKELTKFKEEF  201



>ref|WP_013070541.1| hypothetical protein [Zunongwangia profunda]
 ref|YP_003583585.1| hypothetical protein ZPR_1044 [Zunongwangia profunda SM-A87]
 gb|ADF51389.1| probable secreted protein [Zunongwangia profunda SM-A87]
Length=282

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 72/147 (49%), Gaps = 16/147 (11%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESW---------APEY  973
             T+  +++   AD++ LQ+V    ER  K L ++A  L  K  F E W           EY
Sbjct  70    TIATIIKNSKADIVGLQEVDIYTERSGKKL-NMAKVLAEKAGF-EYWYFSKSINFQGGEY  127

Query  972   GNAILSKWPIKSCKVQKIFD--DSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQ  799
             G AILSK+P+      K+ +  +++ R +  A I +    EI    T LD+ D +  + Q
Sbjct  128   GTAILSKFPLSDTITTKLPNPKNAEPRTLSLANIHINPKLEIKIANTHLDYTDASNNLAQ  187

Query  798   INA---IIQSSDTPHILAGGLNSLDEA  727
             ++A   I+ S D P I+ G  N + E+
Sbjct  188   VSAIRKILSSEDKPVIITGDFNVVPES  214



>ref|WP_007762486.1| endonuclease [Bacteroides finegoldii]
 gb|EKJ90780.1| hypothetical protein HMPREF1057_02082 [Bacteroides finegoldii 
CL09T03C10]
Length=264

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 73/142 (51%), Gaps = 16/142 (11%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSD---LAAGLGMKYA-FAESW----APEYGN  967
             + EV+++ + D+++LQ++  E   E+ P      L+   GMKY  FA +       +YGN
Sbjct  51    IAEVIKQEDPDIVSLQEI--ERNTEINPWDTPERLSVLTGMKYYYFAHALDIPTGGDYGN  108

Query  966   AILSKWPIKSCKVQK--IFDDSDFRNVMKATIDVPEVGEINFFCTLLDH-LDENWRMKQI  796
              ILSK+PI   K  K  +  ++D+         + E  E  F  T LDH  ++  R+KQI
Sbjct  109   VILSKFPISEEKSFKLSVLKENDYVRSFGYVKVIKEGKEFYFATTHLDHKYEDATRLKQI  168

Query  795   NAII---QSSDTPHILAGGLNS  739
             + I+   +  D P IL G LNS
Sbjct  169   DEILACMEQLDKPIILGGDLNS  190



>ref|WP_011545534.1| endonuclease [Burkholderia cenocepacia]
 ref|YP_621207.1| endonuclease/exonuclease/phosphatase [Burkholderia cenocepacia 
AU 1054]
 ref|YP_840124.1| endonuclease/exonuclease/phosphatase [Burkholderia cenocepacia 
HI2424]
 gb|ABF76234.1| Endonuclease/exonuclease/phosphatase [Burkholderia cenocepacia 
AU 1054]
 gb|ABK13231.1| Endonuclease/exonuclease/phosphatase [Burkholderia cenocepacia 
HI2424]
 gb|KGY55533.1| endonuclease [Burkholderia cepacia]
Length=263

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 66/134 (49%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESW-APE--YGNAILSK  952
             +  V+ EL+ADV+ALQ+V     R    L+ L    GM  A   +   PE  YGNA+LS+
Sbjct  51    IAAVIDELDADVIALQEVPLGGTRAPDVLAHLRDATGMHAAAGPTIDTPERRYGNAVLSR  110

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
              PI++ +   + F   + R  + A ID    G I    T L  L  + R  Q+  ++ + 
Sbjct  111   CPIRAARTLDLSFHPREPRGALDADIDC-STGPIRVVATHLG-LSASERSAQVQRLLAAF  168

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  169   DTGAMPVILLGDIN  182



>ref|WP_024988328.1| endonuclease [Bacteroides acidifaciens]
Length=264

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 71/142 (50%), Gaps = 16/142 (11%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPL---SDLAAGLGMKYA-FAESW----APEYGN  967
             + EV+++ N D+++LQ++  E   E+ P      L+   GMKY  FA +       +YGN
Sbjct  51    IAEVIKKENPDIVSLQEI--ERNTEINPWDTPKKLSELTGMKYYYFAHALDIPTGGDYGN  108

Query  966   AILSKWPIKSCKVQK--IFDDSDFRNVMKATIDVPEVGEINFFCTLLDH-LDENWRMKQI  796
              ILSK+P+   K  K  +  + D+           E  E  F  T LDH  ++  R+KQI
Sbjct  109   VILSKYPVSEEKSFKLSVLKEGDYVRSFGYVKVAKEGKEFYFATTHLDHKYEDAARLKQI  168

Query  795   NAI---IQSSDTPHILAGGLNS  739
             + I   ++  D P IL G LNS
Sbjct  169   DEILACVEQLDKPVILGGDLNS  190



>ref|XP_009033009.1| hypothetical protein AURANDRAFT_70680 [Aureococcus anophagefferens]
 gb|EGB11893.1| hypothetical protein AURANDRAFT_70680 [Aureococcus anophagefferens]
Length=789

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 67/151 (44%), Gaps = 26/151 (17%)
 Frame = -1

Query  1038  LSDLAAGLGMKY-AFAES-------WAPEYGNAILSKWPIKSCKVQKIF-----------  916
             L  LAA LGM + AF E+        A  +GNA+LS+ P        +            
Sbjct  564   LHRLAAALGMPHVAFVEAERAKCFFGAAPFGNAVLSRRPFVDAGHLVLAAEPGDVRLGGQ  623

Query  915   --DDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQ--SSDTP--HILA  754
               DD + R V+ A ++V +   + F    LDH  E  R KQI   +   ++  P  H++ 
Sbjct  624   RRDDVESRGVVWAAVEVGDE-RVGFAAAHLDHKAEELREKQIGRCLDHVNAHCPALHLVC  682

Query  753   GGLNSLDEADYSPQRWAEIVKYYEEMGKPTP  661
             G LN+   AD+S   W  IV +Y   G P P
Sbjct  683   GDLNTFRRADHSDAAWDAIVAFYASRGWPRP  713



>ref|WP_008646780.1| endonuclease [Bacteroides sp. 3_1_23]
 gb|EFI39382.1| putative endonuclease/exonuclease/phosphatase family protein 
[Bacteroides sp. 3_1_23]
Length=264

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 71/142 (50%), Gaps = 16/142 (11%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPL---SDLAAGLGMKYA-FAESW----APEYGN  967
             + EV+++ N D+++LQ++  E   E+ P      L+   GMKY  FA +       +YGN
Sbjct  51    IAEVIKKENPDIVSLQEI--ERNTEINPWDTPKKLSELTGMKYYYFAHALDIPTGGDYGN  108

Query  966   AILSKWPIKSCKVQK--IFDDSDFRNVMKATIDVPEVGEINFFCTLLDH-LDENWRMKQI  796
              ILSK+P+   K  K  +  + D+           E  E  F  T LDH  ++  R+KQI
Sbjct  109   VILSKYPVSEEKSFKLSVLKEGDYVRSFGYVKVAKEGKEFYFATTHLDHKYEDAARLKQI  168

Query  795   NAI---IQSSDTPHILAGGLNS  739
             + I   ++  D P IL G LNS
Sbjct  169   DEILACVEQLDKPVILGGDLNS  190



>ref|WP_008358523.1| endonuclease/exonuclease/phosphatase family protein [Nocardioidaceae 
bacterium Broad-1]
 gb|EGD43476.1| endonuclease/exonuclease/phosphatase family protein [Nocardioidaceae 
bacterium Broad-1]
Length=332

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 100/245 (41%), Gaps = 57/245 (23%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEER--EMKPLSDLAAGLGMKYAF-AESWAPE---YGNAI  961
             +  V+R   ADV+ LQ+V     R   +   + +A+ LGM+  F A  +  +   YGNAI
Sbjct  125   IAGVIRGSGADVVLLQEVDRNRRRSGNVDQPAIIASHLGMQAVFGANDYITDRGGYGNAI  184

Query  960   LSKWPIKSCKVQKI--FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAI  787
             LS++PI       +   D  + R V++A I V E   +  F T LDH  ++ R  QI A+
Sbjct  185   LSRFPIAESGNTHLPNSDGKEQRGVLRANIIV-EGQRLVVFNTHLDHTSDSLRQAQIGAV  243

Query  786   ---IQSSDTPHILAGGLNSLDEADYSPQRWAEIVKYYEEMGKPTPKVEVMKYLKSKQYCD  616
                + + D   +L G LN+   +       A +      +G                   
Sbjct  244   MSRVNAYDGAKLLGGDLNAGSGSGVLGTALASLTDAGASLGA------------------  285

Query  615   AKDFGGECESVVMIAKGQCVQGTCKYGTRVDYIVSSPDSVYKFVPGSYSVLSSKGTSDHH  436
             + D GG                      RVDY++  P+S  +   G    ++  G SDHH
Sbjct  286   SHDGGG----------------------RVDYLL--PNSWLEAGAGR---VTPTGLSDHH  318

Query  435   IVKVD  421
              V +D
Sbjct  319   AVSID  323



>ref|WP_008665481.1| metallophosphoesterase [Rhodopirellula europaea]
 gb|EMI27691.1| metallophosphoesterase [Rhodopirellula europaea SH398]
Length=330

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 71/138 (51%), Gaps = 11/138 (8%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEERE--MKPLSDLAAGLGMKYAFAESW---APEYGNAIL  958
             +  V+R ++ D++A+Q+V     R   +  +  LAA  G+   FA+       EYG A+L
Sbjct  115   LANVIRSVDPDLVAVQEVDQNTHRNGMVNQVETLAARTGLHGIFAKQIDYDGGEYGQAVL  174

Query  957   SKWPIKSCKVQKIFDD--SDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQ---IN  793
             SK+PIKS +V  +  D   + R V  A I + E   + F  T L H   + R KQ   +N
Sbjct  175   SKYPIKSLEVHWLPGDPIRERRIVGVAEIQLHET-PLRFATTHLHHARSDLREKQATELN  233

Query  792   AIIQSSDTPHILAGGLNS  739
              ++ + + P I+AG  N+
Sbjct  234   RLLANGNAPVIVAGDFNT  251



>ref|WP_002623555.1| Endonuclease/Exonuclease/phosphatase family protein [Cystobacter 
fuscus]
 gb|EPX63417.1| Endonuclease/Exonuclease/phosphatase family protein [Cystobacter 
fuscus DSM 2262]
Length=254

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 67/126 (53%), Gaps = 14/126 (11%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSD----LAAGLGMKYAFA---ESWAPEYGNA  964
             V EVLRE++AD++ALQ+V   + R + P  D    LA  LG+  AF    E     YGNA
Sbjct  25    VEEVLREVDADLIALQEVG--DYRGVTPRDDHPEHLARQLGLHLAFGPNVERGGRRYGNA  82

Query  963   ILSKWPI-KSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWR-MKQINA  790
             ILS+ PI +S        D++ R  ++  +D+    +++ FC    HL    R  ++  +
Sbjct  83    ILSRLPILRSRNYDLSVGDNEPRGALRCDLDLGGGQQLHLFCL---HLGLGIRERRRQES  139

Query  789   IIQSSD  772
             ++ SSD
Sbjct  140   LLLSSD  145



>ref|WP_008023545.1| endonuclease [Bacteroides xylanisolvens]
 gb|EIY86098.1| hypothetical protein HMPREF1074_02507 [Bacteroides xylanisolvens 
CL03T12C04]
Length=264

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 72/142 (51%), Gaps = 16/142 (11%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPL---SDLAAGLGMKYA-FAESW----APEYGN  967
             + EV+++ + D+++LQ++  E   E+ P      L+   GMKY  FA +       +YGN
Sbjct  51    IAEVIKKESPDIVSLQEI--ERNTEINPWDTPKKLSELTGMKYYYFAHALDIPTGGDYGN  108

Query  966   AILSKWPIKSCKVQK--IFDDSDFRNVMKATIDVPEVGEINFFCTLLDH-LDENWRMKQI  796
              ILSK+P+   K  K  +  + D+         V E  E  F  T LDH  ++  R+KQI
Sbjct  109   VILSKYPVSEEKSFKLSVLKEGDYVRSFGYVKVVKEGKEFYFATTHLDHKYEDAARLKQI  168

Query  795   NAI---IQSSDTPHILAGGLNS  739
             + I   ++  D P IL G LNS
Sbjct  169   DEILACVEQLDKPVILGGDLNS  190



>gb|KIF80558.1| endonuclease [Herbaspirillum sp. TSA66]
Length=275

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 66/138 (48%), Gaps = 17/138 (12%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESWA-----PEYGNAIL  958
             V  VLRE+NADV+ALQ+V     R    L+ L    G  YA AE  A       YGNA+L
Sbjct  73    VGAVLREINADVIALQEVPLGGSRTPNVLAALQKATG--YAAAEGPACDTHERRYGNAVL  130

Query  957   SKWPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLD--ENWRMKQINAI  787
             S++PI S ++  + F   + R  + A +D       N    +  HL      R  QI  +
Sbjct  131   SRYPILSMRMIDLSFGSREPRGALDADLDC----HGNMLRVIATHLGLRPAERRDQIRRL  186

Query  786   IQSSDT---PHILAGGLN  742
             +Q  DT   P IL G +N
Sbjct  187   LQVFDTDEMPVILLGDIN  204



>ref|WP_008708175.1| endonuclease/exonuclease/phosphatase family protein [Rhodopirellula 
maiorica]
 gb|EMI15858.1| endonuclease/exonuclease/phosphatase family protein [Rhodopirellula 
maiorica SM1]
Length=244

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 75/149 (50%), Gaps = 19/149 (13%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEER--------EMKPLSDLAAGLGMKYAFAESWAPEYGN  967
             +  V+RE+  D++ALQ+V     R        E+  L+D+    G            YGN
Sbjct  30    IANVIREVKPDLVALQEVDQNVRRSQSVDQPAELARLTDMNVVFGANIPLQGG---HYGN  86

Query  966   AILSKWPI--KSCKVQKIFDDSDFRNVMKATIDVPEVGE-INFFCTLLDHL-DENWRMKQ  799
             A+LS++PI  ++  +     D + R  ++ TI++P V E +    T  DH  DE  R++ 
Sbjct  87    AVLSRFPIVKQTNHLLPNLADGEQRGYIEVTIEIPGVAEPLRLMATHFDHRPDERERLES  146

Query  798   INAI-IQSSDTPH---ILAGGLNSLDEAD  724
              +AI  ++ D P    +LAG +N++ +++
Sbjct  147   ADAINARAKDQPQQIVLLAGDMNAVPDSE  175



>ref|WP_006398961.1| endonuclease [Burkholderia multivorans]
 ref|YP_001585455.1| endonuclease/exonuclease/phosphatase [Burkholderia multivorans 
ATCC 17616]
 ref|YP_001941794.1| metal-dependent hydrolase [Burkholderia multivorans ATCC 17616]
 gb|ABX19163.1| Endonuclease/exonuclease/phosphatase [Burkholderia multivorans 
ATCC 17616]
 dbj|BAG47804.1| metal-dependent hydrolase [Burkholderia multivorans ATCC 17616]
 gb|EEE00443.1| endonuclease/exonuclease/phosphatase [Burkholderia multivorans 
CGD1]
 gb|AIO71709.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
multivorans]
Length=278

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFA---ESWAPEYGNAILSK  952
             +  V+ EL+ADV+ALQ+V     R    L+ L    GM  A     ++    YGNA+LS+
Sbjct  51    IAAVIDELDADVIALQEVPLGGTRAPDVLAPLRDATGMHVAAGPTIDTAERRYGNAVLSR  110

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ +   + F   + R  + A ID    G +    T L  L    R  Q+  ++ + 
Sbjct  111   YPIRAARTLDLSFHQREPRGALDADIDC-RTGPLRVVATHLG-LSARERSAQVQRLLAAF  168

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  169   DTGAMPVILLGDIN  182



>ref|WP_006415934.1| endonuclease/exonuclease/phosphatase family protein, partial 
[Burkholderia multivorans]
 gb|EJO54229.1| endonuclease/exonuclease/phosphatase family protein, partial 
[Burkholderia multivorans CF2]
Length=257

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFA---ESWAPEYGNAILSK  952
             +  V+ EL+ADV+ALQ+V     R    L+ L    GM  A     ++    YGNA+LS+
Sbjct  30    IAAVIEELDADVIALQEVPLGGTRAPDVLAHLRDATGMHAAAGPTIDTAERRYGNAVLSR  89

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ +   + F   + R  + A ID    G +    T L  L    R  Q+  ++ + 
Sbjct  90    YPIRAARTLDLSFHQREPRGALDADIDC-RSGPLRVVATHLG-LSARERSAQVQRLLAAF  147

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  148   DTGAMPVILLGDIN  161



>ref|WP_039224212.1| endonuclease [Burkholderia multivorans]
 gb|KHS09875.1| endonuclease [Burkholderia multivorans]
 gb|KHS15130.1| endonuclease [Burkholderia multivorans]
Length=278

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFA---ESWAPEYGNAILSK  952
             +  V+ EL+ADV+ALQ+V     R    L+ L    GM  A     ++    YGNA+LS+
Sbjct  51    IAAVIDELDADVIALQEVPLGGTRAPDVLAPLRDATGMHVAAGPTIDTAERRYGNAVLSR  110

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ +   + F   + R  + A ID    G +    T L  L    R  Q+  ++ + 
Sbjct  111   YPIRAARTLDLSFHQREPRGALDADIDC-RTGPLRVVATHLG-LSARERSAQVQRLLAAF  168

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  169   DTGAMPVILLGDIN  182



>ref|WP_003008399.1| endonuclease [Sphingobacterium spiritivorum]
 gb|EEI91589.1| endonuclease/exonuclease/phosphatase family protein [Sphingobacterium 
spiritivorum ATCC 33300]
Length=258

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 77/148 (52%), Gaps = 18/148 (12%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDV-----KAEEEREMKPLSDLAAGLGMKYAFAESWAP----EY  973
              + +V+R   ADV+ LQ++     ++E   + K L++LA   GMKY F          EY
Sbjct  49    AIAKVIRTSGADVVGLQEIDVNVGRSEHVDQAKKLAELA---GMKYYFFSKGIDLEKGEY  105

Query  972   GNAILSKWPIKSCKVQKIFD--DSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQ  799
             G  ILSK+PI + +  ++     S+ R++  A I +P   EI F  T LD  +EN R+ Q
Sbjct  106   GTLILSKFPITNTERLELPMPVKSEMRSLGIAKIKIPSGKEILFANTHLDLKEEN-RIAQ  164

Query  798   INAIIQS-SDTPH--ILAGGLNSLDEAD  724
                I+    DT H  +L G LN+  +++
Sbjct  165   AKFIVNHFQDTKHLVVLVGDLNAQPQSE  192



>ref|WP_006799945.1| endonuclease [Dysgonomonas gadei]
 gb|EGK01222.1| hypothetical protein HMPREF9455_02414 [Dysgonomonas gadei ATCC 
BAA-286]
Length=263

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 70/149 (47%), Gaps = 20/149 (13%)
 Frame = -1

Query  1116  EVLRELNADVLALQDVKAEEEREMKP-------LSDLAAGLGMKYAFAESW---APEYGN  967
             E +++ N D++ALQ+V     R   P       +S+LA   GM   +  +       YG 
Sbjct  50    EFIKKENPDIVALQEVDVNTLRTRAPHQNGKNFISELAFRTGMLSLYGRTIDYAGGYYGI  109

Query  966   AILSKWPIKSCKVQKIF-----DDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMK  802
              ILSK+PI   + Q+IF        + R ++   +++ E   I F CT LD+     R  
Sbjct  110   GILSKYPIS--QSQRIFLPMPEGAKERRALLTGVVELSEGKSITFACTHLDYTTSAVRRA  167

Query  801   QINAIIQS---SDTPHILAGGLNSLDEAD  724
             Q++ I Q     +TP IL G  N+  ++D
Sbjct  168   QVDFINQQLMKIETPVILCGDFNARPDSD  196



>ref|WP_006411227.1| endonuclease [Burkholderia multivorans]
 gb|EJO54955.1| endonuclease/exonuclease/phosphatase family protein [Burkholderia 
multivorans ATCC BAA-247]
Length=278

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFA---ESWAPEYGNAILSK  952
             +  V+ EL+ADV+ALQ+V     R    L+ L    GM  A     ++    YGNA+LS+
Sbjct  51    IAAVIDELDADVIALQEVPLGGTRGPDVLAHLRDATGMHAAAGPTIDTAERRYGNAVLSR  110

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ +   + F   + R  + A ID    G +    T L  L    R  Q+  ++ + 
Sbjct  111   YPIRAARTLDLSFHQREPRGALDADIDC-RTGPLRVVATHLG-LSARERSAQVQRLLAAF  168

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  169   DTGAMPVILLGDIN  182



>ref|WP_006405123.1| endonuclease [Burkholderia multivorans]
 gb|EEE07170.1| endonuclease/exonuclease/phosphatase [Burkholderia multivorans 
CGD2]
 gb|EEE13539.1| endonuclease/exonuclease/phosphatase [Burkholderia multivorans 
CGD2M]
Length=280

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFA---ESWAPEYGNAILSK  952
             +  V+ EL+ADV+ALQ+V     R    L+ L    GM  A     ++    YGNA+LS+
Sbjct  51    IAAVIDELDADVIALQEVPLGGTRGPDVLAHLRDATGMHAAAGPTIDTAERRYGNAVLSR  110

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ +   + F   + R  + A ID    G +    T L  L    R  Q+  ++ + 
Sbjct  111   YPIRAARTLDLSFHQREPRGALDADIDC-RTGPLRVVATHLG-LSARERSAQVQRLLAAF  168

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  169   DTGAMPVILLGDIN  182



>gb|EZP42436.1| putative secreted protein [Stenotrophomonas sp. RIT309]
Length=294

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 78/154 (51%), Gaps = 18/154 (12%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSD-LAAGLGMKYAFAES---WAPE-YGNAI  961
             T+V  L+ L  D +ALQ+V   ++R ++  +  LA+ LG +Y F  +    AP+ YGNA+
Sbjct  66    TIVAELKRLQPDAIALQEVI--QKRNVRNQAQWLASQLGYRYVFVSTDPVGAPKRYGNAL  123

Query  960   LSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLL----DHLDENWRMKQIN  793
             L++ PI +     +    D+R V    IDV E   +N + T L    D   +  R  Q+ 
Sbjct  124   LTRRPILAHGEHLLLPLDDYRTVAHLRIDV-EGRPVNVYATHLNERSDDAGQRIRRSQVE  182

Query  792   AIIQ-----SSDTPHILAGGLNSL-DEADYSPQR  709
              +++     S+  P ++AG  N+L D  D S  R
Sbjct  183   DLLRFIAGSSAGAPVVIAGDFNALVDAGDLSELR  216



>ref|WP_020867148.1| endonuclease [Streptomyces rapamycinicus]
 ref|YP_008788612.1| endonuclease [Streptomyces rapamycinicus NRRL 5491]
 gb|AGP53746.1| endonuclease [Streptomyces rapamycinicus NRRL 5491]
Length=284

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 71/145 (49%), Gaps = 18/145 (12%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEERE--MKPLSDLAAGLGMKYAFA--------ESWAP--  979
             V  V++ +  DV+ LQ+V    +R   +   + L   LGM++AF         E   P  
Sbjct  62    VARVIQAMRVDVVGLQEVDRFWKRSGFVDQPAWLGERLGMRHAFGANLDLDPEEPGRPRS  121

Query  978   EYGNAILSKWPIKSCKVQK--IFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRM  805
             +YG A+LS+WPI+S       +    + R +++AT+DV   G + F  T L H D   R 
Sbjct  122   QYGTAVLSRWPIRSWTNTHLPLVPGHEQRGLLRATLDV-RGGRVEFAVTHLQHDDNQERE  180

Query  804   KQINAIIQ---SSDTPHILAGGLNS  739
             +Q   I++   S+    +L G LN+
Sbjct  181   RQSARIVELLGSAPERTVLVGDLNA  205



>ref|WP_035956362.1| endonuclease [Burkholderia multivorans]
 gb|KGC07654.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
multivorans]
Length=278

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFA---ESWAPEYGNAILSK  952
             +  V+ EL+ADV+ALQ+V     R    L+ L    GM  A     ++    YGNA+LS+
Sbjct  51    IAAVIEELDADVIALQEVPLGGTRAPDVLAHLRDATGMHAAAGPTIDTAERRYGNAVLSR  110

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ +   + F   + R  + A ID    G +    T L  L    R  Q+  ++ + 
Sbjct  111   YPIRAARTLDLSFHQREPRGALDADIDC-RSGPLRVVATHLG-LSARERSAQVQRLLAAF  168

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  169   DTGAMPVILLGDIN  182



>ref|WP_032978896.1| endonuclease [Stenotrophomonas sp. RIT309]
Length=288

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 78/154 (51%), Gaps = 18/154 (12%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSD-LAAGLGMKYAFAES---WAPE-YGNAI  961
             T+V  L+ L  D +ALQ+V   ++R ++  +  LA+ LG +Y F  +    AP+ YGNA+
Sbjct  60    TIVAELKRLQPDAIALQEVI--QKRNVRNQAQWLASQLGYRYVFVSTDPVGAPKRYGNAL  117

Query  960   LSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLL----DHLDENWRMKQIN  793
             L++ PI +     +    D+R V    IDV E   +N + T L    D   +  R  Q+ 
Sbjct  118   LTRRPILAHGEHLLLPLDDYRTVAHLRIDV-EGRPVNVYATHLNERSDDAGQRIRRSQVE  176

Query  792   AIIQ-----SSDTPHILAGGLNSL-DEADYSPQR  709
              +++     S+  P ++AG  N+L D  D S  R
Sbjct  177   DLLRFIAGSSAGAPVVIAGDFNALVDAGDLSELR  210



>ref|WP_026327172.1| hypothetical protein [Proteiniphilum acetatigenes]
Length=273

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 77/148 (52%), Gaps = 17/148 (11%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLG----MKYAFAESW---APEYGNA  964
             +  V++  + D+++LQ+V     R  K L D+A  LG    M+  F ++      EYG+A
Sbjct  58    IANVIKRHDPDLVSLQEVDKNTRRNAK-LGDIAKKLGELTGMERYFVKAMDHDGGEYGDA  116

Query  963   ILSKWPIKSCKVQKIFDDSDF----RNVMKATIDVPEVGEINFFCTLLDHL-DENWRMKQ  799
             +LSK PIK  K   +    +     R+V + T++  E  E  F  T  DHL +E  R+KQ
Sbjct  117   VLSKLPIKERKGYNLGVTPELGGEPRSVARVTVE-KENKEFYFIATHFDHLGNEANRLKQ  175

Query  798   ---INAIIQSSDTPHILAGGLNSLDEAD  724
                +  I++S D   I+AG LN+  E++
Sbjct  176   ARDLVDILKSYDKRVIVAGDLNATPESE  203



>ref|WP_037532874.1| endonuclease [Sphingobacterium thalpophilum]
Length=273

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 86/176 (49%), Gaps = 27/176 (15%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPL---SDLAAGLGMKYAFAESWAP----EYGNA  964
             +  V+R++N DV++LQ+V  E   ++ P+    ++AA  GMKY F          +YGN 
Sbjct  61    IAAVIRKVNPDVVSLQEV--ERNTDVNPMDFPKEIAALTGMKYYFFAHALTLKKGDYGNV  118

Query  963   ILSKWPI---KSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHL----DENWRM  805
             ILSK+P+   KS  +    D  D R+   A ++  + G+  +F T   HL    D+  R+
Sbjct  119   ILSKYPLLQTKSIHLGVANDGDDTRSFGYALLE--KDGKQFYFAT--THLGYKKDDATRL  174

Query  804   KQINAI---IQSSDTPHILAGGLNSLDEADYSP--QRWAEIVKYYE--EMGKPTPK  658
             KQI  I   I++   P IL   LNS   +   P  Q+W  +       E   PTPK
Sbjct  175   KQIAEILKEIKNLKQPIILGADLNSRPNSQTMPALQKWFTLPCQISNCEWTVPTPK  230



>ref|WP_032951913.1| endonuclease [Stenotrophomonas maltophilia]
Length=288

 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 78/154 (51%), Gaps = 18/154 (12%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEEREMKPLSD-LAAGLGMKYAFAES---WAPE-YGNAI  961
             T+V  L+ L  D +ALQ+V   ++R ++  +  LA+ LG +Y F  +    AP+ YGNA+
Sbjct  60    TIVAELKRLQPDAIALQEVI--QKRNVRNQAQWLASQLGYRYVFVSTDPVGAPKRYGNAL  117

Query  960   LSKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLL----DHLDENWRMKQIN  793
             L++ PI +     +    D+R V    IDV E   +N + T L    D   +  R  Q+ 
Sbjct  118   LTRRPILAHGEHLLLPLDDYRTVAHLRIDV-EGRPVNVYATHLNERSDDAGQRIRRSQVE  176

Query  792   AIIQ-----SSDTPHILAGGLNSL-DEADYSPQR  709
              +++     S+  P ++AG  N+L D  D S  R
Sbjct  177   DLLRFIAGSSAGAPVVIAGDFNALVDAGDLSELR  210



>emb|CDR05246.1| Endonuclease/exonuclease/phosphatase [Streptomyces iranensis]
Length=323

 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 70/145 (48%), Gaps = 18/145 (12%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEERE--MKPLSDLAAGLGMKYAFA--------ESWAP--  979
             V  V++ +  DV+ LQ+V    +R   +   + L   LGM++AF         E   P  
Sbjct  101   VARVIQAMRVDVVGLQEVDRFWKRSGFVDQPARLGERLGMRHAFGANLDLDPEEPGRPRR  160

Query  978   EYGNAILSKWPIKSCKVQK--IFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRM  805
             +YG A+LS WPI+S       +    + R +++AT+DV   G + F  T L H D   R 
Sbjct  161   QYGTAVLSNWPIRSWTNTHLPLVPGHEQRGLLRATLDV-RGGCVEFAVTHLQHDDNQERE  219

Query  804   KQINAIIQ---SSDTPHILAGGLNS  739
             +Q   I++   SS    IL G LN+
Sbjct  220   RQSARIVELLGSSPERTILVGDLNA  244



>ref|WP_034235365.1| endonuclease [Arenibacter certesii]
Length=260

 Score = 54.3 bits (129),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 80/163 (49%), Gaps = 23/163 (14%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKP-------LSDLAAGLGMKYAFAESWA---PEY  973
             + E ++ ++ D++ALQ+V     RE  P       +++L    GM  AF ++       Y
Sbjct  45    LAEFIKSVDPDIVALQEVDVRTYRERAPKQNGKDFITELGYRTGMLSAFGKTIPYMDGYY  104

Query  972   GNAILSKWPIKSCKVQKIF-----DDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWR  808
             G  ILSK+P+ S  +++I+        + R V+ A ++  +   I F  T LD+ +   R
Sbjct  105   GIGILSKYPLSS--IERIYLPKSAHGKEQRAVLVADVEYRDGAYITFASTHLDYTNTQER  162

Query  807   MKQINAI---IQSSDTPHILAGGLNSLDEAD---YSPQRWAEI  697
               Q+ A+   + +   P +LAG  N++ EA+      +RW ++
Sbjct  163   QLQVQALNKELLNRSYPVLLAGDFNAIPEAEEIMNGMKRWKDL  205



>ref|WP_008411183.1| Endonuclease/exonuclease/phosphatase [Desulfotomaculum hydrothermale]
 emb|CCO08013.1| Endonuclease/exonuclease/phosphatase [Desulfotomaculum hydrothermale 
Lam5 = DSM 18033]
Length=242

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 66/135 (49%), Gaps = 10/135 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREM--KPLSDLAAGLGMKYAFAE--SW-APEYGNAIL  958
             V +VL    A ++ LQ+V     R         L   L   + FA   +W A +YGNA+L
Sbjct  26    VAQVLGAGKAQLIGLQEVDKHMPRSFFQHQAKILGRWLRKSWVFAPNLTWGAAQYGNAVL  85

Query  957   SKWPIKSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQ---INAI  787
               WPI S +   +    + R +++  I +P  G ++FFCT L  L++  R++Q   I  I
Sbjct  86    CGWPIVSYRQYLLPSQGEQRGLLETEIALP-AGTVSFFCTHLG-LNQQERLQQAEEILRI  143

Query  786   IQSSDTPHILAGGLN  742
             +  ++ P IL G  N
Sbjct  144   VTRTNRPVILVGDFN  158



>ref|WP_014398116.1| endonuclease/exonuclease/phosphatase [Corallococcus coralloides]
 ref|YP_005371279.1| endonuclease/exonuclease/phosphatase [Corallococcus coralloides 
DSM 2259]
 gb|AFE10751.1| endonuclease/exonuclease/phosphatase [Corallococcus coralloides 
DSM 2259]
Length=254

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 72/143 (50%), Gaps = 18/143 (13%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDV---KAEEEREMKPLSDLAAGLGMKYAFAESW---APEYGNAI  961
             V  VLRE+NAD++ALQ+V   + +  RE +P   LA  LGM  AF  +       YGNAI
Sbjct  25    VGSVLREVNADIIALQEVGDFRGKTPREDQP-EHLAEMLGMHMAFGPNVVRNGRRYGNAI  83

Query  960   LSKWPI-KSCKVQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAII  784
             LS+ P+ KS          + R  ++  +D+    +++ FC  L  L  + R +Q  A++
Sbjct  84    LSRLPVLKSKNYDLSVPRREPRGALRCDLDLGGGQQLHVFCLHLG-LSVSERRRQ-EALL  141

Query  783   QSSDT--------PHILAGGLNS  739
              S+D         P ++ G  NS
Sbjct  142   LSADLLRDAARKDPMVVCGDFNS  164



>ref|WP_012336638.1| endonuclease [Burkholderia cenocepacia]
 ref|YP_001773706.1| endonuclease/exonuclease/phosphatase [Burkholderia cenocepacia 
MC0-3]
 gb|ACA95211.1| Endonuclease/exonuclease/phosphatase [Burkholderia cenocepacia 
MC0-3]
Length=258

 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESW-APE--YGNAILSK  952
             +  V+ EL+ADV+ALQ+V     R    L+ L    GM      +   PE  YGNA+LS+
Sbjct  46    IAAVIDELDADVIALQEVPLGGTRAPDVLAHLRDATGMHAVAGPTIDTPERRYGNAVLSR  105

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
              PI++ +   + F   + R  + A ID    G I    T L  L  + R  Q+  ++ + 
Sbjct  106   CPIRAARTLDLSFHPREPRGALDADIDC-STGPIRVVATHLG-LSASERSAQVQRLLAAF  163

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  164   DTGAMPVILLGDIN  177



>ref|WP_002997343.1| endonuclease [Sphingobacterium spiritivorum]
 gb|EFK59484.1| endonuclease/exonuclease/phosphatase family protein [Sphingobacterium 
spiritivorum ATCC 33861]
Length=258

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 77/147 (52%), Gaps = 18/147 (12%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDV-----KAEEEREMKPLSDLAAGLGMKYAFAESWAP----EYG  970
             + +V+R   ADV+ LQ++     ++E   + K L++LA   GM+Y F          EYG
Sbjct  50    IAKVIRTSGADVVGLQEIDVNVGRSENVDQAKKLAELA---GMEYYFFSKGIDLEKGEYG  106

Query  969   NAILSKWPIKSCKVQKIFD--DSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQI  796
               ILSK+PI + +  ++     S+ R++  A I +P   EI F  T LD  +EN R+ Q 
Sbjct  107   TVILSKFPITNTERLELPMPVKSEMRSLGIAKIKIPSGKEILFANTHLDLKEEN-RIAQT  165

Query  795   NAIIQS-SDTPH--ILAGGLNSLDEAD  724
               I+    DT H  +L G LN+  +++
Sbjct  166   KFIVNHFQDTKHLVVLVGDLNAQPQSE  192



>ref|WP_027813159.1| endonuclease [Burkholderia cenocepacia]
Length=263

 Score = 54.3 bits (129),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESW-APE--YGNAILSK  952
             +  V+ EL+ADV+ALQ+V     R    L+ L    GM      +   PE  YGNA+LS+
Sbjct  51    IAAVIDELDADVIALQEVPLGGTRAPDVLAHLRDATGMHAVAGPTIDTPERRYGNAVLSR  110

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
              PI++ +   + F   + R  + A ID    G I    T L  L  + R  Q+  ++ + 
Sbjct  111   CPIRAARTLDLSFHPREPRGALDADIDC-STGPIRVVATHLG-LSASERSAQVQRLLAAF  168

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  169   DTGAMPVILLGDIN  182



>ref|WP_027785983.1| endonuclease [Burkholderia cepacia]
Length=266

 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESW-APE--YGNAILSK  952
             +  V+ EL+ADV+ALQ+V     R    L+ L    GM  A   +   PE  YGNA+LS+
Sbjct  51    IAAVIDELDADVIALQEVPLGGTRAPDVLAHLRDATGMHAAAGPTIDTPERRYGNAVLSR  110

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
              PI++ +   + F   + R  + A ID    G I    T L  L    R  Q+  ++ + 
Sbjct  111   CPIRAARTLDLSFHPREPRGALDADIDC-GAGTIRVVATHLG-LSAGERSAQVQRLLAAF  168

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  169   DTGAMPVILLGDIN  182



>ref|WP_024689266.1| hypothetical protein [Pseudomonas syringae]
Length=261

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 71/143 (50%), Gaps = 19/143 (13%)
 Frame = -1

Query  1116  EVLRELNADVLALQDVKAEEEREMKPLSD---------LAAGLGMKYAFAESWA---PEY  973
             E +R ++ADV+ LQ+V  E     + + D         LA  +   +A+  +      ++
Sbjct  45    EAVRSVSADVVFLQEVHGEHHSHARTVKDWPTISQYEFLADSMWSDFAYGRNAVYPDGDH  104

Query  972   GNAILSKWPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQI  796
             GNA+LSK+PI S +   I  D ++ R ++   IDVP  G ++  C  L  L E+ R KQ+
Sbjct  105   GNALLSKYPIVSHENLDISIDGTEQRGLLHCVIDVPNRGHVHAVCVHLG-LWESHRRKQL  163

Query  795   NAIIQ-----SSDTPHILAGGLN  742
               + +      ++ P I+AG  N
Sbjct  164   TLLAELMHRLPAEAPVIVAGDFN  186



>ref|WP_027806790.1| endonuclease [Burkholderia cenocepacia]
Length=263

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESW-APE--YGNAILSK  952
             +  V+ EL+ADV+ALQ+V     R    L+ L    GM      +   PE  YGNA+LS+
Sbjct  51    IAAVIDELDADVIALQEVPLGGTRAPDVLAHLRDATGMHAVAGPTIDTPERRYGNAVLSR  110

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
              PI++ +   + F   + R  + A ID    G I    T L  L  + R  Q+  ++ + 
Sbjct  111   CPIRAARTLDLSFHPREPRGALDADIDC-STGPIRVVATHLG-LSASERSAQVQRLLAAF  168

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  169   DTGAMPVILLGDIN  182



>ref|WP_023478140.1| Endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
cenocepacia]
 gb|ESS36561.1| Endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
cenocepacia KC-01]
Length=263

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 65/134 (49%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYAFAESW-APE--YGNAILSK  952
             +  V+ EL+ADV+ALQ+V     R    L+ L    GM      +   PE  YGNA+LS+
Sbjct  51    IAAVIDELDADVIALQEVPLGGTRAPDVLAHLRDATGMHAVAGPTIDTPERRYGNAVLSR  110

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
              PI++ +   + F   + R  + A ID    G I    T L  L  + R  Q+  ++ + 
Sbjct  111   CPIRAARTLDLSFHPREPRGALDADIDC-STGPIRVVATHLG-LSASERSAQVQRLLAAF  168

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  169   DTGAMPVILLGDIN  182



>ref|WP_024695599.1| hypothetical protein [Pseudomonas syringae]
Length=261

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 71/143 (50%), Gaps = 19/143 (13%)
 Frame = -1

Query  1116  EVLRELNADVLALQDVKAEEEREMKPLSD---------LAAGLGMKYAFAESWA---PEY  973
             E +R ++ADV+ LQ+V  E     + + D         LA  +   +A+  +      ++
Sbjct  45    EAVRSVSADVVFLQEVHGEHHSHARTVKDWPTISQYEFLADSMWSDFAYGRNAVYPDGDH  104

Query  972   GNAILSKWPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQI  796
             GNA+LSK+PI S +   I  D ++ R ++   IDVP  G ++  C  L  L E+ R KQ+
Sbjct  105   GNALLSKYPIVSHENLDISIDGTEQRGLLHCIIDVPNRGHVHAVCVHLG-LWESHRRKQL  163

Query  795   NAIIQ-----SSDTPHILAGGLN  742
               + +      ++ P I+AG  N
Sbjct  164   TLLAELMHRLPAEAPVIVAGDFN  186



>ref|WP_009951183.1| Metal-dependent hydrolase, partial [Burkholderia pseudomallei]
Length=290

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  27    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  86

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  87    FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  144

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  145   DTRALPVILLGDIN  158



>ref|WP_037964542.1| metal-dependent hydrolase [Streptomyces sp. PRh5]
 gb|EXU62255.1| metal-dependent hydrolase [Streptomyces sp. PRh5]
Length=284

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 72/148 (49%), Gaps = 18/148 (12%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEERE--MKPLSDLAAGLGMKYAFA--------ESWAP--  979
             V  V++ +  DV+ LQ+V    +R   +   + L   LGM++AF         E   P  
Sbjct  63    VARVVQAMRVDVVGLQEVDRFWKRSGFVDQPAWLGERLGMRHAFGANLDLDPEEPGRPRR  122

Query  978   EYGNAILSKWPIKSCKVQ--KIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRM  805
             +YG A+LS+WPI+S       +    + R +++AT+DV     ++F  T L H D   R 
Sbjct  123   QYGTAVLSRWPIRSWTNTPLPLVPGHEQRGLLRATLDV-RGACVDFAVTHLQHNDSQERE  181

Query  804   KQINAIIQ---SSDTPHILAGGLNSLDE  730
             +Q   I++   SS    IL G LN+  E
Sbjct  182   RQSARIVELLGSSPERTILVGDLNATSE  209



>ref|WP_038719992.1| endonuclease, partial [Burkholderia pseudomallei]
Length=244

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  30    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  89

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  90    FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  147

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  148   DTRALPVILLGDIN  161



>ref|WP_023358501.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei]
 ref|YP_008740445.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei NCTC 13179]
 gb|AGZ31317.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei NCTC 13179]
Length=334

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  71    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  130

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  131   FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  188

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  189   DTRALPVILLGDIN  202



>ref|WP_012923641.1| endonuclease [Kribbella flavida]
 ref|YP_003383886.1| endonuclease/exonuclease/phosphatase [Kribbella flavida DSM 17836]
 gb|ADB35087.1| Endonuclease/exonuclease/phosphatase [Kribbella flavida DSM 17836]
Length=269

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 72/150 (48%), Gaps = 19/150 (13%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVK---AEEEREMKPLSDLAAGLGMKYAFA-----ESWAP----  979
             +  V+ +  A V+ LQ+V    +E        + LA  LGM+Y FA     +   P    
Sbjct  54    IATVIAQSGAAVVGLQEVDVHWSERSNWQNQAAWLATRLGMEYRFAANLDLDPLVPGEPR  113

Query  978   -EYGNAILSKWPIKSCK--VQKIFDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWR  808
              +YG AILS++PI S    +  +   S+ R +  ATIDV    ++ F  T L  L    R
Sbjct  114   RQYGTAILSRYPITSFSNTLLPLHAGSEQRGLAVATIDVAG-RDVRFATTHLSKLTSAER  172

Query  807   MKQINAIIQ---SSDTPHILAGGLNSLDEA  727
             ++Q   I+Q    S TP +L G LN++  A
Sbjct  173   VEQSQRIVQLLAGSTTPTLLTGDLNAVPTA  202



>ref|WP_011205603.1| endonuclease [Burkholderia pseudomallei]
 ref|YP_111393.1| hypothetical protein BPSS1382 [Burkholderia pseudomallei K96243]
 emb|CAH38854.1| putative Endonuclease/Exonuclease/phosphatase family protein 
[Burkholderia pseudomallei K96243]
Length=338

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  75    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  134

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  135   FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  192

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  193   DTRALPVILLGDIN  206



>gb|AIV80231.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR3965]
Length=313

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  50    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  109

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  110   FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  167

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  168   DTRALPVILLGDIN  181



>gb|KGC26868.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei]
 gb|AIV45031.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei TSV 48]
 gb|KGW13799.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei TSV 25]
Length=334

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  71    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  130

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  131   FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  188

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  189   DTRALPVILLGDIN  202



>gb|EQA86756.1| endonuclease [Burkholderia pseudomallei MSHR338]
Length=338

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  75    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  134

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  135   FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  192

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  193   DTRALPVILLGDIN  206



>gb|KGS25253.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR5569]
 gb|KGS38329.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei ABCPW 107]
 gb|KGV64838.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei BDU 2]
 gb|KGX16942.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
sp. MSHR4009]
 gb|KGX24494.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
sp. MSHR4018]
Length=334

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  71    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  130

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  131   FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  188

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  189   DTRALPVILLGDIN  202



>ref|WP_020889612.1| putative secreted protein [Cyclobacterium qasimii]
 gb|EPR66387.1| putative secreted protein [Cyclobacterium qasimii M12-11B]
Length=290

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 70/138 (51%), Gaps = 11/138 (8%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPL---SDLAAGLGMKYAFAESW---APEYGNAI  961
             + +V+ +  ADV+ LQ++    ER  K L    +LA   GM++ F++        +G AI
Sbjct  79    IAKVIIDSKADVVGLQEIDVNNERSGKHLDQAKELARLTGMEFYFSKGIDYKGGAFGTAI  138

Query  960   LSKWPIKSCKVQKIFDD--SDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAI  787
             LSK+PI   +   + ++  ++ R +   T++ PE  +I F  T LD+  ++  + Q  AI
Sbjct  139   LSKYPISQMETLYLPEETGTERRTLSIITVEFPEGKKIRFGNTHLDYTSDDNALAQAKAI  198

Query  786   ---IQSSDTPHILAGGLN  742
                 ++   P +L G  N
Sbjct  199   TSYFENEALPVVLVGDFN  216



>gb|AHE29200.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei NCTC 13178]
Length=334

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  71    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  130

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  131   FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  188

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  189   DTRALPVILLGDIN  202



>gb|AHE35625.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei NAU20B-16]
 gb|AHG36342.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR511]
 gb|AHG70031.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR146]
 gb|KGC46335.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei]
 gb|KGS46067.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR5613]
 gb|KGV28883.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR4462]
 gb|KGV53129.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei ABCPW 91]
 gb|KGV77068.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR4375]
 gb|KGV78001.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR4299]
 gb|KGW35145.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR3016]
 gb|KGX03529.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR640]
 gb|KGX61015.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei TSV44]
Length=334

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  71    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  130

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  131   FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  188

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  189   DTRALPVILLGDIN  202



>ref|WP_037501251.1| hypothetical protein [Sphingobacterium sp. ACCC 05744]
Length=274

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 70/142 (49%), Gaps = 13/142 (9%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEER--EMKPLSDLAAGLGMKYAFAESW---APEYGNAI  961
              +V+V+R  +ADV+ALQ+V    +R  +M     +A  LGM Y FA++       YG  +
Sbjct  58    AIVQVIRAADADVVALQEVDQLTKRSGKMDQPKLIAEKLGMHYFFAKAMDYDGGAYGQLL  117

Query  960   LSKWPIKSCKVQKIFDDSDF----RNVMKATIDVPEVGEINFFCTLLD-HLDENWRMKQI  796
             LSK+PI S  + K+   + F    R + +  + + +   I F    LD   D+  R+ Q 
Sbjct  118   LSKYPIASTAIHKLPSVAGFKGEPRIMGEIQVQLDQNTVIRFATVHLDAQKDKENRLLQA  177

Query  795   NAIIQS---SDTPHILAGGLNS  739
               I+ S      P I+AG  N+
Sbjct  178   KYIVNSVGKKKIPAIVAGDFNA  199



>gb|KGC85853.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei Pasteur 52237]
Length=334

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  71    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  130

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  131   FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  188

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  189   DTRALPVILLGDIN  202



>gb|EIF72932.1| endonuclease/exonuclease/phosphatase family protein [Burkholderia 
pseudomallei 354e]
 gb|EIF76429.1| endonuclease/exonuclease/phosphatase family protein [Burkholderia 
pseudomallei 354a]
Length=334

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  71    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  130

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  131   FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  188

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  189   DTRALPVILLGDIN  202



>ref|WP_020850201.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei]
 ref|YP_008328468.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR305]
 gb|AGR69125.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR305]
 gb|AHK68622.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR520]
 gb|AIO84065.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei]
 gb|AIP01449.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei]
 gb|AIP20029.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR5855]
 gb|AIP43111.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR5848]
 gb|AIP83882.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei]
 gb|KGD06602.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei]
 gb|KGD32999.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei]
 gb|AIS91821.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei NAU35A-3]
 gb|KGS01784.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR5608]
 gb|KGS70151.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR4868]
 gb|KGS75716.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR5596]
 gb|KGS96173.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR7498]
 gb|KGU59825.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR983]
 gb|KGU78622.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR4304]
 gb|KGV39929.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR4308]
 gb|KGW03389.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR4000]
 gb|KGW24395.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR733]
 gb|KGW46749.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR684]
 gb|KGW57195.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR303]
 gb|KGW62606.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR1357]
 gb|KGW81186.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR332]
 gb|KGX15141.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
sp. ABCPW 1]
 gb|KGX23865.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
sp. MSHR44]
 gb|KGX45891.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei MSHR2138]
Length=334

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  71    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  130

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  131   FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  188

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  189   DTRALPVILLGDIN  202



>ref|WP_011853358.1| endonuclease [Burkholderia pseudomallei]
 ref|YP_001062967.1| metal-dependent hydrolase [Burkholderia pseudomallei 668]
 gb|ABN87010.1| metal-dependent hydrolase [Burkholderia pseudomallei 668]
 gb|KGD12634.1| endonuclease/Exonuclease/phosphatase family protein [Burkholderia 
pseudomallei]
Length=338

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  75    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  134

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  135   FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  192

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  193   DTRALPVILLGDIN  206



>gb|KGE13174.1| endonuclease/exonuclease/phosphatase [Sphingobacterium sp. ACCC 
05744]
Length=272

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 70/142 (49%), Gaps = 13/142 (9%)
 Frame = -1

Query  1125  TVVEVLRELNADVLALQDVKAEEER--EMKPLSDLAAGLGMKYAFAESW---APEYGNAI  961
              +V+V+R  +ADV+ALQ+V    +R  +M     +A  LGM Y FA++       YG  +
Sbjct  56    AIVQVIRAADADVVALQEVDQLTKRSGKMDQPKLIAEKLGMHYFFAKAMDYDGGAYGQLL  115

Query  960   LSKWPIKSCKVQKIFDDSDF----RNVMKATIDVPEVGEINFFCTLLD-HLDENWRMKQI  796
             LSK+PI S  + K+   + F    R + +  + + +   I F    LD   D+  R+ Q 
Sbjct  116   LSKYPIASTAIHKLPSVAGFKGEPRIMGEIQVQLDQNTVIRFATVHLDAQKDKENRLLQA  175

Query  795   NAIIQS---SDTPHILAGGLNS  739
               I+ S      P I+AG  N+
Sbjct  176   KYIVNSVGKKKIPAIVAGDFNA  197



>emb|CDA82606.1| uncharacterized protein BN772_01106 [Bacteroides sp. CAG:754]
Length=264

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 71/142 (50%), Gaps = 16/142 (11%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPL---SDLAAGLGMKYA-FAESW----APEYGN  967
             + EV+++ N D+++LQ++  E   E+ P      L+   GMKY  FA +       +YGN
Sbjct  51    IAEVIKKENPDIVSLQEI--ERNTEINPWDTPKKLSELTGMKYYYFAHALDIPTGGDYGN  108

Query  966   AILSKWPIKSCKVQK--IFDDSDFRNVMKATIDVPEVGEINFFCTLLDH-LDENWRMKQI  796
              ILSK+P+   K  K  +  + D+           E  E  F  T LDH  ++  R+KQ+
Sbjct  109   VILSKYPVSEEKSFKLSVLKEGDYVRSFGYVKVSKEGKEFYFATTHLDHKYEDAARLKQV  168

Query  795   NAI---IQSSDTPHILAGGLNS  739
             + I   ++  D P IL G LNS
Sbjct  169   DEILACVELLDKPVILGGDLNS  190



>ref|WP_038725980.1| MULTISPECIES: endonuclease, partial [pseudomallei group]
Length=244

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  30    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  89

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  90    FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  147

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  148   DTRALPVILLGDIN  161



>ref|WP_004524317.1| endonuclease [Burkholderia pseudomallei]
 gb|EBA46304.1| endonuclease/exonuclease/phosphatase family protein [Burkholderia 
pseudomallei 305]
 gb|EDU11353.1| endonuclease/exonuclease/phosphatase family protein [Burkholderia 
pseudomallei 1655]
 gb|EEH24900.1| endonuclease/exonuclease/phosphatase family protein [Burkholderia 
pseudomallei Pakistan 9]
 gb|EMP73236.1| putative endonuclease/exonuclease/phosphatase family protein 
[Burkholderia pseudomallei MSHR1043]
 gb|KEO65765.1| endonuclease [Burkholderia pseudomallei MSHR5855]
Length=338

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 68/134 (51%), Gaps = 9/134 (7%)
 Frame = -1

Query  1122  VVEVLRELNADVLALQDVKAEEEREMKPLSDLAAGLGMKYA---FAESWAPEYGNAILSK  952
             +  VL EL ADV+ALQ+V     R    L+ L A  GM  A     ++ A  YGNA+LS+
Sbjct  75    IAVVLDELRADVIALQEVPLGGARGADVLAHLRACTGMHAAEGPTIDTPARRYGNAVLSR  134

Query  951   WPIKSCKVQKI-FDDSDFRNVMKATIDVPEVGEINFFCTLLDHLDENWRMKQINAIIQSS  775
             +PI++ ++  + F + + R  + A I+    G +    T L  L    R  Q+  ++ + 
Sbjct  135   FPIRAARMLDLSFGNREPRGALDADIEC-GFGVLRVVATHLG-LSATERSAQVARLLAAF  192

Query  774   DT---PHILAGGLN  742
             DT   P IL G +N
Sbjct  193   DTRALPVILLGDIN  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3744971002710